F488292
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 402 | 1017 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0502355|Ga0436365_0502355_1174_2151 |
| Length | 310 |
| Sequence | MIDSSRVPQVFAQAQPAAALPGLPDGAKVGFYEKGNVRIRYAEIGSGFPLLATPGGGLNSCMAVWARAVINIPQEFRGDFRVITMDQRNATGGESTGPVAVDDPWGAFADDQLGVMDHLGIDKFFFFGNCIGGPFAMKLMERAPQRVTAAILSQPVGHNPAKPDYMYDAGKTVWAKELRERRSDVSMETIEQYLHNLYRVQPDFVYSVSRDFAKACERPMLVLPDDVDAHPLVTSIDVASLCPNAEITVFPWKDPPELKARTINRARTFLKRYQAVSEAAGDHRHCCCRQEHAPDQCRGAEACWRAYLAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 253 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.13 |
| Metatranscriptomes | 1.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 6.29 |
| Rhizosphere | 87.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000660 | 3300003215 | Bacteria | 21135 |
| 2 | JGI25153J46596_10000980 | 3300003215 | Bacteria | 17315 |
| 3 | JGI25404J52841_10004319 | 3300003659 | Bacteria | 2872 |
| 4 | JGI25405J52794_10000579 | 3300003911 | Bacteria | 5391 |
| 5 | JGI25405J52794_10000642 | 3300003911 | Bacteria | 5239 |
| 6 | Ga0058860_10061687 | 3300004801 | Bacteria | 901 |
| 7 | Ga0058860_12023695 | 3300004801 | Bacteria | 847 |
| 8 | Ga0058860_12080127 | 3300004801 | Bacteria | 1774 |
| 9 | Ga0065712_10116098 | 3300005290 | Bacteria | 1741 |
| 10 | Ga0065707_10052887 | 3300005295 | Bacteria | 941 |
| 11 | Ga0070683_100076228 | 3300005329 | Bacteria | 3134 |
| 12 | Ga0070683_100188352 | 3300005329 | Bacteria | 1959 |
| 13 | Ga0070683_100304232 | 3300005329 | Unclassified | 1517 |
| 14 | Ga0068869_100149941 | 3300005334 | Bacteria | 1808 |
| 15 | Ga0070680_100012393 | 3300005336 | Bacteria | 6622 |
| 16 | Ga0070680_100281796 | 3300005336 | Bacteria | 1408 |
| 17 | Ga0070682_100130458 | 3300005337 | Bacteria | 1700 |
| 18 | Ga0070689_100001712 | 3300005340 | Bacteria | 14020 |
| 19 | Ga0070691_10095973 | 3300005341 | Bacteria | 1468 |
| 20 | Ga0070687_100012756 | 3300005343 | Bacteria | 3721 |
| 21 | Ga0070661_100049691 | 3300005344 | Bacteria | 3070 |
| 22 | Ga0070668_100264719 | 3300005347 | Bacteria | 1431 |
| 23 | Ga0070668_100592314 | 3300005347 | Bacteria | 969 |
| 24 | Ga0070669_100024245 | 3300005353 | Bacteria | 4349 |
| 25 | Ga0070669_100052634 | 3300005353 | Bacteria | 2979 |
| 26 | Ga0070675_100354128 | 3300005354 | Bacteria | 1302 |
| 27 | Ga0070671_100198355 | 3300005355 | Bacteria | 1702 |
| 28 | Ga0070671_100227976 | 3300005355 | Bacteria | 1581 |
| 29 | Ga0070671_100421928 | 3300005355 | Bacteria | 1143 |
| 30 | Ga0070674_100069463 | 3300005356 | Bacteria | 2485 |
| 31 | Ga0070674_100092455 | 3300005356 | Bacteria | 2187 |
| 32 | Ga0070674_100184044 | 3300005356 | Bacteria | 1602 |
| 33 | Ga0070688_100022506 | 3300005365 | Bacteria | 3695 |
| 34 | Ga0070659_100205046 | 3300005366 | Unclassified | 1624 |
| 35 | Ga0070703_10062311 | 3300005406 | Bacteria | 1224 |
| 36 | Ga0070709_10027715 | 3300005434 | Bacteria | 3371 |
| 37 | Ga0070709_10028128 | 3300005434 | Bacteria | 3350 |
| 38 | Ga0070709_10273446 | 3300005434 | Bacteria | 1225 |
| 39 | Ga0070709_10354792 | 3300005434 | Bacteria | 1084 |
| 40 | Ga0070709_10406250 | 3300005434 | Bacteria | 1018 |
| 41 | Ga0070714_100269103 | 3300005435 | Bacteria | 1580 |
| 42 | Ga0070714_100369054 | 3300005435 | Bacteria | 1351 |
| 43 | Ga0070713_100001818 | 3300005436 | Bacteria | 13769 |
| 44 | Ga0070713_100245791 | 3300005436 | Bacteria | 1630 |
| 45 | Ga0070713_100447612 | 3300005436 | Bacteria | 1212 |
| 46 | Ga0070710_10005916 | 3300005437 | Bacteria | 5844 |
| 47 | Ga0070710_10071614 | 3300005437 | Unclassified | 1999 |
| 48 | Ga0070710_10151469 | 3300005437 | Bacteria | 1431 |
| 49 | Ga0070710_10224710 | 3300005437 | Bacteria | 1196 |
| 50 | Ga0070701_10123940 | 3300005438 | Bacteria | 1460 |
| 51 | Ga0070711_100012791 | 3300005439 | Bacteria | 5255 |
| 52 | Ga0070711_100197101 | 3300005439 | Bacteria | 1551 |
| 53 | Ga0070711_100285425 | 3300005439 | Bacteria | 1307 |
| 54 | Ga0070711_100374934 | 3300005439 | Bacteria | 1149 |
| 55 | Ga0070705_100228448 | 3300005440 | Bacteria | 1293 |
| 56 | Ga0070705_100238846 | 3300005440 | Bacteria | 1269 |
| 57 | Ga0070694_100375942 | 3300005444 | Bacteria | 1107 |
| 58 | Ga0070694_100423221 | 3300005444 | Bacteria | 1047 |
| 59 | Ga0070708_100023270 | 3300005445 | Bacteria | 5266 |
| 60 | Ga0070708_100037899 | 3300005445 | Bacteria | 4208 |
| 61 | Ga0070708_100041980 | 3300005445 | Bacteria | 4012 |
| 62 | Ga0070708_100079289 | 3300005445 | Bacteria | 2970 |
| 63 | Ga0070708_100162362 | 3300005445 | Bacteria | 2082 |
| 64 | Ga0070663_100003746 | 3300005455 | Bacteria | 8820 |
| 65 | Ga0070663_100131359 | 3300005455 | Bacteria | 1902 |
| 66 | Ga0070663_100171937 | 3300005455 | Bacteria | 1675 |
| 67 | Ga0070678_100026011 | 3300005456 | Bacteria | 3950 |
| 68 | Ga0070678_100065791 | 3300005456 | Bacteria | 2693 |
| 69 | Ga0070681_10014225 | 3300005458 | Bacteria | 7919 |
| 70 | Ga0070681_10015634 | 3300005458 | Bacteria | 7558 |
| 71 | Ga0070681_10067759 | 3300005458 | Bacteria | 3537 |
| 72 | Ga0070681_10085961 | 3300005458 | Bacteria | 3098 |
| 73 | Ga0070685_10156714 | 3300005466 | Bacteria | 1448 |
| 74 | Ga0070706_100041310 | 3300005467 | Bacteria | 4258 |
| 75 | Ga0070706_100082271 | 3300005467 | Bacteria | 2982 |
| 76 | Ga0070706_100150633 | 3300005467 | Bacteria | 2171 |
| 77 | Ga0070706_100291570 | 3300005467 | Bacteria | 1522 |
| 78 | Ga0070706_100456100 | 3300005467 | Bacteria | 1189 |
| 79 | Ga0070706_100562057 | 3300005467 | Bacteria | 1061 |
| 80 | Ga0070707_100016720 | 3300005468 | Bacteria | 6886 |
| 81 | Ga0070707_100091058 | 3300005468 | Bacteria | 2952 |
| 82 | Ga0070707_100092187 | 3300005468 | Bacteria | 2933 |
| 83 | Ga0070707_100146059 | 3300005468 | Bacteria | 2302 |
| 84 | Ga0070698_100042952 | 3300005471 | Bacteria | 4636 |
| 85 | Ga0070698_100160045 | 3300005471 | Bacteria | 2196 |
| 86 | Ga0070698_100176052 | 3300005471 | Bacteria | 2079 |
| 87 | Ga0070698_100209625 | 3300005471 | Bacteria | 1884 |
| 88 | Ga0070699_100152525 | 3300005518 | Bacteria | 2044 |
| 89 | Ga0070699_100245674 | 3300005518 | Bacteria | 1598 |
| 90 | Ga0070679_100101735 | 3300005530 | Bacteria | 2860 |
| 91 | Ga0070679_100446100 | 3300005530 | Bacteria | 1239 |
| 92 | Ga0070684_100079407 | 3300005535 | Bacteria | 2901 |
| 93 | Ga0070684_100151539 | 3300005535 | Bacteria | 2101 |
| 94 | Ga0070684_100174935 | 3300005535 | Bacteria | 1951 |
| 95 | Ga0068853_100009933 | 3300005539 | Bacteria | 7684 |
| 96 | Ga0068853_100814216 | 3300005539 | Bacteria | 895 |
| 97 | Ga0070686_100259615 | 3300005544 | Bacteria | 1273 |
| 98 | Ga0070695_100032790 | 3300005545 | Bacteria | 3247 |
| 99 | Ga0070695_100364046 | 3300005545 | Bacteria | 1087 |
| 100 | Ga0070693_100046413 | 3300005547 | Bacteria | 2467 |
| 101 | Ga0070693_100213790 | 3300005547 | Bacteria | 1260 |
| 102 | Ga0070665_100023942 | 3300005548 | Bacteria | 6149 |
| 103 | Ga0070665_100049009 | 3300005548 | Bacteria | 4239 |
| 104 | Ga0070665_100074587 | 3300005548 | Bacteria | 3398 |
| 105 | Ga0070704_100411765 | 3300005549 | Bacteria | 1156 |
| 106 | Ga0068855_100124391 | 3300005563 | Bacteria | 2950 |
| 107 | Ga0068855_100148869 | 3300005563 | Bacteria | 2662 |
| 108 | Ga0068855_100345913 | 3300005563 | Bacteria | 1639 |
| 109 | Ga0068855_100735858 | 3300005563 | Bacteria | 1053 |
| 110 | Ga0070664_100271514 | 3300005564 | Unclassified | 1527 |
| 111 | Ga0070664_100766953 | 3300005564 | Bacteria | 901 |
| 112 | Ga0068857_100021961 | 3300005577 | Bacteria | 5617 |
| 113 | Ga0068857_100165748 | 3300005577 | Bacteria | 2007 |
| 114 | Ga0068854_100167695 | 3300005578 | Bacteria | 1706 |
| 115 | Ga0068856_100019721 | 3300005614 | Bacteria | 6544 |
| 116 | Ga0068856_100066265 | 3300005614 | Unclassified | 3569 |
| 117 | Ga0068856_100222275 | 3300005614 | Bacteria | 1904 |
| 118 | Ga0068856_100488644 | 3300005614 | Bacteria | 1252 |
| 119 | Ga0068852_100240551 | 3300005616 | Bacteria | 1729 |
| 120 | Ga0068852_100406863 | 3300005616 | Bacteria | 1340 |
| 121 | Ga0068852_100426777 | 3300005616 | Bacteria | 1308 |
| 122 | Ga0068859_100046003 | 3300005617 | Bacteria | 4384 |
| 123 | Ga0068859_100279634 | 3300005617 | Bacteria | 1761 |
| 124 | Ga0068859_100548623 | 3300005617 | Bacteria | 1250 |
| 125 | Ga0068864_100038231 | 3300005618 | Bacteria | 4097 |
| 126 | Ga0068864_100196892 | 3300005618 | Bacteria | 1849 |
| 127 | Ga0068866_10108439 | 3300005718 | Bacteria | 1544 |
| 128 | Ga0068861_100345905 | 3300005719 | Bacteria | 1303 |
| 129 | Ga0068863_100077315 | 3300005841 | Bacteria | 3150 |
| 130 | Ga0068858_100250949 | 3300005842 | Bacteria | 1681 |
| 131 | Ga0068860_100019692 | 3300005843 | Bacteria | 6542 |
| 132 | Ga0068862_100182770 | 3300005844 | Bacteria | 1883 |
| 133 | Ga0081455_10000418 | 3300005937 | Bacteria | 55929 |
| 134 | Ga0081455_10001315 | 3300005937 | Bacteria | 30785 |
| 135 | Ga0081455_10002053 | 3300005937 | Bacteria | 24074 |
| 136 | Ga0081455_10006568 | 3300005937 | Bacteria | 12443 |
| 137 | Ga0081455_10041502 | 3300005937 | Bacteria | 4045 |
| 138 | Ga0081455_10096981 | 3300005937 | Bacteria | 2376 |
| 139 | Ga0081455_10200913 | 3300005937 | Unclassified | 1493 |
| 140 | Ga0081538_10146066 | 3300005981 | Bacteria | 1081 |
| 141 | Ga0081540_1003181 | 3300005983 | Bacteria | 13089 |
| 142 | Ga0081540_1005915 | 3300005983 | Bacteria | 9026 |
| 143 | Ga0081540_1009489 | 3300005983 | Bacteria | 6702 |
| 144 | Ga0081540_1023383 | 3300005983 | Bacteria | 3616 |
| 145 | Ga0081540_1051182 | 3300005983 | Bacteria | 2044 |
| 146 | Ga0081540_1072176 | 3300005983 | Bacteria | 1591 |
| 147 | Ga0081539_10049231 | 3300005985 | Bacteria | 2393 |
| 148 | Ga0081539_10174064 | 3300005985 | Bacteria | 1015 |
| 149 | Ga0070717_10000508 | 3300006028 | Bacteria | 24700 |
| 150 | Ga0070717_10159065 | 3300006028 | Bacteria | 1959 |
| 151 | Ga0070717_10285474 | 3300006028 | Bacteria | 1465 |
| 152 | Ga0070717_10403909 | 3300006028 | Bacteria | 1227 |
| 153 | Ga0070717_10616178 | 3300006028 | Bacteria | 985 |
| 154 | Ga0075365_10007763 | 3300006038 | Bacteria | 6041 |
| 155 | Ga0075365_10029750 | 3300006038 | Bacteria | 3494 |
| 156 | Ga0075365_10232165 | 3300006038 | Bacteria | 1295 |
| 157 | Ga0075368_10018756 | 3300006042 | Bacteria | 2604 |
| 158 | Ga0075363_100002080 | 3300006048 | Bacteria | 8010 |
| 159 | Ga0075364_10039545 | 3300006051 | Bacteria | 3058 |
| 160 | Ga0070715_10072632 | 3300006163 | Unclassified | 1541 |
| 161 | Ga0070716_100013860 | 3300006173 | Bacteria | 4118 |
| 162 | Ga0070716_100066344 | 3300006173 | Bacteria | 2105 |
| 163 | Ga0070716_100343610 | 3300006173 | Bacteria | 1054 |
| 164 | Ga0070716_100543921 | 3300006173 | Unclassified | 864 |
| 165 | Ga0070712_100004011 | 3300006175 | Bacteria | 9046 |
| 166 | Ga0070712_100017121 | 3300006175 | Bacteria | 4687 |
| 167 | Ga0070712_100131478 | 3300006175 | Bacteria | 1897 |
| 168 | Ga0070712_100266166 | 3300006175 | Unclassified | 1375 |
| 169 | Ga0070712_100380414 | 3300006175 | Bacteria | 1162 |
| 170 | Ga0070712_100441496 | 3300006175 | Bacteria | 1082 |
| 171 | Ga0075362_10051383 | 3300006177 | Bacteria | 1845 |
| 172 | Ga0075367_10045916 | 3300006178 | Bacteria | 2565 |
| 173 | Ga0075427_10005724 | 3300006194 | Bacteria | 1779 |
| 174 | Ga0075366_10080388 | 3300006195 | Bacteria | 1947 |
| 175 | Ga0075370_10065259 | 3300006353 | Bacteria | 2076 |
| 176 | Ga0068871_100239522 | 3300006358 | Bacteria | 1577 |
| 177 | Ga0075428_100010863 | 3300006844 | Bacteria | 10122 |
| 178 | Ga0075428_100032851 | 3300006844 | Bacteria | 5730 |
| 179 | Ga0075428_100066107 | 3300006844 | Unclassified | 3960 |
| 180 | Ga0075428_100075095 | 3300006844 | Bacteria | 3692 |
| 181 | Ga0075428_100150368 | 3300006844 | Bacteria | 2529 |
| 182 | Ga0075428_100184999 | 3300006844 | Bacteria | 2254 |
| 183 | Ga0075428_100207317 | 3300006844 | Bacteria | 2118 |
| 184 | Ga0075428_100251285 | 3300006844 | Bacteria | 1906 |
| 185 | Ga0075428_100267326 | 3300006844 | Bacteria | 1840 |
| 186 | Ga0075428_100333364 | 3300006844 | Bacteria | 1630 |
| 187 | Ga0075428_100625157 | 3300006844 | Bacteria | 1149 |
| 188 | Ga0075428_100644001 | 3300006844 | Bacteria | 1130 |
| 189 | Ga0075430_100002737 | 3300006846 | Bacteria | 14720 |
| 190 | Ga0075430_100004372 | 3300006846 | Bacteria | 11930 |
| 191 | Ga0075430_100029545 | 3300006846 | Bacteria | 4652 |
| 192 | Ga0075430_100035787 | 3300006846 | Bacteria | 4211 |
| 193 | Ga0075430_100357510 | 3300006846 | Bacteria | 1206 |
| 194 | Ga0075431_100010541 | 3300006847 | Bacteria | 9291 |
| 195 | Ga0075431_100038421 | 3300006847 | Bacteria | 4929 |
| 196 | Ga0075431_100059560 | 3300006847 | Bacteria | 3940 |
| 197 | Ga0075431_100086499 | 3300006847 | Bacteria | 3234 |
| 198 | Ga0075431_100093943 | 3300006847 | Bacteria | 3095 |
| 199 | Ga0075431_100103518 | 3300006847 | Bacteria | 2938 |
| 200 | Ga0075431_100180513 | 3300006847 | Bacteria | 2166 |
| 201 | Ga0075431_100183018 | 3300006847 | Bacteria | 2150 |
| 202 | Ga0075431_100506636 | 3300006847 | Bacteria | 1198 |
| 203 | Ga0075433_10021818 | 3300006852 | Bacteria | 5372 |
| 204 | Ga0075433_10095949 | 3300006852 | Bacteria | 2624 |
| 205 | Ga0075433_10233632 | 3300006852 | Bacteria | 1632 |
| 206 | Ga0075433_10239031 | 3300006852 | Bacteria | 1612 |
| 207 | Ga0075433_10243633 | 3300006852 | Unclassified | 1596 |
| 208 | Ga0075433_10394652 | 3300006852 | Bacteria | 1221 |
| 209 | Ga0075433_10621321 | 3300006852 | Bacteria | 948 |
| 210 | Ga0075434_100003432 | 3300006871 | Bacteria | 14172 |
| 211 | Ga0075434_100031726 | 3300006871 | Bacteria | 5209 |
| 212 | Ga0075434_100079291 | 3300006871 | Bacteria | 3280 |
| 213 | Ga0075434_100142922 | 3300006871 | Bacteria | 2413 |
| 214 | Ga0075434_100179083 | 3300006871 | Bacteria | 2139 |
| 215 | Ga0075434_100287264 | 3300006871 | Bacteria | 1665 |
| 216 | Ga0075434_100305621 | 3300006871 | Bacteria | 1611 |
| 217 | Ga0075434_100376443 | 3300006871 | Bacteria | 1441 |
| 218 | Ga0075429_100017090 | 3300006880 | Bacteria | 6273 |
| 219 | Ga0075429_100017929 | 3300006880 | Bacteria | 6121 |
| 220 | Ga0075429_100022663 | 3300006880 | Bacteria | 5444 |
| 221 | Ga0075429_100059942 | 3300006880 | Unclassified | 3316 |
| 222 | Ga0075429_100075368 | 3300006880 | Bacteria | 2939 |
| 223 | Ga0075429_100274146 | 3300006880 | Bacteria | 1477 |
| 224 | Ga0075429_100292310 | 3300006880 | Unclassified | 1427 |
| 225 | Ga0075429_100407619 | 3300006880 | Bacteria | 1191 |
| 226 | Ga0068865_100109719 | 3300006881 | Bacteria | 2034 |
| 227 | Ga0068865_100299010 | 3300006881 | Bacteria | 1287 |
| 228 | Ga0075436_100245266 | 3300006914 | Bacteria | 1275 |
| 229 | Ga0075436_100273145 | 3300006914 | Bacteria | 1207 |
| 230 | Ga0097620_100046004 | 3300006931 | Bacteria | 4384 |
| 231 | Ga0097620_100279624 | 3300006931 | Bacteria | 1761 |
| 232 | Ga0097620_100548622 | 3300006931 | Bacteria | 1250 |
| 233 | Ga0075435_100475383 | 3300007076 | Bacteria | 1079 |
| 234 | Ga0099794_10004782 | 3300007265 | Bacteria | 5372 |
| 235 | Ga0099795_10016588 | 3300007788 | Bacteria | 2332 |
| 236 | Ga0099795_10132238 | 3300007788 | Bacteria | 1008 |
| 237 | Ga0105240_10077293 | 3300009093 | Bacteria | 4101 |
| 238 | Ga0105240_10437551 | 3300009093 | Bacteria | 1466 |
| 239 | Ga0111539_10032319 | 3300009094 | Bacteria | 6355 |
| 240 | Ga0111539_10073530 | 3300009094 | Bacteria | 4030 |
| 241 | Ga0111539_10252629 | 3300009094 | Bacteria | 2053 |
| 242 | Ga0111539_10330986 | 3300009094 | Bacteria | 1773 |
| 243 | Ga0111539_10344374 | 3300009094 | Bacteria | 1735 |
| 244 | Ga0111539_10427569 | 3300009094 | Bacteria | 1542 |
| 245 | Ga0111539_10677395 | 3300009094 | Bacteria | 1201 |
| 246 | Ga0111539_10736348 | 3300009094 | Bacteria | 1148 |
| 247 | Ga0105245_10279932 | 3300009098 | Bacteria | 1630 |
| 248 | Ga0105247_10253644 | 3300009101 | Bacteria | 1203 |
| 249 | Ga0114129_10006147 | 3300009147 | Bacteria | 17031 |
| 250 | Ga0114129_10071358 | 3300009147 | Bacteria | 4842 |
| 251 | Ga0114129_10075599 | 3300009147 | Bacteria | 4690 |
| 252 | Ga0114129_10111234 | 3300009147 | Unclassified | 3780 |
| 253 | Ga0114129_10115567 | 3300009147 | Bacteria | 3698 |
| 254 | Ga0114129_10209081 | 3300009147 | Bacteria | 2639 |
| 255 | Ga0114129_10405755 | 3300009147 | Bacteria | 1795 |
| 256 | Ga0114129_10450159 | 3300009147 | Bacteria | 1689 |
| 257 | Ga0114129_10597890 | 3300009147 | Bacteria | 1430 |
| 258 | Ga0114129_11528689 | 3300009147 | Bacteria | 819 |
| 259 | Ga0105243_10365124 | 3300009148 | Bacteria | 1330 |
| 260 | Ga0105242_10062722 | 3300009176 | Bacteria | 3059 |
| 261 | Ga0105242_10239275 | 3300009176 | Bacteria | 1631 |
| 262 | Ga0105248_10042634 | 3300009177 | Bacteria | 5089 |
| 263 | Ga0105248_10045067 | 3300009177 | Bacteria | 4945 |
| 264 | Ga0105248_10377773 | 3300009177 | Bacteria | 1595 |
| 265 | Ga0105248_10526754 | 3300009177 | Bacteria | 1333 |
| 266 | Ga0105237_10129363 | 3300009545 | Bacteria | 2519 |
| 267 | Ga0105237_10274718 | 3300009545 | Bacteria | 1688 |
| 268 | Ga0105237_10633181 | 3300009545 | Bacteria | 1076 |
| 269 | Ga0105238_10070875 | 3300009551 | Bacteria | 3484 |
| 270 | Ga0105238_10190186 | 3300009551 | Bacteria | 2029 |
| 271 | Ga0105238_10195703 | 3300009551 | Bacteria | 1997 |
| 272 | Ga0105238_10362786 | 3300009551 | Bacteria | 1438 |
| 273 | Ga0105249_10182709 | 3300009553 | Bacteria | 2041 |
| 274 | Ga0105249_10294679 | 3300009553 | Bacteria | 1625 |
| 275 | Ga0105249_10876774 | 3300009553 | Bacteria | 964 |
