F488292

General Info

Members Datasets Scaffolds Average Seq Length
1017 402 1017 262

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0502355|Ga0436365_0502355_1174_2151
Length 310
Sequence MIDSSRVPQVFAQAQPAAALPGLPDGAKVGFYEKGNVRIRYAEIGSGFPLLATPGGGLNSCMAVWARAVINIPQEFRGDFRVITMDQRNATGGESTGPVAVDDPWGAFADDQLGVMDHLGIDKFFFFGNCIGGPFAMKLMERAPQRVTAAILSQPVGHNPAKPDYMYDAGKTVWAKELRERRSDVSMETIEQYLHNLYRVQPDFVYSVSRDFAKACERPMLVLPDDVDAHPLVTSIDVASLCPNAEITVFPWKDPPELKARTINRARTFLKRYQAVSEAAGDHRHCCCRQEHAPDQCRGAEACWRAYLAT

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 6.29
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000660 3300003215 Bacteria 21135
2 JGI25153J46596_10000980 3300003215 Bacteria 17315
3 JGI25404J52841_10004319 3300003659 Bacteria 2872
4 JGI25405J52794_10000579 3300003911 Bacteria 5391
5 JGI25405J52794_10000642 3300003911 Bacteria 5239
6 Ga0058860_10061687 3300004801 Bacteria 901
7 Ga0058860_12023695 3300004801 Bacteria 847
8 Ga0058860_12080127 3300004801 Bacteria 1774
9 Ga0065712_10116098 3300005290 Bacteria 1741
10 Ga0065707_10052887 3300005295 Bacteria 941
11 Ga0070683_100076228 3300005329 Bacteria 3134
12 Ga0070683_100188352 3300005329 Bacteria 1959
13 Ga0070683_100304232 3300005329 Unclassified 1517
14 Ga0068869_100149941 3300005334 Bacteria 1808
15 Ga0070680_100012393 3300005336 Bacteria 6622
16 Ga0070680_100281796 3300005336 Bacteria 1408
17 Ga0070682_100130458 3300005337 Bacteria 1700
18 Ga0070689_100001712 3300005340 Bacteria 14020
19 Ga0070691_10095973 3300005341 Bacteria 1468
20 Ga0070687_100012756 3300005343 Bacteria 3721
21 Ga0070661_100049691 3300005344 Bacteria 3070
22 Ga0070668_100264719 3300005347 Bacteria 1431
23 Ga0070668_100592314 3300005347 Bacteria 969
24 Ga0070669_100024245 3300005353 Bacteria 4349
25 Ga0070669_100052634 3300005353 Bacteria 2979
26 Ga0070675_100354128 3300005354 Bacteria 1302
27 Ga0070671_100198355 3300005355 Bacteria 1702
28 Ga0070671_100227976 3300005355 Bacteria 1581
29 Ga0070671_100421928 3300005355 Bacteria 1143
30 Ga0070674_100069463 3300005356 Bacteria 2485
31 Ga0070674_100092455 3300005356 Bacteria 2187
32 Ga0070674_100184044 3300005356 Bacteria 1602
33 Ga0070688_100022506 3300005365 Bacteria 3695
34 Ga0070659_100205046 3300005366 Unclassified 1624
35 Ga0070703_10062311 3300005406 Bacteria 1224
36 Ga0070709_10027715 3300005434 Bacteria 3371
37 Ga0070709_10028128 3300005434 Bacteria 3350
38 Ga0070709_10273446 3300005434 Bacteria 1225
39 Ga0070709_10354792 3300005434 Bacteria 1084
40 Ga0070709_10406250 3300005434 Bacteria 1018
41 Ga0070714_100269103 3300005435 Bacteria 1580
42 Ga0070714_100369054 3300005435 Bacteria 1351
43 Ga0070713_100001818 3300005436 Bacteria 13769
44 Ga0070713_100245791 3300005436 Bacteria 1630
45 Ga0070713_100447612 3300005436 Bacteria 1212
46 Ga0070710_10005916 3300005437 Bacteria 5844
47 Ga0070710_10071614 3300005437 Unclassified 1999
48 Ga0070710_10151469 3300005437 Bacteria 1431
49 Ga0070710_10224710 3300005437 Bacteria 1196
50 Ga0070701_10123940 3300005438 Bacteria 1460
51 Ga0070711_100012791 3300005439 Bacteria 5255
52 Ga0070711_100197101 3300005439 Bacteria 1551
53 Ga0070711_100285425 3300005439 Bacteria 1307
54 Ga0070711_100374934 3300005439 Bacteria 1149
55 Ga0070705_100228448 3300005440 Bacteria 1293
56 Ga0070705_100238846 3300005440 Bacteria 1269
57 Ga0070694_100375942 3300005444 Bacteria 1107
58 Ga0070694_100423221 3300005444 Bacteria 1047
59 Ga0070708_100023270 3300005445 Bacteria 5266
60 Ga0070708_100037899 3300005445 Bacteria 4208
61 Ga0070708_100041980 3300005445 Bacteria 4012
62 Ga0070708_100079289 3300005445 Bacteria 2970
63 Ga0070708_100162362 3300005445 Bacteria 2082
64 Ga0070663_100003746 3300005455 Bacteria 8820
65 Ga0070663_100131359 3300005455 Bacteria 1902
66 Ga0070663_100171937 3300005455 Bacteria 1675
67 Ga0070678_100026011 3300005456 Bacteria 3950
68 Ga0070678_100065791 3300005456 Bacteria 2693
69 Ga0070681_10014225 3300005458 Bacteria 7919
70 Ga0070681_10015634 3300005458 Bacteria 7558
71 Ga0070681_10067759 3300005458 Bacteria 3537
72 Ga0070681_10085961 3300005458 Bacteria 3098
73 Ga0070685_10156714 3300005466 Bacteria 1448
74 Ga0070706_100041310 3300005467 Bacteria 4258
75 Ga0070706_100082271 3300005467 Bacteria 2982
76 Ga0070706_100150633 3300005467 Bacteria 2171
77 Ga0070706_100291570 3300005467 Bacteria 1522
78 Ga0070706_100456100 3300005467 Bacteria 1189
79 Ga0070706_100562057 3300005467 Bacteria 1061
80 Ga0070707_100016720 3300005468 Bacteria 6886
81 Ga0070707_100091058 3300005468 Bacteria 2952
82 Ga0070707_100092187 3300005468 Bacteria 2933
83 Ga0070707_100146059 3300005468 Bacteria 2302
84 Ga0070698_100042952 3300005471 Bacteria 4636
85 Ga0070698_100160045 3300005471 Bacteria 2196
86 Ga0070698_100176052 3300005471 Bacteria 2079
87 Ga0070698_100209625 3300005471 Bacteria 1884
88 Ga0070699_100152525 3300005518 Bacteria 2044
89 Ga0070699_100245674 3300005518 Bacteria 1598
90 Ga0070679_100101735 3300005530 Bacteria 2860
91 Ga0070679_100446100 3300005530 Bacteria 1239
92 Ga0070684_100079407 3300005535 Bacteria 2901
93 Ga0070684_100151539 3300005535 Bacteria 2101
94 Ga0070684_100174935 3300005535 Bacteria 1951
95 Ga0068853_100009933 3300005539 Bacteria 7684
96 Ga0068853_100814216 3300005539 Bacteria 895
97 Ga0070686_100259615 3300005544 Bacteria 1273
98 Ga0070695_100032790 3300005545 Bacteria 3247
99 Ga0070695_100364046 3300005545 Bacteria 1087
100 Ga0070693_100046413 3300005547 Bacteria 2467
101 Ga0070693_100213790 3300005547 Bacteria 1260
102 Ga0070665_100023942 3300005548 Bacteria 6149
103 Ga0070665_100049009 3300005548 Bacteria 4239
104 Ga0070665_100074587 3300005548 Bacteria 3398
105 Ga0070704_100411765 3300005549 Bacteria 1156
106 Ga0068855_100124391 3300005563 Bacteria 2950
107 Ga0068855_100148869 3300005563 Bacteria 2662
108 Ga0068855_100345913 3300005563 Bacteria 1639
109 Ga0068855_100735858 3300005563 Bacteria 1053
110 Ga0070664_100271514 3300005564 Unclassified 1527
111 Ga0070664_100766953 3300005564 Bacteria 901
112 Ga0068857_100021961 3300005577 Bacteria 5617
113 Ga0068857_100165748 3300005577 Bacteria 2007
114 Ga0068854_100167695 3300005578 Bacteria 1706
115 Ga0068856_100019721 3300005614 Bacteria 6544
116 Ga0068856_100066265 3300005614 Unclassified 3569
117 Ga0068856_100222275 3300005614 Bacteria 1904
118 Ga0068856_100488644 3300005614 Bacteria 1252
119 Ga0068852_100240551 3300005616 Bacteria 1729
120 Ga0068852_100406863 3300005616 Bacteria 1340
121 Ga0068852_100426777 3300005616 Bacteria 1308
122 Ga0068859_100046003 3300005617 Bacteria 4384
123 Ga0068859_100279634 3300005617 Bacteria 1761
124 Ga0068859_100548623 3300005617 Bacteria 1250
125 Ga0068864_100038231 3300005618 Bacteria 4097
126 Ga0068864_100196892 3300005618 Bacteria 1849
127 Ga0068866_10108439 3300005718 Bacteria 1544
128 Ga0068861_100345905 3300005719 Bacteria 1303
129 Ga0068863_100077315 3300005841 Bacteria 3150
130 Ga0068858_100250949 3300005842 Bacteria 1681
131 Ga0068860_100019692 3300005843 Bacteria 6542
132 Ga0068862_100182770 3300005844 Bacteria 1883
133 Ga0081455_10000418 3300005937 Bacteria 55929
134 Ga0081455_10001315 3300005937 Bacteria 30785
135 Ga0081455_10002053 3300005937 Bacteria 24074
136 Ga0081455_10006568 3300005937 Bacteria 12443
137 Ga0081455_10041502 3300005937 Bacteria 4045
138 Ga0081455_10096981 3300005937 Bacteria 2376
139 Ga0081455_10200913 3300005937 Unclassified 1493
140 Ga0081538_10146066 3300005981 Bacteria 1081
141 Ga0081540_1003181 3300005983 Bacteria 13089
142 Ga0081540_1005915 3300005983 Bacteria 9026
143 Ga0081540_1009489 3300005983 Bacteria 6702
144 Ga0081540_1023383 3300005983 Bacteria 3616
145 Ga0081540_1051182 3300005983 Bacteria 2044
146 Ga0081540_1072176 3300005983 Bacteria 1591
147 Ga0081539_10049231 3300005985 Bacteria 2393
148 Ga0081539_10174064 3300005985 Bacteria 1015
149 Ga0070717_10000508 3300006028 Bacteria 24700
150 Ga0070717_10159065 3300006028 Bacteria 1959
151 Ga0070717_10285474 3300006028 Bacteria 1465
152 Ga0070717_10403909 3300006028 Bacteria 1227
153 Ga0070717_10616178 3300006028 Bacteria 985
154 Ga0075365_10007763 3300006038 Bacteria 6041
155 Ga0075365_10029750 3300006038 Bacteria 3494
156 Ga0075365_10232165 3300006038 Bacteria 1295
157 Ga0075368_10018756 3300006042 Bacteria 2604
158 Ga0075363_100002080 3300006048 Bacteria 8010
159 Ga0075364_10039545 3300006051 Bacteria 3058
160 Ga0070715_10072632 3300006163 Unclassified 1541
161 Ga0070716_100013860 3300006173 Bacteria 4118
162 Ga0070716_100066344 3300006173 Bacteria 2105
163 Ga0070716_100343610 3300006173 Bacteria 1054
164 Ga0070716_100543921 3300006173 Unclassified 864
165 Ga0070712_100004011 3300006175 Bacteria 9046
166 Ga0070712_100017121 3300006175 Bacteria 4687
167 Ga0070712_100131478 3300006175 Bacteria 1897
168 Ga0070712_100266166 3300006175 Unclassified 1375
169 Ga0070712_100380414 3300006175 Bacteria 1162
170 Ga0070712_100441496 3300006175 Bacteria 1082
171 Ga0075362_10051383 3300006177 Bacteria 1845
172 Ga0075367_10045916 3300006178 Bacteria 2565
173 Ga0075427_10005724 3300006194 Bacteria 1779
174 Ga0075366_10080388 3300006195 Bacteria 1947
175 Ga0075370_10065259 3300006353 Bacteria 2076
176 Ga0068871_100239522 3300006358 Bacteria 1577
177 Ga0075428_100010863 3300006844 Bacteria 10122
178 Ga0075428_100032851 3300006844 Bacteria 5730
179 Ga0075428_100066107 3300006844 Unclassified 3960
180 Ga0075428_100075095 3300006844 Bacteria 3692
181 Ga0075428_100150368 3300006844 Bacteria 2529
182 Ga0075428_100184999 3300006844 Bacteria 2254
183 Ga0075428_100207317 3300006844 Bacteria 2118
184 Ga0075428_100251285 3300006844 Bacteria 1906
185 Ga0075428_100267326 3300006844 Bacteria 1840
186 Ga0075428_100333364 3300006844 Bacteria 1630
187 Ga0075428_100625157 3300006844 Bacteria 1149
188 Ga0075428_100644001 3300006844 Bacteria 1130
189 Ga0075430_100002737 3300006846 Bacteria 14720
190 Ga0075430_100004372 3300006846 Bacteria 11930
191 Ga0075430_100029545 3300006846 Bacteria 4652
192 Ga0075430_100035787 3300006846 Bacteria 4211
193 Ga0075430_100357510 3300006846 Bacteria 1206
194 Ga0075431_100010541 3300006847 Bacteria 9291
195 Ga0075431_100038421 3300006847 Bacteria 4929
196 Ga0075431_100059560 3300006847 Bacteria 3940
197 Ga0075431_100086499 3300006847 Bacteria 3234
198 Ga0075431_100093943 3300006847 Bacteria 3095
199 Ga0075431_100103518 3300006847 Bacteria 2938
200 Ga0075431_100180513 3300006847 Bacteria 2166
201 Ga0075431_100183018 3300006847 Bacteria 2150
202 Ga0075431_100506636 3300006847 Bacteria 1198
203 Ga0075433_10021818 3300006852 Bacteria 5372
204 Ga0075433_10095949 3300006852 Bacteria 2624
205 Ga0075433_10233632 3300006852 Bacteria 1632
206 Ga0075433_10239031 3300006852 Bacteria 1612
207 Ga0075433_10243633 3300006852 Unclassified 1596
208 Ga0075433_10394652 3300006852 Bacteria 1221
209 Ga0075433_10621321 3300006852 Bacteria 948
210 Ga0075434_100003432 3300006871 Bacteria 14172
211 Ga0075434_100031726 3300006871 Bacteria 5209
212 Ga0075434_100079291 3300006871 Bacteria 3280
213 Ga0075434_100142922 3300006871 Bacteria 2413
214 Ga0075434_100179083 3300006871 Bacteria 2139
215 Ga0075434_100287264 3300006871 Bacteria 1665
216 Ga0075434_100305621 3300006871 Bacteria 1611
217 Ga0075434_100376443 3300006871 Bacteria 1441
218 Ga0075429_100017090 3300006880 Bacteria 6273
219 Ga0075429_100017929 3300006880 Bacteria 6121
220 Ga0075429_100022663 3300006880 Bacteria 5444
221 Ga0075429_100059942 3300006880 Unclassified 3316
222 Ga0075429_100075368 3300006880 Bacteria 2939
223 Ga0075429_100274146 3300006880 Bacteria 1477
224 Ga0075429_100292310 3300006880 Unclassified 1427
225 Ga0075429_100407619 3300006880 Bacteria 1191
226 Ga0068865_100109719 3300006881 Bacteria 2034
227 Ga0068865_100299010 3300006881 Bacteria 1287
228 Ga0075436_100245266 3300006914 Bacteria 1275
229 Ga0075436_100273145 3300006914 Bacteria 1207
230 Ga0097620_100046004 3300006931 Bacteria 4384
231 Ga0097620_100279624 3300006931 Bacteria 1761
232 Ga0097620_100548622 3300006931 Bacteria 1250
233 Ga0075435_100475383 3300007076 Bacteria 1079
234 Ga0099794_10004782 3300007265 Bacteria 5372
235 Ga0099795_10016588 3300007788 Bacteria 2332
236 Ga0099795_10132238 3300007788 Bacteria 1008
237 Ga0105240_10077293 3300009093 Bacteria 4101
238 Ga0105240_10437551 3300009093 Bacteria 1466