| 276 | Ga0099796_10001978 | 3300010159 | Bacteria | 4357 |
| 277 | Ga0099796_10032242 | 3300010159 | Bacteria | 1715 |
| 278 | Ga0099796_10052250 | 3300010159 | Bacteria | 1422 |
| 279 | Ga0105239_10256496 | 3300010375 | Bacteria | 1965 |
| 280 | Ga0105246_10022952 | 3300011119 | Bacteria | 4033 |
| 281 | Ga0105246_10091653 | 3300011119 | Bacteria | 2192 |
| 282 | Ga0157373_10157606 | 3300013100 | Bacteria | 1597 |
| 283 | Ga0157370_10149127 | 3300013104 | Bacteria | 2177 |
| 284 | Ga0157370_10560401 | 3300013104 | Bacteria | 1047 |
| 285 | Ga0157369_10859717 | 3300013105 | Bacteria | 931 |
| 286 | Ga0157374_10023559 | 3300013296 | Bacteria | 5509 |
| 287 | Ga0157374_10171265 | 3300013296 | Bacteria | 2118 |
| 288 | Ga0157378_10001940 | 3300013297 | Bacteria | 18554 |
| 289 | Ga0157378_10092125 | 3300013297 | Bacteria | 2757 |
| 290 | Ga0157378_10177848 | 3300013297 | Bacteria | 2000 |
| 291 | Ga0163162_10053689 | 3300013306 | Bacteria | 4051 |
| 292 | Ga0163162_10213580 | 3300013306 | Bacteria | 2059 |
| 293 | Ga0163162_10250062 | 3300013306 | Bacteria | 1905 |
| 294 | Ga0163162_10330755 | 3300013306 | Bacteria | 1656 |
| 295 | Ga0157372_10110431 | 3300013307 | Bacteria | 3150 |
| 296 | Ga0157375_10051102 | 3300013308 | Bacteria | 4058 |
| 297 | Ga0157375_10307361 | 3300013308 | Bacteria | 1750 |
| 298 | Ga0163163_10005361 | 3300014325 | Bacteria | 11079 |
| 299 | Ga0163163_10042646 | 3300014325 | Bacteria | 4445 |
| 300 | Ga0163163_10053277 | 3300014325 | Bacteria | 3993 |
| 301 | Ga0163163_10063883 | 3300014325 | Bacteria | 3652 |
| 302 | Ga0163163_10407568 | 3300014325 | Bacteria | 1418 |
| 303 | Ga0163163_10474655 | 3300014325 | Bacteria | 1312 |
| 304 | Ga0182008_10076783 | 3300014497 | Bacteria | 1643 |
| 305 | Ga0182008_10154516 | 3300014497 | Bacteria | 1152 |
| 306 | Ga0157379_10006693 | 3300014968 | Bacteria | 9953 |
| 307 | Ga0157379_10011648 | 3300014968 | Bacteria | 7678 |
| 308 | Ga0157379_10209695 | 3300014968 | Bacteria | 1763 |
| 309 | Ga0157379_10220305 | 3300014968 | Bacteria | 1719 |
| 310 | Ga0157379_10252556 | 3300014968 | Bacteria | 1601 |
| 311 | Ga0157376_10061010 | 3300014969 | Bacteria | 3169 |
| 312 | Ga0157376_10342880 | 3300014969 | Bacteria | 1427 |
| 313 | Ga0163161_10543954 | 3300017792 | Bacteria | 951 |
| 314 | Ga0206352_10676952 | 3300020078 | Bacteria | 2326 |
| 315 | Ga0206350_10268593 | 3300020080 | Bacteria | 1718 |
| 316 | Ga0206353_10378285 | 3300020082 | Bacteria | 2845 |
| 317 | Ga0213876_10034704 | 3300021384 | Bacteria | 2661 |
| 318 | Ga0213875_10000009 | 3300021388 | Bacteria | 451129 |
| 319 | Ga0213875_10000498 | 3300021388 | Bacteria | 32954 |
| 320 | Ga0213875_10002698 | 3300021388 | Bacteria | 10477 |
| 321 | Ga0213875_10033177 | 3300021388 | Bacteria | 2438 |
| 322 | Ga0224712_10004135 | 3300022467 | Bacteria | 3880 |
| 323 | Ga0207673_1018854 | 3300025290 | Bacteria | 925 |
| 324 | Ga0209758_1000523 | 3300025297 | Bacteria | 61460 |
| 325 | Ga0209758_1000772 | 3300025297 | Bacteria | 45993 |
| 326 | Ga0207426_1060373 | 3300025302 | Bacteria | 1093 |
| 327 | Ga0207656_10043114 | 3300025321 | Bacteria | 1923 |
| 328 | Ga0207653_10039405 | 3300025885 | Bacteria | 1547 |
| 329 | Ga0207682_10099526 | 3300025893 | Bacteria | 1270 |
| 330 | Ga0207692_10133398 | 3300025898 | Bacteria | 1405 |
| 331 | Ga0207692_10147891 | 3300025898 | Bacteria | 1343 |
| 332 | Ga0207692_10178917 | 3300025898 | Bacteria | 1234 |
| 333 | Ga0207692_10183182 | 3300025898 | Bacteria | 1221 |
| 334 | Ga0207692_10223781 | 3300025898 | Bacteria | 1117 |
| 335 | Ga0207710_10167639 | 3300025900 | Bacteria | 1073 |
| 336 | Ga0207688_10159357 | 3300025901 | Bacteria | 1337 |
| 337 | Ga0207685_10008557 | 3300025905 | Bacteria | 2922 |
| 338 | Ga0207685_10065834 | 3300025905 | Bacteria | 1452 |
| 339 | Ga0207699_10032557 | 3300025906 | Unclassified | 2938 |
| 340 | Ga0207699_10047550 | 3300025906 | Bacteria | 2516 |
| 341 | Ga0207699_10205470 | 3300025906 | Bacteria | 1337 |
| 342 | Ga0207699_10345308 | 3300025906 | Bacteria | 1049 |
| 343 | Ga0207643_10236080 | 3300025908 | Bacteria | 1123 |
| 344 | Ga0207684_10038926 | 3300025910 | Bacteria | 4035 |
| 345 | Ga0207684_10040262 | 3300025910 | Bacteria | 3962 |
| 346 | Ga0207684_10040850 | 3300025910 | Bacteria | 3932 |
| 347 | Ga0207684_10076272 | 3300025910 | Bacteria | 2849 |
| 348 | Ga0207684_10142507 | 3300025910 | Bacteria | 2061 |
| 349 | Ga0207654_10237492 | 3300025911 | Bacteria | 1216 |
| 350 | Ga0207707_10000826 | 3300025912 | Bacteria | 30384 |
| 351 | Ga0207707_10055373 | 3300025912 | Bacteria | 3450 |
| 352 | Ga0207707_10191248 | 3300025912 | Bacteria | 1785 |
| 353 | Ga0207695_10108109 | 3300025913 | Bacteria | 2766 |
| 354 | Ga0207671_10239926 | 3300025914 | Bacteria | 1424 |
| 355 | Ga0207693_10015489 | 3300025915 | Bacteria | 6117 |
| 356 | Ga0207693_10017116 | 3300025915 | Bacteria | 5784 |
| 357 | Ga0207693_10017417 | 3300025915 | Bacteria | 5731 |
| 358 | Ga0207693_10030988 | 3300025915 | Bacteria | 4225 |
| 359 | Ga0207693_10035034 | 3300025915 | Bacteria | 3959 |
| 360 | Ga0207693_10097559 | 3300025915 | Bacteria | 2304 |
| 361 | Ga0207693_10185034 | 3300025915 | Bacteria | 1640 |
| 362 | Ga0207693_10273489 | 3300025915 | Bacteria | 1324 |
| 363 | Ga0207663_10106228 | 3300025916 | Bacteria | 1897 |
| 364 | Ga0207663_10127861 | 3300025916 | Bacteria | 1751 |
| 365 | Ga0207663_10264211 | 3300025916 | Bacteria | 1272 |
| 366 | Ga0207663_10390693 | 3300025916 | Bacteria | 1062 |
| 367 | Ga0207663_10398163 | 3300025916 | Bacteria | 1052 |
| 368 | Ga0207660_10006793 | 3300025917 | Bacteria | 7411 |
| 369 | Ga0207660_10399309 | 3300025917 | Bacteria | 1107 |
| 370 | Ga0207649_10034408 | 3300025920 | Bacteria | 3036 |
| 371 | Ga0207652_10103988 | 3300025921 | Bacteria | 2511 |
| 372 | Ga0207652_10139669 | 3300025921 | Bacteria | 2166 |
| 373 | Ga0207652_10230292 | 3300025921 | Bacteria | 1670 |
| 374 | Ga0207646_10028109 | 3300025922 | Bacteria | 5123 |
| 375 | Ga0207646_10079635 | 3300025922 | Bacteria | 2929 |
| 376 | Ga0207646_10126681 | 3300025922 | Bacteria | 2296 |
| 377 | Ga0207646_10215507 | 3300025922 | Bacteria | 1734 |
| 378 | Ga0207646_10461763 | 3300025922 | Bacteria | 1145 |
| 379 | Ga0207694_10159623 | 3300025924 | Bacteria | 1820 |
| 380 | Ga0207650_10223482 | 3300025925 | Bacteria | 1516 |
| 381 | Ga0207659_10129719 | 3300025926 | Bacteria | 1944 |
| 382 | Ga0207700_10057126 | 3300025928 | Bacteria | 2941 |
| 383 | Ga0207700_10134359 | 3300025928 | Bacteria | 2024 |
| 384 | Ga0207700_10306219 | 3300025928 | Bacteria | 1373 |
| 385 | Ga0207700_10761585 | 3300025928 | Bacteria | 865 |
| 386 | Ga0207664_10040534 | 3300025929 | Bacteria | 3623 |
| 387 | Ga0207664_10120292 | 3300025929 | Bacteria | 2196 |
| 388 | Ga0207664_10127460 | 3300025929 | Bacteria | 2138 |
| 389 | Ga0207664_10241747 | 3300025929 | Bacteria | 1572 |
| 390 | Ga0207664_10531251 | 3300025929 | Bacteria | 1055 |
| 391 | Ga0207644_10116157 | 3300025931 | Bacteria | 2030 |
| 392 | Ga0207644_10247275 | 3300025931 | Bacteria | 1422 |
| 393 | Ga0207644_10407824 | 3300025931 | Bacteria | 1112 |
| 394 | Ga0207690_10162705 | 3300025932 | Unclassified | 1665 |
| 395 | Ga0207686_10218201 | 3300025934 | Bacteria | 1375 |
| 396 | Ga0207686_10268353 | 3300025934 | Bacteria | 1254 |
| 397 | Ga0207670_10001158 | 3300025936 | Bacteria | 13899 |
| 398 | Ga0207670_10239140 | 3300025936 | Bacteria | 1398 |
| 399 | Ga0207669_10295440 | 3300025937 | Bacteria | 1229 |
| 400 | Ga0207704_10030866 | 3300025938 | Bacteria | 3011 |
| 401 | Ga0207704_10068732 | 3300025938 | Bacteria | 2234 |
| 402 | Ga0207665_10041256 | 3300025939 | Bacteria | 3081 |
| 403 | Ga0207691_10148033 | 3300025940 | Bacteria | 2066 |
| 404 | Ga0207691_10153588 | 3300025940 | Bacteria | 2023 |
| 405 | Ga0207711_10020274 | 3300025941 | Bacteria | 5540 |
| 406 | Ga0207711_10452869 | 3300025941 | Bacteria | 1195 |
| 407 | Ga0207689_10065447 | 3300025942 | Bacteria | 2989 |
| 408 | Ga0207689_10278216 | 3300025942 | Bacteria | 1386 |
| 409 | Ga0207661_10054190 | 3300025944 | Bacteria | 3212 |
| 410 | Ga0207661_10100788 | 3300025944 | Bacteria | 2425 |
| 411 | Ga0207661_10171817 | 3300025944 | Bacteria | 1887 |
| 412 | Ga0207661_10519340 | 3300025944 | Unclassified | 1089 |
| 413 | Ga0207679_10377168 | 3300025945 | Bacteria | 1242 |
| 414 | Ga0207667_10183269 | 3300025949 | Bacteria | 2150 |
| 415 | Ga0207667_10389928 | 3300025949 | Bacteria | 1418 |
| 416 | Ga0207712_10074195 | 3300025961 | Bacteria | 2456 |
| 417 | Ga0207712_10223864 | 3300025961 | Bacteria | 1506 |
| 418 | Ga0207668_10159755 | 3300025972 | Bacteria | 1755 |
| 419 | Ga0207668_10570888 | 3300025972 | Bacteria | 982 |
| 420 | Ga0207658_10191795 | 3300025986 | Bacteria | 1699 |
| 421 | Ga0207677_10082806 | 3300026023 | Bacteria | 2307 |
| 422 | Ga0207703_10059696 | 3300026035 | Bacteria | 3116 |
| 423 | Ga0207703_10066404 | 3300026035 | Bacteria | 2967 |
| 424 | Ga0207639_10013284 | 3300026041 | Bacteria | 5759 |
| 425 | Ga0207678_10022356 | 3300026067 | Bacteria | 5540 |
| 426 | Ga0207678_10023373 | 3300026067 | Bacteria | 5405 |
| 427 | Ga0207678_10061720 | 3300026067 | Bacteria | 3224 |
| 428 | Ga0207678_10141966 | 3300026067 | Bacteria | 2050 |
| 429 | Ga0207708_10059185 | 3300026075 | Bacteria | 2924 |
| 430 | Ga0207708_10080554 | 3300026075 | Bacteria | 2502 |
| 431 | Ga0207708_10106677 | 3300026075 | Bacteria | 2172 |
| 432 | Ga0207708_10179578 | 3300026075 | Bacteria | 1680 |
| 433 | Ga0207702_10296923 | 3300026078 | Bacteria | 1532 |
| 434 | Ga0207702_10323983 | 3300026078 | Bacteria | 1468 |
| 435 | Ga0207641_10058449 | 3300026088 | Bacteria | 3282 |
| 436 | Ga0207676_10021432 | 3300026095 | Bacteria | 4740 |
| 437 | Ga0207676_10241401 | 3300026095 | Bacteria | 1621 |
| 438 | Ga0207674_10029348 | 3300026116 | Bacteria | 5790 |
| 439 | Ga0207675_100174232 | 3300026118 | Bacteria | 2057 |
| 440 | Ga0207675_100358227 | 3300026118 | Bacteria | 1431 |
| 441 | Ga0207675_100491048 | 3300026118 | Bacteria | 1221 |
| 442 | Ga0207683_10011965 | 3300026121 | Bacteria | 7406 |
| 443 | Ga0207683_10089105 | 3300026121 | Bacteria | 2746 |
| 444 | Ga0207698_10025424 | 3300026142 | Bacteria | 4172 |
| 445 | Ga0207698_10025926 | 3300026142 | Bacteria | 4140 |
| 446 | Ga0207698_10218050 | 3300026142 | Bacteria | 1722 |
| 447 | Ga0207698_10239002 | 3300026142 | Bacteria | 1654 |
| 448 | Ga0209995_1001114 | 3300027471 | Bacteria | 4126 |
| 449 | Ga0209179_1005644 | 3300027512 | Bacteria | 1972 |
| 450 | Ga0209179_1017893 | 3300027512 | Bacteria | 1348 |
| 451 | Ga0209588_1010243 | 3300027671 | Bacteria | 2815 |
| 452 | Ga0209588_1014115 | 3300027671 | Bacteria | 2443 |
| 453 | Ga0209813_10037515 | 3300027866 | Bacteria | 1461 |
| 454 | Ga0207428_10017007 | 3300027907 | Bacteria | 6248 |
| 455 | Ga0207428_10185093 | 3300027907 | Bacteria | 1572 |
| 456 | Ga0207428_10569867 | 3300027907 | Bacteria | 818 |
| 457 | Ga0268266_10008924 | 3300028379 | Bacteria | 8871 |
| 458 | Ga0268266_10055963 | 3300028379 | Bacteria | 3392 |
| 459 | Ga0268266_10093765 | 3300028379 | Bacteria | 2634 |
| 460 | Ga0268266_10386239 | 3300028379 | Bacteria | 1321 |
| 461 | Ga0268266_10551608 | 3300028379 | Bacteria | 1104 |
| 462 | Ga0268265_10651112 | 3300028380 | Bacteria | 1013 |
| 463 | Ga0268264_10216680 | 3300028381 | Bacteria | 1760 |
| 464 | Ga0265334_10052047 | 3300028573 | Bacteria | 1568 |
| 465 | Ga0265338_10005513 | 3300028800 | Bacteria | 16493 |
| 466 | Ga0265763_1000743 | 3300030763 | Bacteria | 2125 |
| 467 | Ga0265773_1000831 | 3300031018 | Bacteria | 1448 |
| 468 | Ga0265325_10001561 | 3300031241 | Bacteria | 15970 |
| 469 | Ga0265325_10041154 | 3300031241 | Bacteria | 2422 |
| 470 | Ga0265325_10092934 | 3300031241 | Bacteria | 1485 |
| 471 | Ga0265340_10002096 | 3300031247 | Bacteria | 11429 |
| 472 | Ga0265340_10024688 | 3300031247 | Bacteria | 3051 |
| 473 | Ga0265340_10059854 | 3300031247 | Bacteria | 1826 |
| 474 | Ga0265340_10159963 | 3300031247 | Bacteria | 1023 |
| 475 | Ga0265339_10000126 | 3300031249 | Bacteria | 63942 |
| 476 | Ga0265339_10001221 | 3300031249 | Bacteria | 19322 |
| 477 | Ga0265339_10032717 | 3300031249 | Bacteria | 2932 |
| 478 | Ga0265331_10110721 | 3300031250 | Bacteria | 1259 |
| 479 | Ga0307509_10071890 | 3300031507 | Bacteria | 3606 |
| 480 | Ga0265313_10000844 | 3300031595 | Bacteria | 30856 |
| 481 | Ga0265313_10073133 | 3300031595 | Bacteria | 1574 |
| 482 | Ga0265314_10191221 | 3300031711 | Bacteria | 1218 |
| 483 | Ga0265342_10000035 | 3300031712 | Bacteria | 142886 |
| 484 | Ga0265342_10011621 | 3300031712 | Bacteria | 6010 |
| 485 | Ga0307405_10405273 | 3300031731 | Bacteria | 1069 |
| 486 | Ga0307410_10328407 | 3300031852 | Bacteria | 1216 |
| 487 | Ga0307406_10295878 | 3300031901 | Bacteria | 1241 |
| 488 | Ga0307406_10325776 | 3300031901 | Bacteria | 1190 |
| 489 | Ga0307406_10737456 | 3300031901 | Bacteria | 826 |
| 490 | Ga0307412_10201176 | 3300031911 | Bacteria | 1513 |
| 491 | Ga0307409_100306152 | 3300031995 | Bacteria | 1481 |
| 492 | Ga0307416_100211485 | 3300032002 | Bacteria | 1851 |
| 493 | Ga0307416_100786288 | 3300032002 | Bacteria | 1046 |
| 494 | Ga0307414_10284462 | 3300032004 | Bacteria | 1391 |
| 495 | Ga0307510_10030926 | 3300033180 | Bacteria | 6060 |
| 496 | Ga0373930_0009760 | 3300034816 | Bacteria | 1705 |
| 497 | Ga0373958_0014116 | 3300034819 | Bacteria | 1393 |
| 498 | Ga0373959_0002069 | 3300034820 | Bacteria | 3200 |
| 499 | Ga0373959_0010829 | 3300034820 | Bacteria | 1600 |
| 500 | Ga0373938_0002389 | 3300034957 | Bacteria | 3023 |
| 501 | Ga0373938_0003206 | 3300034957 | Bacteria | 2661 |
| 502 | Ga0373938_0017284 | 3300034957 | Bacteria | 1419 |
| 503 | Ga0373926_0023452 | 3300035083 | Bacteria | 2144 |
| 504 | Ga0373934_0045836 | 3300035086 | Bacteria | 1729 |
| 505 | Ga0373940_0024313 | 3300035088 | Bacteria | 1570 |
| 506 | Ga0373940_0044257 | 3300035088 | Bacteria | 1233 |
| 507 | Ga0373944_0091453 | 3300035089 | Bacteria | 1017 |
| 508 | Ga0373951_0036107 | 3300035091 | Bacteria | 1179 |
| 509 | Ga0373952_0003300 | 3300035092 | Bacteria | 2910 |
| 510 | Ga0373952_0016312 | 3300035092 | Bacteria | 1509 |
| 511 | Ga0373923_0008125 | 3300035111 | Bacteria | 3725 |
| 512 | Ga0373923_0060800 | 3300035111 | Bacteria | 1604 |
| 513 | Ga0373923_0221424 | 3300035111 | Unclassified | 879 |
| 514 | Ga0373936_0000543 | 3300035113 | Bacteria | 12919 |
| 515 | Ga0373936_0047359 | 3300035113 | Bacteria | 1734 |
| 516 | Ga0373941_0083401 | 3300035115 | Bacteria | 1083 |
| 517 | Ga0373945_0075529 | 3300035116 | Bacteria | 1283 |
| 518 | Ga0373945_0105445 | 3300035116 | Bacteria | 1107 |
| 519 | Ga0373953_0002974 | 3300035117 | Bacteria | 5184 |
| 520 | Ga0373953_0028233 | 3300035117 | Bacteria | 2162 |
| 521 | Ga0373953_0075244 | 3300035117 | Bacteria | 1398 |
| 522 | Ga0373954_0001388 | 3300035118 | Bacteria | 9806 |
| 523 | Ga0373954_0006655 | 3300035118 | Bacteria | 5043 |
| 524 | Ga0373956_0025815 | 3300035119 | Bacteria | 2541 |
| 525 | Ga0373956_0042926 | 3300035119 | Bacteria | 2012 |
| 526 | Ga0373956_0044968 | 3300035119 | Bacteria | 1969 |
| 527 | Ga0373957_0001852 | 3300035120 | Bacteria | 5861 |
| 528 | Ga0373960_0006938 | 3300035121 | Bacteria | 2670 |
| 529 | Ga0373960_0028381 | 3300035121 | Bacteria | 1544 |
| 530 | Ga0373960_0049121 | 3300035121 | Bacteria | 1247 |
| 531 | Ga0373960_0050417 | 3300035121 | Bacteria | 1234 |
| 532 | Ga0373943_0006448 | 3300035170 | Bacteria | 5270 |
| 533 | Ga0373943_0206150 | 3300035170 | Bacteria | 1090 |
| 534 | Ga0373946_0012654 | 3300035171 | Bacteria | 3162 |
| 535 | Ga0373946_0057326 | 3300035171 | Bacteria | 1648 |
| 536 | Ga0373946_0191560 | 3300035171 | Bacteria | 975 |
| 537 | Ga0373955_0001296 | 3300035172 | Bacteria | 10657 |
| 538 | Ga0373955_0003427 | 3300035172 | Bacteria | 6967 |
| 539 | Ga0373955_0068572 | 3300035172 | Bacteria | 1977 |
| 540 | Ga0373955_0420628 | 3300035172 | Bacteria | 813 |
| 541 | Ga0373961_0014464 | 3300035241 | Bacteria | 2005 |
| 542 | Ga0373924_0002032 | 3300035410 | Bacteria | 6746 |
| 543 | Ga0373924_0033584 | 3300035410 | Bacteria | 2072 |
| 544 | Ga0373924_0037176 | 3300035410 | Bacteria | 1981 |
| 545 | Ga0373924_0040683 | 3300035410 | Bacteria | 1903 |
| 546 | Ga0373931_0009119 | 3300035691 | Bacteria | 4734 |
| 547 | Ga0373931_0160678 | 3300035691 | Bacteria | 1317 |
| 548 | Ga0373935_0000053 | 3300035692 | Bacteria | 46838 |
| 549 | Ga0373935_0012176 | 3300035692 | Bacteria | 5174 |
| 550 | Ga0373935_0037806 | 3300035692 | Bacteria | 3021 |
| 551 | Ga0373935_0058415 | 3300035692 | Bacteria | 2464 |
| 552 | Ga0373935_0114102 | 3300035692 | Bacteria | 1797 |
| 553 | Ga0373935_0569430 | 3300035692 | Bacteria | 827 |
| 554 | Ga0373927_0003990 | 3300035695 | Bacteria | 10440 |
| 555 | Ga0373927_0006706 | 3300035695 | Bacteria | 7832 |
| 556 | Ga0373927_0054934 | 3300035695 | Unclassified | 2576 |
| 557 | Ga0373927_0168063 | 3300035695 | Bacteria | 1437 |
| 558 | Ga0373927_0188718 | 3300035695 | Bacteria | 1352 |
| 559 | Ga0373927_0363302 | 3300035695 | Bacteria | 954 |
| 560 | Ga0373933_0001972 | 3300035724 | Bacteria | 11822 |
| 561 | Ga0373933_0006420 | 3300035724 | Bacteria | 6400 |
| 562 | Ga0373933_0015184 | 3300035724 | Bacteria | 4292 |
| 563 | Ga0373933_0177325 | 3300035724 | Bacteria | 1358 |
| 564 | Ga0373947_0000259 | 3300035725 | Bacteria | 29909 |
| 565 | Ga0373947_0007231 | 3300035725 | Bacteria | 6433 |
| 566 | Ga0373947_0022302 | 3300035725 | Bacteria | 3671 |
| 567 | Ga0373947_0045158 | 3300035725 | Bacteria | 2636 |
| 568 | Ga0373947_0078493 | 3300035725 | Bacteria | 2038 |
| 569 | Ga0373947_0099192 | 3300035725 | Bacteria | 1828 |
| 570 | Ga0373947_0108107 | 3300035725 | Bacteria | 1754 |
| 571 | Ga0373937_0000030 | 3300036401 | Bacteria | 122176 |
| 572 | Ga0373937_0002031 | 3300036401 | Bacteria | 16910 |
| 573 | Ga0373937_0011822 | 3300036401 | Bacteria | 7664 |
| 574 | Ga0373937_0051982 | 3300036401 | Bacteria | 3756 |
| 575 | Ga0373937_0053663 | 3300036401 | Bacteria | 3697 |
| 576 | Ga0373937_0091262 | 3300036401 | Bacteria | 2822 |
| 577 | Ga0373937_0102344 | 3300036401 | Bacteria | 2659 |
| 578 | Ga0373937_0165925 | 3300036401 | Bacteria | 2071 |
| 579 | Ga0373937_0244830 | 3300036401 | Bacteria | 1690 |
| 580 | Ga0373937_0714988 | 3300036401 | Bacteria | 949 |
| 581 | Ga0372808_016532 | 3300036459 | Bacteria | 1057 |
| 582 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 583 | Ga0373925_0013015 | 3300037068 | Bacteria | 6025 |
| 584 | Ga0373925_0044707 | 3300037068 | Bacteria | 3289 |
| 585 | Ga0373925_0200374 | 3300037068 | Bacteria | 1587 |
| 586 | Ga0373925_0216552 | 3300037068 | Bacteria | 1527 |
| 587 | Ga0373925_0246128 | 3300037068 | Unclassified | 1433 |
| 588 | Ga0373925_0334062 | 3300037068 | Bacteria | 1228 |
| 589 | Ga0395899_0124497 | 3300037312 | Bacteria | 1844 |
| 590 | Ga0395900_0024386 | 3300037418 | Bacteria | 6194 |
| 591 | Ga0395900_0803020 | 3300037418 | Bacteria | 869 |
| 592 | Ga0436364_0116063 | 3300037853 | Bacteria | 34499 |
| 593 | Ga0436364_0174146 | 3300037853 | Bacteria | 60383 |
| 594 | Ga0436364_0518856 | 3300037853 | Bacteria | 4142 |
| 595 | Ga0436364_0790051 | 3300037853 | Bacteria | 7354 |
| 596 | Ga0436364_1167573 | 3300037853 | Bacteria | 1842 |
| 597 | Ga0436364_1414712 | 3300037853 | Bacteria | 14633 |
| 598 | Ga0395901_0009263 | 3300038443 | Bacteria | 9984 |
| 599 | Ga0395901_0544387 | 3300038443 | Unclassified | 1177 |
| 600 | Ga0395901_0684383 | 3300038443 | Bacteria | 1025 |
| 601 | Ga0395901_0767182 | 3300038443 | Bacteria | 956 |
| 602 | Ga0436365_0297513 | 3300039437 | Bacteria | 1297 |
| 603 | Ga0436365_0316468 | 3300039437 | Bacteria | 3400 |
| 604 | Ga0436365_0502355 | 3300039437 | Bacteria | 2696 |
| 605 | Ga0436365_0536902 | 3300039437 | Bacteria | 5780 |
| 606 | Ga0436365_1057670 | 3300039437 | Bacteria | 2070 |
| 607 | Ga0436365_1534158 | 3300039437 | Bacteria | 1930 |
| 608 | Ga0436360_0521374 | 3300039438 | Bacteria | 992 |
| 609 | Ga0436360_0736047 | 3300039438 | Bacteria | 1241 |
| 610 | Ga0436360_1043436 | 3300039438 | Bacteria | 1358 |
| 611 | Ga0436361_0261761 | 3300039447 | Bacteria | 1407 |
| 612 | Ga0436361_0724946 | 3300039447 | Bacteria | 1227 |
| 613 | Ga0436361_1073850 | 3300039447 | Bacteria | 1843 |
| 614 | Ga0436363_0651762 | 3300039450 | Bacteria | 2465 |
| 615 | Ga0436363_0833932 | 3300039450 | Unclassified | 1451 |
| 616 | Ga0436363_1260906 | 3300039450 | Bacteria | 932 |
| 617 | Ga0436363_1557386 | 3300039450 | Unclassified | 3146 |
| 618 | Ga0436362_0220226 | 3300039453 | Bacteria | 4248 |
| 619 | Ga0436362_0976859 | 3300039453 | Bacteria | 1575 |
| 620 | Ga0451791_1395462 | 3300041451 | Bacteria | 924 |
| 621 | Ga0451853_0295340 | 3300041512 | Bacteria | 984 |
| 622 | Ga0439460_0027138 | 3300042461 | Bacteria | 1606 |
| 623 | Ga0439440_0068646 | 3300042993 | Bacteria | 918 |
| 624 | Ga0453683_0017377 | 3300044673 | Bacteria | 4630 |
| 625 | Ga0453683_0210344 | 3300044673 | Bacteria | 1236 |
| 626 | Ga0466963_0137965 | 3300044694 | Bacteria | 1688 |
| 627 | Ga0466959_0276615 | 3300045049 | Bacteria | 1153 |
| 628 | Ga0451576_0162542 | 3300045051 | Bacteria | 2330 |
| 629 | Ga0466967_0025189 | 3300045976 | Bacteria | 4903 |
| 630 | Ga0466967_0199815 | 3300045976 | Unclassified | 1893 |
| 631 | Ga0495627_050764 | 3300046453 | Bacteria | 1249 |
| 632 | Ga0495592_0000046 | 3300046454 | Bacteria | 117345 |
| 633 | Ga0495592_0063065 | 3300046454 | Bacteria | 2719 |
| 634 | Ga0495592_0191067 | 3300046454 | Bacteria | 1388 |
| 635 | Ga0495592_0383981 | 3300046454 | Unclassified | 893 |
| 636 | Ga0495603_0026171 | 3300046455 | Bacteria | 3525 |
| 637 | Ga0495603_0165408 | 3300046455 | Bacteria | 1282 |
| 638 | Ga0495629_0145069 | 3300046459 | Bacteria | 1651 |
| 639 | Ga0495629_0190112 | 3300046459 | Bacteria | 1421 |
| 640 | Ga0495651_0000822 | 3300046462 | Bacteria | 24113 |
| 641 | Ga0495651_0016074 | 3300046462 | Bacteria | 5796 |
| 642 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 643 | Ga0495653_0090986 | 3300046463 | Bacteria | 2231 |
| 644 | Ga0495650_0089444 | 3300046471 | Bacteria | 1174 |
| 645 | Ga0495580_0379804 | 3300046472 | Bacteria | 954 |
| 646 | Ga0495582_0064649 | 3300046473 | Bacteria | 2020 |
| 647 | Ga0495582_0082452 | 3300046473 | Bacteria | 1787 |
| 648 | Ga0495582_0136768 | 3300046473 | Bacteria | 1387 |
| 649 | Ga0495605_0032275 | 3300046474 | Bacteria | 2667 |
| 650 | Ga0495605_0154621 | 3300046474 | Bacteria | 1021 |
| 651 | Ga0495639_0027441 | 3300046475 | Bacteria | 2520 |
| 652 | Ga0495639_0061050 | 3300046475 | Unclassified | 1728 |
| 653 | Ga0495639_0112738 | 3300046475 | Bacteria | 1292 |
| 654 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 655 | Ga0495664_0099885 | 3300046477 | Bacteria | 1747 |
| 656 | Ga0495585_0031747 | 3300046492 | Bacteria | 2997 |
| 657 | Ga0495585_0141051 | 3300046492 | Bacteria | 1262 |
| 658 | Ga0495594_0201253 | 3300046499 | Bacteria | 1135 |
| 659 | Ga0495594_0207085 | 3300046499 | Bacteria | 1118 |
| 660 | Ga0495596_0042107 | 3300046500 | Bacteria | 1800 |
| 661 | Ga0495606_0076311 | 3300046507 | Bacteria | 2095 |
| 662 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 663 | Ga0495608_0136303 | 3300046511 | Bacteria | 1568 |
| 664 | Ga0495608_0296983 | 3300046511 | Bacteria | 1000 |
| 665 | Ga0495616_0104194 | 3300046513 | Bacteria | 1326 |
| 666 | Ga0495618_0000034 | 3300046514 | Bacteria | 104335 |
| 667 | Ga0495618_0029155 | 3300046514 | Bacteria | 3442 |
| 668 | Ga0495618_0042664 | 3300046514 | Bacteria | 2860 |
| 669 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 670 | Ga0495630_0000662 | 3300046517 | Bacteria | 24856 |
| 671 | Ga0495630_0052129 | 3300046517 | Bacteria | 3063 |
| 672 | Ga0495630_0164878 | 3300046517 | Bacteria | 1687 |
| 673 | Ga0495630_0446629 | 3300046517 | Bacteria | 991 |
| 674 | Ga0495630_0470612 | 3300046517 | Bacteria | 963 |
| 675 | Ga0495632_0092412 | 3300046519 | Bacteria | 1433 |
| 676 | Ga0495632_0122309 | 3300046519 | Bacteria | 1216 |
| 677 | Ga0495637_0110886 | 3300046520 | Bacteria | 1063 |
| 678 | Ga0495666_0121148 | 3300046526 | Bacteria | 1225 |
| 679 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 680 | Ga0495652_0107711 | 3300046529 | Bacteria | 2248 |
| 681 | Ga0495654_0148259 | 3300046530 | Bacteria | 1040 |
| 682 | Ga0495665_0031706 | 3300046531 | Bacteria | 2829 |
| 683 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 684 | Ga0495640_0021159 | 3300046533 | Bacteria | 4778 |
| 685 | Ga0495640_0079911 | 3300046533 | Bacteria | 2176 |
| 686 | Ga0495640_0118297 | 3300046533 | Bacteria | 1724 |
| 687 | Ga0495640_0142197 | 3300046533 | Bacteria | 1546 |
| 688 | Ga0495640_0283651 | 3300046533 | Bacteria | 1031 |
| 689 | Ga0495586_0276195 | 3300046535 | Bacteria | 961 |
| 690 | Ga0495587_0000031 | 3300046536 | Bacteria | 126721 |
| 691 | Ga0495587_0023239 | 3300046536 | Bacteria | 3811 |
| 692 | Ga0495587_0105693 | 3300046536 | Bacteria | 1619 |
| 693 | Ga0495598_0006275 | 3300046537 | Bacteria | 2680 |
| 694 | Ga0495598_0040224 | 3300046537 | Bacteria | 1362 |
| 695 | Ga0495621_0014292 | 3300046539 | Bacteria | 2510 |
| 696 | Ga0495621_0089291 | 3300046539 | Bacteria | 1160 |
| 697 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 698 | Ga0495633_0141254 | 3300046558 | Bacteria | 1113 |
| 699 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 700 | Ga0495667_0032557 | 3300046559 | Bacteria | 3493 |
| 701 | Ga0495667_0049591 | 3300046559 | Bacteria | 2771 |
| 702 | Ga0495667_0143668 | 3300046559 | Bacteria | 1537 |
| 703 | Ga0495667_0171686 | 3300046559 | Bacteria | 1393 |
| 704 | Ga0495668_0228320 | 3300046616 | Bacteria | 1019 |
| 705 | Ga0495634_0048400 | 3300046642 | Bacteria | 2862 |
| 706 | Ga0495634_0176246 | 3300046642 | Bacteria | 1341 |
| 707 | Ga0495634_0222471 | 3300046642 | Bacteria | 1164 |
| 708 | Ga0495634_0234240 | 3300046642 | Unclassified | 1129 |
| 709 | Ga0495635_0000022 | 3300046663 | Bacteria | 160907 |
| 710 | Ga0495635_0030518 | 3300046663 | Bacteria | 3746 |
| 711 | Ga0495635_0047055 | 3300046663 | Bacteria | 2976 |
| 712 | Ga0495635_0048550 | 3300046663 | Bacteria | 2926 |
| 713 | Ga0495635_0094506 | 3300046663 | Bacteria | 2044 |
| 714 | Ga0495635_0113006 | 3300046663 | Bacteria | 1855 |
| 715 | Ga0495635_0352268 | 3300046663 | Bacteria | 982 |
| 716 | Ga0495659_0008947 | 3300046664 | Bacteria | 3189 |
| 717 | Ga0495659_0144296 | 3300046664 | Bacteria | 952 |
| 718 | Ga0495588_0008543 | 3300046674 | Bacteria | 4705 |
| 719 | Ga0495657_0000276 | 3300046675 | Bacteria | 46295 |
| 720 | Ga0495657_0177179 | 3300046675 | Bacteria | 1310 |
| 721 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 722 | Ga0495599_0032207 | 3300046678 | Bacteria | 3291 |
| 723 | Ga0495599_0142819 | 3300046678 | Bacteria | 1484 |
| 724 | Ga0495599_0231768 | 3300046678 | Bacteria | 1127 |
| 725 | Ga0495623_0000094 | 3300046679 | Bacteria | 53328 |
| 726 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 727 | Ga0495646_0311863 | 3300046680 | Unclassified | 830 |
| 728 | Ga0495658_0018990 | 3300046683 | Unclassified | 3582 |
| 729 | Ga0495658_0308146 | 3300046683 | Bacteria | 1002 |
| 730 | Ga0495669_0030566 | 3300046684 | Bacteria | 2364 |
| 731 | Ga0495613_0005203 | 3300046689 | Bacteria | 9769 |
| 732 | Ga0495613_0099585 | 3300046689 | Bacteria | 2100 |
| 733 | Ga0495613_0110784 | 3300046689 | Bacteria | 1978 |
| 734 | Ga0495613_0317316 | 3300046689 | Bacteria | 1076 |
| 735 | Ga0495624_0084366 | 3300046690 | Bacteria | 1963 |
| 736 | Ga0495624_0377068 | 3300046690 | Bacteria | 852 |
| 737 | Ga0495670_0223965 | 3300046691 | Bacteria | 999 |
| 738 | Ga0495671_0099852 | 3300046692 | Bacteria | 1419 |
| 739 | Ga0495589_0166944 | 3300046794 | Bacteria | 1047 |
| 740 | Ga0495600_0000033 | 3300046809 | Bacteria | 83590 |
| 741 | Ga0495600_0080882 | 3300046809 | Bacteria | 2121 |
| 742 | Ga0495600_0196539 | 3300046809 | Bacteria | 1296 |
| 743 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 744 | Ga0495604_0076491 | 3300047317 | Bacteria | 2518 |
| 745 | Ga0495604_0225285 | 3300047317 | Bacteria | 1289 |
| 746 | Ga0495604_0240144 | 3300047317 | Bacteria | 1239 |
| 747 | Ga0495636_0025653 | 3300047318 | Bacteria | 2394 |
| 748 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 749 | Ga0495674_0092387 | 3300047319 | Bacteria | 2583 |
| 750 | Ga0495674_0458762 | 3300047319 | Bacteria | 1023 |
| 751 | Ga0495672_0137765 | 3300047320 | Unclassified | 1278 |
| 752 | Ga0495676_0297060 | 3300047321 | Bacteria | 1090 |
| 753 | Ga0495680_0000091 | 3300047322 | Bacteria | 81622 |
| 754 | Ga0495680_0074954 | 3300047322 | Bacteria | 2568 |
| 755 | Ga0495680_0357576 | 3300047322 | Bacteria | 1015 |
| 756 | Ga0495683_0078567 | 3300047323 | Bacteria | 1612 |
| 757 | Ga0495675_0000064 | 3300047444 | Bacteria | 74132 |
| 758 | Ga0495677_0045265 | 3300047445 | Bacteria | 1614 |
| 759 | Ga0495684_0000035 | 3300047471 | Bacteria | 107768 |
| 760 | Ga0495684_0056398 | 3300047471 | Bacteria | 2995 |
| 761 | Ga0495684_0139669 | 3300047471 | Bacteria | 1817 |
| 762 | Ga0495684_0421958 | 3300047471 | Unclassified | 932 |
| 763 | Ga0495593_0044108 | 3300047673 | Bacteria | 2387 |
| 764 | Ga0495602_0000029 | 3300048088 | Bacteria | 142344 |
| 765 | Ga0495602_0004741 | 3300048088 | Bacteria | 14214 |
| 766 | Ga0495614_0129833 | 3300048089 | Bacteria | 1115 |
| 767 | Ga0495615_0019320 | 3300048090 | Bacteria | 1512 |
| 768 | Ga0495626_0146195 | 3300048091 | Bacteria | 999 |
| 769 | Ga0496100_0005415 | 3300048903 | Bacteria | 6873 |
| 770 | Ga0496100_0016994 | 3300048903 | Bacteria | 4283 |
| 771 | Ga0496100_0517799 | 3300048903 | Bacteria | 920 |
| 772 | Ga0496101_0002908 | 3300048904 | Bacteria | 10544 |
| 773 | Ga0496101_0457919 | 3300048904 | Bacteria | 1006 |
| 774 | Ga0496102_0034692 | 3300048905 | Bacteria | 4539 |
| 775 | Ga0496102_0176027 | 3300048905 | Bacteria | 2014 |
| 776 | Ga0496102_0288922 | 3300048905 | Bacteria | 1545 |
| 777 | Ga0496102_0491735 | 3300048905 | Bacteria | 1148 |
| 778 | Ga0496103_0097114 | 3300048906 | Bacteria | 1862 |
| 779 | Ga0496103_0104527 | 3300048906 | Bacteria | 1795 |
| 780 | Ga0496104_0000406 | 3300048907 | Bacteria | 37705 |
| 781 | Ga0496104_0011780 | 3300048907 | Bacteria | 7846 |
| 782 | Ga0496104_0018833 | 3300048907 | Bacteria | 6306 |
| 783 | Ga0496104_0046997 | 3300048907 | Bacteria | 4067 |
| 784 | Ga0496104_0118048 | 3300048907 | Bacteria | 2546 |
| 785 | Ga0496104_0152806 | 3300048907 | Bacteria | 2215 |
| 786 | Ga0496104_0713763 | 3300048907 | Unclassified | 910 |
| 787 | Ga0496105_0003838 | 3300048908 | Bacteria | 11215 |
| 788 | Ga0496105_0006511 | 3300048908 | Bacteria | 8981 |
| 789 | Ga0496105_0026574 | 3300048908 | Bacteria | 4724 |
| 790 | Ga0496105_0045525 | 3300048908 | Bacteria | 3620 |
| 791 | Ga0496105_0153463 | 3300048908 | Bacteria | 1892 |
| 792 | Ga0496105_0269211 | 3300048908 | Bacteria | 1376 |
| 793 | Ga0496106_0009563 | 3300048909 | Bacteria | 7159 |
| 794 | Ga0496106_0025869 | 3300048909 | Bacteria | 4367 |
| 795 | Ga0496106_0033663 | 3300048909 | Bacteria | 3824 |
| 796 | Ga0496106_0060627 | 3300048909 | Bacteria | 2868 |
| 797 | Ga0496107_0025460 | 3300048910 | Bacteria | 4189 |
| 798 | Ga0496107_0065981 | 3300048910 | Bacteria | 2624 |
| 799 | Ga0496107_0069604 | 3300048910 | Bacteria | 2554 |
| 800 | Ga0496107_0198228 | 3300048910 | Bacteria | 1492 |
| 801 | Ga0496108_0023370 | 3300048911 | Bacteria | 5086 |
| 802 | Ga0496108_0121307 | 3300048911 | Bacteria | 2242 |
| 803 | Ga0496108_0266269 | 3300048911 | Bacteria | 1491 |
| 804 | Ga0496108_0545867 | 3300048911 | Bacteria | 1011 |
| 805 | Ga0496109_0028898 | 3300048912 | Bacteria | 4963 |
| 806 | Ga0496109_0116590 | 3300048912 | Bacteria | 2486 |
| 807 | Ga0496109_0386913 | 3300048912 | Bacteria | 1321 |
| 808 | Ga0496110_0011457 | 3300048913 | Bacteria | 7258 |
| 809 | Ga0496110_0017500 | 3300048913 | Bacteria | 5997 |
| 810 | Ga0496110_0017778 | 3300048913 | Bacteria | 5950 |
| 811 | Ga0496110_0043652 | 3300048913 | Bacteria | 3915 |
| 812 | Ga0496111_0093464 | 3300048914 | Bacteria | 2205 |
| 813 | Ga0496111_0188218 | 3300048914 | Bacteria | 1534 |
| 814 | Ga0496112_0018293 | 3300048915 | Bacteria | 6596 |
| 815 | Ga0496112_0086701 | 3300048915 | Bacteria | 3097 |
| 816 | Ga0496112_0218245 | 3300048915 | Bacteria | 1863 |
| 817 | Ga0496112_0239272 | 3300048915 | Bacteria | 1768 |
| 818 | Ga0496112_0567934 | 3300048915 | Bacteria | 1067 |
| 819 | Ga0496113_0080132 | 3300048916 | Bacteria | 2500 |
| 820 | Ga0496113_0141939 | 3300048916 | Bacteria | 1890 |
| 821 | Ga0496114_0002985 | 3300048917 | Bacteria | 12975 |
| 822 | Ga0496114_0044873 | 3300048917 | Bacteria | 3669 |
| 823 | Ga0496114_0060123 | 3300048917 | Bacteria | 3175 |
| 824 | Ga0496114_0091496 | 3300048917 | Bacteria | 2584 |
| 825 | Ga0496114_0568657 | 3300048917 | Bacteria | 1001 |
| 826 | Ga0496115_0019674 | 3300048918 | Bacteria | 5197 |
| 827 | Ga0496115_0032525 | 3300048918 | Bacteria | 4115 |
| 828 | Ga0496115_0078034 | 3300048918 | Bacteria | 2694 |
| 829 | Ga0496115_0082880 | 3300048918 | Bacteria | 2613 |
| 830 | Ga0496115_0087655 | 3300048918 | Bacteria | 2540 |
| 831 | Ga0496115_0244727 | 3300048918 | Bacteria | 1478 |
| 832 | Ga0496118_0242857 | 3300048921 | Bacteria | 1030 |
| 833 | Ga0496121_0023126 | 3300048924 | Bacteria | 6000 |
| 834 | Ga0496121_0051252 | 3300048924 | Bacteria | 3478 |
| 835 | Ga0496126_0017149 | 3300048929 | Bacteria | 7221 |
| 836 | Ga0496126_0039939 | 3300048929 | Bacteria | 4351 |
| 837 | Ga0496126_0109813 | 3300048929 | Bacteria | 2403 |
| 838 | Ga0496126_0120611 | 3300048929 | Bacteria | 2275 |
| 839 | Ga0495678_025380 | 3300049459 | Bacteria | 2546 |
| 840 | Ga0501311_014377 | 3300049527 | Bacteria | 1009 |
| 841 | Ga0501317_008493 | 3300049533 | Bacteria | 1184 |
| 842 | Ga0501318_011075 | 3300049534 | Bacteria | 1013 |
| 843 | Ga0501321_005571 | 3300049537 | Bacteria | 1250 |
| 844 | Ga0501034_0138934 | 3300049571 | Bacteria | 2410 |
| 845 | Ga0501036_0011679 | 3300049572 | Bacteria | 7279 |
| 846 | Ga0501036_0127330 | 3300049572 | Bacteria | 2151 |
| 847 | Ga0501038_0109451 | 3300049574 | Unclassified | 2289 |
| 848 | Ga0501039_0021841 | 3300049575 | Bacteria | 4911 |
| 849 | Ga0501039_0034004 | 3300049575 | Bacteria | 3933 |
| 850 | Ga0501039_0315379 | 3300049575 | Bacteria | 1229 |
| 851 | Ga0501040_0000995 | 3300049576 | Bacteria | 17916 |
| 852 | Ga0501040_0015514 | 3300049576 | Bacteria | 5034 |
| 853 | Ga0501040_0074209 | 3300049576 | Bacteria | 2351 |
| 854 | Ga0501040_0242757 | 3300049576 | Bacteria | 1284 |
| 855 | Ga0501041_0017617 | 3300049577 | Bacteria | 4250 |
| 856 | Ga0501041_0058187 | 3300049577 | Bacteria | 2364 |
| 857 | Ga0501041_0130470 | 3300049577 | Bacteria | 1565 |
| 858 | Ga0501042_0011394 | 3300049578 | Bacteria | 6001 |
| 859 | Ga0501042_0118816 | 3300049578 | Bacteria | 1903 |