239 Ga0111539_10032319 3300009094 Bacteria 6355
240 Ga0111539_10073530 3300009094 Bacteria 4030
241 Ga0111539_10252629 3300009094 Bacteria 2053
242 Ga0111539_10330986 3300009094 Bacteria 1773
243 Ga0111539_10344374 3300009094 Bacteria 1735
244 Ga0111539_10427569 3300009094 Bacteria 1542
245 Ga0111539_10677395 3300009094 Bacteria 1201
246 Ga0111539_10736348 3300009094 Bacteria 1148
247 Ga0105245_10279932 3300009098 Bacteria 1630
248 Ga0105247_10253644 3300009101 Bacteria 1203
249 Ga0114129_10006147 3300009147 Bacteria 17031
250 Ga0114129_10071358 3300009147 Bacteria 4842
251 Ga0114129_10075599 3300009147 Bacteria 4690
252 Ga0114129_10111234 3300009147 Unclassified 3780
253 Ga0114129_10115567 3300009147 Bacteria 3698
254 Ga0114129_10209081 3300009147 Bacteria 2639
255 Ga0114129_10405755 3300009147 Bacteria 1795
256 Ga0114129_10450159 3300009147 Bacteria 1689
257 Ga0114129_10597890 3300009147 Bacteria 1430
258 Ga0114129_11528689 3300009147 Bacteria 819
259 Ga0105243_10365124 3300009148 Bacteria 1330
260 Ga0105242_10062722 3300009176 Bacteria 3059
261 Ga0105242_10239275 3300009176 Bacteria 1631
262 Ga0105248_10042634 3300009177 Bacteria 5089
263 Ga0105248_10045067 3300009177 Bacteria 4945
264 Ga0105248_10377773 3300009177 Bacteria 1595
265 Ga0105248_10526754 3300009177 Bacteria 1333
266 Ga0105237_10129363 3300009545 Bacteria 2519
267 Ga0105237_10274718 3300009545 Bacteria 1688
268 Ga0105237_10633181 3300009545 Bacteria 1076
269 Ga0105238_10070875 3300009551 Bacteria 3484
270 Ga0105238_10190186 3300009551 Bacteria 2029
271 Ga0105238_10195703 3300009551 Bacteria 1997
272 Ga0105238_10362786 3300009551 Bacteria 1438
273 Ga0105249_10182709 3300009553 Bacteria 2041
274 Ga0105249_10294679 3300009553 Bacteria 1625
275 Ga0105249_10876774 3300009553 Bacteria 964
276 Ga0099796_10001978 3300010159 Bacteria 4357
277 Ga0099796_10032242 3300010159 Bacteria 1715
278 Ga0099796_10052250 3300010159 Bacteria 1422
279 Ga0105239_10256496 3300010375 Bacteria 1965
280 Ga0105246_10022952 3300011119 Bacteria 4033
281 Ga0105246_10091653 3300011119 Bacteria 2192
282 Ga0157373_10157606 3300013100 Bacteria 1597
283 Ga0157370_10149127 3300013104 Bacteria 2177
284 Ga0157370_10560401 3300013104 Bacteria 1047
285 Ga0157369_10859717 3300013105 Bacteria 931
286 Ga0157374_10023559 3300013296 Bacteria 5509
287 Ga0157374_10171265 3300013296 Bacteria 2118
288 Ga0157378_10001940 3300013297 Bacteria 18554
289 Ga0157378_10092125 3300013297 Bacteria 2757
290 Ga0157378_10177848 3300013297 Bacteria 2000
291 Ga0163162_10053689 3300013306 Bacteria 4051
292 Ga0163162_10213580 3300013306 Bacteria 2059
293 Ga0163162_10250062 3300013306 Bacteria 1905
294 Ga0163162_10330755 3300013306 Bacteria 1656
295 Ga0157372_10110431 3300013307 Bacteria 3150
296 Ga0157375_10051102 3300013308 Bacteria 4058
297 Ga0157375_10307361 3300013308 Bacteria 1750
298 Ga0163163_10005361 3300014325 Bacteria 11079
299 Ga0163163_10042646 3300014325 Bacteria 4445
300 Ga0163163_10053277 3300014325 Bacteria 3993
301 Ga0163163_10063883 3300014325 Bacteria 3652
302 Ga0163163_10407568 3300014325 Bacteria 1418
303 Ga0163163_10474655 3300014325 Bacteria 1312
304 Ga0182008_10076783 3300014497 Bacteria 1643
305 Ga0182008_10154516 3300014497 Bacteria 1152
306 Ga0157379_10006693 3300014968 Bacteria 9953
307 Ga0157379_10011648 3300014968 Bacteria 7678
308 Ga0157379_10209695 3300014968 Bacteria 1763
309 Ga0157379_10220305 3300014968 Bacteria 1719
310 Ga0157379_10252556 3300014968 Bacteria 1601
311 Ga0157376_10061010 3300014969 Bacteria 3169
312 Ga0157376_10342880 3300014969 Bacteria 1427
313 Ga0163161_10543954 3300017792 Bacteria 951
314 Ga0206352_10676952 3300020078 Bacteria 2326
315 Ga0206350_10268593 3300020080 Bacteria 1718
316 Ga0206353_10378285 3300020082 Bacteria 2845
317 Ga0213876_10034704 3300021384 Bacteria 2661
318 Ga0213875_10000009 3300021388 Bacteria 451129
319 Ga0213875_10000498 3300021388 Bacteria 32954
320 Ga0213875_10002698 3300021388 Bacteria 10477
321 Ga0213875_10033177 3300021388 Bacteria 2438
322 Ga0224712_10004135 3300022467 Bacteria 3880
323 Ga0207673_1018854 3300025290 Bacteria 925
324 Ga0209758_1000523 3300025297 Bacteria 61460
325 Ga0209758_1000772 3300025297 Bacteria 45993
326 Ga0207426_1060373 3300025302 Bacteria 1093
327 Ga0207656_10043114 3300025321 Bacteria 1923
328 Ga0207653_10039405 3300025885 Bacteria 1547
329 Ga0207682_10099526 3300025893 Bacteria 1270
330 Ga0207692_10133398 3300025898 Bacteria 1405
331 Ga0207692_10147891 3300025898 Bacteria 1343
332 Ga0207692_10178917 3300025898 Bacteria 1234
333 Ga0207692_10183182 3300025898 Bacteria 1221
334 Ga0207692_10223781 3300025898 Bacteria 1117
335 Ga0207710_10167639 3300025900 Bacteria 1073
336 Ga0207688_10159357 3300025901 Bacteria 1337
337 Ga0207685_10008557 3300025905 Bacteria 2922
338 Ga0207685_10065834 3300025905 Bacteria 1452
339 Ga0207699_10032557 3300025906 Unclassified 2938
340 Ga0207699_10047550 3300025906 Bacteria 2516
341 Ga0207699_10205470 3300025906 Bacteria 1337
342 Ga0207699_10345308 3300025906 Bacteria 1049
343 Ga0207643_10236080 3300025908 Bacteria 1123
344 Ga0207684_10038926 3300025910 Bacteria 4035
345 Ga0207684_10040262 3300025910 Bacteria 3962
346 Ga0207684_10040850 3300025910 Bacteria 3932
347 Ga0207684_10076272 3300025910 Bacteria 2849
348 Ga0207684_10142507 3300025910 Bacteria 2061
349 Ga0207654_10237492 3300025911 Bacteria 1216
350 Ga0207707_10000826 3300025912 Bacteria 30384
351 Ga0207707_10055373 3300025912 Bacteria 3450
352 Ga0207707_10191248 3300025912 Bacteria 1785
353 Ga0207695_10108109 3300025913 Bacteria 2766
354 Ga0207671_10239926 3300025914 Bacteria 1424
355 Ga0207693_10015489 3300025915 Bacteria 6117
356 Ga0207693_10017116 3300025915 Bacteria 5784
357 Ga0207693_10017417 3300025915 Bacteria 5731
358 Ga0207693_10030988 3300025915 Bacteria 4225
359 Ga0207693_10035034 3300025915 Bacteria 3959
360 Ga0207693_10097559 3300025915 Bacteria 2304
361 Ga0207693_10185034 3300025915 Bacteria 1640
362 Ga0207693_10273489 3300025915 Bacteria 1324
363 Ga0207663_10106228 3300025916 Bacteria 1897
364 Ga0207663_10127861 3300025916 Bacteria 1751
365 Ga0207663_10264211 3300025916 Bacteria 1272
366 Ga0207663_10390693 3300025916 Bacteria 1062
367 Ga0207663_10398163 3300025916 Bacteria 1052
368 Ga0207660_10006793 3300025917 Bacteria 7411
369 Ga0207660_10399309 3300025917 Bacteria 1107
370 Ga0207649_10034408 3300025920 Bacteria 3036
371 Ga0207652_10103988 3300025921 Bacteria 2511
372 Ga0207652_10139669 3300025921 Bacteria 2166
373 Ga0207652_10230292 3300025921 Bacteria 1670
374 Ga0207646_10028109 3300025922 Bacteria 5123
375 Ga0207646_10079635 3300025922 Bacteria 2929
376 Ga0207646_10126681 3300025922 Bacteria 2296
377 Ga0207646_10215507 3300025922 Bacteria 1734
378 Ga0207646_10461763 3300025922 Bacteria 1145
379 Ga0207694_10159623 3300025924 Bacteria 1820
380 Ga0207650_10223482 3300025925 Bacteria 1516
381 Ga0207659_10129719 3300025926 Bacteria 1944
382 Ga0207700_10057126 3300025928 Bacteria 2941
383 Ga0207700_10134359 3300025928 Bacteria 2024
384 Ga0207700_10306219 3300025928 Bacteria 1373
385 Ga0207700_10761585 3300025928 Bacteria 865
386 Ga0207664_10040534 3300025929 Bacteria 3623
387 Ga0207664_10120292 3300025929 Bacteria 2196
388 Ga0207664_10127460 3300025929 Bacteria 2138
389 Ga0207664_10241747 3300025929 Bacteria 1572
390 Ga0207664_10531251 3300025929 Bacteria 1055
391 Ga0207644_10116157 3300025931 Bacteria 2030
392 Ga0207644_10247275 3300025931 Bacteria 1422
393 Ga0207644_10407824 3300025931 Bacteria 1112
394 Ga0207690_10162705 3300025932 Unclassified 1665
395 Ga0207686_10218201 3300025934 Bacteria 1375
396 Ga0207686_10268353 3300025934 Bacteria 1254
397 Ga0207670_10001158 3300025936 Bacteria 13899
398 Ga0207670_10239140 3300025936 Bacteria 1398
399 Ga0207669_10295440 3300025937 Bacteria 1229
400 Ga0207704_10030866 3300025938 Bacteria 3011
401 Ga0207704_10068732 3300025938 Bacteria 2234
402 Ga0207665_10041256 3300025939 Bacteria 3081
403 Ga0207691_10148033 3300025940 Bacteria 2066
404 Ga0207691_10153588 3300025940 Bacteria 2023
405 Ga0207711_10020274 3300025941 Bacteria 5540
406 Ga0207711_10452869 3300025941 Bacteria 1195
407 Ga0207689_10065447 3300025942 Bacteria 2989
408 Ga0207689_10278216 3300025942 Bacteria 1386
409 Ga0207661_10054190 3300025944 Bacteria 3212
410 Ga0207661_10100788 3300025944 Bacteria 2425
411 Ga0207661_10171817 3300025944 Bacteria 1887
412 Ga0207661_10519340 3300025944 Unclassified 1089
413 Ga0207679_10377168 3300025945 Bacteria 1242
414 Ga0207667_10183269 3300025949 Bacteria 2150
415 Ga0207667_10389928 3300025949 Bacteria 1418
416 Ga0207712_10074195 3300025961 Bacteria 2456
417 Ga0207712_10223864 3300025961 Bacteria 1506
418 Ga0207668_10159755 3300025972 Bacteria 1755
419 Ga0207668_10570888 3300025972 Bacteria 982
420 Ga0207658_10191795 3300025986 Bacteria 1699
421 Ga0207677_10082806 3300026023 Bacteria 2307
422 Ga0207703_10059696 3300026035 Bacteria 3116
423 Ga0207703_10066404 3300026035 Bacteria 2967
424 Ga0207639_10013284 3300026041 Bacteria 5759
425 Ga0207678_10022356 3300026067 Bacteria 5540
426 Ga0207678_10023373 3300026067 Bacteria 5405
427 Ga0207678_10061720 3300026067 Bacteria 3224
428 Ga0207678_10141966 3300026067 Bacteria 2050
429 Ga0207708_10059185 3300026075 Bacteria 2924
430 Ga0207708_10080554 3300026075 Bacteria 2502
431 Ga0207708_10106677 3300026075 Bacteria 2172
432 Ga0207708_10179578 3300026075 Bacteria 1680
433 Ga0207702_10296923 3300026078 Bacteria 1532
434 Ga0207702_10323983 3300026078 Bacteria 1468
435 Ga0207641_10058449 3300026088 Bacteria 3282
436 Ga0207676_10021432 3300026095 Bacteria 4740
437 Ga0207676_10241401 3300026095 Bacteria 1621
438 Ga0207674_10029348 3300026116 Bacteria 5790
439 Ga0207675_100174232 3300026118 Bacteria 2057
440 Ga0207675_100358227 3300026118 Bacteria 1431
441 Ga0207675_100491048 3300026118 Bacteria 1221
442 Ga0207683_10011965 3300026121 Bacteria 7406
443 Ga0207683_10089105 3300026121 Bacteria 2746
444 Ga0207698_10025424 3300026142 Bacteria 4172
445 Ga0207698_10025926 3300026142 Bacteria 4140
446 Ga0207698_10218050 3300026142 Bacteria 1722
447 Ga0207698_10239002 3300026142 Bacteria 1654
448 Ga0209995_1001114 3300027471 Bacteria 4126
449 Ga0209179_1005644 3300027512 Bacteria 1972
450 Ga0209179_1017893 3300027512 Bacteria 1348
451 Ga0209588_1010243 3300027671 Bacteria 2815
452 Ga0209588_1014115 3300027671 Bacteria 2443
453 Ga0209813_10037515 3300027866 Bacteria 1461
454 Ga0207428_10017007 3300027907 Bacteria 6248
455 Ga0207428_10185093 3300027907 Bacteria 1572
456 Ga0207428_10569867 3300027907 Bacteria 818
457 Ga0268266_10008924 3300028379 Bacteria 8871
458 Ga0268266_10055963 3300028379 Bacteria 3392
459 Ga0268266_10093765 3300028379 Bacteria 2634
460 Ga0268266_10386239 3300028379 Bacteria 1321
461 Ga0268266_10551608 3300028379 Bacteria 1104
462 Ga0268265_10651112 3300028380 Bacteria 1013
463 Ga0268264_10216680 3300028381 Bacteria 1760
464 Ga0265334_10052047 3300028573 Bacteria 1568
465 Ga0265338_10005513 3300028800 Bacteria 16493
466 Ga0265763_1000743 3300030763 Bacteria 2125
467 Ga0265773_1000831 3300031018 Bacteria 1448
468 Ga0265325_10001561 3300031241 Bacteria 15970
469 Ga0265325_10041154 3300031241 Bacteria 2422
470 Ga0265325_10092934 3300031241 Bacteria 1485
471 Ga0265340_10002096 3300031247 Bacteria 11429
472 Ga0265340_10024688 3300031247 Bacteria 3051
473 Ga0265340_10059854 3300031247 Bacteria 1826
474 Ga0265340_10159963 3300031247 Bacteria 1023
475 Ga0265339_10000126 3300031249 Bacteria 63942
476 Ga0265339_10001221 3300031249 Bacteria 19322
477 Ga0265339_10032717 3300031249 Bacteria 2932
478 Ga0265331_10110721 3300031250 Bacteria 1259
479 Ga0307509_10071890 3300031507 Bacteria 3606
480 Ga0265313_10000844 3300031595 Bacteria 30856
481 Ga0265313_10073133 3300031595 Bacteria 1574
482 Ga0265314_10191221 3300031711 Bacteria 1218
483 Ga0265342_10000035 3300031712 Bacteria 142886
484 Ga0265342_10011621 3300031712 Bacteria 6010
485 Ga0307405_10405273 3300031731 Bacteria 1069
486 Ga0307410_10328407 3300031852 Bacteria 1216
487 Ga0307406_10295878 3300031901 Bacteria 1241
488 Ga0307406_10325776 3300031901 Bacteria 1190
489 Ga0307406_10737456 3300031901 Bacteria 826
490 Ga0307412_10201176 3300031911 Bacteria 1513
491 Ga0307409_100306152 3300031995 Bacteria 1481