| 860 | Ga0501042_0340267 | 3300049578 | Bacteria | 1085 |
| 861 | Ga0501046_0049382 | 3300049580 | Bacteria | 3328 |
| 862 | Ga0501046_0114167 | 3300049580 | Bacteria | 2061 |
| 863 | Ga0501046_0271644 | 3300049580 | Bacteria | 1243 |
| 864 | Ga0501048_0011738 | 3300049582 | Bacteria | 6531 |
| 865 | Ga0501048_0032626 | 3300049582 | Bacteria | 3763 |
| 866 | Ga0501048_0137931 | 3300049582 | Bacteria | 1724 |
| 867 | Ga0501048_0328501 | 3300049582 | Bacteria | 1090 |
| 868 | Ga0501068_0095855 | 3300049584 | Bacteria | 1835 |
| 869 | Ga0501070_0111390 | 3300049586 | Bacteria | 2262 |
| 870 | Ga0501071_0180918 | 3300049587 | Bacteria | 1580 |
| 871 | Ga0501071_0306412 | 3300049587 | Bacteria | 1205 |
| 872 | Ga0501072_0011150 | 3300049588 | Bacteria | 6860 |
| 873 | Ga0501072_0041410 | 3300049588 | Bacteria | 3618 |
| 874 | Ga0501073_0246179 | 3300049589 | Bacteria | 1234 |
| 875 | Ga0501073_0290283 | 3300049589 | Bacteria | 1129 |
| 876 | Ga0501075_0000059 | 3300049591 | Bacteria | 46955 |
| 877 | Ga0501075_0002900 | 3300049591 | Bacteria | 11504 |
| 878 | Ga0501075_0016035 | 3300049591 | Bacteria | 5391 |
| 879 | Ga0501075_0571537 | 3300049591 | Bacteria | 862 |
| 880 | Ga0501076_0000302 | 3300049592 | Bacteria | 30790 |
| 881 | Ga0501076_0013335 | 3300049592 | Bacteria | 6163 |
| 882 | Ga0501076_0109490 | 3300049592 | Bacteria | 2232 |
| 883 | Ga0501077_0020718 | 3300049593 | Bacteria | 4163 |
| 884 | Ga0501077_0043474 | 3300049593 | Bacteria | 2855 |
| 885 | Ga0501079_0007487 | 3300049741 | Bacteria | 8257 |
| 886 | Ga0501079_0251304 | 3300049741 | Bacteria | 1382 |
| 887 | Ga0501079_0286054 | 3300049741 | Bacteria | 1289 |
| 888 | Ga0501080_0022370 | 3300049742 | Bacteria | 5857 |
| 889 | Ga0501080_0062421 | 3300049742 | Bacteria | 3468 |
| 890 | Ga0501080_0129125 | 3300049742 | Bacteria | 2340 |
| 891 | Ga0501080_0350061 | 3300049742 | Bacteria | 1334 |
| 892 | Ga0501081_0002714 | 3300049743 | Bacteria | 11204 |
| 893 | Ga0501081_0111241 | 3300049743 | Bacteria | 1944 |
| 894 | Ga0501081_0294897 | 3300049743 | Bacteria | 1189 |
| 895 | Ga0501081_0455651 | 3300049743 | Bacteria | 951 |
| 896 | Ga0501083_0149014 | 3300049744 | Bacteria | 1532 |
| 897 | Ga0501035_0120363 | 3300049822 | Unclassified | 2296 |
| 898 | Ga0501044_0174924 | 3300049823 | Bacteria | 2116 |
| 899 | nmdc:mga03683_849_c1 | 3300050489 | Bacteria | 6172 |
| 900 | nmdc:mga03n38_870_c1 | 3300050490 | Bacteria | 8105 |
| 901 | nmdc:mga00v17_47431_c1 | 3300050491 | Bacteria | 2602 |
| 902 | nmdc:mga0yw44_16746_c1 | 3300050492 | Bacteria | 3969 |
| 903 | nmdc:mga0yw44_23402_c1 | 3300050492 | Bacteria | 3480 |
| 904 | nmdc:mga0k408_18460_c1 | 3300050493 | Bacteria | 3894 |
| 905 | nmdc:mga06z11_18660_c1 | 3300050494 | Bacteria | 3173 |
| 906 | nmdc:mga05p37_163993_c1 | 3300050507 | Bacteria | 2713 |
| 907 | nmdc:mga05p37_16858_c1 | 3300050507 | Bacteria | 8808 |
| 908 | nmdc:mga05p37_17862_c1 | 3300050507 | Bacteria | 8562 |
| 909 | nmdc:mga05p37_231768_c1 | 3300050507 | Bacteria | 2224 |
| 910 | nmdc:mga05p37_287343_c1 | 3300050507 | Bacteria | 1959 |
| 911 | nmdc:mga05p37_40389_c1 | 3300050507 | Bacteria | 5730 |
| 912 | nmdc:mga05p37_578_c1 | 3300050507 | Bacteria | 40238 |
| 913 | nmdc:mga05p37_59858_c1 | 3300050507 | Unclassified | 4690 |
| 914 | nmdc:mga09592_103701_c1 | 3300050508 | Bacteria | 2437 |
| 915 | nmdc:mga09592_1636_c1 | 3300050508 | Bacteria | 18036 |
| 916 | nmdc:mga09592_201363_c1 | 3300050508 | Bacteria | 1724 |
| 917 | nmdc:mga09592_213560_c1 | 3300050508 | Bacteria | 1672 |
| 918 | nmdc:mga09592_274253_c1 | 3300050508 | Unclassified | 1463 |
| 919 | nmdc:mga09592_3930_c1 | 3300050508 | Bacteria | 11973 |
| 920 | nmdc:mga09592_529_c1 | 3300050508 | Bacteria | 28853 |
| 921 | nmdc:mga09592_5368_c1 | 3300050508 | Bacteria | 10419 |
| 922 | nmdc:mga09592_54535_c1 | 3300050508 | Unclassified | 3377 |
| 923 | nmdc:mga09592_82205_c1 | 3300050508 | Bacteria | 2745 |
| 924 | nmdc:mga09592_93745_c1 | 3300050508 | Bacteria | 2568 |
| 925 | nmdc:mga0qj67_1023_c1 | 3300050509 | Bacteria | 19334 |
| 926 | nmdc:mga0qj67_163453_c1 | 3300050509 | Bacteria | 1807 |
| 927 | nmdc:mga0qj67_171275_c1 | 3300050509 | Bacteria | 1763 |
| 928 | nmdc:mga0qj67_171_c1 | 3300050509 | Bacteria | 43599 |
| 929 | nmdc:mga0qj67_391859_c1 | 3300050509 | Bacteria | 1121 |
| 930 | nmdc:mga06r32_104218_c1 | 3300050510 | Bacteria | 2785 |
| 931 | nmdc:mga06r32_134128_c1 | 3300050510 | Unclassified | 2450 |
| 932 | nmdc:mga06r32_157949_c1 | 3300050510 | Bacteria | 2250 |
| 933 | nmdc:mga06r32_231940_c1 | 3300050510 | Bacteria | 1834 |
| 934 | nmdc:mga06r32_274536_c1 | 3300050510 | Bacteria | 1673 |
| 935 | nmdc:mga06r32_308_c1 | 3300050510 | Bacteria | 40566 |
| 936 | nmdc:mga06r32_32719_c1 | 3300050510 | Bacteria | 4895 |
| 937 | nmdc:mga06r32_457_c1 | 3300050510 | Bacteria | 34863 |
| 938 | nmdc:mga06r32_642505_c1 | 3300050510 | Bacteria | 1030 |
| 939 | nmdc:mga06r32_652918_c1 | 3300050510 | Bacteria | 1020 |
| 940 | nmdc:mga06r32_6565_c1 | 3300050510 | Bacteria | 10451 |
| 941 | nmdc:mga06r32_673_c1 | 3300050510 | Bacteria | 29768 |
| 942 | nmdc:mga06r32_706290_c1 | 3300050510 | Bacteria | 974 |
| 943 | nmdc:mga06r32_85194_c1 | 3300050510 | Bacteria | 3081 |
| 944 | nmdc:mga06r32_92225_c1 | 3300050510 | Bacteria | 2961 |
| 945 | nmdc:mga08y16_24463_c1 | 3300050511 | Bacteria | 6374 |
| 946 | nmdc:mga08y16_26204_c1 | 3300050511 | Bacteria | 6148 |
| 947 | nmdc:mga08y16_275912_c1 | 3300050511 | Bacteria | 1735 |
| 948 | nmdc:mga08y16_304808_c1 | 3300050511 | Bacteria | 1641 |
| 949 | nmdc:mga08y16_307815_c1 | 3300050511 | Bacteria | 1632 |
| 950 | nmdc:mga08y16_334302_c1 | 3300050511 | Bacteria | 1558 |
| 951 | nmdc:mga08y16_345251_c1 | 3300050511 | Bacteria | 1530 |
| 952 | nmdc:mga08y16_36541_c1 | 3300050511 | Bacteria | 5159 |
| 953 | nmdc:mga08y16_402576_c1 | 3300050511 | Bacteria | 1400 |
| 954 | nmdc:mga08y16_482921_c1 | 3300050511 | Bacteria | 1261 |
| 955 | nmdc:mga0n895_11714_c1 | 3300050512 | Bacteria | 7837 |
| 956 | nmdc:mga0n895_145088_c1 | 3300050512 | Bacteria | 2403 |
| 957 | nmdc:mga0n895_157936_c1 | 3300050512 | Bacteria | 2299 |
| 958 | nmdc:mga0n895_247331_c1 | 3300050512 | Bacteria | 1810 |
| 959 | nmdc:mga0n895_258275_c1 | 3300050512 | Bacteria | 1768 |
| 960 | nmdc:mga0n895_284502_c1 | 3300050512 | Bacteria | 1676 |
| 961 | nmdc:mga0n895_37143_c1 | 3300050512 | Bacteria | 4710 |
| 962 | nmdc:mga0n895_395792_c1 | 3300050512 | Bacteria | 1397 |
| 963 | nmdc:mga0n895_60709_c1 | 3300050512 | Bacteria | 3731 |
| 964 | nmdc:mga0n895_890131_c1 | 3300050512 | Bacteria | 876 |
| 965 | nmdc:mga0n895_97954_c1 | 3300050512 | Bacteria | 2939 |
| 966 | nmdc:mga0rr50_223668_c1 | 3300050513 | Bacteria | 1555 |
| 967 | nmdc:mga08x19_409287_c1 | 3300050514 | Bacteria | 952 |
| 968 | nmdc:mga0a205_133457_c1 | 3300050515 | Bacteria | 2383 |
| 969 | nmdc:mga0a205_195351_c1 | 3300050515 | Bacteria | 1914 |
| 970 | nmdc:mga0a205_246756_c1 | 3300050515 | Bacteria | 1666 |
| 971 | nmdc:mga0a205_358959_c1 | 3300050515 | Bacteria | 1324 |
| 972 | nmdc:mga0a205_365456_c1 | 3300050515 | Bacteria | 1309 |
| 973 | nmdc:mga0a205_478035_c1 | 3300050515 | Bacteria | 1104 |
| 974 | nmdc:mga0a205_52331_c1 | 3300050515 | Bacteria | 3941 |
| 975 | nmdc:mga0a205_59046_c1 | 3300050515 | Bacteria | 3706 |
| 976 | nmdc:mga0a205_61195_c1 | 3300050515 | Bacteria | 3636 |
| 977 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 978 | Ga0495601_0001559 | 3300053077 | Bacteria | 12672 |
| 979 | Ga0495601_0008686 | 3300053077 | Bacteria | 5994 |
| 980 | Ga0495601_0010988 | 3300053077 | Bacteria | 5407 |
| 981 | Ga0495601_0085827 | 3300053077 | Bacteria | 2023 |
| 982 | Ga0495601_0161501 | 3300053077 | Bacteria | 1464 |
| 983 | Ga0495601_0186008 | 3300053077 | Bacteria | 1358 |
| 984 | Ga0495601_0272536 | 3300053077 | Bacteria | 1104 |
| 985 | Ga0495612_0000026 | 3300053078 | Bacteria | 111627 |
| 986 | Ga0495612_0005642 | 3300053078 | Bacteria | 5171 |
| 987 | Ga0495595_0000024 | 3300053084 | Bacteria | 108008 |
| 988 | Ga0495595_0004562 | 3300053084 | Bacteria | 5570 |
| 989 | Ga0495595_0057640 | 3300053084 | Bacteria | 1812 |
| 990 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 991 | Ga0495619_0001277 | 3300053085 | Bacteria | 16520 |
| 992 | Ga0495619_0006262 | 3300053085 | Bacteria | 7546 |
| 993 | Ga0495619_0039945 | 3300053085 | Bacteria | 3065 |
| 994 | Ga0495619_0078338 | 3300053085 | Unclassified | 2222 |
| 995 | Ga0495619_0266546 | 3300053085 | Bacteria | 1187 |
| 996 | Ga0500651_0117561 | 3300053093 | Bacteria | 1617 |
| 997 | Ga0500641_0047437 | 3300053096 | Bacteria | 1756 |
| 998 | Ga0500616_0096090 | 3300053153 | Bacteria | 1457 |
| 999 | Ga0501084_0002329 | 3300054114 | Bacteria | 15261 |
| 1000 | Ga0501084_0150306 | 3300054114 | Bacteria | 1963 |
| 1001 | Ga0501084_0189071 | 3300054114 | Bacteria | 1737 |
| 1002 | Ga0587093_001576 | 3300059478 | Bacteria | 1960 |
| 1003 | Ga0587066_000440 | 3300059490 | Bacteria | 3334 |
| 1004 | Ga0587075_000381 | 3300059644 | Bacteria | 3396 |
| 1005 | Ga0587078_002060 | 3300059646 | Bacteria | 1908 |
| 1006 | Ga0587111_0000520 | 3300060346 | Bacteria | 3744 |
| 1007 | Ga0501082_0004557 | 3300060353 | Bacteria | 12097 |
| 1008 | Ga0501082_0091037 | 3300060353 | Bacteria | 2634 |
| 1009 | Ga0501082_0161732 | 3300060353 | Bacteria | 1946 |
| 1010 | Ga0501082_0294225 | 3300060353 | Bacteria | 1414 |
| 1011 | Ga0501082_0328814 | 3300060353 | Bacteria | 1332 |
| 1012 | Ga0501082_0342397 | 3300060353 | Bacteria | 1303 |
| 1013 | Ga0501082_0497413 | 3300060353 | Bacteria | 1066 |
| 1014 | Ga0530510_0000001 | 3300061734 | Bacteria | 285623 |
| 1015 | Ga0530510_0004611 | 3300061734 | Bacteria | 9532 |
| 1016 | Ga0530510_0011725 | 3300061734 | Bacteria | 6152 |
| 1017 | Ga0530510_0088355 | 3300061734 | Bacteria | 2259 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0080882 | Ga0495600_0080882_1461_2096 | 207 |
| 2 | 3300049743 | Ga0501081_0455651 | Ga0501081_0455651_59_697 | 208 |
| 3 | 3300021388 | Ga0213875_10033177 | Ga0213875_100331772 | 211 |
| 4 | 3300025915 | Ga0207693_10017116 | Ga0207693_100171164 | 216 |
| 5 | 3300037853 | Ga0436364_0790051 | Ga0436364_0790051_1873_2778 | 216 |
| 6 | 3300005841 | Ga0068863_100077315 | Ga0068863_1000773152 | 220 |
| 7 | 3300026088 | Ga0207641_10058449 | Ga0207641_100584492 | 220 |
| 8 | 3300050512 | nmdc:mga0n895_890131_c1 | nmdc:mga0n895_890131_c1_10_702 | 225 |
| 9 | 3300039447 | Ga0436361_0724946 | Ga0436361_0724946_352_1140 | 226 |
| 10 | 3300046475 | Ga0495639_0112738 | Ga0495639_0112738_222_1028 | 230 |
| 11 | 3300005467 | Ga0070706_100456100 | Ga0070706_1004561001 | 232 |
| 12 | 3300005471 | Ga0070698_100209625 | Ga0070698_1002096252 | 232 |
| 13 | 3300025986 | Ga0207658_10191795 | Ga0207658_101917951 | 234 |
| 14 | 3300026067 | Ga0207678_10141966 | Ga0207678_101419662 | 234 |
| 15 | 3300049576 | Ga0501040_0074209 | Ga0501040_0074209_65_823 | 235 |
| 16 | 3300049577 | Ga0501041_0130470 | Ga0501041_0130470_626_1384 | 235 |
| 17 | 3300049580 | Ga0501046_0271644 | Ga0501046_0271644_122_880 | 235 |
| 18 | 3300049582 | Ga0501048_0137931 | Ga0501048_0137931_673_1431 | 235 |
| 19 | 3300060353 | Ga0501082_0328814 | Ga0501082_0328814_365_1123 | 235 |
| 20 | 3300061734 | Ga0530510_0088355 | Ga0530510_0088355_1197_1955 | 235 |
| 21 | 3300005564 | Ga0070664_100766953 | Ga0070664_1007669531 | 236 |
| 22 | 3300031507 | Ga0307509_10071890 | Ga0307509_100718902 | 236 |
| 23 | 3300014968 | Ga0157379_10220305 | Ga0157379_102203052 | 237 |
| 24 | 3300035692 | Ga0373935_0012176 | Ga0373935_0012176_3378_4121 | 237 |
| 25 | 3300005564 | Ga0070664_100271514 | Ga0070664_1002715142 | 238 |
| 26 | 3300009147 | Ga0114129_11528689 | Ga0114129_115286891 | 238 |
| 27 | 3300038443 | Ga0395901_0544387 | Ga0395901_0544387_356_1084 | 238 |
| 28 | 3300039450 | Ga0436363_0833932 | Ga0436363_0833932_519_1247 | 238 |
| 29 | 3300049572 | Ga0501036_0011679 | Ga0501036_0011679_2574_3302 | 238 |
| 30 | 3300049574 | Ga0501038_0109451 | Ga0501038_0109451_175_903 | 238 |
| 31 | 3300049575 | Ga0501039_0034004 | Ga0501039_0034004_1877_2605 | 238 |
| 32 | 3300049576 | Ga0501040_0000995 | Ga0501040_0000995_12940_13668 | 238 |
| 33 | 3300049577 | Ga0501041_0017617 | Ga0501041_0017617_657_1385 | 238 |
| 34 | 3300049578 | Ga0501042_0011394 | Ga0501042_0011394_2452_3180 | 238 |
| 35 | 3300049582 | Ga0501048_0011738 | Ga0501048_0011738_2721_3449 | 238 |
| 36 | 3300049588 | Ga0501072_0011150 | Ga0501072_0011150_2850_3578 | 238 |
| 37 | 3300049591 | Ga0501075_0000059 | Ga0501075_0000059_33465_34193 | 238 |
| 38 | 3300049592 | Ga0501076_0000302 | Ga0501076_0000302_10689_11417 | 238 |
| 39 | 3300049593 | Ga0501077_0043474 | Ga0501077_0043474_1733_2461 | 238 |
| 40 | 3300049741 | Ga0501079_0007487 | Ga0501079_0007487_1737_2465 | 238 |
| 41 | 3300049742 | Ga0501080_0022370 | Ga0501080_0022370_3780_4508 | 238 |
| 42 | 3300049743 | Ga0501081_0002714 | Ga0501081_0002714_4966_5694 | 238 |
| 43 | 3300049822 | Ga0501035_0120363 | Ga0501035_0120363_422_1150 | 238 |
| 44 | 3300054114 | Ga0501084_0002329 | Ga0501084_0002329_11293_12021 | 238 |
| 45 | 3300060353 | Ga0501082_0004557 | Ga0501082_0004557_9664_10392 | 238 |
| 46 | 3300061734 | Ga0530510_0000001 | Ga0530510_0000001_88306_89034 | 238 |
| 47 | 3300005329 | Ga0070683_100304232 | Ga0070683_1003042322 | 239 |
| 48 | 3300005445 | Ga0070708_100037899 | Ga0070708_1000378994 | 239 |
| 49 | 3300005458 | Ga0070681_10067759 | Ga0070681_100677593 | 239 |
| 50 | 3300005471 | Ga0070698_100160045 | Ga0070698_1001600453 | 239 |
| 51 | 3300005548 | Ga0070665_100049009 | Ga0070665_1000490094 | 239 |
| 52 | 3300005614 | Ga0068856_100488644 | Ga0068856_1004886442 | 239 |
| 53 | 3300005937 | Ga0081455_10200913 | Ga0081455_102009132 | 239 |
| 54 | 3300005983 | Ga0081540_1051182 | Ga0081540_10511821 | 239 |
| 55 | 3300006028 | Ga0070717_10000508 | Ga0070717_100005083 | 239 |
| 56 | 3300006028 | Ga0070717_10403909 | Ga0070717_104039092 | 239 |
| 57 | 3300006163 | Ga0070715_10072632 | Ga0070715_100726322 | 239 |
| 58 | 3300006173 | Ga0070716_100343610 | Ga0070716_1003436101 | 239 |
| 59 | 3300006175 | Ga0070712_100266166 | Ga0070712_1002661662 | 239 |
| 60 | 3300006175 | Ga0070712_100380414 | Ga0070712_1003804141 | 239 |
| 61 | 3300006846 | Ga0075430_100004372 | Ga0075430_10000437212 | 239 |
| 62 | 3300006871 | Ga0075434_100031726 | Ga0075434_1000317262 | 239 |
| 63 | 3300006871 | Ga0075434_100287264 | Ga0075434_1002872641 | 239 |
| 64 | 3300007788 | Ga0099795_10132238 | Ga0099795_101322382 | 239 |
| 65 | 3300009093 | Ga0105240_10437551 | Ga0105240_104375512 | 239 |
| 66 | 3300009094 | Ga0111539_10677395 | Ga0111539_106773952 | 239 |
| 67 | 3300010159 | Ga0099796_10052250 | Ga0099796_100522502 | 239 |
| 68 | 3300021388 | Ga0213875_10000498 | Ga0213875_1000049828 | 239 |
| 69 | 3300021388 | Ga0213875_10002698 | Ga0213875_1000269810 | 239 |
| 70 | 3300025898 | Ga0207692_10178917 | Ga0207692_101789172 | 239 |
| 71 | 3300025906 | Ga0207699_10032557 | Ga0207699_100325572 | 239 |
| 72 | 3300025906 | Ga0207699_10205470 | Ga0207699_102054702 | 239 |
| 73 | 3300025912 | Ga0207707_10055373 | Ga0207707_100553732 | 239 |
| 74 | 3300025915 | Ga0207693_10017417 | Ga0207693_100174175 | 239 |
| 75 | 3300025916 | Ga0207663_10264211 | Ga0207663_102642112 | 239 |
| 76 | 3300025916 | Ga0207663_10398163 | Ga0207663_103981632 | 239 |
| 77 | 3300025934 | Ga0207686_10268353 | Ga0207686_102683532 | 239 |
| 78 | 3300025941 | Ga0207711_10452869 | Ga0207711_104528692 | 239 |
| 79 | 3300025944 | Ga0207661_10100788 | Ga0207661_101007882 | 239 |
| 80 | 3300035111 | Ga0373923_0221424 | Ga0373923_0221424_132_863 | 239 |
| 81 | 3300035116 | Ga0373945_0105445 | Ga0373945_0105445_130_861 | 239 |
| 82 | 3300035171 | Ga0373946_0191560 | Ga0373946_0191560_37_768 | 239 |
| 83 | 3300035172 | Ga0373955_0420628 | Ga0373955_0420628_62_796 | 239 |
| 84 | 3300035410 | Ga0373924_0040683 | Ga0373924_0040683_308_1039 | 239 |
| 85 | 3300035695 | Ga0373927_0054934 | Ga0373927_0054934_1350_2087 | 239 |
| 86 | 3300035724 | Ga0373933_0015184 | Ga0373933_0015184_853_1584 | 239 |
| 87 | 3300036401 | Ga0373937_0011822 | Ga0373937_0011822_1399_2130 | 239 |
| 88 | 3300036401 | Ga0373937_0051982 | Ga0373937_0051982_1518_2255 | 239 |
| 89 | 3300036401 | Ga0373937_0053663 | Ga0373937_0053663_1747_2478 | 239 |
| 90 | 3300036401 | Ga0373937_0102344 | Ga0373937_0102344_364_1098 | 239 |
| 91 | 3300037068 | Ga0373925_0200374 | Ga0373925_0200374_422_1153 | 239 |
| 92 | 3300037068 | Ga0373925_0246128 | Ga0373925_0246128_93_830 | 239 |
| 93 | 3300037853 | Ga0436364_0116063 | Ga0436364_0116063_28829_29605 | 239 |
| 94 | 3300037853 | Ga0436364_1167573 | Ga0436364_1167573_698_1435 | 239 |
| 95 | 3300037853 | Ga0436364_1414712 | Ga0436364_1414712_2597_3331 | 239 |
| 96 | 3300039438 | Ga0436360_0521374 | Ga0436360_0521374_155_892 | 239 |
| 97 | 3300039438 | Ga0436360_1043436 | Ga0436360_1043436_505_1242 | 239 |
| 98 | 3300039447 | Ga0436361_1073850 | Ga0436361_1073850_543_1280 | 239 |
| 99 | 3300039450 | Ga0436363_1260906 | Ga0436363_1260906_83_820 | 239 |
| 100 | 3300039450 | Ga0436363_1557386 | Ga0436363_1557386_132_869 | 239 |
| 101 | 3300039453 | Ga0436362_0976859 | Ga0436362_0976859_104_841 | 239 |
| 102 | 3300044673 | Ga0453683_0210344 | Ga0453683_0210344_448_1185 | 239 |
| 103 | 3300046454 | Ga0495592_0383981 | Ga0495592_0383981_128_859 | 239 |
| 104 | 3300046499 | Ga0495594_0207085 | Ga0495594_0207085_260_997 | 239 |
| 105 | 3300046511 | Ga0495608_0136303 | Ga0495608_0136303_808_1539 | 239 |
| 106 | 3300046511 | Ga0495608_0296983 | Ga0495608_0296983_204_935 | 239 |
| 107 | 3300046514 | Ga0495618_0042664 | Ga0495618_0042664_430_1167 | 239 |
| 108 | 3300046529 | Ga0495652_0107711 | Ga0495652_0107711_1292_2023 | 239 |
| 109 | 3300046533 | Ga0495640_0283651 | Ga0495640_0283651_88_825 | 239 |
| 110 | 3300046536 | Ga0495587_0023239 | Ga0495587_0023239_1105_1836 | 239 |
| 111 | 3300046536 | Ga0495587_0105693 | Ga0495587_0105693_30_761 | 239 |
| 112 | 3300046559 | Ga0495667_0032557 | Ga0495667_0032557_1747_2478 | 239 |
| 113 | 3300046559 | Ga0495667_0049591 | Ga0495667_0049591_1372_2109 | 239 |
| 114 | 3300046642 | Ga0495634_0048400 | Ga0495634_0048400_204_941 | 239 |
| 115 | 3300046642 | Ga0495634_0234240 | Ga0495634_0234240_194_931 | 239 |
| 116 | 3300046663 | Ga0495635_0030518 | Ga0495635_0030518_1149_1886 | 239 |
| 117 | 3300046663 | Ga0495635_0048550 | Ga0495635_0048550_2055_2786 | 239 |
| 118 | 3300046663 | Ga0495635_0352268 | Ga0495635_0352268_93_830 | 239 |
| 119 | 3300046675 | Ga0495657_0177179 | Ga0495657_0177179_511_1242 | 239 |
| 120 | 3300046678 | Ga0495599_0032207 | Ga0495599_0032207_25_756 | 239 |
| 121 | 3300046678 | Ga0495599_0142819 | Ga0495599_0142819_403_1140 | 239 |
| 122 | 3300046680 | Ga0495646_0311863 | Ga0495646_0311863_89_820 | 239 |
| 123 | 3300046809 | Ga0495600_0196539 | Ga0495600_0196539_272_1009 | 239 |
| 124 | 3300047317 | Ga0495604_0240144 | Ga0495604_0240144_243_974 | 239 |
| 125 | 3300047322 | Ga0495680_0357576 | Ga0495680_0357576_58_789 | 239 |
| 126 | 3300047471 | Ga0495684_0421958 | Ga0495684_0421958_104_835 | 239 |
| 127 | 3300048088 | Ga0495602_0004741 | Ga0495602_0004741_1837_2568 | 239 |
| 128 | 3300049576 | Ga0501040_0015514 | Ga0501040_0015514_1878_2615 | 239 |
| 129 | 3300049577 | Ga0501041_0058187 | Ga0501041_0058187_1037_1774 | 239 |
| 130 | 3300049578 | Ga0501042_0118816 | Ga0501042_0118816_503_1240 | 239 |
| 131 | 3300050508 | nmdc:mga09592_529_c1 | nmdc:mga09592_529_c1_9735_10472 | 239 |
| 132 | 3300050510 | nmdc:mga06r32_673_c1 | nmdc:mga06r32_673_c1_28938_29675 | 239 |
| 133 | 3300050512 | nmdc:mga0n895_97954_c1 | nmdc:mga0n895_97954_c1_2146_2895 | 239 |
| 134 | 3300053077 | Ga0495601_0001559 | Ga0495601_0001559_3263_3994 | 239 |
| 135 | 3300053077 | Ga0495601_0010988 | Ga0495601_0010988_1865_2602 | 239 |
| 136 | 3300053077 | Ga0495601_0186008 | Ga0495601_0186008_34_765 | 239 |
| 137 | 3300053078 | Ga0495612_0005642 | Ga0495612_0005642_40_771 | 239 |
| 138 | 3300053084 | Ga0495595_0057640 | Ga0495595_0057640_406_1137 | 239 |
| 139 | 3300053085 | Ga0495619_0006262 | Ga0495619_0006262_3877_4614 | 239 |
| 140 | 3300053085 | Ga0495619_0039945 | Ga0495619_0039945_1681_2412 | 239 |
| 141 | 3300005336 | Ga0070680_100281796 | Ga0070680_1002817961 | 240 |
| 142 | 3300005434 | Ga0070709_10406250 | Ga0070709_104062501 | 240 |
| 143 | 3300005458 | Ga0070681_10085961 | Ga0070681_100859612 | 240 |
| 144 | 3300006028 | Ga0070717_10616178 | Ga0070717_106161782 | 240 |
| 145 | 3300013104 | Ga0157370_10560401 | Ga0157370_105604011 | 240 |
| 146 | 3300025906 | Ga0207699_10345308 | Ga0207699_103453081 | 240 |
| 147 | 3300025912 | Ga0207707_10191248 | Ga0207707_101912482 | 240 |
| 148 | 3300025917 | Ga0207660_10399309 | Ga0207660_103993092 | 240 |
| 149 | 3300027512 | Ga0209179_1005644 | Ga0209179_10056441 | 240 |
| 150 | 3300031247 | Ga0265340_10002096 | Ga0265340_100020964 | 240 |
| 151 | 3300031249 | Ga0265339_10001221 | Ga0265339_100012219 | 240 |
| 152 | 3300031712 | Ga0265342_10000035 | Ga0265342_1000003539 | 240 |
| 153 | 3300046459 | Ga0495629_0190112 | Ga0495629_0190112_335_1090 | 240 |
| 154 | 3300046473 | Ga0495582_0082452 | Ga0495582_0082452_432_1187 | 240 |
| 155 | 3300050512 | nmdc:mga0n895_284502_c1 | nmdc:mga0n895_284502_c1_277_1029 | 240 |
| 156 | 3300050514 | nmdc:mga08x19_409287_c1 | nmdc:mga08x19_409287_c1_152_904 | 240 |
| 157 | 3300005340 | Ga0070689_100001712 | Ga0070689_1000017129 | 242 |
| 158 | 3300005343 | Ga0070687_100012756 | Ga0070687_1000127562 | 242 |
| 159 | 3300005365 | Ga0070688_100022506 | Ga0070688_1000225064 | 242 |
| 160 | 3300005544 | Ga0070686_100259615 | Ga0070686_1002596152 | 242 |
| 161 | 3300005617 | Ga0068859_100279634 | Ga0068859_1002796343 | 242 |
| 162 | 3300005618 | Ga0068864_100196892 | Ga0068864_1001968922 | 242 |
| 163 | 3300005844 | Ga0068862_100182770 | Ga0068862_1001827703 | 242 |
| 164 | 3300006931 | Ga0097620_100279624 | Ga0097620_1002796243 | 242 |
| 165 | 3300009098 | Ga0105245_10279932 | Ga0105245_102799322 | 242 |
| 166 | 3300009176 | Ga0105242_10239275 | Ga0105242_102392752 | 242 |
| 167 | 3300009177 | Ga0105248_10377773 | Ga0105248_103777732 | 242 |
| 168 | 3300014325 | Ga0163163_10005361 | Ga0163163_100053614 | 242 |
| 169 | 3300014969 | Ga0157376_10061010 | Ga0157376_100610103 | 242 |
| 170 | 3300025936 | Ga0207670_10001158 | Ga0207670_100011589 | 242 |
| 171 | 3300025942 | Ga0207689_10278216 | Ga0207689_102782162 | 242 |
| 172 | 3300026095 | Ga0207676_10021432 | Ga0207676_100214323 | 242 |
| 173 | 3300027471 | Ga0209995_1001114 | Ga0209995_10011142 | 242 |
| 174 | 3300034957 | Ga0373938_0002389 | Ga0373938_0002389_2013_2888 | 242 |
| 175 | 3300035092 | Ga0373952_0003300 | Ga0373952_0003300_1471_2361 | 242 |
| 176 | 3300048911 | Ga0496108_0023370 | Ga0496108_0023370_679_1569 | 242 |
| 177 | 3300048915 | Ga0496112_0239272 | Ga0496112_0239272_556_1446 | 242 |
| 178 | 3300048916 | Ga0496113_0141939 | Ga0496113_0141939_310_1200 | 242 |
| 179 | 3300049575 | Ga0501039_0315379 | Ga0501039_0315379_205_957 | 242 |
| 180 | 3300049587 | Ga0501071_0306412 | Ga0501071_0306412_305_1057 | 242 |
| 181 | 3300049588 | Ga0501072_0041410 | Ga0501072_0041410_38_790 | 242 |
| 182 | 3300049592 | Ga0501076_0109490 | Ga0501076_0109490_1319_2071 | 242 |
| 183 | 3300049742 | Ga0501080_0350061 | Ga0501080_0350061_300_1052 | 242 |
| 184 | 3300049743 | Ga0501081_0111241 | Ga0501081_0111241_1149_1901 | 242 |
| 185 | 3300050512 | nmdc:mga0n895_145088_c1 | nmdc:mga0n895_145088_c1_1072_1815 | 242 |
| 186 | 3300050513 | nmdc:mga0rr50_223668_c1 | nmdc:mga0rr50_223668_c1_138_881 | 242 |
| 187 | 3300060353 | Ga0501082_0091037 | Ga0501082_0091037_1131_1883 | 242 |
| 188 | 3300006871 | Ga0075434_100376443 | Ga0075434_1003764432 | 243 |
| 189 | 3300035086 | Ga0373934_0045836 | Ga0373934_0045836_811_1584 | 243 |
| 190 | 3300035111 | Ga0373923_0008125 | Ga0373923_0008125_1991_2764 | 243 |
| 191 | 3300035113 | Ga0373936_0000543 | Ga0373936_0000543_5289_6062 | 243 |
| 192 | 3300035117 | Ga0373953_0002974 | Ga0373953_0002974_1900_2673 | 243 |
| 193 | 3300035118 | Ga0373954_0001388 | Ga0373954_0001388_3562_4335 | 243 |
| 194 | 3300035119 | Ga0373956_0044968 | Ga0373956_0044968_154_927 | 243 |
| 195 | 3300035170 | Ga0373943_0006448 | Ga0373943_0006448_336_1109 | 243 |
| 196 | 3300035171 | Ga0373946_0012654 | Ga0373946_0012654_1459_2232 | 243 |
| 197 | 3300035172 | Ga0373955_0001296 | Ga0373955_0001296_5819_6592 | 243 |
| 198 | 3300035410 | Ga0373924_0002032 | Ga0373924_0002032_2117_2890 | 243 |
| 199 | 3300035692 | Ga0373935_0000053 | Ga0373935_0000053_19988_20761 | 243 |
| 200 | 3300035695 | Ga0373927_0003990 | Ga0373927_0003990_4143_4916 | 243 |
| 201 | 3300035724 | Ga0373933_0006420 | Ga0373933_0006420_5267_6040 | 243 |
| 202 | 3300035725 | Ga0373947_0000259 | Ga0373947_0000259_28128_28901 | 243 |
| 203 | 3300036401 | Ga0373937_0000030 | Ga0373937_0000030_18905_19678 | 243 |
| 204 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_46598_47371 | 243 |
| 205 | 3300046454 | Ga0495592_0000046 | Ga0495592_0000046_82241_83014 | 243 |
| 206 | 3300046459 | Ga0495629_0145069 | Ga0495629_0145069_756_1529 | 243 |
| 207 | 3300046462 | Ga0495651_0000822 | Ga0495651_0000822_4128_4901 | 243 |
| 208 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_46644_47417 | 243 |
| 209 | 3300046473 | Ga0495582_0064649 | Ga0495582_0064649_187_960 | 243 |
| 210 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_82278_83051 | 243 |
| 211 | 3300046511 | Ga0495608_0000006 | Ga0495608_0000006_131495_132268 | 243 |
| 212 | 3300046514 | Ga0495618_0000034 | Ga0495618_0000034_99457_100230 | 243 |
| 213 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_46561_47334 | 243 |
| 214 | 3300046517 | Ga0495630_0000662 | Ga0495630_0000662_4160_4933 | 243 |
| 215 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_541447_542220 | 243 |
| 216 | 3300046533 | Ga0495640_0000007 | Ga0495640_0000007_79181_79954 | 243 |
| 217 | 3300046536 | Ga0495587_0000031 | Ga0495587_0000031_46663_47436 | 243 |
| 218 | 3300046539 | Ga0495621_0014292 | Ga0495621_0014292_805_1653 | 243 |
| 219 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_27914_28687 | 243 |
| 220 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_390287_391060 | 243 |
| 221 | 3300046663 | Ga0495635_0000022 | Ga0495635_0000022_16946_17719 | 243 |
| 222 | 3300046675 | Ga0495657_0000276 | Ga0495657_0000276_20042_20815 | 243 |
| 223 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_185341_186114 | 243 |
| 224 | 3300046679 | Ga0495623_0000094 | Ga0495623_0000094_27849_28622 | 243 |
| 225 | 3300046680 | Ga0495646_0000007 | Ga0495646_0000007_50691_51464 | 243 |
| 226 | 3300046689 | Ga0495613_0005203 | Ga0495613_0005203_2811_3584 | 243 |
| 227 | 3300046690 | Ga0495624_0084366 | Ga0495624_0084366_424_1197 | 243 |
| 228 | 3300046809 | Ga0495600_0000033 | Ga0495600_0000033_36251_37024 | 243 |
| 229 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_72307_73080 | 243 |
| 230 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_514690_515463 | 243 |
| 231 | 3300047322 | Ga0495680_0000091 | Ga0495680_0000091_53032_53805 | 243 |
| 232 | 3300047444 | Ga0495675_0000064 | Ga0495675_0000064_26799_27572 | 243 |
| 233 | 3300047471 | Ga0495684_0000035 | Ga0495684_0000035_27816_28589 | 243 |
| 234 | 3300048088 | Ga0495602_0000029 | Ga0495602_0000029_27806_28579 | 243 |
| 235 | 3300053077 | Ga0495601_0000008 | Ga0495601_0000008_275306_276079 | 243 |
| 236 | 3300053078 | Ga0495612_0000026 | Ga0495612_0000026_69880_70653 | 243 |
| 237 | 3300053084 | Ga0495595_0000024 | Ga0495595_0000024_27923_28696 | 243 |
| 238 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_46666_47439 | 243 |
| 239 | 3300053085 | Ga0495619_0266546 | Ga0495619_0266546_277_1152 | 243 |
| 240 | 3300035120 | Ga0373957_0001852 | Ga0373957_0001852_3898_4683 | 244 |
| 241 | 3300035724 | Ga0373933_0001972 | Ga0373933_0001972_7267_8052 | 244 |
| 242 | 3300041512 | Ga0451853_0295340 | Ga0451853_0295340_33_908 | 244 |
| 243 | 3300053077 | Ga0495601_0008686 | Ga0495601_0008686_1401_2186 | 244 |
| 244 | 3300006852 | Ga0075433_10394652 | Ga0075433_103946521 | 245 |
| 245 | 3300006871 | Ga0075434_100305621 | Ga0075434_1003056212 | 245 |
| 246 | 3300035117 | Ga0373953_0028233 | Ga0373953_0028233_78_863 | 245 |
| 247 | 3300035172 | Ga0373955_0003427 | Ga0373955_0003427_165_950 | 245 |
| 248 | 3300036401 | Ga0373937_0002031 | Ga0373937_0002031_14151_14936 | 245 |
| 249 | 3300045051 | Ga0451576_0162542 | Ga0451576_0162542_1022_1882 | 245 |
| 250 | 3300046454 | Ga0495592_0063065 | Ga0495592_0063065_367_1152 | 245 |
| 251 | 3300046462 | Ga0495651_0016074 | Ga0495651_0016074_1612_2397 | 245 |
| 252 | 3300046463 | Ga0495653_0090986 | Ga0495653_0090986_854_1639 | 245 |
| 253 | 3300047317 | Ga0495604_0076491 | Ga0495604_0076491_1446_2231 | 245 |
| 254 | 3300047322 | Ga0495680_0074954 | Ga0495680_0074954_615_1400 | 245 |
| 255 | 3300050512 | nmdc:mga0n895_247331_c1 | nmdc:mga0n895_247331_c1_461_1321 | 245 |
| 256 | 3300050515 | nmdc:mga0a205_365456_c1 | nmdc:mga0a205_365456_c1_57_917 | 245 |
| 257 | 3300053084 | Ga0495595_0004562 | Ga0495595_0004562_2281_3066 | 245 |
| 258 | 3300053085 | Ga0495619_0001277 | Ga0495619_0001277_5006_5791 | 245 |
| 259 | 3300005354 | Ga0070675_100354128 | Ga0070675_1003541282 | 246 |
| 260 | 3300005468 | Ga0070707_100092187 | Ga0070707_1000921872 | 246 |
| 261 | 3300005548 | Ga0070665_100023942 | Ga0070665_1000239422 | 246 |
| 262 | 3300009177 | Ga0105248_10042634 | Ga0105248_100426346 | 246 |
| 263 | 3300025937 | Ga0207669_10295440 | Ga0207669_102954401 | 246 |
| 264 | 3300035410 | Ga0373924_0033584 | Ga0373924_0033584_12_815 | 246 |
| 265 | 3300038443 | Ga0395901_0684383 | Ga0395901_0684383_152_955 | 246 |
| 266 | 3300003911 | JGI25405J52794_10000642 | JGI25405J52794_100006422 | 247 |
| 267 | 3300005436 | Ga0070713_100001818 | Ga0070713_1000018189 | 247 |
| 268 | 3300005437 | Ga0070710_10005916 | Ga0070710_100059165 | 247 |
| 269 | 3300005439 | Ga0070711_100012791 | Ga0070711_1000127915 | 247 |
| 270 | 3300005614 | Ga0068856_100066265 | Ga0068856_1000662652 | 247 |
| 271 | 3300006028 | Ga0070717_10159065 | Ga0070717_101590652 | 247 |
| 272 | 3300006173 | Ga0070716_100543921 | Ga0070716_1005439211 | 247 |
| 273 | 3300006175 | Ga0070712_100004011 | Ga0070712_1000040119 | 247 |
| 274 | 3300006177 | Ga0075362_10051383 | Ga0075362_100513832 | 247 |
| 275 | 3300006195 | Ga0075366_10080388 | Ga0075366_100803883 | 247 |
| 276 | 3300006846 | Ga0075430_100002737 | Ga0075430_1000027379 | 247 |
| 277 | 3300006847 | Ga0075431_100010541 | Ga0075431_1000105419 | 247 |
| 278 | 3300006871 | Ga0075434_100179083 | Ga0075434_1001790832 | 247 |
| 279 | 3300006880 | Ga0075429_100017929 | Ga0075429_1000179298 | 247 |
| 280 | 3300009147 | Ga0114129_10209081 | Ga0114129_102090812 | 247 |
| 281 | 3300014325 | Ga0163163_10042646 | Ga0163163_100426461 | 247 |
| 282 | 3300025908 | Ga0207643_10236080 | Ga0207643_102360802 | 247 |
| 283 | 3300025945 | Ga0207679_10377168 | Ga0207679_103771681 | 247 |
| 284 | 3300028380 | Ga0268265_10651112 | Ga0268265_106511122 | 247 |
| 285 | 3300031901 | Ga0307406_10737456 | Ga0307406_107374561 | 247 |
| 286 | 3300031995 | Ga0307409_100306152 | Ga0307409_1003061521 | 247 |
| 287 | 3300032002 | Ga0307416_100211485 | Ga0307416_1002114851 | 247 |
| 288 | 3300035691 | Ga0373931_0160678 | Ga0373931_0160678_206_979 | 247 |
| 289 | 3300035692 | Ga0373935_0114102 | Ga0373935_0114102_27_842 | 247 |
| 290 | 3300048903 | Ga0496100_0517799 | Ga0496100_0517799_130_903 | 247 |
| 291 | 3300048907 | Ga0496104_0152806 | Ga0496104_0152806_345_1118 | 247 |
| 292 | 3300048912 | Ga0496109_0116590 | Ga0496109_0116590_340_1113 | 247 |
| 293 | 3300048918 | Ga0496115_0244727 | Ga0496115_0244727_669_1442 | 247 |
| 294 | 3300049527 | Ga0501311_014377 | Ga0501311_014377_180_938 | 247 |
| 295 | 3300050507 | nmdc:mga05p37_287343_c1 | nmdc:mga05p37_287343_c1_1155_1913 | 247 |
| 296 | 3300050508 | nmdc:mga09592_5368_c1 | nmdc:mga09592_5368_c1_5009_5782 | 247 |
| 297 | 3300050508 | nmdc:mga09592_82205_c1 | nmdc:mga09592_82205_c1_226_984 | 247 |
| 298 | 3300050509 | nmdc:mga0qj67_1023_c1 | nmdc:mga0qj67_1023_c1_9007_9780 | 247 |
| 299 | 3300050510 | nmdc:mga06r32_308_c1 | nmdc:mga06r32_308_c1_35574_36347 | 247 |
| 300 | 3300050510 | nmdc:mga06r32_32719_c1 | nmdc:mga06r32_32719_c1_3820_4578 | 247 |
| 301 | 3300050511 | nmdc:mga08y16_304808_c1 | nmdc:mga08y16_304808_c1_119_877 | 247 |
| 302 | 3300003215 | JGI25153J46596_10000980 | JGI25153J46596_1000098015 | 248 |
| 303 | 3300003911 | JGI25405J52794_10000579 | JGI25405J52794_100005793 | 248 |
| 304 | 3300004801 | Ga0058860_10061687 | Ga0058860_100616871 | 248 |
| 305 | 3300004801 | Ga0058860_12023695 | Ga0058860_120236951 | 248 |
| 306 | 3300004801 | Ga0058860_12080127 | Ga0058860_120801271 | 248 |
| 307 | 3300005295 | Ga0065707_10052887 | Ga0065707_100528871 | 248 |
| 308 | 3300005329 | Ga0070683_100076228 | Ga0070683_1000762284 | 248 |
| 309 | 3300005329 | Ga0070683_100188352 | Ga0070683_1001883522 | 248 |
| 310 | 3300005344 | Ga0070661_100049691 | Ga0070661_1000496913 | 248 |
| 311 | 3300005366 | Ga0070659_100205046 | Ga0070659_1002050461 | 248 |
| 312 | 3300005445 | Ga0070708_100023270 | Ga0070708_1000232705 | 248 |
| 313 | 3300005445 | Ga0070708_100041980 | Ga0070708_1000419801 | 248 |
| 314 | 3300005445 | Ga0070708_100079289 | Ga0070708_1000792893 | 248 |
| 315 | 3300005445 | Ga0070708_100162362 | Ga0070708_1001623622 | 248 |
| 316 | 3300005467 | Ga0070706_100041310 | Ga0070706_1000413103 | 248 |
| 317 | 3300005467 | Ga0070706_100082271 | Ga0070706_1000822714 | 248 |
| 318 | 3300005467 | Ga0070706_100150633 | Ga0070706_1001506332 | 248 |
| 319 | 3300005467 | Ga0070706_100291570 | Ga0070706_1002915701 | 248 |
| 320 | 3300005468 | Ga0070707_100016720 | Ga0070707_1000167201 | 248 |
| 321 | 3300005468 | Ga0070707_100091058 | Ga0070707_1000910585 | 248 |
| 322 | 3300005468 | Ga0070707_100146059 | Ga0070707_1001460592 | 248 |
| 323 | 3300005471 | Ga0070698_100042952 | Ga0070698_1000429524 | 248 |
| 324 | 3300005471 | Ga0070698_100176052 | Ga0070698_1001760522 | 248 |
| 325 | 3300005518 | Ga0070699_100245674 | Ga0070699_1002456741 | 248 |
| 326 | 3300005530 | Ga0070679_100101735 | Ga0070679_1001017352 | 248 |
| 327 | 3300005535 | Ga0070684_100079407 | Ga0070684_1000794073 | 248 |
| 328 | 3300005535 | Ga0070684_100151539 | Ga0070684_1001515392 | 248 |
| 329 | 3300005539 | Ga0068853_100814216 | Ga0068853_1008142161 | 248 |
| 330 | 3300005548 | Ga0070665_100074587 | Ga0070665_1000745873 | 248 |
| 331 | 3300005563 | Ga0068855_100124391 | Ga0068855_1001243912 | 248 |
| 332 | 3300005563 | Ga0068855_100148869 | Ga0068855_1001488694 | 248 |
| 333 | 3300005577 | Ga0068857_100165748 | Ga0068857_1001657483 | 248 |
| 334 | 3300005614 | Ga0068856_100019721 | Ga0068856_1000197213 | 248 |