492 Ga0307416_100211485 3300032002 Bacteria 1851
493 Ga0307416_100786288 3300032002 Bacteria 1046
494 Ga0307414_10284462 3300032004 Bacteria 1391
495 Ga0307510_10030926 3300033180 Bacteria 6060
496 Ga0373930_0009760 3300034816 Bacteria 1705
497 Ga0373958_0014116 3300034819 Bacteria 1393
498 Ga0373959_0002069 3300034820 Bacteria 3200
499 Ga0373959_0010829 3300034820 Bacteria 1600
500 Ga0373938_0002389 3300034957 Bacteria 3023
501 Ga0373938_0003206 3300034957 Bacteria 2661
502 Ga0373938_0017284 3300034957 Bacteria 1419
503 Ga0373926_0023452 3300035083 Bacteria 2144
504 Ga0373934_0045836 3300035086 Bacteria 1729
505 Ga0373940_0024313 3300035088 Bacteria 1570
506 Ga0373940_0044257 3300035088 Bacteria 1233
507 Ga0373944_0091453 3300035089 Bacteria 1017
508 Ga0373951_0036107 3300035091 Bacteria 1179
509 Ga0373952_0003300 3300035092 Bacteria 2910
510 Ga0373952_0016312 3300035092 Bacteria 1509
511 Ga0373923_0008125 3300035111 Bacteria 3725
512 Ga0373923_0060800 3300035111 Bacteria 1604
513 Ga0373923_0221424 3300035111 Unclassified 879
514 Ga0373936_0000543 3300035113 Bacteria 12919
515 Ga0373936_0047359 3300035113 Bacteria 1734
516 Ga0373941_0083401 3300035115 Bacteria 1083
517 Ga0373945_0075529 3300035116 Bacteria 1283
518 Ga0373945_0105445 3300035116 Bacteria 1107
519 Ga0373953_0002974 3300035117 Bacteria 5184
520 Ga0373953_0028233 3300035117 Bacteria 2162
521 Ga0373953_0075244 3300035117 Bacteria 1398
522 Ga0373954_0001388 3300035118 Bacteria 9806
523 Ga0373954_0006655 3300035118 Bacteria 5043
524 Ga0373956_0025815 3300035119 Bacteria 2541
525 Ga0373956_0042926 3300035119 Bacteria 2012
526 Ga0373956_0044968 3300035119 Bacteria 1969
527 Ga0373957_0001852 3300035120 Bacteria 5861
528 Ga0373960_0006938 3300035121 Bacteria 2670
529 Ga0373960_0028381 3300035121 Bacteria 1544
530 Ga0373960_0049121 3300035121 Bacteria 1247
531 Ga0373960_0050417 3300035121 Bacteria 1234
532 Ga0373943_0006448 3300035170 Bacteria 5270
533 Ga0373943_0206150 3300035170 Bacteria 1090
534 Ga0373946_0012654 3300035171 Bacteria 3162
535 Ga0373946_0057326 3300035171 Bacteria 1648
536 Ga0373946_0191560 3300035171 Bacteria 975
537 Ga0373955_0001296 3300035172 Bacteria 10657
538 Ga0373955_0003427 3300035172 Bacteria 6967
539 Ga0373955_0068572 3300035172 Bacteria 1977
540 Ga0373955_0420628 3300035172 Bacteria 813
541 Ga0373961_0014464 3300035241 Bacteria 2005
542 Ga0373924_0002032 3300035410 Bacteria 6746
543 Ga0373924_0033584 3300035410 Bacteria 2072
544 Ga0373924_0037176 3300035410 Bacteria 1981
545 Ga0373924_0040683 3300035410 Bacteria 1903
546 Ga0373931_0009119 3300035691 Bacteria 4734
547 Ga0373931_0160678 3300035691 Bacteria 1317
548 Ga0373935_0000053 3300035692 Bacteria 46838
549 Ga0373935_0012176 3300035692 Bacteria 5174
550 Ga0373935_0037806 3300035692 Bacteria 3021
551 Ga0373935_0058415 3300035692 Bacteria 2464
552 Ga0373935_0114102 3300035692 Bacteria 1797
553 Ga0373935_0569430 3300035692 Bacteria 827
554 Ga0373927_0003990 3300035695 Bacteria 10440
555 Ga0373927_0006706 3300035695 Bacteria 7832
556 Ga0373927_0054934 3300035695 Unclassified 2576
557 Ga0373927_0168063 3300035695 Bacteria 1437
558 Ga0373927_0188718 3300035695 Bacteria 1352
559 Ga0373927_0363302 3300035695 Bacteria 954
560 Ga0373933_0001972 3300035724 Bacteria 11822
561 Ga0373933_0006420 3300035724 Bacteria 6400
562 Ga0373933_0015184 3300035724 Bacteria 4292
563 Ga0373933_0177325 3300035724 Bacteria 1358
564 Ga0373947_0000259 3300035725 Bacteria 29909
565 Ga0373947_0007231 3300035725 Bacteria 6433
566 Ga0373947_0022302 3300035725 Bacteria 3671
567 Ga0373947_0045158 3300035725 Bacteria 2636
568 Ga0373947_0078493 3300035725 Bacteria 2038
569 Ga0373947_0099192 3300035725 Bacteria 1828
570 Ga0373947_0108107 3300035725 Bacteria 1754
571 Ga0373937_0000030 3300036401 Bacteria 122176
572 Ga0373937_0002031 3300036401 Bacteria 16910
573 Ga0373937_0011822 3300036401 Bacteria 7664
574 Ga0373937_0051982 3300036401 Bacteria 3756
575 Ga0373937_0053663 3300036401 Bacteria 3697
576 Ga0373937_0091262 3300036401 Bacteria 2822
577 Ga0373937_0102344 3300036401 Bacteria 2659
578 Ga0373937_0165925 3300036401 Bacteria 2071
579 Ga0373937_0244830 3300036401 Bacteria 1690
580 Ga0373937_0714988 3300036401 Bacteria 949
581 Ga0372808_016532 3300036459 Bacteria 1057
582 Ga0373925_0000002 3300037068 Bacteria 368879
583 Ga0373925_0013015 3300037068 Bacteria 6025
584 Ga0373925_0044707 3300037068 Bacteria 3289
585 Ga0373925_0200374 3300037068 Bacteria 1587
586 Ga0373925_0216552 3300037068 Bacteria 1527
587 Ga0373925_0246128 3300037068 Unclassified 1433
588 Ga0373925_0334062 3300037068 Bacteria 1228
589 Ga0395899_0124497 3300037312 Bacteria 1844
590 Ga0395900_0024386 3300037418 Bacteria 6194
591 Ga0395900_0803020 3300037418 Bacteria 869
592 Ga0436364_0116063 3300037853 Bacteria 34499
593 Ga0436364_0174146 3300037853 Bacteria 60383
594 Ga0436364_0518856 3300037853 Bacteria 4142
595 Ga0436364_0790051 3300037853 Bacteria 7354
596 Ga0436364_1167573 3300037853 Bacteria 1842
597 Ga0436364_1414712 3300037853 Bacteria 14633
598 Ga0395901_0009263 3300038443 Bacteria 9984
599 Ga0395901_0544387 3300038443 Unclassified 1177
600 Ga0395901_0684383 3300038443 Bacteria 1025
601 Ga0395901_0767182 3300038443 Bacteria 956
602 Ga0436365_0297513 3300039437 Bacteria 1297
603 Ga0436365_0316468 3300039437 Bacteria 3400
604 Ga0436365_0502355 3300039437 Bacteria 2696
605 Ga0436365_0536902 3300039437 Bacteria 5780
606 Ga0436365_1057670 3300039437 Bacteria 2070
607 Ga0436365_1534158 3300039437 Bacteria 1930
608 Ga0436360_0521374 3300039438 Bacteria 992
609 Ga0436360_0736047 3300039438 Bacteria 1241
610 Ga0436360_1043436 3300039438 Bacteria 1358
611 Ga0436361_0261761 3300039447 Bacteria 1407
612 Ga0436361_0724946 3300039447 Bacteria 1227
613 Ga0436361_1073850 3300039447 Bacteria 1843
614 Ga0436363_0651762 3300039450 Bacteria 2465
615 Ga0436363_0833932 3300039450 Unclassified 1451
616 Ga0436363_1260906 3300039450 Bacteria 932
617 Ga0436363_1557386 3300039450 Unclassified 3146
618 Ga0436362_0220226 3300039453 Bacteria 4248
619 Ga0436362_0976859 3300039453 Bacteria 1575
620 Ga0451791_1395462 3300041451 Bacteria 924
621 Ga0451853_0295340 3300041512 Bacteria 984
622 Ga0439460_0027138 3300042461 Bacteria 1606
623 Ga0439440_0068646 3300042993 Bacteria 918
624 Ga0453683_0017377 3300044673 Bacteria 4630
625 Ga0453683_0210344 3300044673 Bacteria 1236
626 Ga0466963_0137965 3300044694 Bacteria 1688
627 Ga0466959_0276615 3300045049 Bacteria 1153
628 Ga0451576_0162542 3300045051 Bacteria 2330
629 Ga0466967_0025189 3300045976 Bacteria 4903
630 Ga0466967_0199815 3300045976 Unclassified 1893
631 Ga0495627_050764 3300046453 Bacteria 1249
632 Ga0495592_0000046 3300046454 Bacteria 117345
633 Ga0495592_0063065 3300046454 Bacteria 2719
634 Ga0495592_0191067 3300046454 Bacteria 1388
635 Ga0495592_0383981 3300046454 Unclassified 893
636 Ga0495603_0026171 3300046455 Bacteria 3525
637 Ga0495603_0165408 3300046455 Bacteria 1282
638 Ga0495629_0145069 3300046459 Bacteria 1651
639 Ga0495629_0190112 3300046459 Bacteria 1421
640 Ga0495651_0000822 3300046462 Bacteria 24113
641 Ga0495651_0016074 3300046462 Bacteria 5796
642 Ga0495653_0000006 3300046463 Bacteria 363285
643 Ga0495653_0090986 3300046463 Bacteria 2231
644 Ga0495650_0089444 3300046471 Bacteria 1174
645 Ga0495580_0379804 3300046472 Bacteria 954
646 Ga0495582_0064649 3300046473 Bacteria 2020
647 Ga0495582_0082452 3300046473 Bacteria 1787
648 Ga0495582_0136768 3300046473 Bacteria 1387
649 Ga0495605_0032275 3300046474 Bacteria 2667
650 Ga0495605_0154621 3300046474 Bacteria 1021
651 Ga0495639_0027441 3300046475 Bacteria 2520
652 Ga0495639_0061050 3300046475 Unclassified 1728
653 Ga0495639_0112738 3300046475 Bacteria 1292
654 Ga0495664_0000002 3300046477 Bacteria 625183
655 Ga0495664_0099885 3300046477 Bacteria 1747
656 Ga0495585_0031747 3300046492 Bacteria 2997
657 Ga0495585_0141051 3300046492 Bacteria 1262
658 Ga0495594_0201253 3300046499 Bacteria 1135
659 Ga0495594_0207085 3300046499 Bacteria 1118
660 Ga0495596_0042107 3300046500 Bacteria 1800
661 Ga0495606_0076311 3300046507 Bacteria 2095
662 Ga0495608_0000006 3300046511 Bacteria 324334
663 Ga0495608_0136303 3300046511 Bacteria 1568
664 Ga0495608_0296983 3300046511 Bacteria 1000
665 Ga0495616_0104194 3300046513 Bacteria 1326
666 Ga0495618_0000034 3300046514 Bacteria 104335
667 Ga0495618_0029155 3300046514 Bacteria 3442
668 Ga0495618_0042664 3300046514 Bacteria 2860
669 Ga0495628_0000002 3300046516 Bacteria 589399
670 Ga0495630_0000662 3300046517 Bacteria 24856
671 Ga0495630_0052129 3300046517 Bacteria 3063
672 Ga0495630_0164878 3300046517 Bacteria 1687
673 Ga0495630_0446629 3300046517 Bacteria 991
674 Ga0495630_0470612 3300046517 Bacteria 963
675 Ga0495632_0092412 3300046519 Bacteria 1433
676 Ga0495632_0122309 3300046519 Bacteria 1216
677 Ga0495637_0110886 3300046520 Bacteria 1063
678 Ga0495666_0121148 3300046526 Bacteria 1225
679 Ga0495652_0000004 3300046529 Bacteria 588877
680 Ga0495652_0107711 3300046529 Bacteria 2248
681 Ga0495654_0148259 3300046530 Bacteria 1040
682 Ga0495665_0031706 3300046531 Bacteria 2829
683 Ga0495640_0000007 3300046533 Bacteria 265481
684 Ga0495640_0021159 3300046533 Bacteria 4778
685 Ga0495640_0079911 3300046533 Bacteria 2176
686 Ga0495640_0118297 3300046533 Bacteria 1724
687 Ga0495640_0142197 3300046533 Bacteria 1546
688 Ga0495640_0283651 3300046533 Bacteria 1031
689 Ga0495586_0276195 3300046535 Bacteria 961
690 Ga0495587_0000031 3300046536 Bacteria 126721
691 Ga0495587_0023239 3300046536 Bacteria 3811
692 Ga0495587_0105693 3300046536 Bacteria 1619
693 Ga0495598_0006275 3300046537 Bacteria 2680
694 Ga0495598_0040224 3300046537 Bacteria 1362
695 Ga0495621_0014292 3300046539 Bacteria 2510
696 Ga0495621_0089291 3300046539 Bacteria 1160
697 Ga0495645_0000003 3300046543 Bacteria 570133
698 Ga0495633_0141254 3300046558 Bacteria 1113
699 Ga0495667_0000002 3300046559 Bacteria 437535
700 Ga0495667_0032557 3300046559 Bacteria 3493
701 Ga0495667_0049591 3300046559 Bacteria 2771
702 Ga0495667_0143668 3300046559 Bacteria 1537
703 Ga0495667_0171686 3300046559 Bacteria 1393
704 Ga0495668_0228320 3300046616 Bacteria 1019
705 Ga0495634_0048400 3300046642 Bacteria 2862
706 Ga0495634_0176246 3300046642 Bacteria 1341
707 Ga0495634_0222471 3300046642 Bacteria 1164
708 Ga0495634_0234240 3300046642 Unclassified 1129
709 Ga0495635_0000022 3300046663 Bacteria 160907
710 Ga0495635_0030518 3300046663 Bacteria 3746
711 Ga0495635_0047055 3300046663 Bacteria 2976
712 Ga0495635_0048550 3300046663 Bacteria 2926
713 Ga0495635_0094506 3300046663 Bacteria 2044
714 Ga0495635_0113006 3300046663 Bacteria 1855
715 Ga0495635_0352268 3300046663 Bacteria 982
716 Ga0495659_0008947 3300046664 Bacteria 3189
717 Ga0495659_0144296 3300046664 Bacteria 952
718 Ga0495588_0008543 3300046674 Bacteria 4705
719 Ga0495657_0000276 3300046675 Bacteria 46295
720 Ga0495657_0177179 3300046675 Bacteria 1310
721 Ga0495599_0000001 3300046678 Bacteria 537563
722 Ga0495599_0032207 3300046678 Bacteria 3291
723 Ga0495599_0142819 3300046678 Bacteria 1484
724 Ga0495599_0231768 3300046678 Bacteria 1127
725 Ga0495623_0000094 3300046679 Bacteria 53328
726 Ga0495646_0000007 3300046680 Bacteria 236764
727 Ga0495646_0311863 3300046680 Unclassified 830
728 Ga0495658_0018990 3300046683 Unclassified 3582
729 Ga0495658_0308146 3300046683 Bacteria 1002
730 Ga0495669_0030566 3300046684 Bacteria 2364
731 Ga0495613_0005203 3300046689 Bacteria 9769
732 Ga0495613_0099585 3300046689 Bacteria 2100
733 Ga0495613_0110784 3300046689 Bacteria 1978
734 Ga0495613_0317316 3300046689 Bacteria 1076
735 Ga0495624_0084366 3300046690 Bacteria 1963
736 Ga0495624_0377068 3300046690 Bacteria 852
737 Ga0495670_0223965 3300046691 Bacteria 999
738 Ga0495671_0099852 3300046692 Bacteria 1419
739 Ga0495589_0166944 3300046794 Bacteria 1047
740 Ga0495600_0000033 3300046809 Bacteria 83590
741 Ga0495600_0080882 3300046809 Bacteria 2121
742 Ga0495600_0196539 3300046809 Bacteria 1296
743 Ga0495604_0000005 3300047317 Bacteria 424516
744 Ga0495604_0076491 3300047317 Bacteria 2518
745 Ga0495604_0225285 3300047317 Bacteria 1289
746 Ga0495604_0240144 3300047317 Bacteria 1239
747 Ga0495636_0025653 3300047318 Bacteria 2394
748 Ga0495674_0000003 3300047319 Bacteria 562126