| 335 | 3300005616 | Ga0068852_100240551 | Ga0068852_1002405512 | 248 |
| 336 | 3300005617 | Ga0068859_100046003 | Ga0068859_1000460032 | 248 |
| 337 | 3300005843 | Ga0068860_100019692 | Ga0068860_1000196926 | 248 |
| 338 | 3300005937 | Ga0081455_10000418 | Ga0081455_1000041830 | 248 |
| 339 | 3300005937 | Ga0081455_10001315 | Ga0081455_1000131515 | 248 |
| 340 | 3300005937 | Ga0081455_10002053 | Ga0081455_1000205325 | 248 |
| 341 | 3300005937 | Ga0081455_10096981 | Ga0081455_100969811 | 248 |
| 342 | 3300005981 | Ga0081538_10146066 | Ga0081538_101460661 | 248 |
| 343 | 3300005985 | Ga0081539_10174064 | Ga0081539_101740641 | 248 |
| 344 | 3300006194 | Ga0075427_10005724 | Ga0075427_100057241 | 248 |
| 345 | 3300006844 | Ga0075428_100010863 | Ga0075428_1000108632 | 248 |
| 346 | 3300006844 | Ga0075428_100032851 | Ga0075428_1000328512 | 248 |
| 347 | 3300006844 | Ga0075428_100066107 | Ga0075428_1000661074 | 248 |
| 348 | 3300006844 | Ga0075428_100150368 | Ga0075428_1001503682 | 248 |
| 349 | 3300006844 | Ga0075428_100251285 | Ga0075428_1002512852 | 248 |
| 350 | 3300006844 | Ga0075428_100267326 | Ga0075428_1002673262 | 248 |
| 351 | 3300006844 | Ga0075428_100333364 | Ga0075428_1003333642 | 248 |
| 352 | 3300006844 | Ga0075428_100625157 | Ga0075428_1006251571 | 248 |
| 353 | 3300006844 | Ga0075428_100644001 | Ga0075428_1006440011 | 248 |
| 354 | 3300006846 | Ga0075430_100029545 | Ga0075430_1000295453 | 248 |
| 355 | 3300006846 | Ga0075430_100035787 | Ga0075430_1000357876 | 248 |
| 356 | 3300006846 | Ga0075430_100357510 | Ga0075430_1003575101 | 248 |
| 357 | 3300006847 | Ga0075431_100038421 | Ga0075431_1000384212 | 248 |
| 358 | 3300006847 | Ga0075431_100086499 | Ga0075431_1000864994 | 248 |
| 359 | 3300006847 | Ga0075431_100103518 | Ga0075431_1001035182 | 248 |
| 360 | 3300006847 | Ga0075431_100180513 | Ga0075431_1001805132 | 248 |
| 361 | 3300006847 | Ga0075431_100183018 | Ga0075431_1001830183 | 248 |
| 362 | 3300006847 | Ga0075431_100506636 | Ga0075431_1005066361 | 248 |
| 363 | 3300006852 | Ga0075433_10021818 | Ga0075433_100218188 | 248 |
| 364 | 3300006852 | Ga0075433_10095949 | Ga0075433_100959491 | 248 |
| 365 | 3300006852 | Ga0075433_10243633 | Ga0075433_102436333 | 248 |
| 366 | 3300006852 | Ga0075433_10621321 | Ga0075433_106213211 | 248 |
| 367 | 3300006880 | Ga0075429_100017090 | Ga0075429_1000170901 | 248 |
| 368 | 3300006880 | Ga0075429_100022663 | Ga0075429_1000226637 | 248 |
| 369 | 3300006880 | Ga0075429_100059942 | Ga0075429_1000599421 | 248 |
| 370 | 3300006880 | Ga0075429_100075368 | Ga0075429_1000753681 | 248 |
| 371 | 3300006880 | Ga0075429_100274146 | Ga0075429_1002741462 | 248 |
| 372 | 3300006880 | Ga0075429_100292310 | Ga0075429_1002923101 | 248 |
| 373 | 3300006880 | Ga0075429_100407619 | Ga0075429_1004076191 | 248 |
| 374 | 3300006914 | Ga0075436_100245266 | Ga0075436_1002452661 | 248 |
| 375 | 3300006931 | Ga0097620_100046004 | Ga0097620_1000460042 | 248 |
| 376 | 3300007076 | Ga0075435_100475383 | Ga0075435_1004753832 | 248 |
| 377 | 3300009094 | Ga0111539_10032319 | Ga0111539_100323192 | 248 |
| 378 | 3300009094 | Ga0111539_10330986 | Ga0111539_103309862 | 248 |
| 379 | 3300009094 | Ga0111539_10427569 | Ga0111539_104275691 | 248 |
| 380 | 3300009101 | Ga0105247_10253644 | Ga0105247_102536442 | 248 |
| 381 | 3300009147 | Ga0114129_10071358 | Ga0114129_100713583 | 248 |
| 382 | 3300009147 | Ga0114129_10075599 | Ga0114129_100755992 | 248 |
| 383 | 3300009147 | Ga0114129_10111234 | Ga0114129_101112342 | 248 |
| 384 | 3300009147 | Ga0114129_10115567 | Ga0114129_101155673 | 248 |
| 385 | 3300009147 | Ga0114129_10450159 | Ga0114129_104501592 | 248 |
| 386 | 3300009147 | Ga0114129_10597890 | Ga0114129_105978902 | 248 |
| 387 | 3300009545 | Ga0105237_10129363 | Ga0105237_101293633 | 248 |
| 388 | 3300009551 | Ga0105238_10070875 | Ga0105238_100708754 | 248 |
| 389 | 3300009551 | Ga0105238_10195703 | Ga0105238_101957032 | 248 |
| 390 | 3300009553 | Ga0105249_10182709 | Ga0105249_101827092 | 248 |
| 391 | 3300009553 | Ga0105249_10294679 | Ga0105249_102946792 | 248 |
| 392 | 3300010375 | Ga0105239_10256496 | Ga0105239_102564962 | 248 |
| 393 | 3300013100 | Ga0157373_10157606 | Ga0157373_101576063 | 248 |
| 394 | 3300013104 | Ga0157370_10149127 | Ga0157370_101491272 | 248 |
| 395 | 3300013105 | Ga0157369_10859717 | Ga0157369_108597171 | 248 |
| 396 | 3300013306 | Ga0163162_10053689 | Ga0163162_100536893 | 248 |
| 397 | 3300013306 | Ga0163162_10250062 | Ga0163162_102500622 | 248 |
| 398 | 3300013307 | Ga0157372_10110431 | Ga0157372_101104313 | 248 |
| 399 | 3300013308 | Ga0157375_10051102 | Ga0157375_100511022 | 248 |
| 400 | 3300014325 | Ga0163163_10063883 | Ga0163163_100638834 | 248 |
| 401 | 3300014497 | Ga0182008_10076783 | Ga0182008_100767832 | 248 |
| 402 | 3300014968 | Ga0157379_10011648 | Ga0157379_100116483 | 248 |
| 403 | 3300020078 | Ga0206352_10676952 | Ga0206352_106769522 | 248 |
| 404 | 3300020080 | Ga0206350_10268593 | Ga0206350_102685932 | 248 |
| 405 | 3300020082 | Ga0206353_10378285 | Ga0206353_103782853 | 248 |
| 406 | 3300022467 | Ga0224712_10004135 | Ga0224712_100041353 | 248 |
| 407 | 3300025290 | Ga0207673_1018854 | Ga0207673_10188541 | 248 |
| 408 | 3300025297 | Ga0209758_1000523 | Ga0209758_100052368 | 248 |
| 409 | 3300025302 | Ga0207426_1060373 | Ga0207426_10603731 | 248 |
| 410 | 3300025900 | Ga0207710_10167639 | Ga0207710_101676392 | 248 |
| 411 | 3300025910 | Ga0207684_10038926 | Ga0207684_100389261 | 248 |
| 412 | 3300025910 | Ga0207684_10040850 | Ga0207684_100408501 | 248 |
| 413 | 3300025910 | Ga0207684_10076272 | Ga0207684_100762722 | 248 |
| 414 | 3300025910 | Ga0207684_10142507 | Ga0207684_101425071 | 248 |
| 415 | 3300025914 | Ga0207671_10239926 | Ga0207671_102399262 | 248 |
| 416 | 3300025915 | Ga0207693_10273489 | Ga0207693_102734892 | 248 |
| 417 | 3300025920 | Ga0207649_10034408 | Ga0207649_100344082 | 248 |
| 418 | 3300025921 | Ga0207652_10103988 | Ga0207652_101039882 | 248 |
| 419 | 3300025921 | Ga0207652_10230292 | Ga0207652_102302922 | 248 |
| 420 | 3300025922 | Ga0207646_10028109 | Ga0207646_100281094 | 248 |
| 421 | 3300025922 | Ga0207646_10079635 | Ga0207646_100796351 | 248 |
| 422 | 3300025922 | Ga0207646_10126681 | Ga0207646_101266811 | 248 |
| 423 | 3300025922 | Ga0207646_10215507 | Ga0207646_102155071 | 248 |
| 424 | 3300025924 | Ga0207694_10159623 | Ga0207694_101596232 | 248 |
| 425 | 3300025928 | Ga0207700_10134359 | Ga0207700_101343593 | 248 |
| 426 | 3300025928 | Ga0207700_10761585 | Ga0207700_107615851 | 248 |
| 427 | 3300025929 | Ga0207664_10531251 | Ga0207664_105312511 | 248 |
| 428 | 3300025932 | Ga0207690_10162705 | Ga0207690_101627052 | 248 |
| 429 | 3300025944 | Ga0207661_10054190 | Ga0207661_100541903 | 248 |
| 430 | 3300025944 | Ga0207661_10171817 | Ga0207661_101718172 | 248 |
| 431 | 3300025944 | Ga0207661_10519340 | Ga0207661_105193402 | 248 |
| 432 | 3300025949 | Ga0207667_10183269 | Ga0207667_101832692 | 248 |
| 433 | 3300025961 | Ga0207712_10074195 | Ga0207712_100741952 | 248 |
| 434 | 3300025961 | Ga0207712_10223864 | Ga0207712_102238642 | 248 |
| 435 | 3300026023 | Ga0207677_10082806 | Ga0207677_100828061 | 248 |
| 436 | 3300026075 | Ga0207708_10106677 | Ga0207708_101066771 | 248 |
| 437 | 3300026075 | Ga0207708_10179578 | Ga0207708_101795782 | 248 |
| 438 | 3300026078 | Ga0207702_10296923 | Ga0207702_102969232 | 248 |
| 439 | 3300026078 | Ga0207702_10323983 | Ga0207702_103239831 | 248 |
| 440 | 3300026142 | Ga0207698_10025424 | Ga0207698_100254244 | 248 |
| 441 | 3300027907 | Ga0207428_10017007 | Ga0207428_100170078 | 248 |
| 442 | 3300027907 | Ga0207428_10185093 | Ga0207428_101850932 | 248 |
| 443 | 3300027907 | Ga0207428_10569867 | Ga0207428_105698671 | 248 |
| 444 | 3300028379 | Ga0268266_10055963 | Ga0268266_100559632 | 248 |
| 445 | 3300028381 | Ga0268264_10216680 | Ga0268264_102166802 | 248 |
| 446 | 3300031595 | Ga0265313_10073133 | Ga0265313_100731331 | 248 |
| 447 | 3300031901 | Ga0307406_10295878 | Ga0307406_102958782 | 248 |
| 448 | 3300031901 | Ga0307406_10325776 | Ga0307406_103257761 | 248 |
| 449 | 3300032002 | Ga0307416_100786288 | Ga0307416_1007862881 | 248 |
| 450 | 3300032004 | Ga0307414_10284462 | Ga0307414_102844622 | 248 |
| 451 | 3300035083 | Ga0373926_0023452 | Ga0373926_0023452_507_1268 | 248 |
| 452 | 3300035171 | Ga0373946_0057326 | Ga0373946_0057326_451_1212 | 248 |
| 453 | 3300035692 | Ga0373935_0058415 | Ga0373935_0058415_986_1747 | 248 |
| 454 | 3300035695 | Ga0373927_0188718 | Ga0373927_0188718_350_1111 | 248 |
| 455 | 3300035695 | Ga0373927_0363302 | Ga0373927_0363302_177_926 | 248 |
| 456 | 3300035725 | Ga0373947_0108107 | Ga0373947_0108107_859_1620 | 248 |
| 457 | 3300036401 | Ga0373937_0165925 | Ga0373937_0165925_586_1347 | 248 |
| 458 | 3300036401 | Ga0373937_0714988 | Ga0373937_0714988_171_932 | 248 |
| 459 | 3300037068 | Ga0373925_0013015 | Ga0373925_0013015_5045_5806 | 248 |
| 460 | 3300037068 | Ga0373925_0216552 | Ga0373925_0216552_425_1186 | 248 |
| 461 | 3300037312 | Ga0395899_0124497 | Ga0395899_0124497_1080_1832 | 248 |
| 462 | 3300037418 | Ga0395900_0024386 | Ga0395900_0024386_2023_2775 | 248 |
| 463 | 3300037418 | Ga0395900_0803020 | Ga0395900_0803020_14_772 | 248 |
| 464 | 3300038443 | Ga0395901_0009263 | Ga0395901_0009263_6530_7282 | 248 |
| 465 | 3300038443 | Ga0395901_0767182 | Ga0395901_0767182_57_815 | 248 |
| 466 | 3300039437 | Ga0436365_0297513 | Ga0436365_0297513_229_990 | 248 |
| 467 | 3300039437 | Ga0436365_1057670 | Ga0436365_1057670_267_1028 | 248 |
| 468 | 3300039450 | Ga0436363_0651762 | Ga0436363_0651762_119_880 | 248 |
| 469 | 3300039453 | Ga0436362_0220226 | Ga0436362_0220226_494_1255 | 248 |
| 470 | 3300042993 | Ga0439440_0068646 | Ga0439440_0068646_41_799 | 248 |
| 471 | 3300044673 | Ga0453683_0017377 | Ga0453683_0017377_3159_3917 | 248 |
| 472 | 3300045976 | Ga0466967_0199815 | Ga0466967_0199815_807_1556 | 248 |
| 473 | 3300046454 | Ga0495592_0191067 | Ga0495592_0191067_343_1104 | 248 |
| 474 | 3300046533 | Ga0495640_0142197 | Ga0495640_0142197_195_956 | 248 |
| 475 | 3300046559 | Ga0495667_0143668 | Ga0495667_0143668_74_838 | 248 |
| 476 | 3300046642 | Ga0495634_0176246 | Ga0495634_0176246_448_1212 | 248 |
| 477 | 3300046663 | Ga0495635_0094506 | Ga0495635_0094506_419_1183 | 248 |
| 478 | 3300046678 | Ga0495599_0231768 | Ga0495599_0231768_98_859 | 248 |
| 479 | 3300046689 | Ga0495613_0317316 | Ga0495613_0317316_49_810 | 248 |
| 480 | 3300046692 | Ga0495671_0099852 | Ga0495671_0099852_246_1121 | 248 |
| 481 | 3300047445 | Ga0495677_0045265 | Ga0495677_0045265_725_1600 | 248 |
| 482 | 3300048907 | Ga0496104_0713763 | Ga0496104_0713763_105_854 | 248 |
| 483 | 3300048911 | Ga0496108_0545867 | Ga0496108_0545867_51_812 | 248 |
| 484 | 3300048917 | Ga0496114_0091496 | Ga0496114_0091496_1150_1899 | 248 |
| 485 | 3300049533 | Ga0501317_008493 | Ga0501317_008493_298_1056 | 248 |
| 486 | 3300049534 | Ga0501318_011075 | Ga0501318_011075_161_919 | 248 |
| 487 | 3300049537 | Ga0501321_005571 | Ga0501321_005571_394_1152 | 248 |
| 488 | 3300049571 | Ga0501034_0138934 | Ga0501034_0138934_520_1290 | 248 |
| 489 | 3300049572 | Ga0501036_0127330 | Ga0501036_0127330_151_909 | 248 |
| 490 | 3300049575 | Ga0501039_0021841 | Ga0501039_0021841_2416_3174 | 248 |
| 491 | 3300049576 | Ga0501040_0242757 | Ga0501040_0242757_192_950 | 248 |
| 492 | 3300049578 | Ga0501042_0340267 | Ga0501042_0340267_295_1059 | 248 |
| 493 | 3300049580 | Ga0501046_0114167 | Ga0501046_0114167_549_1307 | 248 |
| 494 | 3300049582 | Ga0501048_0032626 | Ga0501048_0032626_1229_1987 | 248 |
| 495 | 3300049582 | Ga0501048_0328501 | Ga0501048_0328501_296_1054 | 248 |
| 496 | 3300049589 | Ga0501073_0246179 | Ga0501073_0246179_264_1034 | 248 |
| 497 | 3300049589 | Ga0501073_0290283 | Ga0501073_0290283_241_999 | 248 |
| 498 | 3300049591 | Ga0501075_0002900 | Ga0501075_0002900_9598_10362 | 248 |
| 499 | 3300049591 | Ga0501075_0016035 | Ga0501075_0016035_3428_4186 | 248 |
| 500 | 3300049591 | Ga0501075_0571537 | Ga0501075_0571537_39_797 | 248 |
| 501 | 3300049592 | Ga0501076_0013335 | Ga0501076_0013335_1446_2210 | 248 |
| 502 | 3300049593 | Ga0501077_0020718 | Ga0501077_0020718_153_911 | 248 |
| 503 | 3300049741 | Ga0501079_0251304 | Ga0501079_0251304_497_1255 | 248 |
| 504 | 3300049741 | Ga0501079_0286054 | Ga0501079_0286054_378_1136 | 248 |
| 505 | 3300049742 | Ga0501080_0129125 | Ga0501080_0129125_127_891 | 248 |
| 506 | 3300049743 | Ga0501081_0294897 | Ga0501081_0294897_247_1005 | 248 |
| 507 | 3300049744 | Ga0501083_0149014 | Ga0501083_0149014_342_1100 | 248 |
| 508 | 3300049823 | Ga0501044_0174924 | Ga0501044_0174924_907_1677 | 248 |
| 509 | 3300050492 | nmdc:mga0yw44_23402_c1 | nmdc:mga0yw44_23402_c1_799_1695 | 248 |
| 510 | 3300050493 | nmdc:mga0k408_18460_c1 | nmdc:mga0k408_18460_c1_338_1084 | 248 |
| 511 | 3300050507 | nmdc:mga05p37_163993_c1 | nmdc:mga05p37_163993_c1_1291_2049 | 248 |
| 512 | 3300050507 | nmdc:mga05p37_16858_c1 | nmdc:mga05p37_16858_c1_1723_2481 | 248 |
| 513 | 3300050507 | nmdc:mga05p37_17862_c1 | nmdc:mga05p37_17862_c1_1762_2520 | 248 |
| 514 | 3300050507 | nmdc:mga05p37_231768_c1 | nmdc:mga05p37_231768_c1_544_1305 | 248 |
| 515 | 3300050507 | nmdc:mga05p37_40389_c1 | nmdc:mga05p37_40389_c1_1030_1788 | 248 |
| 516 | 3300050507 | nmdc:mga05p37_59858_c1 | nmdc:mga05p37_59858_c1_2231_3079 | 248 |
| 517 | 3300050508 | nmdc:mga09592_103701_c1 | nmdc:mga09592_103701_c1_930_1688 | 248 |
| 518 | 3300050508 | nmdc:mga09592_1636_c1 | nmdc:mga09592_1636_c1_11290_12048 | 248 |
| 519 | 3300050508 | nmdc:mga09592_201363_c1 | nmdc:mga09592_201363_c1_604_1362 | 248 |
| 520 | 3300050508 | nmdc:mga09592_213560_c1 | nmdc:mga09592_213560_c1_488_1246 | 248 |
| 521 | 3300050508 | nmdc:mga09592_274253_c1 | nmdc:mga09592_274253_c1_488_1336 | 248 |
| 522 | 3300050508 | nmdc:mga09592_54535_c1 | nmdc:mga09592_54535_c1_2500_3261 | 248 |
| 523 | 3300050508 | nmdc:mga09592_93745_c1 | nmdc:mga09592_93745_c1_923_1681 | 248 |
| 524 | 3300050509 | nmdc:mga0qj67_163453_c1 | nmdc:mga0qj67_163453_c1_685_1443 | 248 |
| 525 | 3300050509 | nmdc:mga0qj67_171275_c1 | nmdc:mga0qj67_171275_c1_598_1356 | 248 |
| 526 | 3300050509 | nmdc:mga0qj67_391859_c1 | nmdc:mga0qj67_391859_c1_78_953 | 248 |
| 527 | 3300050510 | nmdc:mga06r32_104218_c1 | nmdc:mga06r32_104218_c1_1370_2131 | 248 |
| 528 | 3300050510 | nmdc:mga06r32_157949_c1 | nmdc:mga06r32_157949_c1_517_1275 | 248 |
| 529 | 3300050510 | nmdc:mga06r32_231940_c1 | nmdc:mga06r32_231940_c1_591_1349 | 248 |
| 530 | 3300050510 | nmdc:mga06r32_274536_c1 | nmdc:mga06r32_274536_c1_844_1602 | 248 |
| 531 | 3300050510 | nmdc:mga06r32_652918_c1 | nmdc:mga06r32_652918_c1_12_770 | 248 |
| 532 | 3300050510 | nmdc:mga06r32_6565_c1 | nmdc:mga06r32_6565_c1_8842_9600 | 248 |
| 533 | 3300050510 | nmdc:mga06r32_706290_c1 | nmdc:mga06r32_706290_c1_50_808 | 248 |
| 534 | 3300050510 | nmdc:mga06r32_85194_c1 | nmdc:mga06r32_85194_c1_216_974 | 248 |
| 535 | 3300050510 | nmdc:mga06r32_92225_c1 | nmdc:mga06r32_92225_c1_1662_2438 | 248 |
| 536 | 3300050511 | nmdc:mga08y16_24463_c1 | nmdc:mga08y16_24463_c1_4307_5065 | 248 |
| 537 | 3300050511 | nmdc:mga08y16_307815_c1 | nmdc:mga08y16_307815_c1_814_1572 | 248 |
| 538 | 3300050511 | nmdc:mga08y16_334302_c1 | nmdc:mga08y16_334302_c1_74_832 | 248 |
| 539 | 3300050511 | nmdc:mga08y16_345251_c1 | nmdc:mga08y16_345251_c1_522_1277 | 248 |
| 540 | 3300050511 | nmdc:mga08y16_36541_c1 | nmdc:mga08y16_36541_c1_520_1269 | 248 |
| 541 | 3300050512 | nmdc:mga0n895_157936_c1 | nmdc:mga0n895_157936_c1_1312_2160 | 248 |
| 542 | 3300050512 | nmdc:mga0n895_37143_c1 | nmdc:mga0n895_37143_c1_3409_4167 | 248 |
| 543 | 3300050512 | nmdc:mga0n895_395792_c1 | nmdc:mga0n895_395792_c1_37_786 | 248 |
| 544 | 3300050515 | nmdc:mga0a205_195351_c1 | nmdc:mga0a205_195351_c1_1071_1832 | 248 |
| 545 | 3300050515 | nmdc:mga0a205_52331_c1 | nmdc:mga0a205_52331_c1_74_832 | 248 |
| 546 | 3300050515 | nmdc:mga0a205_61195_c1 | nmdc:mga0a205_61195_c1_583_1341 | 248 |
| 547 | 3300053077 | Ga0495601_0161501 | Ga0495601_0161501_371_1132 | 248 |
| 548 | 3300054114 | Ga0501084_0150306 | Ga0501084_0150306_841_1599 | 248 |
| 549 | 3300054114 | Ga0501084_0189071 | Ga0501084_0189071_131_895 | 248 |
| 550 | 3300059478 | Ga0587093_001576 | Ga0587093_001576_202_963 | 248 |
| 551 | 3300059490 | Ga0587066_000440 | Ga0587066_000440_202_963 | 248 |
| 552 | 3300059644 | Ga0587075_000381 | Ga0587075_000381_620_1381 | 248 |
| 553 | 3300059646 | Ga0587078_002060 | Ga0587078_002060_976_1737 | 248 |
| 554 | 3300060346 | Ga0587111_0000520 | Ga0587111_0000520_2865_3626 | 248 |
| 555 | 3300060353 | Ga0501082_0161732 | Ga0501082_0161732_970_1728 | 248 |
| 556 | 3300060353 | Ga0501082_0294225 | Ga0501082_0294225_199_957 | 248 |
| 557 | 3300060353 | Ga0501082_0497413 | Ga0501082_0497413_81_857 | 248 |
| 558 | 3300061734 | Ga0530510_0004611 | Ga0530510_0004611_1782_2540 | 248 |
| 559 | 3300061734 | Ga0530510_0011725 | Ga0530510_0011725_3937_4695 | 248 |
| 560 | 3300005290 | Ga0065712_10116098 | Ga0065712_101160981 | 249 |
| 561 | 3300005435 | Ga0070714_100269103 | Ga0070714_1002691031 | 249 |
| 562 | 3300005456 | Ga0070678_100065791 | Ga0070678_1000657912 | 249 |
| 563 | 3300005458 | Ga0070681_10014225 | Ga0070681_100142257 | 249 |
| 564 | 3300005530 | Ga0070679_100446100 | Ga0070679_1004461001 | 249 |
| 565 | 3300006051 | Ga0075364_10039545 | Ga0075364_100395451 | 249 |
| 566 | 3300006847 | Ga0075431_100059560 | Ga0075431_1000595603 | 249 |