749 Ga0495674_0092387 3300047319 Bacteria 2583
750 Ga0495674_0458762 3300047319 Bacteria 1023
751 Ga0495672_0137765 3300047320 Unclassified 1278
752 Ga0495676_0297060 3300047321 Bacteria 1090
753 Ga0495680_0000091 3300047322 Bacteria 81622
754 Ga0495680_0074954 3300047322 Bacteria 2568
755 Ga0495680_0357576 3300047322 Bacteria 1015
756 Ga0495683_0078567 3300047323 Bacteria 1612
757 Ga0495675_0000064 3300047444 Bacteria 74132
758 Ga0495677_0045265 3300047445 Bacteria 1614
759 Ga0495684_0000035 3300047471 Bacteria 107768
760 Ga0495684_0056398 3300047471 Bacteria 2995
761 Ga0495684_0139669 3300047471 Bacteria 1817
762 Ga0495684_0421958 3300047471 Unclassified 932
763 Ga0495593_0044108 3300047673 Bacteria 2387
764 Ga0495602_0000029 3300048088 Bacteria 142344
765 Ga0495602_0004741 3300048088 Bacteria 14214
766 Ga0495614_0129833 3300048089 Bacteria 1115
767 Ga0495615_0019320 3300048090 Bacteria 1512
768 Ga0495626_0146195 3300048091 Bacteria 999
769 Ga0496100_0005415 3300048903 Bacteria 6873
770 Ga0496100_0016994 3300048903 Bacteria 4283
771 Ga0496100_0517799 3300048903 Bacteria 920
772 Ga0496101_0002908 3300048904 Bacteria 10544
773 Ga0496101_0457919 3300048904 Bacteria 1006
774 Ga0496102_0034692 3300048905 Bacteria 4539
775 Ga0496102_0176027 3300048905 Bacteria 2014
776 Ga0496102_0288922 3300048905 Bacteria 1545
777 Ga0496102_0491735 3300048905 Bacteria 1148
778 Ga0496103_0097114 3300048906 Bacteria 1862
779 Ga0496103_0104527 3300048906 Bacteria 1795
780 Ga0496104_0000406 3300048907 Bacteria 37705
781 Ga0496104_0011780 3300048907 Bacteria 7846
782 Ga0496104_0018833 3300048907 Bacteria 6306
783 Ga0496104_0046997 3300048907 Bacteria 4067
784 Ga0496104_0118048 3300048907 Bacteria 2546
785 Ga0496104_0152806 3300048907 Bacteria 2215
786 Ga0496104_0713763 3300048907 Unclassified 910
787 Ga0496105_0003838 3300048908 Bacteria 11215
788 Ga0496105_0006511 3300048908 Bacteria 8981
789 Ga0496105_0026574 3300048908 Bacteria 4724
790 Ga0496105_0045525 3300048908 Bacteria 3620
791 Ga0496105_0153463 3300048908 Bacteria 1892
792 Ga0496105_0269211 3300048908 Bacteria 1376
793 Ga0496106_0009563 3300048909 Bacteria 7159
794 Ga0496106_0025869 3300048909 Bacteria 4367
795 Ga0496106_0033663 3300048909 Bacteria 3824
796 Ga0496106_0060627 3300048909 Bacteria 2868
797 Ga0496107_0025460 3300048910 Bacteria 4189
798 Ga0496107_0065981 3300048910 Bacteria 2624
799 Ga0496107_0069604 3300048910 Bacteria 2554
800 Ga0496107_0198228 3300048910 Bacteria 1492
801 Ga0496108_0023370 3300048911 Bacteria 5086
802 Ga0496108_0121307 3300048911 Bacteria 2242
803 Ga0496108_0266269 3300048911 Bacteria 1491
804 Ga0496108_0545867 3300048911 Bacteria 1011
805 Ga0496109_0028898 3300048912 Bacteria 4963
806 Ga0496109_0116590 3300048912 Bacteria 2486
807 Ga0496109_0386913 3300048912 Bacteria 1321
808 Ga0496110_0011457 3300048913 Bacteria 7258
809 Ga0496110_0017500 3300048913 Bacteria 5997
810 Ga0496110_0017778 3300048913 Bacteria 5950
811 Ga0496110_0043652 3300048913 Bacteria 3915
812 Ga0496111_0093464 3300048914 Bacteria 2205
813 Ga0496111_0188218 3300048914 Bacteria 1534
814 Ga0496112_0018293 3300048915 Bacteria 6596
815 Ga0496112_0086701 3300048915 Bacteria 3097
816 Ga0496112_0218245 3300048915 Bacteria 1863
817 Ga0496112_0239272 3300048915 Bacteria 1768
818 Ga0496112_0567934 3300048915 Bacteria 1067
819 Ga0496113_0080132 3300048916 Bacteria 2500
820 Ga0496113_0141939 3300048916 Bacteria 1890
821 Ga0496114_0002985 3300048917 Bacteria 12975
822 Ga0496114_0044873 3300048917 Bacteria 3669
823 Ga0496114_0060123 3300048917 Bacteria 3175
824 Ga0496114_0091496 3300048917 Bacteria 2584
825 Ga0496114_0568657 3300048917 Bacteria 1001
826 Ga0496115_0019674 3300048918 Bacteria 5197
827 Ga0496115_0032525 3300048918 Bacteria 4115
828 Ga0496115_0078034 3300048918 Bacteria 2694
829 Ga0496115_0082880 3300048918 Bacteria 2613
830 Ga0496115_0087655 3300048918 Bacteria 2540
831 Ga0496115_0244727 3300048918 Bacteria 1478
832 Ga0496118_0242857 3300048921 Bacteria 1030
833 Ga0496121_0023126 3300048924 Bacteria 6000
834 Ga0496121_0051252 3300048924 Bacteria 3478
835 Ga0496126_0017149 3300048929 Bacteria 7221
836 Ga0496126_0039939 3300048929 Bacteria 4351
837 Ga0496126_0109813 3300048929 Bacteria 2403
838 Ga0496126_0120611 3300048929 Bacteria 2275
839 Ga0495678_025380 3300049459 Bacteria 2546
840 Ga0501311_014377 3300049527 Bacteria 1009
841 Ga0501317_008493 3300049533 Bacteria 1184
842 Ga0501318_011075 3300049534 Bacteria 1013
843 Ga0501321_005571 3300049537 Bacteria 1250
844 Ga0501034_0138934 3300049571 Bacteria 2410
845 Ga0501036_0011679 3300049572 Bacteria 7279
846 Ga0501036_0127330 3300049572 Bacteria 2151
847 Ga0501038_0109451 3300049574 Unclassified 2289
848 Ga0501039_0021841 3300049575 Bacteria 4911
849 Ga0501039_0034004 3300049575 Bacteria 3933
850 Ga0501039_0315379 3300049575 Bacteria 1229
851 Ga0501040_0000995 3300049576 Bacteria 17916
852 Ga0501040_0015514 3300049576 Bacteria 5034
853 Ga0501040_0074209 3300049576 Bacteria 2351
854 Ga0501040_0242757 3300049576 Bacteria 1284
855 Ga0501041_0017617 3300049577 Bacteria 4250
856 Ga0501041_0058187 3300049577 Bacteria 2364
857 Ga0501041_0130470 3300049577 Bacteria 1565
858 Ga0501042_0011394 3300049578 Bacteria 6001
859 Ga0501042_0118816 3300049578 Bacteria 1903
860 Ga0501042_0340267 3300049578 Bacteria 1085
861 Ga0501046_0049382 3300049580 Bacteria 3328
862 Ga0501046_0114167 3300049580 Bacteria 2061
863 Ga0501046_0271644 3300049580 Bacteria 1243
864 Ga0501048_0011738 3300049582 Bacteria 6531
865 Ga0501048_0032626 3300049582 Bacteria 3763
866 Ga0501048_0137931 3300049582 Bacteria 1724
867 Ga0501048_0328501 3300049582 Bacteria 1090
868 Ga0501068_0095855 3300049584 Bacteria 1835
869 Ga0501070_0111390 3300049586 Bacteria 2262
870 Ga0501071_0180918 3300049587 Bacteria 1580
871 Ga0501071_0306412 3300049587 Bacteria 1205
872 Ga0501072_0011150 3300049588 Bacteria 6860
873 Ga0501072_0041410 3300049588 Bacteria 3618
874 Ga0501073_0246179 3300049589 Bacteria 1234
875 Ga0501073_0290283 3300049589 Bacteria 1129
876 Ga0501075_0000059 3300049591 Bacteria 46955
877 Ga0501075_0002900 3300049591 Bacteria 11504
878 Ga0501075_0016035 3300049591 Bacteria 5391
879 Ga0501075_0571537 3300049591 Bacteria 862
880 Ga0501076_0000302 3300049592 Bacteria 30790
881 Ga0501076_0013335 3300049592 Bacteria 6163
882 Ga0501076_0109490 3300049592 Bacteria 2232
883 Ga0501077_0020718 3300049593 Bacteria 4163
884 Ga0501077_0043474 3300049593 Bacteria 2855
885 Ga0501079_0007487 3300049741 Bacteria 8257
886 Ga0501079_0251304 3300049741 Bacteria 1382
887 Ga0501079_0286054 3300049741 Bacteria 1289
888 Ga0501080_0022370 3300049742 Bacteria 5857
889 Ga0501080_0062421 3300049742 Bacteria 3468
890 Ga0501080_0129125 3300049742 Bacteria 2340
891 Ga0501080_0350061 3300049742 Bacteria 1334
892 Ga0501081_0002714 3300049743 Bacteria 11204
893 Ga0501081_0111241 3300049743 Bacteria 1944
894 Ga0501081_0294897 3300049743 Bacteria 1189
895 Ga0501081_0455651 3300049743 Bacteria 951
896 Ga0501083_0149014 3300049744 Bacteria 1532
897 Ga0501035_0120363 3300049822 Unclassified 2296
898 Ga0501044_0174924 3300049823 Bacteria 2116
899 nmdc:mga03683_849_c1 3300050489 Bacteria 6172
900 nmdc:mga03n38_870_c1 3300050490 Bacteria 8105
901 nmdc:mga00v17_47431_c1 3300050491 Bacteria 2602
902 nmdc:mga0yw44_16746_c1 3300050492 Bacteria 3969
903 nmdc:mga0yw44_23402_c1 3300050492 Bacteria 3480
904 nmdc:mga0k408_18460_c1 3300050493 Bacteria 3894
905 nmdc:mga06z11_18660_c1 3300050494 Bacteria 3173
906 nmdc:mga05p37_163993_c1 3300050507 Bacteria 2713
907 nmdc:mga05p37_16858_c1 3300050507 Bacteria 8808
908 nmdc:mga05p37_17862_c1 3300050507 Bacteria 8562
909 nmdc:mga05p37_231768_c1 3300050507 Bacteria 2224
910 nmdc:mga05p37_287343_c1 3300050507 Bacteria 1959
911 nmdc:mga05p37_40389_c1 3300050507 Bacteria 5730
912 nmdc:mga05p37_578_c1 3300050507 Bacteria 40238
913 nmdc:mga05p37_59858_c1 3300050507 Unclassified 4690
914 nmdc:mga09592_103701_c1 3300050508 Bacteria 2437
915 nmdc:mga09592_1636_c1 3300050508 Bacteria 18036
916 nmdc:mga09592_201363_c1 3300050508 Bacteria 1724
917 nmdc:mga09592_213560_c1 3300050508 Bacteria 1672
918 nmdc:mga09592_274253_c1 3300050508 Unclassified 1463
919 nmdc:mga09592_3930_c1 3300050508 Bacteria 11973
920 nmdc:mga09592_529_c1 3300050508 Bacteria 28853
921 nmdc:mga09592_5368_c1 3300050508 Bacteria 10419
922 nmdc:mga09592_54535_c1 3300050508 Unclassified 3377
923 nmdc:mga09592_82205_c1 3300050508 Bacteria 2745
924 nmdc:mga09592_93745_c1 3300050508 Bacteria 2568
925 nmdc:mga0qj67_1023_c1 3300050509 Bacteria 19334
926 nmdc:mga0qj67_163453_c1 3300050509 Bacteria 1807
927 nmdc:mga0qj67_171275_c1 3300050509 Bacteria 1763
928 nmdc:mga0qj67_171_c1 3300050509 Bacteria 43599
929 nmdc:mga0qj67_391859_c1 3300050509 Bacteria 1121
930 nmdc:mga06r32_104218_c1 3300050510 Bacteria 2785
931 nmdc:mga06r32_134128_c1 3300050510 Unclassified 2450
932 nmdc:mga06r32_157949_c1 3300050510 Bacteria 2250
933 nmdc:mga06r32_231940_c1 3300050510 Bacteria 1834
934 nmdc:mga06r32_274536_c1 3300050510 Bacteria 1673
935 nmdc:mga06r32_308_c1 3300050510 Bacteria 40566
936 nmdc:mga06r32_32719_c1 3300050510 Bacteria 4895
937 nmdc:mga06r32_457_c1 3300050510 Bacteria 34863
938 nmdc:mga06r32_642505_c1 3300050510 Bacteria 1030
939 nmdc:mga06r32_652918_c1 3300050510 Bacteria 1020
940 nmdc:mga06r32_6565_c1 3300050510 Bacteria 10451
941 nmdc:mga06r32_673_c1 3300050510 Bacteria 29768
942 nmdc:mga06r32_706290_c1 3300050510 Bacteria 974
943 nmdc:mga06r32_85194_c1 3300050510 Bacteria 3081
944 nmdc:mga06r32_92225_c1 3300050510 Bacteria 2961
945 nmdc:mga08y16_24463_c1 3300050511 Bacteria 6374
946 nmdc:mga08y16_26204_c1 3300050511 Bacteria 6148
947 nmdc:mga08y16_275912_c1 3300050511 Bacteria 1735
948 nmdc:mga08y16_304808_c1 3300050511 Bacteria 1641
949 nmdc:mga08y16_307815_c1 3300050511 Bacteria 1632
950 nmdc:mga08y16_334302_c1 3300050511 Bacteria 1558
951 nmdc:mga08y16_345251_c1 3300050511 Bacteria 1530
952 nmdc:mga08y16_36541_c1 3300050511 Bacteria 5159
953 nmdc:mga08y16_402576_c1 3300050511 Bacteria 1400
954 nmdc:mga08y16_482921_c1 3300050511 Bacteria 1261
955 nmdc:mga0n895_11714_c1 3300050512 Bacteria 7837
956 nmdc:mga0n895_145088_c1 3300050512 Bacteria 2403
957 nmdc:mga0n895_157936_c1 3300050512 Bacteria 2299
958 nmdc:mga0n895_247331_c1 3300050512 Bacteria 1810
959 nmdc:mga0n895_258275_c1 3300050512 Bacteria 1768
960 nmdc:mga0n895_284502_c1 3300050512 Bacteria 1676
961 nmdc:mga0n895_37143_c1 3300050512 Bacteria 4710
962 nmdc:mga0n895_395792_c1 3300050512 Bacteria 1397
963 nmdc:mga0n895_60709_c1 3300050512 Bacteria 3731
964 nmdc:mga0n895_890131_c1 3300050512 Bacteria 876
965 nmdc:mga0n895_97954_c1 3300050512 Bacteria 2939
966 nmdc:mga0rr50_223668_c1 3300050513 Bacteria 1555
967 nmdc:mga08x19_409287_c1 3300050514 Bacteria 952
968 nmdc:mga0a205_133457_c1 3300050515 Bacteria 2383
969 nmdc:mga0a205_195351_c1 3300050515 Bacteria 1914
970 nmdc:mga0a205_246756_c1 3300050515 Bacteria 1666
971 nmdc:mga0a205_358959_c1 3300050515 Bacteria 1324
972 nmdc:mga0a205_365456_c1 3300050515 Bacteria 1309
973 nmdc:mga0a205_478035_c1 3300050515 Bacteria 1104
974 nmdc:mga0a205_52331_c1 3300050515 Bacteria 3941
975 nmdc:mga0a205_59046_c1 3300050515 Bacteria 3706
976 nmdc:mga0a205_61195_c1 3300050515 Bacteria 3636
977 Ga0495601_0000008 3300053077 Bacteria 362152
978 Ga0495601_0001559 3300053077 Bacteria 12672
979 Ga0495601_0008686 3300053077 Bacteria 5994
980 Ga0495601_0010988 3300053077 Bacteria 5407
981 Ga0495601_0085827 3300053077 Bacteria 2023
982 Ga0495601_0161501 3300053077 Bacteria 1464
983 Ga0495601_0186008 3300053077 Bacteria 1358
984 Ga0495601_0272536 3300053077 Bacteria 1104
985 Ga0495612_0000026 3300053078 Bacteria 111627
986 Ga0495612_0005642 3300053078 Bacteria 5171
987 Ga0495595_0000024 3300053084 Bacteria 108008
988 Ga0495595_0004562 3300053084 Bacteria 5570
989 Ga0495595_0057640 3300053084 Bacteria 1812
990 Ga0495619_0000002 3300053085 Bacteria 530226
991 Ga0495619_0001277 3300053085 Bacteria 16520
992 Ga0495619_0006262 3300053085 Bacteria 7546
993 Ga0495619_0039945 3300053085 Bacteria 3065
994 Ga0495619_0078338 3300053085 Unclassified 2222
995 Ga0495619_0266546 3300053085 Bacteria 1187
996 Ga0500651_0117561 3300053093 Bacteria 1617
997 Ga0500641_0047437 3300053096 Bacteria 1756
998 Ga0500616_0096090 3300053153 Bacteria 1457
999 Ga0501084_0002329 3300054114 Bacteria 15261
1000 Ga0501084_0150306 3300054114 Bacteria 1963
1001 Ga0501084_0189071 3300054114 Bacteria 1737
1002 Ga0587093_001576 3300059478 Bacteria 1960
1003 Ga0587066_000440 3300059490 Bacteria 3334
1004 Ga0587075_000381 3300059644 Bacteria 3396
1005 Ga0587078_002060 3300059646 Bacteria 1908
1006 Ga0587111_0000520 3300060346 Bacteria 3744
1007 Ga0501082_0004557 3300060353 Bacteria 12097
1008 Ga0501082_0091037 3300060353 Bacteria 2634
1009 Ga0501082_0161732 3300060353 Bacteria 1946
1010 Ga0501082_0294225 3300060353 Bacteria 1414
1011 Ga0501082_0328814 3300060353 Bacteria 1332
1012 Ga0501082_0342397 3300060353 Bacteria 1303
1013 Ga0501082_0497413 3300060353 Bacteria 1066
1014 Ga0530510_0000001 3300061734 Bacteria 285623
1015 Ga0530510_0004611 3300061734 Bacteria 9532
1016 Ga0530510_0011725 3300061734 Bacteria 6152
1017 Ga0530510_0088355 3300061734 Bacteria 2259

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0080882 Ga0495600_0080882_1461_2096 207
2 3300049743 Ga0501081_0455651 Ga0501081_0455651_59_697 208
3 3300021388 Ga0213875_10033177 Ga0213875_100331772 211
4 3300025915 Ga0207693_10017116 Ga0207693_100171164 216
5 3300037853 Ga0436364_0790051 Ga0436364_0790051_1873_2778 216
6 3300005841 Ga0068863_100077315 Ga0068863_1000773152 220
7 3300026088 Ga0207641_10058449 Ga0207641_100584492 220
8 3300050512 nmdc:mga0n895_890131_c1 nmdc:mga0n895_890131_c1_10_702 225
9 3300039447 Ga0436361_0724946 Ga0436361_0724946_352_1140 226
10 3300046475 Ga0495639_0112738 Ga0495639_0112738_222_1028 230
11 3300005467 Ga0070706_100456100 Ga0070706_1004561001 232
12 3300005471 Ga0070698_100209625 Ga0070698_1002096252 232
13 3300025986 Ga0207658_10191795 Ga0207658_101917951 234
14 3300026067 Ga0207678_10141966 Ga0207678_101419662 234
15 3300049576 Ga0501040_0074209 Ga0501040_0074209_65_823 235
16 3300049577 Ga0501041_0130470 Ga0501041_0130470_626_1384 235
17 3300049580 Ga0501046_0271644 Ga0501046_0271644_122_880 235
18 3300049582 Ga0501048_0137931 Ga0501048_0137931_673_1431 235
19 3300060353 Ga0501082_0328814 Ga0501082_0328814_365_1123 235
20 3300061734 Ga0530510_0088355 Ga0530510_0088355_1197_1955 235
21 3300005564 Ga0070664_100766953 Ga0070664_1007669531 236
22 3300031507 Ga0307509_10071890 Ga0307509_100718902 236
23 3300014968 Ga0157379_10220305 Ga0157379_102203052 237
24 3300035692 Ga0373935_0012176 Ga0373935_0012176_3378_4121 237
25 3300005564 Ga0070664_100271514 Ga0070664_1002715142 238
26 3300009147 Ga0114129_11528689 Ga0114129_115286891 238
27 3300038443 Ga0395901_0544387 Ga0395901_0544387_356_1084 238
28 3300039450 Ga0436363_0833932 Ga0436363_0833932_519_1247 238
29 3300049572 Ga0501036_0011679 Ga0501036_0011679_2574_3302 238
30 3300049574 Ga0501038_0109451 Ga0501038_0109451_175_903 238
31 3300049575 Ga0501039_0034004 Ga0501039_0034004_1877_2605 238
32 3300049576 Ga0501040_0000995 Ga0501040_0000995_12940_13668 238
33 3300049577 Ga0501041_0017617 Ga0501041_0017617_657_1385 238
34 3300049578 Ga0501042_0011394 Ga0501042_0011394_2452_3180 238
35 3300049582 Ga0501048_0011738 Ga0501048_0011738_2721_3449 238
36 3300049588 Ga0501072_0011150 Ga0501072_0011150_2850_3578 238
37 3300049591 Ga0501075_0000059 Ga0501075_0000059_33465_34193 238
38 3300049592 Ga0501076_0000302 Ga0501076_0000302_10689_11417 238
39 3300049593 Ga0501077_0043474 Ga0501077_0043474_1733_2461 238
40 3300049741 Ga0501079_0007487 Ga0501079_0007487_1737_2465 238
41 3300049742 Ga0501080_0022370 Ga0501080_0022370_3780_4508 238
42 3300049743 Ga0501081_0002714 Ga0501081_0002714_4966_5694 238
43 3300049822 Ga0501035_0120363 Ga0501035_0120363_422_1150 238
44 3300054114 Ga0501084_0002329 Ga0501084_0002329_11293_12021 238
45 3300060353 Ga0501082_0004557 Ga0501082_0004557_9664_10392 238
46 3300061734 Ga0530510_0000001 Ga0530510_0000001_88306_89034 238
47 3300005329 Ga0070683_100304232 Ga0070683_1003042322 239
48 3300005445 Ga0070708_100037899 Ga0070708_1000378994 239
49 3300005458 Ga0070681_10067759 Ga0070681_100677593 239
50 3300005471 Ga0070698_100160045 Ga0070698_1001600453 239
51 3300005548 Ga0070665_100049009 Ga0070665_1000490094 239
52 3300005614 Ga0068856_100488644 Ga0068856_1004886442 239
53 3300005937 Ga0081455_10200913 Ga0081455_102009132 239
54 3300005983 Ga0081540_1051182 Ga0081540_10511821 239
55 3300006028 Ga0070717_10000508 Ga0070717_100005083 239
56 3300006028 Ga0070717_10403909 Ga0070717_104039092 239
57 3300006163 Ga0070715_10072632 Ga0070715_100726322 239
58 3300006173 Ga0070716_100343610 Ga0070716_1003436101 239
59 3300006175 Ga0070712_100266166 Ga0070712_1002661662 239
60 3300006175 Ga0070712_100380414 Ga0070712_1003804141 239
61 3300006846 Ga0075430_100004372 Ga0075430_10000437212 239
62 3300006871 Ga0075434_100031726 Ga0075434_1000317262 239
63 3300006871 Ga0075434_100287264 Ga0075434_1002872641 239
64 3300007788 Ga0099795_10132238 Ga0099795_101322382 239
65 3300009093 Ga0105240_10437551 Ga0105240_104375512 239
66 3300009094 Ga0111539_10677395 Ga0111539_106773952 239
67 3300010159 Ga0099796_10052250 Ga0099796_100522502 239
68 3300021388 Ga0213875_10000498 Ga0213875_1000049828 239
69 3300021388 Ga0213875_10002698 Ga0213875_1000269810 239
70 3300025898 Ga0207692_10178917 Ga0207692_101789172 239
71 3300025906 Ga0207699_10032557 Ga0207699_100325572 239
72 3300025906 Ga0207699_10205470 Ga0207699_102054702 239
73 3300025912 Ga0207707_10055373 Ga0207707_100553732 239
74 3300025915 Ga0207693_10017417 Ga0207693_100174175 239
75 3300025916 Ga0207663_10264211 Ga0207663_102642112 239
76 3300025916 Ga0207663_10398163 Ga0207663_103981632 239
77 3300025934 Ga0207686_10268353 Ga0207686_102683532 239
78 3300025941 Ga0207711_10452869 Ga0207711_104528692 239
79 3300025944 Ga0207661_10100788 Ga0207661_101007882 239
80 3300035111 Ga0373923_0221424 Ga0373923_0221424_132_863 239
81 3300035116 Ga0373945_0105445 Ga0373945_0105445_130_861 239
82 3300035171 Ga0373946_0191560 Ga0373946_0191560_37_768 239
83 3300035172 Ga0373955_0420628 Ga0373955_0420628_62_796 239
84 3300035410 Ga0373924_0040683 Ga0373924_0040683_308_1039 239
85 3300035695 Ga0373927_0054934 Ga0373927_0054934_1350_2087 239
86 3300035724 Ga0373933_0015184 Ga0373933_0015184_853_1584 239
87 3300036401 Ga0373937_0011822 Ga0373937_0011822_1399_2130 239
88 3300036401 Ga0373937_0051982 Ga0373937_0051982_1518_2255 239
89 3300036401 Ga0373937_0053663 Ga0373937_0053663_1747_2478 239
90 3300036401 Ga0373937_0102344 Ga0373937_0102344_364_1098 239
91 3300037068 Ga0373925_0200374 Ga0373925_0200374_422_1153 239
92 3300037068 Ga0373925_0246128 Ga0373925_0246128_93_830 239
93 3300037853 Ga0436364_0116063 Ga0436364_0116063_28829_29605 239
94 3300037853 Ga0436364_1167573 Ga0436364_1167573_698_1435 239
95 3300037853 Ga0436364_1414712 Ga0436364_1414712_2597_3331 239
96 3300039438 Ga0436360_0521374 Ga0436360_0521374_155_892 239
97 3300039438 Ga0436360_1043436 Ga0436360_1043436_505_1242 239
98 3300039447 Ga0436361_1073850 Ga0436361_1073850_543_1280 239
99 3300039450 Ga0436363_1260906 Ga0436363_1260906_83_820 239
100 3300039450 Ga0436363_1557386 Ga0436363_1557386_132_869 239
101 3300039453 Ga0436362_0976859 Ga0436362_0976859_104_841 239
102 3300044673 Ga0453683_0210344 Ga0453683_0210344_448_1185 239
103 3300046454 Ga0495592_0383981 Ga0495592_0383981_128_859 239
104 3300046499 Ga0495594_0207085 Ga0495594_0207085_260_997 239
105 3300046511 Ga0495608_0136303 Ga0495608_0136303_808_1539 239
106 3300046511 Ga0495608_0296983 Ga0495608_0296983_204_935 239
107 3300046514 Ga0495618_0042664 Ga0495618_0042664_430_1167 239
108 3300046529 Ga0495652_0107711 Ga0495652_0107711_1292_2023 239
109 3300046533 Ga0495640_0283651 Ga0495640_0283651_88_825 239
110 3300046536 Ga0495587_0023239 Ga0495587_0023239_1105_1836 239
111 3300046536 Ga0495587_0105693 Ga0495587_0105693_30_761 239
112 3300046559 Ga0495667_0032557 Ga0495667_0032557_1747_2478 239
113 3300046559 Ga0495667_0049591 Ga0495667_0049591_1372_2109 239
114 3300046642 Ga0495634_0048400 Ga0495634_0048400_204_941 239
115 3300046642 Ga0495634_0234240 Ga0495634_0234240_194_931 239
116 3300046663 Ga0495635_0030518 Ga0495635_0030518_1149_1886 239
117 3300046663 Ga0495635_0048550 Ga0495635_0048550_2055_2786 239
118 3300046663 Ga0495635_0352268 Ga0495635_0352268_93_830 239
119 3300046675 Ga0495657_0177179 Ga0495657_0177179_511_1242 239
120 3300046678 Ga0495599_0032207 Ga0495599_0032207_25_756 239
121 3300046678 Ga0495599_0142819 Ga0495599_0142819_403_1140 239
122 3300046680 Ga0495646_0311863 Ga0495646_0311863_89_820 239
123 3300046809 Ga0495600_0196539 Ga0495600_0196539_272_1009 239
124 3300047317 Ga0495604_0240144 Ga0495604_0240144_243_974 239
125 3300047322 Ga0495680_0357576 Ga0495680_0357576_58_789 239
126 3300047471 Ga0495684_0421958 Ga0495684_0421958_104_835 239
127 3300048088 Ga0495602_0004741 Ga0495602_0004741_1837_2568 239
128 3300049576 Ga0501040_0015514 Ga0501040_0015514_1878_2615 239
129 3300049577 Ga0501041_0058187 Ga0501041_0058187_1037_1774 239
130 3300049578 Ga0501042_0118816 Ga0501042_0118816_503_1240 239
131 3300050508 nmdc:mga09592_529_c1 nmdc:mga09592_529_c1_9735_10472 239
132 3300050510 nmdc:mga06r32_673_c1 nmdc:mga06r32_673_c1_28938_29675 239
133 3300050512 nmdc:mga0n895_97954_c1 nmdc:mga0n895_97954_c1_2146_2895 239
134 3300053077 Ga0495601_0001559 Ga0495601_0001559_3263_3994 239
135 3300053077 Ga0495601_0010988 Ga0495601_0010988_1865_2602 239
136 3300053077 Ga0495601_0186008 Ga0495601_0186008_34_765 239
137 3300053078 Ga0495612_0005642 Ga0495612_0005642_40_771 239
138 3300053084 Ga0495595_0057640 Ga0495595_0057640_406_1137 239
139 3300053085 Ga0495619_0006262 Ga0495619_0006262_3877_4614 239
140 3300053085 Ga0495619_0039945 Ga0495619_0039945_1681_2412 239
141 3300005336 Ga0070680_100281796 Ga0070680_1002817961 240
142 3300005434 Ga0070709_10406250 Ga0070709_104062501 240
143 3300005458 Ga0070681_10085961 Ga0070681_100859612 240
144 3300006028 Ga0070717_10616178 Ga0070717_106161782 240
145 3300013104 Ga0157370_10560401 Ga0157370_105604011 240
146 3300025906 Ga0207699_10345308 Ga0207699_103453081 240
147 3300025912 Ga0207707_10191248 Ga0207707_101912482 240
148 3300025917 Ga0207660_10399309 Ga0207660_103993092 240
149 3300027512 Ga0209179_1005644 Ga0209179_10056441 240
150 3300031247 Ga0265340_10002096 Ga0265340_100020964 240
151 3300031249 Ga0265339_10001221 Ga0265339_100012219 240
152 3300031712 Ga0265342_10000035 Ga0265342_1000003539 240
153 3300046459 Ga0495629_0190112 Ga0495629_0190112_335_1090 240
154 3300046473 Ga0495582_0082452 Ga0495582_0082452_432_1187 240
155 3300050512 nmdc:mga0n895_284502_c1 nmdc:mga0n895_284502_c1_277_1029 240
156 3300050514 nmdc:mga08x19_409287_c1 nmdc:mga08x19_409287_c1_152_904 240
157 3300005340 Ga0070689_100001712 Ga0070689_1000017129 242
158 3300005343 Ga0070687_100012756 Ga0070687_1000127562 242
159 3300005365 Ga0070688_100022506 Ga0070688_1000225064 242
160 3300005544 Ga0070686_100259615 Ga0070686_1002596152 242
161 3300005617 Ga0068859_100279634 Ga0068859_1002796343 242
162 3300005618 Ga0068864_100196892 Ga0068864_1001968922 242
163 3300005844 Ga0068862_100182770 Ga0068862_1001827703 242
164 3300006931 Ga0097620_100279624 Ga0097620_1002796243 242
165 3300009098 Ga0105245_10279932 Ga0105245_102799322 242
166 3300009176 Ga0105242_10239275 Ga0105242_102392752 242
167 3300009177 Ga0105248_10377773 Ga0105248_103777732 242
168 3300014325 Ga0163163_10005361 Ga0163163_100053614 242
169 3300014969 Ga0157376_10061010 Ga0157376_100610103 242
170 3300025936 Ga0207670_10001158 Ga0207670_100011589 242
171 3300025942 Ga0207689_10278216 Ga0207689_102782162 242
172 3300026095 Ga0207676_10021432 Ga0207676_100214323 242
173 3300027471 Ga0209995_1001114 Ga0209995_10011142 242
174 3300034957 Ga0373938_0002389 Ga0373938_0002389_2013_2888 242
175 3300035092 Ga0373952_0003300 Ga0373952_0003300_1471_2361 242
176 3300048911 Ga0496108_0023370 Ga0496108_0023370_679_1569 242
177 3300048915 Ga0496112_0239272 Ga0496112_0239272_556_1446 242
178 3300048916 Ga0496113_0141939 Ga0496113_0141939_310_1200 242
179 3300049575 Ga0501039_0315379 Ga0501039_0315379_205_957 242
180 3300049587 Ga0501071_0306412 Ga0501071_0306412_305_1057 242
181 3300049588 Ga0501072_0041410 Ga0501072_0041410_38_790 242
182 3300049592 Ga0501076_0109490 Ga0501076_0109490_1319_2071 242
183 3300049742 Ga0501080_0350061 Ga0501080_0350061_300_1052 242
184 3300049743 Ga0501081_0111241 Ga0501081_0111241_1149_1901 242
185 3300050512 nmdc:mga0n895_145088_c1 nmdc:mga0n895_145088_c1_1072_1815 242
186 3300050513 nmdc:mga0rr50_223668_c1 nmdc:mga0rr50_223668_c1_138_881 242
187 3300060353 Ga0501082_0091037 Ga0501082_0091037_1131_1883 242
188 3300006871 Ga0075434_100376443 Ga0075434_1003764432 243
189 3300035086 Ga0373934_0045836 Ga0373934_0045836_811_1584 243
190 3300035111 Ga0373923_0008125 Ga0373923_0008125_1991_2764 243
191 3300035113 Ga0373936_0000543 Ga0373936_0000543_5289_6062 243
192 3300035117 Ga0373953_0002974 Ga0373953_0002974_1900_2673 243
193 3300035118 Ga0373954_0001388 Ga0373954_0001388_3562_4335 243
194 3300035119 Ga0373956_0044968 Ga0373956_0044968_154_927 243
195 3300035170 Ga0373943_0006448 Ga0373943_0006448_336_1109 243
196 3300035171 Ga0373946_0012654 Ga0373946_0012654_1459_2232 243
197 3300035172 Ga0373955_0001296 Ga0373955_0001296_5819_6592 243
198 3300035410 Ga0373924_0002032 Ga0373924_0002032_2117_2890 243
199 3300035692 Ga0373935_0000053 Ga0373935_0000053_19988_20761 243
200 3300035695 Ga0373927_0003990 Ga0373927_0003990_4143_4916 243
201 3300035724 Ga0373933_0006420 Ga0373933_0006420_5267_6040 243
202 3300035725 Ga0373947_0000259 Ga0373947_0000259_28128_28901 243
203 3300036401 Ga0373937_0000030 Ga0373937_0000030_18905_19678 243
204 3300037068 Ga0373925_0000002 Ga0373925_0000002_46598_47371 243
205 3300046454 Ga0495592_0000046 Ga0495592_0000046_82241_83014 243
206 3300046459 Ga0495629_0145069 Ga0495629_0145069_756_1529 243
207 3300046462 Ga0495651_0000822 Ga0495651_0000822_4128_4901 243
208 3300046463 Ga0495653_0000006 Ga0495653_0000006_46644_47417 243
209 3300046473 Ga0495582_0064649 Ga0495582_0064649_187_960 243
210 3300046477 Ga0495664_0000002 Ga0495664_0000002_82278_83051 243
211 3300046511 Ga0495608_0000006 Ga0495608_0000006_131495_132268 243
212 3300046514 Ga0495618_0000034 Ga0495618_0000034_99457_100230 243
213 3300046516 Ga0495628_0000002 Ga0495628_0000002_46561_47334 243
214 3300046517 Ga0495630_0000662 Ga0495630_0000662_4160_4933 243
215 3300046529 Ga0495652_0000004 Ga0495652_0000004_541447_542220 243
216 3300046533 Ga0495640_0000007 Ga0495640_0000007_79181_79954 243
217 3300046536 Ga0495587_0000031 Ga0495587_0000031_46663_47436 243
218 3300046539 Ga0495621_0014292 Ga0495621_0014292_805_1653 243
219 3300046543 Ga0495645_0000003 Ga0495645_0000003_27914_28687 243
220 3300046559 Ga0495667_0000002 Ga0495667_0000002_390287_391060 243
221 3300046663 Ga0495635_0000022 Ga0495635_0000022_16946_17719 243
222 3300046675 Ga0495657_0000276 Ga0495657_0000276_20042_20815 243
223 3300046678 Ga0495599_0000001 Ga0495599_0000001_185341_186114 243
224 3300046679 Ga0495623_0000094 Ga0495623_0000094_27849_28622 243
225 3300046680 Ga0495646_0000007 Ga0495646_0000007_50691_51464 243
226 3300046689 Ga0495613_0005203 Ga0495613_0005203_2811_3584 243
227 3300046690 Ga0495624_0084366 Ga0495624_0084366_424_1197 243
228 3300046809 Ga0495600_0000033 Ga0495600_0000033_36251_37024 243
229 3300047317 Ga0495604_0000005 Ga0495604_0000005_72307_73080 243
230 3300047319 Ga0495674_0000003 Ga0495674_0000003_514690_515463 243
231 3300047322 Ga0495680_0000091 Ga0495680_0000091_53032_53805 243
232 3300047444 Ga0495675_0000064 Ga0495675_0000064_26799_27572 243
233 3300047471 Ga0495684_0000035 Ga0495684_0000035_27816_28589 243
234 3300048088 Ga0495602_0000029 Ga0495602_0000029_27806_28579 243
235 3300053077 Ga0495601_0000008 Ga0495601_0000008_275306_276079 243
236 3300053078 Ga0495612_0000026 Ga0495612_0000026_69880_70653 243
237 3300053084 Ga0495595_0000024 Ga0495595_0000024_27923_28696 243
238 3300053085 Ga0495619_0000002 Ga0495619_0000002_46666_47439 243
239 3300053085 Ga0495619_0266546 Ga0495619_0266546_277_1152 243
240 3300035120 Ga0373957_0001852 Ga0373957_0001852_3898_4683 244
241 3300035724 Ga0373933_0001972 Ga0373933_0001972_7267_8052 244
242 3300041512 Ga0451853_0295340 Ga0451853_0295340_33_908 244
243 3300053077 Ga0495601_0008686 Ga0495601_0008686_1401_2186 244
244 3300006852 Ga0075433_10394652 Ga0075433_103946521 245
245 3300006871 Ga0075434_100305621 Ga0075434_1003056212 245
246 3300035117 Ga0373953_0028233 Ga0373953_0028233_78_863 245
247 3300035172 Ga0373955_0003427 Ga0373955_0003427_165_950 245
248 3300036401 Ga0373937_0002031 Ga0373937_0002031_14151_14936 245
249 3300045051 Ga0451576_0162542 Ga0451576_0162542_1022_1882 245
250 3300046454 Ga0495592_0063065 Ga0495592_0063065_367_1152 245
251 3300046462 Ga0495651_0016074 Ga0495651_0016074_1612_2397 245
252 3300046463 Ga0495653_0090986 Ga0495653_0090986_854_1639 245
253 3300047317 Ga0495604_0076491 Ga0495604_0076491_1446_2231 245
254 3300047322 Ga0495680_0074954 Ga0495680_0074954_615_1400 245
255 3300050512 nmdc:mga0n895_247331_c1 nmdc:mga0n895_247331_c1_461_1321 245
256 3300050515 nmdc:mga0a205_365456_c1 nmdc:mga0a205_365456_c1_57_917 245
257 3300053084 Ga0495595_0004562 Ga0495595_0004562_2281_3066 245
258 3300053085 Ga0495619_0001277 Ga0495619_0001277_5006_5791 245
259 3300005354 Ga0070675_100354128 Ga0070675_1003541282 246
260 3300005468 Ga0070707_100092187 Ga0070707_1000921872 246
261 3300005548 Ga0070665_100023942 Ga0070665_1000239422 246
262 3300009177 Ga0105248_10042634 Ga0105248_100426346 246
263 3300025937 Ga0207669_10295440 Ga0207669_102954401 246
264 3300035410 Ga0373924_0033584 Ga0373924_0033584_12_815 246
265 3300038443 Ga0395901_0684383 Ga0395901_0684383_152_955 246
266 3300003911 JGI25405J52794_10000642 JGI25405J52794_100006422 247
267 3300005436 Ga0070713_100001818 Ga0070713_1000018189 247
268 3300005437 Ga0070710_10005916 Ga0070710_100059165 247
269 3300005439 Ga0070711_100012791 Ga0070711_1000127915 247
270 3300005614 Ga0068856_100066265 Ga0068856_1000662652 247
271 3300006028 Ga0070717_10159065 Ga0070717_101590652 247
272 3300006173 Ga0070716_100543921 Ga0070716_1005439211 247
273 3300006175 Ga0070712_100004011 Ga0070712_1000040119 247
274 3300006177 Ga0075362_10051383 Ga0075362_100513832 247
275 3300006195 Ga0075366_10080388 Ga0075366_100803883 247
276 3300006846 Ga0075430_100002737 Ga0075430_1000027379 247
277 3300006847 Ga0075431_100010541 Ga0075431_1000105419 247
278 3300006871 Ga0075434_100179083 Ga0075434_1001790832 247
279 3300006880 Ga0075429_100017929 Ga0075429_1000179298 247
280 3300009147 Ga0114129_10209081 Ga0114129_102090812 247
281 3300014325 Ga0163163_10042646 Ga0163163_100426461 247
282 3300025908 Ga0207643_10236080 Ga0207643_102360802 247
283 3300025945 Ga0207679_10377168 Ga0207679_103771681 247
284 3300028380 Ga0268265_10651112 Ga0268265_106511122 247
285 3300031901 Ga0307406_10737456 Ga0307406_107374561 247
286 3300031995 Ga0307409_100306152 Ga0307409_1003061521 247
287 3300032002 Ga0307416_100211485 Ga0307416_1002114851 247
288 3300035691 Ga0373931_0160678 Ga0373931_0160678_206_979 247
289 3300035692 Ga0373935_0114102 Ga0373935_0114102_27_842 247
290 3300048903 Ga0496100_0517799 Ga0496100_0517799_130_903 247
291 3300048907 Ga0496104_0152806 Ga0496104_0152806_345_1118 247
292 3300048912 Ga0496109_0116590 Ga0496109_0116590_340_1113 247
293 3300048918 Ga0496115_0244727 Ga0496115_0244727_669_1442 247
294 3300049527 Ga0501311_014377 Ga0501311_014377_180_938 247
295 3300050507 nmdc:mga05p37_287343_c1 nmdc:mga05p37_287343_c1_1155_1913 247
296 3300050508 nmdc:mga09592_5368_c1 nmdc:mga09592_5368_c1_5009_5782 247
297 3300050508 nmdc:mga09592_82205_c1 nmdc:mga09592_82205_c1_226_984 247
298 3300050509 nmdc:mga0qj67_1023_c1 nmdc:mga0qj67_1023_c1_9007_9780 247
299 3300050510 nmdc:mga06r32_308_c1 nmdc:mga06r32_308_c1_35574_36347 247
300 3300050510 nmdc:mga06r32_32719_c1 nmdc:mga06r32_32719_c1_3820_4578 247
301 3300050511 nmdc:mga08y16_304808_c1 nmdc:mga08y16_304808_c1_119_877 247
302 3300003215 JGI25153J46596_10000980 JGI25153J46596_1000098015 248
303 3300003911 JGI25405J52794_10000579 JGI25405J52794_100005793 248
304 3300004801 Ga0058860_10061687 Ga0058860_100616871 248
305 3300004801 Ga0058860_12023695 Ga0058860_120236951 248
306 3300004801 Ga0058860_12080127 Ga0058860_120801271 248
307 3300005295 Ga0065707_10052887 Ga0065707_100528871 248
308 3300005329 Ga0070683_100076228 Ga0070683_1000762284 248
309 3300005329 Ga0070683_100188352 Ga0070683_1001883522 248
310 3300005344 Ga0070661_100049691 Ga0070661_1000496913 248
311 3300005366 Ga0070659_100205046 Ga0070659_1002050461 248
312 3300005445 Ga0070708_100023270 Ga0070708_1000232705 248
313 3300005445 Ga0070708_100041980 Ga0070708_1000419801 248
314 3300005445 Ga0070708_100079289 Ga0070708_1000792893 248
315 3300005445 Ga0070708_100162362 Ga0070708_1001623622 248
316 3300005467 Ga0070706_100041310 Ga0070706_1000413103 248
317 3300005467 Ga0070706_100082271 Ga0070706_1000822714 248
318 3300005467 Ga0070706_100150633 Ga0070706_1001506332 248
319 3300005467 Ga0070706_100291570 Ga0070706_1002915701 248
320 3300005468 Ga0070707_100016720 Ga0070707_1000167201 248
321 3300005468 Ga0070707_100091058 Ga0070707_1000910585 248
322 3300005468 Ga0070707_100146059 Ga0070707_1001460592 248
323 3300005471 Ga0070698_100042952 Ga0070698_1000429524 248
324 3300005471 Ga0070698_100176052 Ga0070698_1001760522 248
325 3300005518 Ga0070699_100245674 Ga0070699_1002456741 248
326 3300005530 Ga0070679_100101735 Ga0070679_1001017352 248
327 3300005535 Ga0070684_100079407 Ga0070684_1000794073 248
328 3300005535 Ga0070684_100151539 Ga0070684_1001515392 248
329 3300005539 Ga0068853_100814216 Ga0068853_1008142161 248
330 3300005548 Ga0070665_100074587 Ga0070665_1000745873 248
331 3300005563 Ga0068855_100124391 Ga0068855_1001243912 248
332 3300005563 Ga0068855_100148869 Ga0068855_1001488694 248
333 3300005577 Ga0068857_100165748 Ga0068857_1001657483 248
334 3300005614 Ga0068856_100019721 Ga0068856_1000197213 248
335 3300005616 Ga0068852_100240551 Ga0068852_1002405512 248
336 3300005617 Ga0068859_100046003 Ga0068859_1000460032 248
337 3300005843 Ga0068860_100019692 Ga0068860_1000196926 248
338 3300005937 Ga0081455_10000418 Ga0081455_1000041830 248
339 3300005937 Ga0081455_10001315 Ga0081455_1000131515 248
340 3300005937 Ga0081455_10002053 Ga0081455_1000205325 248
341 3300005937 Ga0081455_10096981 Ga0081455_100969811 248
342 3300005981 Ga0081538_10146066 Ga0081538_101460661 248
343 3300005985 Ga0081539_10174064 Ga0081539_101740641 248
344 3300006194 Ga0075427_10005724 Ga0075427_100057241 248
345 3300006844 Ga0075428_100010863 Ga0075428_1000108632 248
346 3300006844 Ga0075428_100032851 Ga0075428_1000328512 248
347 3300006844 Ga0075428_100066107 Ga0075428_1000661074 248
348 3300006844 Ga0075428_100150368 Ga0075428_1001503682 248
349 3300006844 Ga0075428_100251285 Ga0075428_1002512852 248
350 3300006844 Ga0075428_100267326 Ga0075428_1002673262 248
351 3300006844 Ga0075428_100333364 Ga0075428_1003333642 248
352 3300006844 Ga0075428_100625157 Ga0075428_1006251571 248
353 3300006844 Ga0075428_100644001 Ga0075428_1006440011 248
354 3300006846 Ga0075430_100029545 Ga0075430_1000295453 248
355 3300006846 Ga0075430_100035787 Ga0075430_1000357876 248
356 3300006846 Ga0075430_100357510 Ga0075430_1003575101 248
357 3300006847 Ga0075431_100038421 Ga0075431_1000384212 248
358 3300006847 Ga0075431_100086499 Ga0075431_1000864994 248
359 3300006847 Ga0075431_100103518 Ga0075431_1001035182 248
360 3300006847 Ga0075431_100180513 Ga0075431_1001805132 248
361 3300006847 Ga0075431_100183018 Ga0075431_1001830183 248
362 3300006847 Ga0075431_100506636 Ga0075431_1005066361 248
363 3300006852 Ga0075433_10021818 Ga0075433_100218188 248
364 3300006852 Ga0075433_10095949 Ga0075433_100959491 248
365 3300006852 Ga0075433_10243633 Ga0075433_102436333 248
366 3300006852 Ga0075433_10621321 Ga0075433_106213211 248
367 3300006880 Ga0075429_100017090 Ga0075429_1000170901 248
368 3300006880 Ga0075429_100022663 Ga0075429_1000226637 248
369 3300006880 Ga0075429_100059942 Ga0075429_1000599421 248
370 3300006880 Ga0075429_100075368 Ga0075429_1000753681 248
371 3300006880 Ga0075429_100274146 Ga0075429_1002741462 248
372 3300006880 Ga0075429_100292310 Ga0075429_1002923101 248
373 3300006880 Ga0075429_100407619 Ga0075429_1004076191 248
374 3300006914 Ga0075436_100245266 Ga0075436_1002452661 248
375 3300006931 Ga0097620_100046004 Ga0097620_1000460042 248
376 3300007076 Ga0075435_100475383 Ga0075435_1004753832 248
377 3300009094 Ga0111539_10032319 Ga0111539_100323192 248
378 3300009094 Ga0111539_10330986 Ga0111539_103309862 248
379 3300009094 Ga0111539_10427569 Ga0111539_104275691 248
380 3300009101 Ga0105247_10253644 Ga0105247_102536442 248
381 3300009147 Ga0114129_10071358 Ga0114129_100713583 248
382 3300009147 Ga0114129_10075599 Ga0114129_100755992 248
383 3300009147 Ga0114129_10111234 Ga0114129_101112342 248
384 3300009147 Ga0114129_10115567 Ga0114129_101155673 248
385 3300009147 Ga0114129_10450159 Ga0114129_104501592 248
386 3300009147 Ga0114129_10597890 Ga0114129_105978902 248
387 3300009545 Ga0105237_10129363 Ga0105237_101293633 248
388 3300009551 Ga0105238_10070875 Ga0105238_100708754 248
389 3300009551 Ga0105238_10195703 Ga0105238_101957032 248
390 3300009553 Ga0105249_10182709 Ga0105249_101827092 248
391 3300009553 Ga0105249_10294679 Ga0105249_102946792 248
392 3300010375 Ga0105239_10256496 Ga0105239_102564962 248
393 3300013100 Ga0157373_10157606 Ga0157373_101576063 248
394 3300013104 Ga0157370_10149127 Ga0157370_101491272 248
395 3300013105 Ga0157369_10859717 Ga0157369_108597171 248
396 3300013306 Ga0163162_10053689 Ga0163162_100536893 248
397 3300013306 Ga0163162_10250062 Ga0163162_102500622 248
398 3300013307 Ga0157372_10110431 Ga0157372_101104313 248
399 3300013308 Ga0157375_10051102 Ga0157375_100511022 248
400 3300014325 Ga0163163_10063883 Ga0163163_100638834 248
401 3300014497 Ga0182008_10076783 Ga0182008_100767832 248
402 3300014968 Ga0157379_10011648 Ga0157379_100116483 248
403 3300020078 Ga0206352_10676952 Ga0206352_106769522 248
404 3300020080 Ga0206350_10268593 Ga0206350_102685932 248
405 3300020082 Ga0206353_10378285 Ga0206353_103782853 248
406 3300022467 Ga0224712_10004135 Ga0224712_100041353 248
407 3300025290 Ga0207673_1018854 Ga0207673_10188541 248
408 3300025297 Ga0209758_1000523 Ga0209758_100052368 248
409 3300025302 Ga0207426_1060373 Ga0207426_10603731 248
410 3300025900 Ga0207710_10167639 Ga0207710_101676392 248
411 3300025910 Ga0207684_10038926 Ga0207684_100389261 248
412 3300025910 Ga0207684_10040850 Ga0207684_100408501 248
413 3300025910 Ga0207684_10076272 Ga0207684_100762722 248
414 3300025910 Ga0207684_10142507 Ga0207684_101425071 248
415 3300025914 Ga0207671_10239926 Ga0207671_102399262 248
416 3300025915 Ga0207693_10273489 Ga0207693_102734892 248
417 3300025920 Ga0207649_10034408 Ga0207649_100344082 248
418 3300025921 Ga0207652_10103988 Ga0207652_101039882 248
419 3300025921 Ga0207652_10230292 Ga0207652_102302922 248
420 3300025922 Ga0207646_10028109 Ga0207646_100281094 248
421 3300025922 Ga0207646_10079635 Ga0207646_100796351 248
422 3300025922 Ga0207646_10126681 Ga0207646_101266811 248
423 3300025922 Ga0207646_10215507 Ga0207646_102155071 248
424 3300025924 Ga0207694_10159623 Ga0207694_101596232 248
425 3300025928 Ga0207700_10134359 Ga0207700_101343593 248
426 3300025928 Ga0207700_10761585 Ga0207700_107615851 248
427 3300025929 Ga0207664_10531251 Ga0207664_105312511 248
428 3300025932 Ga0207690_10162705 Ga0207690_101627052 248
429 3300025944 Ga0207661_10054190 Ga0207661_100541903 248
430 3300025944 Ga0207661_10171817 Ga0207661_101718172 248
431 3300025944 Ga0207661_10519340 Ga0207661_105193402 248
432 3300025949 Ga0207667_10183269 Ga0207667_101832692 248
433 3300025961 Ga0207712_10074195 Ga0207712_100741952 248
434 3300025961 Ga0207712_10223864 Ga0207712_102238642 248
435 3300026023 Ga0207677_10082806 Ga0207677_100828061 248
436 3300026075 Ga0207708_10106677 Ga0207708_101066771 248
437 3300026075 Ga0207708_10179578 Ga0207708_101795782 248
438 3300026078 Ga0207702_10296923 Ga0207702_102969232 248
439 3300026078 Ga0207702_10323983 Ga0207702_103239831 248
440 3300026142 Ga0207698_10025424 Ga0207698_100254244 248
441 3300027907 Ga0207428_10017007 Ga0207428_100170078 248
442 3300027907 Ga0207428_10185093 Ga0207428_101850932 248
443 3300027907 Ga0207428_10569867 Ga0207428_105698671 248
444 3300028379 Ga0268266_10055963 Ga0268266_100559632 248
445 3300028381 Ga0268264_10216680 Ga0268264_102166802 248
446 3300031595 Ga0265313_10073133 Ga0265313_100731331 248
447 3300031901 Ga0307406_10295878 Ga0307406_102958782 248
448 3300031901 Ga0307406_10325776 Ga0307406_103257761 248
449 3300032002 Ga0307416_100786288 Ga0307416_1007862881 248
450 3300032004 Ga0307414_10284462 Ga0307414_102844622 248
451 3300035083 Ga0373926_0023452 Ga0373926_0023452_507_1268 248
452 3300035171 Ga0373946_0057326 Ga0373946_0057326_451_1212 248
453 3300035692 Ga0373935_0058415 Ga0373935_0058415_986_1747 248
454 3300035695 Ga0373927_0188718 Ga0373927_0188718_350_1111 248
455 3300035695 Ga0373927_0363302 Ga0373927_0363302_177_926 248
456 3300035725 Ga0373947_0108107 Ga0373947_0108107_859_1620 248
457 3300036401 Ga0373937_0165925 Ga0373937_0165925_586_1347 248
458 3300036401 Ga0373937_0714988 Ga0373937_0714988_171_932 248
459 3300037068 Ga0373925_0013015 Ga0373925_0013015_5045_5806 248
460 3300037068 Ga0373925_0216552 Ga0373925_0216552_425_1186 248
461 3300037312 Ga0395899_0124497 Ga0395899_0124497_1080_1832 248
462 3300037418 Ga0395900_0024386 Ga0395900_0024386_2023_2775 248
463 3300037418 Ga0395900_0803020 Ga0395900_0803020_14_772 248
464 3300038443 Ga0395901_0009263 Ga0395901_0009263_6530_7282 248
465 3300038443 Ga0395901_0767182 Ga0395901_0767182_57_815 248
466 3300039437 Ga0436365_0297513 Ga0436365_0297513_229_990 248
467 3300039437 Ga0436365_1057670 Ga0436365_1057670_267_1028 248
468 3300039450 Ga0436363_0651762 Ga0436363_0651762_119_880 248
469 3300039453 Ga0436362_0220226 Ga0436362_0220226_494_1255 248
470 3300042993 Ga0439440_0068646 Ga0439440_0068646_41_799 248
471 3300044673 Ga0453683_0017377 Ga0453683_0017377_3159_3917 248
472 3300045976 Ga0466967_0199815 Ga0466967_0199815_807_1556 248
473 3300046454 Ga0495592_0191067 Ga0495592_0191067_343_1104 248
474 3300046533 Ga0495640_0142197 Ga0495640_0142197_195_956 248
475 3300046559 Ga0495667_0143668 Ga0495667_0143668_74_838 248
476 3300046642 Ga0495634_0176246 Ga0495634_0176246_448_1212 248
477 3300046663 Ga0495635_0094506 Ga0495635_0094506_419_1183 248
478 3300046678 Ga0495599_0231768 Ga0495599_0231768_98_859 248
479 3300046689 Ga0495613_0317316 Ga0495613_0317316_49_810 248
480 3300046692 Ga0495671_0099852 Ga0495671_0099852_246_1121 248
481 3300047445 Ga0495677_0045265 Ga0495677_0045265_725_1600 248
482 3300048907 Ga0496104_0713763 Ga0496104_0713763_105_854 248
483 3300048911 Ga0496108_0545867 Ga0496108_0545867_51_812 248
484 3300048917 Ga0496114_0091496 Ga0496114_0091496_1150_1899 248
485 3300049533 Ga0501317_008493 Ga0501317_008493_298_1056 248
486 3300049534 Ga0501318_011075 Ga0501318_011075_161_919 248
487 3300049537 Ga0501321_005571 Ga0501321_005571_394_1152 248
488 3300049571 Ga0501034_0138934 Ga0501034_0138934_520_1290 248
489 3300049572 Ga0501036_0127330 Ga0501036_0127330_151_909 248
490 3300049575 Ga0501039_0021841 Ga0501039_0021841_2416_3174 248
491 3300049576 Ga0501040_0242757 Ga0501040_0242757_192_950 248
492 3300049578 Ga0501042_0340267 Ga0501042_0340267_295_1059 248
493 3300049580 Ga0501046_0114167 Ga0501046_0114167_549_1307 248
494 3300049582 Ga0501048_0032626 Ga0501048_0032626_1229_1987 248
495 3300049582 Ga0501048_0328501 Ga0501048_0328501_296_1054 248
496 3300049589 Ga0501073_0246179 Ga0501073_0246179_264_1034 248
497 3300049589 Ga0501073_0290283 Ga0501073_0290283_241_999 248
498 3300049591 Ga0501075_0002900 Ga0501075_0002900_9598_10362 248
499 3300049591 Ga0501075_0016035 Ga0501075_0016035_3428_4186 248
500 3300049591 Ga0501075_0571537 Ga0501075_0571537_39_797 248
501 3300049592 Ga0501076_0013335 Ga0501076_0013335_1446_2210 248
502 3300049593 Ga0501077_0020718 Ga0501077_0020718_153_911 248
503 3300049741 Ga0501079_0251304 Ga0501079_0251304_497_1255 248
504 3300049741 Ga0501079_0286054 Ga0501079_0286054_378_1136 248
505 3300049742 Ga0501080_0129125 Ga0501080_0129125_127_891 248
506 3300049743 Ga0501081_0294897 Ga0501081_0294897_247_1005 248
507 3300049744 Ga0501083_0149014 Ga0501083_0149014_342_1100 248
508 3300049823 Ga0501044_0174924 Ga0501044_0174924_907_1677 248
509 3300050492 nmdc:mga0yw44_23402_c1 nmdc:mga0yw44_23402_c1_799_1695 248
510 3300050493 nmdc:mga0k408_18460_c1 nmdc:mga0k408_18460_c1_338_1084 248
511 3300050507 nmdc:mga05p37_163993_c1 nmdc:mga05p37_163993_c1_1291_2049 248
512 3300050507 nmdc:mga05p37_16858_c1 nmdc:mga05p37_16858_c1_1723_2481 248
513 3300050507 nmdc:mga05p37_17862_c1 nmdc:mga05p37_17862_c1_1762_2520 248
514 3300050507 nmdc:mga05p37_231768_c1 nmdc:mga05p37_231768_c1_544_1305 248
515 3300050507 nmdc:mga05p37_40389_c1 nmdc:mga05p37_40389_c1_1030_1788 248
516 3300050507 nmdc:mga05p37_59858_c1 nmdc:mga05p37_59858_c1_2231_3079 248
517 3300050508 nmdc:mga09592_103701_c1 nmdc:mga09592_103701_c1_930_1688 248
518 3300050508 nmdc:mga09592_1636_c1 nmdc:mga09592_1636_c1_11290_12048 248
519 3300050508 nmdc:mga09592_201363_c1 nmdc:mga09592_201363_c1_604_1362 248
520 3300050508 nmdc:mga09592_213560_c1 nmdc:mga09592_213560_c1_488_1246 248
521 3300050508 nmdc:mga09592_274253_c1 nmdc:mga09592_274253_c1_488_1336 248
522 3300050508 nmdc:mga09592_54535_c1 nmdc:mga09592_54535_c1_2500_3261 248
523 3300050508 nmdc:mga09592_93745_c1 nmdc:mga09592_93745_c1_923_1681 248
524 3300050509 nmdc:mga0qj67_163453_c1 nmdc:mga0qj67_163453_c1_685_1443 248
525 3300050509 nmdc:mga0qj67_171275_c1 nmdc:mga0qj67_171275_c1_598_1356 248
526 3300050509 nmdc:mga0qj67_391859_c1 nmdc:mga0qj67_391859_c1_78_953 248
527 3300050510 nmdc:mga06r32_104218_c1 nmdc:mga06r32_104218_c1_1370_2131 248
528 3300050510 nmdc:mga06r32_157949_c1 nmdc:mga06r32_157949_c1_517_1275 248
529 3300050510 nmdc:mga06r32_231940_c1 nmdc:mga06r32_231940_c1_591_1349 248
530 3300050510 nmdc:mga06r32_274536_c1 nmdc:mga06r32_274536_c1_844_1602 248
531 3300050510 nmdc:mga06r32_652918_c1 nmdc:mga06r32_652918_c1_12_770 248
532 3300050510 nmdc:mga06r32_6565_c1 nmdc:mga06r32_6565_c1_8842_9600 248
533 3300050510 nmdc:mga06r32_706290_c1 nmdc:mga06r32_706290_c1_50_808 248
534 3300050510 nmdc:mga06r32_85194_c1 nmdc:mga06r32_85194_c1_216_974 248
535 3300050510 nmdc:mga06r32_92225_c1 nmdc:mga06r32_92225_c1_1662_2438 248
536 3300050511 nmdc:mga08y16_24463_c1 nmdc:mga08y16_24463_c1_4307_5065 248
537 3300050511 nmdc:mga08y16_307815_c1 nmdc:mga08y16_307815_c1_814_1572 248
538 3300050511 nmdc:mga08y16_334302_c1 nmdc:mga08y16_334302_c1_74_832 248
539 3300050511 nmdc:mga08y16_345251_c1 nmdc:mga08y16_345251_c1_522_1277 248
540 3300050511 nmdc:mga08y16_36541_c1 nmdc:mga08y16_36541_c1_520_1269 248
541 3300050512 nmdc:mga0n895_157936_c1 nmdc:mga0n895_157936_c1_1312_2160 248
542 3300050512 nmdc:mga0n895_37143_c1 nmdc:mga0n895_37143_c1_3409_4167 248
543 3300050512 nmdc:mga0n895_395792_c1 nmdc:mga0n895_395792_c1_37_786 248
544 3300050515 nmdc:mga0a205_195351_c1 nmdc:mga0a205_195351_c1_1071_1832 248
545 3300050515 nmdc:mga0a205_52331_c1 nmdc:mga0a205_52331_c1_74_832 248
546 3300050515 nmdc:mga0a205_61195_c1 nmdc:mga0a205_61195_c1_583_1341 248
547 3300053077 Ga0495601_0161501 Ga0495601_0161501_371_1132 248
548 3300054114 Ga0501084_0150306 Ga0501084_0150306_841_1599 248
549 3300054114 Ga0501084_0189071 Ga0501084_0189071_131_895 248
550 3300059478 Ga0587093_001576 Ga0587093_001576_202_963 248
551 3300059490 Ga0587066_000440 Ga0587066_000440_202_963 248
552 3300059644 Ga0587075_000381 Ga0587075_000381_620_1381 248
553 3300059646 Ga0587078_002060 Ga0587078_002060_976_1737 248
554 3300060346 Ga0587111_0000520 Ga0587111_0000520_2865_3626 248
555 3300060353 Ga0501082_0161732 Ga0501082_0161732_970_1728 248
556 3300060353 Ga0501082_0294225 Ga0501082_0294225_199_957 248
557 3300060353 Ga0501082_0497413 Ga0501082_0497413_81_857 248
558 3300061734 Ga0530510_0004611 Ga0530510_0004611_1782_2540 248
559 3300061734 Ga0530510_0011725 Ga0530510_0011725_3937_4695 248
560 3300005290 Ga0065712_10116098 Ga0065712_101160981 249
561 3300005435 Ga0070714_100269103 Ga0070714_1002691031 249
562 3300005456 Ga0070678_100065791 Ga0070678_1000657912 249
563 3300005458 Ga0070681_10014225 Ga0070681_100142257 249
564 3300005530 Ga0070679_100446100 Ga0070679_1004461001 249
565 3300006051 Ga0075364_10039545 Ga0075364_100395451 249
566 3300006847 Ga0075431_100059560 Ga0075431_1000595603 249
567 3300035725 Ga0373947_0078493 Ga0373947_0078493_900_1835 249
568 3300048908 Ga0496105_0026574 Ga0496105_0026574_1293_2162 249
569 3300048909 Ga0496106_0033663 Ga0496106_0033663_2945_3814 249
570 3300048918 Ga0496115_0078034 Ga0496115_0078034_68_937 249
571 3300060353 Ga0501082_0342397 Ga0501082_0342397_236_1087 249
572 3300005353 Ga0070669_100024245 Ga0070669_1000242453 250
573 3300005434 Ga0070709_10273446 Ga0070709_102734461 250
574 3300005436 Ga0070713_100245791 Ga0070713_1002457912 250
575 3300005437 Ga0070710_10071614 Ga0070710_100716142 250
576 3300005437 Ga0070710_10224710 Ga0070710_102247102 250
577 3300005439 Ga0070711_100197101 Ga0070711_1001971012 250
578 3300006173 Ga0070716_100066344 Ga0070716_1000663443 250
579 3300006175 Ga0070712_100131478 Ga0070712_1001314783 250
580 3300025321 Ga0207656_10043114 Ga0207656_100431142 250
581 3300025898 Ga0207692_10133398 Ga0207692_101333982 250
582 3300025898 Ga0207692_10223781 Ga0207692_102237811 250
583 3300025915 Ga0207693_10030988 Ga0207693_100309884 250
584 3300025929 Ga0207664_10120292 Ga0207664_101202922 250
585 3300035170 Ga0373943_0206150 Ga0373943_0206150_129_1064 250
586 3300046537 Ga0495598_0006275 Ga0495598_0006275_1303_2178 250
587 3300046539 Ga0495621_0089291 Ga0495621_0089291_75_950 250
588 3300046664 Ga0495659_0008947 Ga0495659_0008947_92_967 250
589 3300046674 Ga0495588_0008543 Ga0495588_0008543_703_1578 250
590 3300047318 Ga0495636_0025653 Ga0495636_0025653_24_899 250
591 3300048090 Ga0495615_0019320 Ga0495615_0019320_210_1085 250
592 3300048914 Ga0496111_0093464 Ga0496111_0093464_659_1510 250
593 3300005356 Ga0070674_100092455 Ga0070674_1000924552 251
594 3300005435 Ga0070714_100369054 Ga0070714_1003690541 251
595 3300005440 Ga0070705_100228448 Ga0070705_1002284482 251
596 3300005937 Ga0081455_10041502 Ga0081455_100415023 251
597 3300006038 Ga0075365_10029750 Ga0075365_100297503 251
598 3300007788 Ga0099795_10016588 Ga0099795_100165881 251
599 3300010159 Ga0099796_10001978 Ga0099796_100019783 251
600 3300025936 Ga0207670_10239140 Ga0207670_102391402 251
601 3300026121 Ga0207683_10011965 Ga0207683_100119652 251
602 3300027512 Ga0209179_1017893 Ga0209179_10178932 251
603 3300031731 Ga0307405_10405273 Ga0307405_104052732 251
604 3300031911 Ga0307412_10201176 Ga0307412_102011762 251
605 3300046530 Ga0495654_0148259 Ga0495654_0148259_123_998 251
606 3300046684 Ga0495669_0030566 Ga0495669_0030566_646_1509 251
607 3300047323 Ga0495683_0078567 Ga0495683_0078567_55_930 251
608 3300049587 Ga0501071_0180918 Ga0501071_0180918_170_985 251
609 3300050489 nmdc:mga03683_849_c1 nmdc:mga03683_849_c1_1765_2532 251
610 3300005434 Ga0070709_10354792 Ga0070709_103547921 252
611 3300005467 Ga0070706_100562057 Ga0070706_1005620571 252
612 3300006173 Ga0070716_100013860 Ga0070716_1000138602 252
613 3300006175 Ga0070712_100441496 Ga0070712_1004414961 252
614 3300025905 Ga0207685_10008557 Ga0207685_100085571 252
615 3300025915 Ga0207693_10185034 Ga0207693_101850341 252
616 3300025928 Ga0207700_10057126 Ga0207700_100571261 252
617 3300025929 Ga0207664_10241747 Ga0207664_102417472 252
618 3300026035 Ga0207703_10066404 Ga0207703_100664042 252
619 3300026142 Ga0207698_10025926 Ga0207698_100259263 252
620 3300028800 Ga0265338_10005513 Ga0265338_100055138 252
621 3300031241 Ga0265325_10041154 Ga0265325_100411542 252
622 3300031247 Ga0265340_10059854 Ga0265340_100598542 252
623 3300031249 Ga0265339_10000126 Ga0265339_1000012631 252
624 3300031595 Ga0265313_10000844 Ga0265313_1000084430 252
625 3300033180 Ga0307510_10030926 Ga0307510_100309262 252
626 3300034957 Ga0373938_0017284 Ga0373938_0017284_370_1245 252
627 3300035088 Ga0373940_0044257 Ga0373940_0044257_120_995 252
628 3300035092 Ga0373952_0016312 Ga0373952_0016312_442_1317 252
629 3300035121 Ga0373960_0049121 Ga0373960_0049121_136_1011 252
630 3300035691 Ga0373931_0009119 Ga0373931_0009119_213_1088 252
631 3300046507 Ga0495606_0076311 Ga0495606_0076311_840_1715 252
632 3300046519 Ga0495632_0092412 Ga0495632_0092412_81_956 252
633 3300046533 Ga0495640_0021159 Ga0495640_0021159_3849_4703 252
634 3300047319 Ga0495674_0458762 Ga0495674_0458762_101_958 252
635 3300048904 Ga0496101_0457919 Ga0496101_0457919_31_894 252
636 3300048905 Ga0496102_0491735 Ga0496102_0491735_52_927 252
637 3300048906 Ga0496103_0097114 Ga0496103_0097114_178_1053 252
638 3300048908 Ga0496105_0003838 Ga0496105_0003838_5046_5921 252
639 3300048909 Ga0496106_0060627 Ga0496106_0060627_341_1216 252
640 3300048910 Ga0496107_0025460 Ga0496107_0025460_295_1170 252
641 3300048913 Ga0496110_0017500 Ga0496110_0017500_2675_3550 252
642 3300048915 Ga0496112_0218245 Ga0496112_0218245_846_1721 252
643 3300048917 Ga0496114_0044873 Ga0496114_0044873_1680_2555 252
644 3300049459 Ga0495678_025380 Ga0495678_025380_239_1114 252
645 3300005439 Ga0070711_100374934 Ga0070711_1003749341 253
646 3300005456 Ga0070678_100026011 Ga0070678_1000260112 253
647 3300005549 Ga0070704_100411765 Ga0070704_1004117651 253
648 3300006871 Ga0075434_100142922 Ga0075434_1001429222 253
649 3300009093 Ga0105240_10077293 Ga0105240_100772932 253
650 3300009094 Ga0111539_10073530 Ga0111539_100735301 253
651 3300009551 Ga0105238_10190186 Ga0105238_101901861 253
652 3300025913 Ga0207695_10108109 Ga0207695_101081092 253
653 3300025915 Ga0207693_10097559 Ga0207693_100975593 253
654 3300026121 Ga0207683_10089105 Ga0207683_100891053 253
655 3300027671 Ga0209588_1014115 Ga0209588_10141151 253
656 3300028379 Ga0268266_10093765 Ga0268266_100937652 253
657 3300031241 Ga0265325_10001561 Ga0265325_1000156110 253
658 3300031247 Ga0265340_10024688 Ga0265340_100246882 253
659 3300031247 Ga0265340_10159963 Ga0265340_101599631 253
660 3300035119 Ga0373956_0025815 Ga0373956_0025815_1443_2306 253
661 3300035695 Ga0373927_0006706 Ga0373927_0006706_1560_2354 253
662 3300035725 Ga0373947_0022302 Ga0373947_0022302_268_1128 253
663 3300035725 Ga0373947_0099192 Ga0373947_0099192_299_1093 253
664 3300037068 Ga0373925_0334062 Ga0373925_0334062_106_897 253
665 3300037853 Ga0436364_0518856 Ga0436364_0518856_1757_2617 253
666 3300039437 Ga0436365_0316468 Ga0436365_0316468_381_1241 253
667 3300039447 Ga0436361_0261761 Ga0436361_0261761_323_1183 253
668 3300046473 Ga0495582_0136768 Ga0495582_0136768_91_951 253
669 3300046475 Ga0495639_0061050 Ga0495639_0061050_665_1528 253
670 3300046517 Ga0495630_0470612 Ga0495630_0470612_47_907 253
671 3300046533 Ga0495640_0079911 Ga0495640_0079911_986_1846 253
672 3300046535 Ga0495586_0276195 Ga0495586_0276195_69_932 253
673 3300046642 Ga0495634_0222471 Ga0495634_0222471_237_1097 253
674 3300046683 Ga0495658_0018990 Ga0495658_0018990_309_1172 253
675 3300046683 Ga0495658_0308146 Ga0495658_0308146_37_963 253
676 3300048907 Ga0496104_0018833 Ga0496104_0018833_3258_4118 253
677 3300048917 Ga0496114_0060123 Ga0496114_0060123_2332_3141 253
678 3300048918 Ga0496115_0087655 Ga0496115_0087655_1640_2500 253
679 3300050511 nmdc:mga08y16_26204_c1 nmdc:mga08y16_26204_c1_2830_3693 253
680 3300050512 nmdc:mga0n895_60709_c1 nmdc:mga0n895_60709_c1_220_1083 253
681 3300050515 nmdc:mga0a205_358959_c1 nmdc:mga0a205_358959_c1_390_1253 253
682 3300053077 Ga0495601_0272536 Ga0495601_0272536_118_978 253
683 3300053085 Ga0495619_0078338 Ga0495619_0078338_758_1618 253
684 3300003215 JGI25153J46596_10000660 JGI25153J46596_1000066012 254
685 3300003659 JGI25404J52841_10004319 JGI25404J52841_100043194 254
686 3300005334 Ga0068869_100149941 Ga0068869_1001499412 254
687 3300005336 Ga0070680_100012393 Ga0070680_1000123933 254
688 3300005337 Ga0070682_100130458 Ga0070682_1001304582 254
689 3300005341 Ga0070691_10095973 Ga0070691_100959731 254
690 3300005347 Ga0070668_100264719 Ga0070668_1002647192 254
691 3300005347 Ga0070668_100592314 Ga0070668_1005923141 254
692 3300005353 Ga0070669_100052634 Ga0070669_1000526341 254
693 3300005355 Ga0070671_100198355 Ga0070671_1001983551 254
694 3300005355 Ga0070671_100227976 Ga0070671_1002279762 254
695 3300005355 Ga0070671_100421928 Ga0070671_1004219281 254
696 3300005356 Ga0070674_100069463 Ga0070674_1000694632 254
697 3300005356 Ga0070674_100184044 Ga0070674_1001840441 254
698 3300005406 Ga0070703_10062311 Ga0070703_100623111 254
699 3300005434 Ga0070709_10027715 Ga0070709_100277152 254
700 3300005434 Ga0070709_10028128 Ga0070709_100281283 254
701 3300005436 Ga0070713_100447612 Ga0070713_1004476121 254
702 3300005437 Ga0070710_10151469 Ga0070710_101514691 254
703 3300005438 Ga0070701_10123940 Ga0070701_101239402 254
704 3300005439 Ga0070711_100285425 Ga0070711_1002854252 254
705 3300005440 Ga0070705_100238846 Ga0070705_1002388461 254
706 3300005444 Ga0070694_100375942 Ga0070694_1003759422 254
707 3300005444 Ga0070694_100423221 Ga0070694_1004232211 254
708 3300005455 Ga0070663_100003746 Ga0070663_1000037464 254
709 3300005455 Ga0070663_100131359 Ga0070663_1001313591 254
710 3300005455 Ga0070663_100171937 Ga0070663_1001719372 254
711 3300005458 Ga0070681_10015634 Ga0070681_100156346 254
712 3300005466 Ga0070685_10156714 Ga0070685_101567141 254
713 3300005518 Ga0070699_100152525 Ga0070699_1001525251 254
714 3300005535 Ga0070684_100174935 Ga0070684_1001749353 254
715 3300005539 Ga0068853_100009933 Ga0068853_1000099333 254
716 3300005545 Ga0070695_100032790 Ga0070695_1000327903 254
717 3300005545 Ga0070695_100364046 Ga0070695_1003640461 254
718 3300005547 Ga0070693_100046413 Ga0070693_1000464132 254
719 3300005547 Ga0070693_100213790 Ga0070693_1002137901 254
720 3300005563 Ga0068855_100345913 Ga0068855_1003459132 254
721 3300005563 Ga0068855_100735858 Ga0068855_1007358581 254
722 3300005577 Ga0068857_100021961 Ga0068857_1000219614 254
723 3300005578 Ga0068854_100167695 Ga0068854_1001676951 254
724 3300005614 Ga0068856_100222275 Ga0068856_1002222753 254
725 3300005616 Ga0068852_100406863 Ga0068852_1004068631 254
726 3300005616 Ga0068852_100426777 Ga0068852_1004267772 254
727 3300005617 Ga0068859_100548623 Ga0068859_1005486232 254
728 3300005618 Ga0068864_100038231 Ga0068864_1000382315 254
729 3300005718 Ga0068866_10108439 Ga0068866_101084391 254
730 3300005719 Ga0068861_100345905 Ga0068861_1003459051 254
731 3300005842 Ga0068858_100250949 Ga0068858_1002509492 254
732 3300005937 Ga0081455_10006568 Ga0081455_1000656812 254
733 3300005983 Ga0081540_1003181 Ga0081540_10031816 254
734 3300005983 Ga0081540_1005915 Ga0081540_100591510 254
735 3300005983 Ga0081540_1009489 Ga0081540_10094892 254
736 3300005983 Ga0081540_1023383 Ga0081540_10233834 254
737 3300005983 Ga0081540_1072176 Ga0081540_10721762 254
738 3300005985 Ga0081539_10049231 Ga0081539_100492312 254
739 3300006028 Ga0070717_10285474 Ga0070717_102854741 254
740 3300006038 Ga0075365_10007763 Ga0075365_100077635 254
741 3300006038 Ga0075365_10232165 Ga0075365_102321652 254
742 3300006042 Ga0075368_10018756 Ga0075368_100187562 254
743 3300006048 Ga0075363_100002080 Ga0075363_1000020805 254
744 3300006175 Ga0070712_100017121 Ga0070712_1000171214 254
745 3300006178 Ga0075367_10045916 Ga0075367_100459164 254
746 3300006353 Ga0075370_10065259 Ga0075370_100652591 254
747 3300006358 Ga0068871_100239522 Ga0068871_1002395221 254
748 3300006844 Ga0075428_100075095 Ga0075428_1000750951 254
749 3300006844 Ga0075428_100184999 Ga0075428_1001849991 254
750 3300006844 Ga0075428_100207317 Ga0075428_1002073172 254
751 3300006847 Ga0075431_100093943 Ga0075431_1000939431 254
752 3300006852 Ga0075433_10233632 Ga0075433_102336322 254
753 3300006852 Ga0075433_10239031 Ga0075433_102390311 254
754 3300006871 Ga0075434_100003432 Ga0075434_1000034321 254
755 3300006871 Ga0075434_100079291 Ga0075434_1000792912 254
756 3300006881 Ga0068865_100109719 Ga0068865_1001097192 254
757 3300006881 Ga0068865_100299010 Ga0068865_1002990101 254
758 3300006914 Ga0075436_100273145 Ga0075436_1002731451 254
759 3300006931 Ga0097620_100548622 Ga0097620_1005486222 254
760 3300007265 Ga0099794_10004782 Ga0099794_100047824 254
761 3300009094 Ga0111539_10252629 Ga0111539_102526292 254
762 3300009094 Ga0111539_10344374 Ga0111539_103443742 254
763 3300009094 Ga0111539_10736348 Ga0111539_107363481 254
764 3300009147 Ga0114129_10006147 Ga0114129_100061471 254
765 3300009147 Ga0114129_10405755 Ga0114129_104057552 254
766 3300009148 Ga0105243_10365124 Ga0105243_103651241 254