| 567 | 3300035725 | Ga0373947_0078493 | Ga0373947_0078493_900_1835 | 249 |
| 568 | 3300048908 | Ga0496105_0026574 | Ga0496105_0026574_1293_2162 | 249 |
| 569 | 3300048909 | Ga0496106_0033663 | Ga0496106_0033663_2945_3814 | 249 |
| 570 | 3300048918 | Ga0496115_0078034 | Ga0496115_0078034_68_937 | 249 |
| 571 | 3300060353 | Ga0501082_0342397 | Ga0501082_0342397_236_1087 | 249 |
| 572 | 3300005353 | Ga0070669_100024245 | Ga0070669_1000242453 | 250 |
| 573 | 3300005434 | Ga0070709_10273446 | Ga0070709_102734461 | 250 |
| 574 | 3300005436 | Ga0070713_100245791 | Ga0070713_1002457912 | 250 |
| 575 | 3300005437 | Ga0070710_10071614 | Ga0070710_100716142 | 250 |
| 576 | 3300005437 | Ga0070710_10224710 | Ga0070710_102247102 | 250 |
| 577 | 3300005439 | Ga0070711_100197101 | Ga0070711_1001971012 | 250 |
| 578 | 3300006173 | Ga0070716_100066344 | Ga0070716_1000663443 | 250 |
| 579 | 3300006175 | Ga0070712_100131478 | Ga0070712_1001314783 | 250 |
| 580 | 3300025321 | Ga0207656_10043114 | Ga0207656_100431142 | 250 |
| 581 | 3300025898 | Ga0207692_10133398 | Ga0207692_101333982 | 250 |
| 582 | 3300025898 | Ga0207692_10223781 | Ga0207692_102237811 | 250 |
| 583 | 3300025915 | Ga0207693_10030988 | Ga0207693_100309884 | 250 |
| 584 | 3300025929 | Ga0207664_10120292 | Ga0207664_101202922 | 250 |
| 585 | 3300035170 | Ga0373943_0206150 | Ga0373943_0206150_129_1064 | 250 |
| 586 | 3300046537 | Ga0495598_0006275 | Ga0495598_0006275_1303_2178 | 250 |
| 587 | 3300046539 | Ga0495621_0089291 | Ga0495621_0089291_75_950 | 250 |
| 588 | 3300046664 | Ga0495659_0008947 | Ga0495659_0008947_92_967 | 250 |
| 589 | 3300046674 | Ga0495588_0008543 | Ga0495588_0008543_703_1578 | 250 |
| 590 | 3300047318 | Ga0495636_0025653 | Ga0495636_0025653_24_899 | 250 |
| 591 | 3300048090 | Ga0495615_0019320 | Ga0495615_0019320_210_1085 | 250 |
| 592 | 3300048914 | Ga0496111_0093464 | Ga0496111_0093464_659_1510 | 250 |
| 593 | 3300005356 | Ga0070674_100092455 | Ga0070674_1000924552 | 251 |
| 594 | 3300005435 | Ga0070714_100369054 | Ga0070714_1003690541 | 251 |
| 595 | 3300005440 | Ga0070705_100228448 | Ga0070705_1002284482 | 251 |
| 596 | 3300005937 | Ga0081455_10041502 | Ga0081455_100415023 | 251 |
| 597 | 3300006038 | Ga0075365_10029750 | Ga0075365_100297503 | 251 |
| 598 | 3300007788 | Ga0099795_10016588 | Ga0099795_100165881 | 251 |
| 599 | 3300010159 | Ga0099796_10001978 | Ga0099796_100019783 | 251 |
| 600 | 3300025936 | Ga0207670_10239140 | Ga0207670_102391402 | 251 |
| 601 | 3300026121 | Ga0207683_10011965 | Ga0207683_100119652 | 251 |
| 602 | 3300027512 | Ga0209179_1017893 | Ga0209179_10178932 | 251 |
| 603 | 3300031731 | Ga0307405_10405273 | Ga0307405_104052732 | 251 |
| 604 | 3300031911 | Ga0307412_10201176 | Ga0307412_102011762 | 251 |
| 605 | 3300046530 | Ga0495654_0148259 | Ga0495654_0148259_123_998 | 251 |
| 606 | 3300046684 | Ga0495669_0030566 | Ga0495669_0030566_646_1509 | 251 |
| 607 | 3300047323 | Ga0495683_0078567 | Ga0495683_0078567_55_930 | 251 |
| 608 | 3300049587 | Ga0501071_0180918 | Ga0501071_0180918_170_985 | 251 |
| 609 | 3300050489 | nmdc:mga03683_849_c1 | nmdc:mga03683_849_c1_1765_2532 | 251 |
| 610 | 3300005434 | Ga0070709_10354792 | Ga0070709_103547921 | 252 |
| 611 | 3300005467 | Ga0070706_100562057 | Ga0070706_1005620571 | 252 |
| 612 | 3300006173 | Ga0070716_100013860 | Ga0070716_1000138602 | 252 |
| 613 | 3300006175 | Ga0070712_100441496 | Ga0070712_1004414961 | 252 |
| 614 | 3300025905 | Ga0207685_10008557 | Ga0207685_100085571 | 252 |
| 615 | 3300025915 | Ga0207693_10185034 | Ga0207693_101850341 | 252 |
| 616 | 3300025928 | Ga0207700_10057126 | Ga0207700_100571261 | 252 |
| 617 | 3300025929 | Ga0207664_10241747 | Ga0207664_102417472 | 252 |
| 618 | 3300026035 | Ga0207703_10066404 | Ga0207703_100664042 | 252 |
| 619 | 3300026142 | Ga0207698_10025926 | Ga0207698_100259263 | 252 |
| 620 | 3300028800 | Ga0265338_10005513 | Ga0265338_100055138 | 252 |
| 621 | 3300031241 | Ga0265325_10041154 | Ga0265325_100411542 | 252 |
| 622 | 3300031247 | Ga0265340_10059854 | Ga0265340_100598542 | 252 |
| 623 | 3300031249 | Ga0265339_10000126 | Ga0265339_1000012631 | 252 |
| 624 | 3300031595 | Ga0265313_10000844 | Ga0265313_1000084430 | 252 |
| 625 | 3300033180 | Ga0307510_10030926 | Ga0307510_100309262 | 252 |
| 626 | 3300034957 | Ga0373938_0017284 | Ga0373938_0017284_370_1245 | 252 |
| 627 | 3300035088 | Ga0373940_0044257 | Ga0373940_0044257_120_995 | 252 |
| 628 | 3300035092 | Ga0373952_0016312 | Ga0373952_0016312_442_1317 | 252 |
| 629 | 3300035121 | Ga0373960_0049121 | Ga0373960_0049121_136_1011 | 252 |
| 630 | 3300035691 | Ga0373931_0009119 | Ga0373931_0009119_213_1088 | 252 |
| 631 | 3300046507 | Ga0495606_0076311 | Ga0495606_0076311_840_1715 | 252 |
| 632 | 3300046519 | Ga0495632_0092412 | Ga0495632_0092412_81_956 | 252 |
| 633 | 3300046533 | Ga0495640_0021159 | Ga0495640_0021159_3849_4703 | 252 |
| 634 | 3300047319 | Ga0495674_0458762 | Ga0495674_0458762_101_958 | 252 |
| 635 | 3300048904 | Ga0496101_0457919 | Ga0496101_0457919_31_894 | 252 |
| 636 | 3300048905 | Ga0496102_0491735 | Ga0496102_0491735_52_927 | 252 |
| 637 | 3300048906 | Ga0496103_0097114 | Ga0496103_0097114_178_1053 | 252 |
| 638 | 3300048908 | Ga0496105_0003838 | Ga0496105_0003838_5046_5921 | 252 |
| 639 | 3300048909 | Ga0496106_0060627 | Ga0496106_0060627_341_1216 | 252 |
| 640 | 3300048910 | Ga0496107_0025460 | Ga0496107_0025460_295_1170 | 252 |
| 641 | 3300048913 | Ga0496110_0017500 | Ga0496110_0017500_2675_3550 | 252 |
| 642 | 3300048915 | Ga0496112_0218245 | Ga0496112_0218245_846_1721 | 252 |
| 643 | 3300048917 | Ga0496114_0044873 | Ga0496114_0044873_1680_2555 | 252 |
| 644 | 3300049459 | Ga0495678_025380 | Ga0495678_025380_239_1114 | 252 |
| 645 | 3300005439 | Ga0070711_100374934 | Ga0070711_1003749341 | 253 |
| 646 | 3300005456 | Ga0070678_100026011 | Ga0070678_1000260112 | 253 |
| 647 | 3300005549 | Ga0070704_100411765 | Ga0070704_1004117651 | 253 |
| 648 | 3300006871 | Ga0075434_100142922 | Ga0075434_1001429222 | 253 |
| 649 | 3300009093 | Ga0105240_10077293 | Ga0105240_100772932 | 253 |
| 650 | 3300009094 | Ga0111539_10073530 | Ga0111539_100735301 | 253 |
| 651 | 3300009551 | Ga0105238_10190186 | Ga0105238_101901861 | 253 |
| 652 | 3300025913 | Ga0207695_10108109 | Ga0207695_101081092 | 253 |
| 653 | 3300025915 | Ga0207693_10097559 | Ga0207693_100975593 | 253 |
| 654 | 3300026121 | Ga0207683_10089105 | Ga0207683_100891053 | 253 |
| 655 | 3300027671 | Ga0209588_1014115 | Ga0209588_10141151 | 253 |
| 656 | 3300028379 | Ga0268266_10093765 | Ga0268266_100937652 | 253 |
| 657 | 3300031241 | Ga0265325_10001561 | Ga0265325_1000156110 | 253 |
| 658 | 3300031247 | Ga0265340_10024688 | Ga0265340_100246882 | 253 |
| 659 | 3300031247 | Ga0265340_10159963 | Ga0265340_101599631 | 253 |
| 660 | 3300035119 | Ga0373956_0025815 | Ga0373956_0025815_1443_2306 | 253 |
| 661 | 3300035695 | Ga0373927_0006706 | Ga0373927_0006706_1560_2354 | 253 |
| 662 | 3300035725 | Ga0373947_0022302 | Ga0373947_0022302_268_1128 | 253 |
| 663 | 3300035725 | Ga0373947_0099192 | Ga0373947_0099192_299_1093 | 253 |
| 664 | 3300037068 | Ga0373925_0334062 | Ga0373925_0334062_106_897 | 253 |
| 665 | 3300037853 | Ga0436364_0518856 | Ga0436364_0518856_1757_2617 | 253 |
| 666 | 3300039437 | Ga0436365_0316468 | Ga0436365_0316468_381_1241 | 253 |
| 667 | 3300039447 | Ga0436361_0261761 | Ga0436361_0261761_323_1183 | 253 |
| 668 | 3300046473 | Ga0495582_0136768 | Ga0495582_0136768_91_951 | 253 |
| 669 | 3300046475 | Ga0495639_0061050 | Ga0495639_0061050_665_1528 | 253 |
| 670 | 3300046517 | Ga0495630_0470612 | Ga0495630_0470612_47_907 | 253 |
| 671 | 3300046533 | Ga0495640_0079911 | Ga0495640_0079911_986_1846 | 253 |
| 672 | 3300046535 | Ga0495586_0276195 | Ga0495586_0276195_69_932 | 253 |
| 673 | 3300046642 | Ga0495634_0222471 | Ga0495634_0222471_237_1097 | 253 |
| 674 | 3300046683 | Ga0495658_0018990 | Ga0495658_0018990_309_1172 | 253 |
| 675 | 3300046683 | Ga0495658_0308146 | Ga0495658_0308146_37_963 | 253 |
| 676 | 3300048907 | Ga0496104_0018833 | Ga0496104_0018833_3258_4118 | 253 |
| 677 | 3300048917 | Ga0496114_0060123 | Ga0496114_0060123_2332_3141 | 253 |
| 678 | 3300048918 | Ga0496115_0087655 | Ga0496115_0087655_1640_2500 | 253 |
| 679 | 3300050511 | nmdc:mga08y16_26204_c1 | nmdc:mga08y16_26204_c1_2830_3693 | 253 |
| 680 | 3300050512 | nmdc:mga0n895_60709_c1 | nmdc:mga0n895_60709_c1_220_1083 | 253 |
| 681 | 3300050515 | nmdc:mga0a205_358959_c1 | nmdc:mga0a205_358959_c1_390_1253 | 253 |
| 682 | 3300053077 | Ga0495601_0272536 | Ga0495601_0272536_118_978 | 253 |
| 683 | 3300053085 | Ga0495619_0078338 | Ga0495619_0078338_758_1618 | 253 |
| 684 | 3300003215 | JGI25153J46596_10000660 | JGI25153J46596_1000066012 | 254 |
| 685 | 3300003659 | JGI25404J52841_10004319 | JGI25404J52841_100043194 | 254 |
| 686 | 3300005334 | Ga0068869_100149941 | Ga0068869_1001499412 | 254 |
| 687 | 3300005336 | Ga0070680_100012393 | Ga0070680_1000123933 | 254 |
| 688 | 3300005337 | Ga0070682_100130458 | Ga0070682_1001304582 | 254 |
| 689 | 3300005341 | Ga0070691_10095973 | Ga0070691_100959731 | 254 |
| 690 | 3300005347 | Ga0070668_100264719 | Ga0070668_1002647192 | 254 |
| 691 | 3300005347 | Ga0070668_100592314 | Ga0070668_1005923141 | 254 |
| 692 | 3300005353 | Ga0070669_100052634 | Ga0070669_1000526341 | 254 |
| 693 | 3300005355 | Ga0070671_100198355 | Ga0070671_1001983551 | 254 |
| 694 | 3300005355 | Ga0070671_100227976 | Ga0070671_1002279762 | 254 |
| 695 | 3300005355 | Ga0070671_100421928 | Ga0070671_1004219281 | 254 |
| 696 | 3300005356 | Ga0070674_100069463 | Ga0070674_1000694632 | 254 |
| 697 | 3300005356 | Ga0070674_100184044 | Ga0070674_1001840441 | 254 |
| 698 | 3300005406 | Ga0070703_10062311 | Ga0070703_100623111 | 254 |
| 699 | 3300005434 | Ga0070709_10027715 | Ga0070709_100277152 | 254 |
| 700 | 3300005434 | Ga0070709_10028128 | Ga0070709_100281283 | 254 |
| 701 | 3300005436 | Ga0070713_100447612 | Ga0070713_1004476121 | 254 |
| 702 | 3300005437 | Ga0070710_10151469 | Ga0070710_101514691 | 254 |
| 703 | 3300005438 | Ga0070701_10123940 | Ga0070701_101239402 | 254 |
| 704 | 3300005439 | Ga0070711_100285425 | Ga0070711_1002854252 | 254 |
| 705 | 3300005440 | Ga0070705_100238846 | Ga0070705_1002388461 | 254 |
| 706 | 3300005444 | Ga0070694_100375942 | Ga0070694_1003759422 | 254 |
| 707 | 3300005444 | Ga0070694_100423221 | Ga0070694_1004232211 | 254 |
| 708 | 3300005455 | Ga0070663_100003746 | Ga0070663_1000037464 | 254 |
| 709 | 3300005455 | Ga0070663_100131359 | Ga0070663_1001313591 | 254 |
| 710 | 3300005455 | Ga0070663_100171937 | Ga0070663_1001719372 | 254 |
| 711 | 3300005458 | Ga0070681_10015634 | Ga0070681_100156346 | 254 |
| 712 | 3300005466 | Ga0070685_10156714 | Ga0070685_101567141 | 254 |
| 713 | 3300005518 | Ga0070699_100152525 | Ga0070699_1001525251 | 254 |
| 714 | 3300005535 | Ga0070684_100174935 | Ga0070684_1001749353 | 254 |
| 715 | 3300005539 | Ga0068853_100009933 | Ga0068853_1000099333 | 254 |
| 716 | 3300005545 | Ga0070695_100032790 | Ga0070695_1000327903 | 254 |
| 717 | 3300005545 | Ga0070695_100364046 | Ga0070695_1003640461 | 254 |
| 718 | 3300005547 | Ga0070693_100046413 | Ga0070693_1000464132 | 254 |
| 719 | 3300005547 | Ga0070693_100213790 | Ga0070693_1002137901 | 254 |
| 720 | 3300005563 | Ga0068855_100345913 | Ga0068855_1003459132 | 254 |
| 721 | 3300005563 | Ga0068855_100735858 | Ga0068855_1007358581 | 254 |
| 722 | 3300005577 | Ga0068857_100021961 | Ga0068857_1000219614 | 254 |
| 723 | 3300005578 | Ga0068854_100167695 | Ga0068854_1001676951 | 254 |
| 724 | 3300005614 | Ga0068856_100222275 | Ga0068856_1002222753 | 254 |
| 725 | 3300005616 | Ga0068852_100406863 | Ga0068852_1004068631 | 254 |
| 726 | 3300005616 | Ga0068852_100426777 | Ga0068852_1004267772 | 254 |
| 727 | 3300005617 | Ga0068859_100548623 | Ga0068859_1005486232 | 254 |
| 728 | 3300005618 | Ga0068864_100038231 | Ga0068864_1000382315 | 254 |
| 729 | 3300005718 | Ga0068866_10108439 | Ga0068866_101084391 | 254 |
| 730 | 3300005719 | Ga0068861_100345905 | Ga0068861_1003459051 | 254 |
| 731 | 3300005842 | Ga0068858_100250949 | Ga0068858_1002509492 | 254 |
| 732 | 3300005937 | Ga0081455_10006568 | Ga0081455_1000656812 | 254 |
| 733 | 3300005983 | Ga0081540_1003181 | Ga0081540_10031816 | 254 |
| 734 | 3300005983 | Ga0081540_1005915 | Ga0081540_100591510 | 254 |
| 735 | 3300005983 | Ga0081540_1009489 | Ga0081540_10094892 | 254 |
| 736 | 3300005983 | Ga0081540_1023383 | Ga0081540_10233834 | 254 |
| 737 | 3300005983 | Ga0081540_1072176 | Ga0081540_10721762 | 254 |
| 738 | 3300005985 | Ga0081539_10049231 | Ga0081539_100492312 | 254 |
| 739 | 3300006028 | Ga0070717_10285474 | Ga0070717_102854741 | 254 |
| 740 | 3300006038 | Ga0075365_10007763 | Ga0075365_100077635 | 254 |
| 741 | 3300006038 | Ga0075365_10232165 | Ga0075365_102321652 | 254 |
| 742 | 3300006042 | Ga0075368_10018756 | Ga0075368_100187562 | 254 |
| 743 | 3300006048 | Ga0075363_100002080 | Ga0075363_1000020805 | 254 |
| 744 | 3300006175 | Ga0070712_100017121 | Ga0070712_1000171214 | 254 |
| 745 | 3300006178 | Ga0075367_10045916 | Ga0075367_100459164 | 254 |
| 746 | 3300006353 | Ga0075370_10065259 | Ga0075370_100652591 | 254 |
| 747 | 3300006358 | Ga0068871_100239522 | Ga0068871_1002395221 | 254 |
| 748 | 3300006844 | Ga0075428_100075095 | Ga0075428_1000750951 | 254 |
| 749 | 3300006844 | Ga0075428_100184999 | Ga0075428_1001849991 | 254 |
| 750 | 3300006844 | Ga0075428_100207317 | Ga0075428_1002073172 | 254 |
| 751 | 3300006847 | Ga0075431_100093943 | Ga0075431_1000939431 | 254 |
| 752 | 3300006852 | Ga0075433_10233632 | Ga0075433_102336322 | 254 |
| 753 | 3300006852 | Ga0075433_10239031 | Ga0075433_102390311 | 254 |
| 754 | 3300006871 | Ga0075434_100003432 | Ga0075434_1000034321 | 254 |
| 755 | 3300006871 | Ga0075434_100079291 | Ga0075434_1000792912 | 254 |
| 756 | 3300006881 | Ga0068865_100109719 | Ga0068865_1001097192 | 254 |
| 757 | 3300006881 | Ga0068865_100299010 | Ga0068865_1002990101 | 254 |
| 758 | 3300006914 | Ga0075436_100273145 | Ga0075436_1002731451 | 254 |
| 759 | 3300006931 | Ga0097620_100548622 | Ga0097620_1005486222 | 254 |
| 760 | 3300007265 | Ga0099794_10004782 | Ga0099794_100047824 | 254 |
| 761 | 3300009094 | Ga0111539_10252629 | Ga0111539_102526292 | 254 |
| 762 | 3300009094 | Ga0111539_10344374 | Ga0111539_103443742 | 254 |
| 763 | 3300009094 | Ga0111539_10736348 | Ga0111539_107363481 | 254 |
| 764 | 3300009147 | Ga0114129_10006147 | Ga0114129_100061471 | 254 |
| 765 | 3300009147 | Ga0114129_10405755 | Ga0114129_104057552 | 254 |
| 766 | 3300009148 | Ga0105243_10365124 | Ga0105243_103651241 | 254 |
| 767 | 3300009176 | Ga0105242_10062722 | Ga0105242_100627222 | 254 |
| 768 | 3300009177 | Ga0105248_10045067 | Ga0105248_100450672 | 254 |
| 769 | 3300009177 | Ga0105248_10526754 | Ga0105248_105267541 | 254 |
| 770 | 3300009545 | Ga0105237_10274718 | Ga0105237_102747183 | 254 |
| 771 | 3300009545 | Ga0105237_10633181 | Ga0105237_106331811 | 254 |
| 772 | 3300009551 | Ga0105238_10362786 | Ga0105238_103627862 | 254 |
| 773 | 3300009553 | Ga0105249_10876774 | Ga0105249_108767741 | 254 |
| 774 | 3300010159 | Ga0099796_10032242 | Ga0099796_100322422 | 254 |
| 775 | 3300011119 | Ga0105246_10022952 | Ga0105246_100229521 | 254 |
| 776 | 3300011119 | Ga0105246_10091653 | Ga0105246_100916533 | 254 |
| 777 | 3300013296 | Ga0157374_10023559 | Ga0157374_100235597 | 254 |
| 778 | 3300013296 | Ga0157374_10171265 | Ga0157374_101712652 | 254 |
| 779 | 3300013297 | Ga0157378_10001940 | Ga0157378_100019408 | 254 |
| 780 | 3300013297 | Ga0157378_10092125 | Ga0157378_100921251 | 254 |
| 781 | 3300013297 | Ga0157378_10177848 | Ga0157378_101778482 | 254 |
| 782 | 3300013306 | Ga0163162_10213580 | Ga0163162_102135803 | 254 |
| 783 | 3300013306 | Ga0163162_10330755 | Ga0163162_103307552 | 254 |
| 784 | 3300013308 | Ga0157375_10307361 | Ga0157375_103073611 | 254 |
| 785 | 3300014325 | Ga0163163_10053277 | Ga0163163_100532772 | 254 |
| 786 | 3300014325 | Ga0163163_10407568 | Ga0163163_104075681 | 254 |
| 787 | 3300014325 | Ga0163163_10474655 | Ga0163163_104746552 | 254 |
| 788 | 3300014497 | Ga0182008_10154516 | Ga0182008_101545161 | 254 |
| 789 | 3300014968 | Ga0157379_10006693 | Ga0157379_100066936 | 254 |
| 790 | 3300014968 | Ga0157379_10209695 | Ga0157379_102096951 | 254 |
| 791 | 3300014968 | Ga0157379_10252556 | Ga0157379_102525561 | 254 |
| 792 | 3300014969 | Ga0157376_10342880 | Ga0157376_103428802 | 254 |
| 793 | 3300017792 | Ga0163161_10543954 | Ga0163161_105439541 | 254 |
| 794 | 3300021384 | Ga0213876_10034704 | Ga0213876_100347041 | 254 |
| 795 | 3300021388 | Ga0213875_10000009 | Ga0213875_10000009147 | 254 |
| 796 | 3300025297 | Ga0209758_1000772 | Ga0209758_100077219 | 254 |
| 797 | 3300025885 | Ga0207653_10039405 | Ga0207653_100394053 | 254 |
| 798 | 3300025893 | Ga0207682_10099526 | Ga0207682_100995261 | 254 |
| 799 | 3300025898 | Ga0207692_10147891 | Ga0207692_101478912 | 254 |
| 800 | 3300025898 | Ga0207692_10183182 | Ga0207692_101831821 | 254 |
| 801 | 3300025901 | Ga0207688_10159357 | Ga0207688_101593572 | 254 |
| 802 | 3300025905 | Ga0207685_10065834 | Ga0207685_100658341 | 254 |
| 803 | 3300025906 | Ga0207699_10047550 | Ga0207699_100475503 | 254 |
| 804 | 3300025910 | Ga0207684_10040262 | Ga0207684_100402625 | 254 |
| 805 | 3300025911 | Ga0207654_10237492 | Ga0207654_102374922 | 254 |
| 806 | 3300025912 | Ga0207707_10000826 | Ga0207707_1000082611 | 254 |
| 807 | 3300025915 | Ga0207693_10015489 | Ga0207693_100154899 | 254 |
| 808 | 3300025915 | Ga0207693_10035034 | Ga0207693_100350342 | 254 |
| 809 | 3300025916 | Ga0207663_10106228 | Ga0207663_101062281 | 254 |
| 810 | 3300025916 | Ga0207663_10127861 | Ga0207663_101278611 | 254 |
| 811 | 3300025916 | Ga0207663_10390693 | Ga0207663_103906931 | 254 |
| 812 | 3300025917 | Ga0207660_10006793 | Ga0207660_100067933 | 254 |
| 813 | 3300025921 | Ga0207652_10139669 | Ga0207652_101396693 | 254 |
| 814 | 3300025922 | Ga0207646_10461763 | Ga0207646_104617631 | 254 |
| 815 | 3300025925 | Ga0207650_10223482 | Ga0207650_102234821 | 254 |
| 816 | 3300025926 | Ga0207659_10129719 | Ga0207659_101297192 | 254 |
| 817 | 3300025928 | Ga0207700_10306219 | Ga0207700_103062191 | 254 |
| 818 | 3300025929 | Ga0207664_10040534 | Ga0207664_100405342 | 254 |
| 819 | 3300025929 | Ga0207664_10127460 | Ga0207664_101274602 | 254 |
| 820 | 3300025931 | Ga0207644_10116157 | Ga0207644_101161572 | 254 |
| 821 | 3300025931 | Ga0207644_10247275 | Ga0207644_102472751 | 254 |
| 822 | 3300025931 | Ga0207644_10407824 | Ga0207644_104078241 | 254 |
| 823 | 3300025934 | Ga0207686_10218201 | Ga0207686_102182011 | 254 |
| 824 | 3300025938 | Ga0207704_10030866 | Ga0207704_100308663 | 254 |
| 825 | 3300025938 | Ga0207704_10068732 | Ga0207704_100687322 | 254 |
| 826 | 3300025939 | Ga0207665_10041256 | Ga0207665_100412562 | 254 |
| 827 | 3300025940 | Ga0207691_10148033 | Ga0207691_101480332 | 254 |
| 828 | 3300025940 | Ga0207691_10153588 | Ga0207691_101535882 | 254 |
| 829 | 3300025941 | Ga0207711_10020274 | Ga0207711_100202745 | 254 |
| 830 | 3300025942 | Ga0207689_10065447 | Ga0207689_100654473 | 254 |
| 831 | 3300025949 | Ga0207667_10389928 | Ga0207667_103899282 | 254 |
| 832 | 3300025972 | Ga0207668_10159755 | Ga0207668_101597552 | 254 |
| 833 | 3300025972 | Ga0207668_10570888 | Ga0207668_105708881 | 254 |
| 834 | 3300026035 | Ga0207703_10059696 | Ga0207703_100596962 | 254 |
| 835 | 3300026041 | Ga0207639_10013284 | Ga0207639_100132842 | 254 |
| 836 | 3300026067 | Ga0207678_10022356 | Ga0207678_100223564 | 254 |
| 837 | 3300026067 | Ga0207678_10023373 | Ga0207678_100233736 | 254 |
| 838 | 3300026067 | Ga0207678_10061720 | Ga0207678_100617203 | 254 |
| 839 | 3300026075 | Ga0207708_10059185 | Ga0207708_100591851 | 254 |
| 840 | 3300026075 | Ga0207708_10080554 | Ga0207708_100805543 | 254 |
| 841 | 3300026095 | Ga0207676_10241401 | Ga0207676_102414011 | 254 |
| 842 | 3300026116 | Ga0207674_10029348 | Ga0207674_100293483 | 254 |
| 843 | 3300026118 | Ga0207675_100174232 | Ga0207675_1001742321 | 254 |
| 844 | 3300026118 | Ga0207675_100358227 | Ga0207675_1003582271 | 254 |
| 845 | 3300026118 | Ga0207675_100491048 | Ga0207675_1004910481 | 254 |
| 846 | 3300026142 | Ga0207698_10218050 | Ga0207698_102180501 | 254 |
| 847 | 3300026142 | Ga0207698_10239002 | Ga0207698_102390022 | 254 |
| 848 | 3300027671 | Ga0209588_1010243 | Ga0209588_10102435 | 254 |
| 849 | 3300027866 | Ga0209813_10037515 | Ga0209813_100375151 | 254 |
| 850 | 3300028379 | Ga0268266_10008924 | Ga0268266_100089245 | 254 |
| 851 | 3300028379 | Ga0268266_10386239 | Ga0268266_103862391 | 254 |
| 852 | 3300028379 | Ga0268266_10551608 | Ga0268266_105516081 | 254 |
| 853 | 3300028573 | Ga0265334_10052047 | Ga0265334_100520472 | 254 |
| 854 | 3300030763 | Ga0265763_1000743 | Ga0265763_10007431 | 254 |
| 855 | 3300031018 | Ga0265773_1000831 | Ga0265773_10008311 | 254 |
| 856 | 3300031241 | Ga0265325_10092934 | Ga0265325_100929341 | 254 |
| 857 | 3300031249 | Ga0265339_10032717 | Ga0265339_100327172 | 254 |
| 858 | 3300031250 | Ga0265331_10110721 | Ga0265331_101107211 | 254 |
| 859 | 3300031711 | Ga0265314_10191221 | Ga0265314_101912212 | 254 |
| 860 | 3300031712 | Ga0265342_10011621 | Ga0265342_100116215 | 254 |
| 861 | 3300031852 | Ga0307410_10328407 | Ga0307410_103284072 | 254 |
| 862 | 3300034816 | Ga0373930_0009760 | Ga0373930_0009760_761_1636 | 254 |
| 863 | 3300034819 | Ga0373958_0014116 | Ga0373958_0014116_53_928 | 254 |
| 864 | 3300034820 | Ga0373959_0002069 | Ga0373959_0002069_1929_2804 | 254 |
| 865 | 3300034820 | Ga0373959_0010829 | Ga0373959_0010829_167_1042 | 254 |
| 866 | 3300034957 | Ga0373938_0003206 | Ga0373938_0003206_1087_1962 | 254 |
| 867 | 3300035088 | Ga0373940_0024313 | Ga0373940_0024313_548_1423 | 254 |
| 868 | 3300035089 | Ga0373944_0091453 | Ga0373944_0091453_27_902 | 254 |
| 869 | 3300035091 | Ga0373951_0036107 | Ga0373951_0036107_42_917 | 254 |
| 870 | 3300035111 | Ga0373923_0060800 | Ga0373923_0060800_43_855 | 254 |
| 871 | 3300035113 | Ga0373936_0047359 | Ga0373936_0047359_599_1474 | 254 |
| 872 | 3300035115 | Ga0373941_0083401 | Ga0373941_0083401_100_975 | 254 |
| 873 | 3300035116 | Ga0373945_0075529 | Ga0373945_0075529_127_1002 | 254 |
| 874 | 3300035117 | Ga0373953_0075244 | Ga0373953_0075244_513_1325 | 254 |
| 875 | 3300035118 | Ga0373954_0006655 | Ga0373954_0006655_822_1634 | 254 |
| 876 | 3300035119 | Ga0373956_0042926 | Ga0373956_0042926_158_970 | 254 |
| 877 | 3300035121 | Ga0373960_0006938 | Ga0373960_0006938_173_1048 | 254 |
| 878 | 3300035121 | Ga0373960_0028381 | Ga0373960_0028381_536_1411 | 254 |
| 879 | 3300035121 | Ga0373960_0050417 | Ga0373960_0050417_300_1175 | 254 |
| 880 | 3300035172 | Ga0373955_0068572 | Ga0373955_0068572_850_1725 | 254 |
| 881 | 3300035241 | Ga0373961_0014464 | Ga0373961_0014464_118_993 | 254 |
| 882 | 3300035410 | Ga0373924_0037176 | Ga0373924_0037176_181_993 | 254 |
| 883 | 3300035692 | Ga0373935_0037806 | Ga0373935_0037806_1277_2089 | 254 |
| 884 | 3300035692 | Ga0373935_0569430 | Ga0373935_0569430_19_783 | 254 |
| 885 | 3300035695 | Ga0373927_0168063 | Ga0373927_0168063_341_1216 | 254 |
| 886 | 3300035724 | Ga0373933_0177325 | Ga0373933_0177325_46_921 | 254 |
| 887 | 3300035725 | Ga0373947_0007231 | Ga0373947_0007231_3772_4584 | 254 |
| 888 | 3300035725 | Ga0373947_0045158 | Ga0373947_0045158_530_1405 | 254 |
| 889 | 3300036401 | Ga0373937_0091262 | Ga0373937_0091262_1599_2411 | 254 |
| 890 | 3300036401 | Ga0373937_0244830 | Ga0373937_0244830_278_1153 | 254 |
| 891 | 3300036459 | Ga0372808_016532 | Ga0372808_016532_159_1034 | 254 |
| 892 | 3300037068 | Ga0373925_0044707 | Ga0373925_0044707_1441_2352 | 254 |
| 893 | 3300037853 | Ga0436364_0174146 | Ga0436364_0174146_34911_35786 | 254 |
| 894 | 3300039437 | Ga0436365_0502355 | Ga0436365_0502355_1174_2151 | 254 |
| 895 | 3300039437 | Ga0436365_0536902 | Ga0436365_0536902_4786_5661 | 254 |
| 896 | 3300039437 | Ga0436365_1534158 | Ga0436365_1534158_61_852 | 254 |
| 897 | 3300039438 | Ga0436360_0736047 | Ga0436360_0736047_62_982 | 254 |
| 898 | 3300041451 | Ga0451791_1395462 | Ga0451791_1395462_14_889 | 254 |
| 899 | 3300042461 | Ga0439460_0027138 | Ga0439460_0027138_205_1038 | 254 |
| 900 | 3300044694 | Ga0466963_0137965 | Ga0466963_0137965_197_1069 | 254 |
| 901 | 3300045049 | Ga0466959_0276615 | Ga0466959_0276615_264_1139 | 254 |
| 902 | 3300045976 | Ga0466967_0025189 | Ga0466967_0025189_1308_2180 | 254 |
| 903 | 3300046453 | Ga0495627_050764 | Ga0495627_050764_64_939 | 254 |
| 904 | 3300046455 | Ga0495603_0026171 | Ga0495603_0026171_959_1834 | 254 |
| 905 | 3300046455 | Ga0495603_0165408 | Ga0495603_0165408_228_1109 | 254 |
| 906 | 3300046471 | Ga0495650_0089444 | Ga0495650_0089444_126_1001 | 254 |
| 907 | 3300046472 | Ga0495580_0379804 | Ga0495580_0379804_138_941 | 254 |
| 908 | 3300046474 | Ga0495605_0032275 | Ga0495605_0032275_737_1612 | 254 |
| 909 | 3300046474 | Ga0495605_0154621 | Ga0495605_0154621_28_903 | 254 |
| 910 | 3300046475 | Ga0495639_0027441 | Ga0495639_0027441_366_1178 | 254 |
| 911 | 3300046477 | Ga0495664_0099885 | Ga0495664_0099885_411_1223 | 254 |
| 912 | 3300046492 | Ga0495585_0031747 | Ga0495585_0031747_230_1042 | 254 |
| 913 | 3300046492 | Ga0495585_0141051 | Ga0495585_0141051_160_1035 | 254 |
| 914 | 3300046499 | Ga0495594_0201253 | Ga0495594_0201253_196_1071 | 254 |
| 915 | 3300046500 | Ga0495596_0042107 | Ga0495596_0042107_623_1498 | 254 |
| 916 | 3300046513 | Ga0495616_0104194 | Ga0495616_0104194_185_1060 | 254 |
| 917 | 3300046514 | Ga0495618_0029155 | Ga0495618_0029155_268_1080 | 254 |
| 918 | 3300046517 | Ga0495630_0052129 | Ga0495630_0052129_1929_2804 | 254 |
| 919 | 3300046517 | Ga0495630_0164878 | Ga0495630_0164878_448_1260 | 254 |
| 920 | 3300046517 | Ga0495630_0446629 | Ga0495630_0446629_103_978 | 254 |
| 921 | 3300046519 | Ga0495632_0122309 | Ga0495632_0122309_232_1107 | 254 |
| 922 | 3300046520 | Ga0495637_0110886 | Ga0495637_0110886_63_938 | 254 |
| 923 | 3300046526 | Ga0495666_0121148 | Ga0495666_0121148_10_885 | 254 |
| 924 | 3300046531 | Ga0495665_0031706 | Ga0495665_0031706_1015_1827 | 254 |
| 925 | 3300046533 | Ga0495640_0118297 | Ga0495640_0118297_162_974 | 254 |
| 926 | 3300046537 | Ga0495598_0040224 | Ga0495598_0040224_199_1074 | 254 |
| 927 | 3300046558 | Ga0495633_0141254 | Ga0495633_0141254_36_911 | 254 |
| 928 | 3300046559 | Ga0495667_0171686 | Ga0495667_0171686_283_1095 | 254 |
| 929 | 3300046616 | Ga0495668_0228320 | Ga0495668_0228320_28_903 | 254 |
| 930 | 3300046663 | Ga0495635_0047055 | Ga0495635_0047055_1119_1931 | 254 |
| 931 | 3300046663 | Ga0495635_0113006 | Ga0495635_0113006_1012_1824 | 254 |
| 932 | 3300046664 | Ga0495659_0144296 | Ga0495659_0144296_12_872 | 254 |
| 933 | 3300046689 | Ga0495613_0099585 | Ga0495613_0099585_715_1527 | 254 |
| 934 | 3300046689 | Ga0495613_0110784 | Ga0495613_0110784_771_1646 | 254 |
| 935 | 3300046690 | Ga0495624_0377068 | Ga0495624_0377068_16_780 | 254 |
| 936 | 3300046691 | Ga0495670_0223965 | Ga0495670_0223965_22_834 | 254 |
| 937 | 3300046794 | Ga0495589_0166944 | Ga0495589_0166944_86_961 | 254 |
| 938 | 3300047317 | Ga0495604_0225285 | Ga0495604_0225285_363_1238 | 254 |
| 939 | 3300047319 | Ga0495674_0092387 | Ga0495674_0092387_580_1392 | 254 |
| 940 | 3300047320 | Ga0495672_0137765 | Ga0495672_0137765_198_1085 | 254 |
| 941 | 3300047321 | Ga0495676_0297060 | Ga0495676_0297060_196_1008 | 254 |
| 942 | 3300047471 | Ga0495684_0056398 | Ga0495684_0056398_1213_2025 | 254 |
| 943 | 3300047471 | Ga0495684_0139669 | Ga0495684_0139669_39_914 | 254 |
| 944 | 3300047673 | Ga0495593_0044108 | Ga0495593_0044108_1538_2350 | 254 |
| 945 | 3300048089 | Ga0495614_0129833 | Ga0495614_0129833_281_1084 | 254 |
| 946 | 3300048091 | Ga0495626_0146195 | Ga0495626_0146195_22_897 | 254 |
| 947 | 3300048903 | Ga0496100_0005415 | Ga0496100_0005415_3162_4037 | 254 |
| 948 | 3300048903 | Ga0496100_0016994 | Ga0496100_0016994_3204_4079 | 254 |
| 949 | 3300048904 | Ga0496101_0002908 | Ga0496101_0002908_9423_10298 | 254 |
| 950 | 3300048905 | Ga0496102_0034692 | Ga0496102_0034692_653_1528 | 254 |
| 951 | 3300048905 | Ga0496102_0176027 | Ga0496102_0176027_268_1143 | 254 |
| 952 | 3300048905 | Ga0496102_0288922 | Ga0496102_0288922_352_1227 | 254 |
| 953 | 3300048906 | Ga0496103_0104527 | Ga0496103_0104527_334_1209 | 254 |
| 954 | 3300048907 | Ga0496104_0000406 | Ga0496104_0000406_11783_12712 | 254 |
| 955 | 3300048907 | Ga0496104_0011780 | Ga0496104_0011780_4975_5850 | 254 |
| 956 | 3300048907 | Ga0496104_0046997 | Ga0496104_0046997_3232_4044 | 254 |
| 957 | 3300048907 | Ga0496104_0118048 | Ga0496104_0118048_1313_2188 | 254 |
| 958 | 3300048908 | Ga0496105_0006511 | Ga0496105_0006511_68_943 | 254 |
| 959 | 3300048908 | Ga0496105_0045525 | Ga0496105_0045525_687_1616 | 254 |
| 960 | 3300048908 | Ga0496105_0153463 | Ga0496105_0153463_507_1382 | 254 |
| 961 | 3300048908 | Ga0496105_0269211 | Ga0496105_0269211_233_1105 | 254 |
| 962 | 3300048909 | Ga0496106_0009563 | Ga0496106_0009563_221_1096 | 254 |
| 963 | 3300048909 | Ga0496106_0025869 | Ga0496106_0025869_2780_3655 | 254 |
| 964 | 3300048910 | Ga0496107_0065981 | Ga0496107_0065981_100_972 | 254 |
| 965 | 3300048910 | Ga0496107_0069604 | Ga0496107_0069604_101_976 | 254 |
| 966 | 3300048910 | Ga0496107_0198228 | Ga0496107_0198228_328_1203 | 254 |
| 967 | 3300048911 | Ga0496108_0121307 | Ga0496108_0121307_358_1233 | 254 |
| 968 | 3300048911 | Ga0496108_0266269 | Ga0496108_0266269_417_1292 | 254 |
| 969 | 3300048912 | Ga0496109_0028898 | Ga0496109_0028898_1003_1878 | 254 |
| 970 | 3300048912 | Ga0496109_0386913 | Ga0496109_0386913_397_1272 | 254 |
| 971 | 3300048913 | Ga0496110_0011457 | Ga0496110_0011457_632_1507 | 254 |
| 972 | 3300048913 | Ga0496110_0017778 | Ga0496110_0017778_941_1816 | 254 |
| 973 | 3300048913 | Ga0496110_0043652 | Ga0496110_0043652_2831_3706 | 254 |
| 974 | 3300048914 | Ga0496111_0188218 | Ga0496111_0188218_511_1386 | 254 |
| 975 | 3300048915 | Ga0496112_0018293 | Ga0496112_0018293_575_1450 | 254 |
| 976 | 3300048915 | Ga0496112_0086701 | Ga0496112_0086701_1868_2743 | 254 |
| 977 | 3300048915 | Ga0496112_0567934 | Ga0496112_0567934_45_920 | 254 |
| 978 | 3300048916 | Ga0496113_0080132 | Ga0496113_0080132_1710_2474 | 254 |
| 979 | 3300048917 | Ga0496114_0002985 | Ga0496114_0002985_170_1045 | 254 |
| 980 | 3300048917 | Ga0496114_0568657 | Ga0496114_0568657_25_930 | 254 |
| 981 | 3300048918 | Ga0496115_0019674 | Ga0496115_0019674_1457_2332 | 254 |
| 982 | 3300048918 | Ga0496115_0032525 | Ga0496115_0032525_561_1445 | 254 |
| 983 | 3300048918 | Ga0496115_0082880 | Ga0496115_0082880_1345_2220 | 254 |
| 984 | 3300048921 | Ga0496118_0242857 | Ga0496118_0242857_33_920 | 254 |
| 985 | 3300048924 | Ga0496121_0023126 | Ga0496121_0023126_2862_3746 | 254 |
| 986 | 3300048924 | Ga0496121_0051252 | Ga0496121_0051252_1481_2356 | 254 |
| 987 | 3300048929 | Ga0496126_0017149 | Ga0496126_0017149_2055_2939 | 254 |
| 988 | 3300048929 | Ga0496126_0039939 | Ga0496126_0039939_749_1636 | 254 |
| 989 | 3300048929 | Ga0496126_0109813 | Ga0496126_0109813_1059_1847 | 254 |
| 990 | 3300048929 | Ga0496126_0120611 | Ga0496126_0120611_392_1183 | 254 |
| 991 | 3300049580 | Ga0501046_0049382 | Ga0501046_0049382_2512_3306 | 254 |
| 992 | 3300049584 | Ga0501068_0095855 | Ga0501068_0095855_610_1485 | 254 |
| 993 | 3300049586 | Ga0501070_0111390 | Ga0501070_0111390_810_1604 | 254 |
| 994 | 3300049742 | Ga0501080_0062421 | Ga0501080_0062421_1048_1842 | 254 |
| 995 | 3300050490 | nmdc:mga03n38_870_c1 | nmdc:mga03n38_870_c1_4743_5615 | 254 |
| 996 | 3300050491 | nmdc:mga00v17_47431_c1 | nmdc:mga00v17_47431_c1_431_1303 | 254 |
| 997 | 3300050492 | nmdc:mga0yw44_16746_c1 | nmdc:mga0yw44_16746_c1_1293_2165 | 254 |
| 998 | 3300050494 | nmdc:mga06z11_18660_c1 | nmdc:mga06z11_18660_c1_1209_2084 | 254 |
| 999 | 3300050507 | nmdc:mga05p37_578_c1 | nmdc:mga05p37_578_c1_22076_22951 | 254 |
| 1000 | 3300050508 | nmdc:mga09592_3930_c1 | nmdc:mga09592_3930_c1_7055_7930 | 254 |
| 1001 | 3300050509 | nmdc:mga0qj67_171_c1 | nmdc:mga0qj67_171_c1_29577_30428 | 254 |
| 1002 | 3300050510 | nmdc:mga06r32_134128_c1 | nmdc:mga06r32_134128_c1_219_1091 | 254 |
| 1003 | 3300050510 | nmdc:mga06r32_457_c1 | nmdc:mga06r32_457_c1_22043_22918 | 254 |
| 1004 | 3300050510 | nmdc:mga06r32_642505_c1 | nmdc:mga06r32_642505_c1_22_897 | 254 |
| 1005 | 3300050511 | nmdc:mga08y16_275912_c1 | nmdc:mga08y16_275912_c1_825_1700 | 254 |
| 1006 | 3300050511 | nmdc:mga08y16_402576_c1 | nmdc:mga08y16_402576_c1_11_901 | 254 |
| 1007 | 3300050511 | nmdc:mga08y16_482921_c1 | nmdc:mga08y16_482921_c1_306_1181 | 254 |
| 1008 | 3300050512 | nmdc:mga0n895_11714_c1 | nmdc:mga0n895_11714_c1_4334_5209 | 254 |
| 1009 | 3300050512 | nmdc:mga0n895_258275_c1 | nmdc:mga0n895_258275_c1_254_1129 | 254 |
| 1010 | 3300050515 | nmdc:mga0a205_133457_c1 | nmdc:mga0a205_133457_c1_1489_2364 | 254 |
| 1011 | 3300050515 | nmdc:mga0a205_246756_c1 | nmdc:mga0a205_246756_c1_88_963 | 254 |
| 1012 | 3300050515 | nmdc:mga0a205_478035_c1 | nmdc:mga0a205_478035_c1_317_1081 | 254 |
| 1013 | 3300050515 | nmdc:mga0a205_59046_c1 | nmdc:mga0a205_59046_c1_2304_3179 | 254 |
| 1014 | 3300053077 | Ga0495601_0085827 | Ga0495601_0085827_312_1175 | 254 |
| 1015 | 3300053093 | Ga0500651_0117561 | Ga0500651_0117561_72_947 | 254 |
| 1016 | 3300053096 | Ga0500641_0047437 | Ga0500641_0047437_734_1621 | 254 |
| 1017 | 3300053153 | Ga0500616_0096090 | Ga0500616_0096090_338_1213 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8096 | 6 | 133 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.744 | 4 | 246 |
| 8b6q-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 with an insertion of calmodulin-m13 fusion at position 154-156 that mimic the structure of caprola, an calcium gated protein labeling technology | 0.7359 | 4 | 150 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.7311 | 4 | 246 |
| 1c4x-assembly1.cif.gz_A | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1 | 0.7307 | 5 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dstB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7637 | 6 | 130 | 3.40.50.12270 |
| af_K7LW21_1_105_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7622 | 4 | 119 | 3.40.50.12270 |
| af_A0A0P0WIT7_2_163_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7321 | 19 | 133 | 3.40.50.1820 |
| 1c4xA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7307 | 5 | 243 | 3.40.50.1820 |
| 2yysB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7283 | 5 | 252 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6ZPU4-F1-model_v4 | Alpha/beta hydrolase | 0.9986 | 8 | 253 |
GO:0016787
|
| AF-A0A533ITP0-F1-model_v4 | deleted | 0.9983 | 1 | 253 |
|
| AF-A0A537TW24-F1-model_v4 | Alpha/beta hydrolase | 0.9969 | 2 | 197 |
GO:0016787
|
| AF-A0A537NFW6-F1-model_v4 | Alpha/beta hydrolase | 0.9961 | 3 | 190 |
GO:0016787
|
| AF-A0A6N9BDZ1-F1-model_v4 | Alpha/beta hydrolase | 0.996 | 8 | 254 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar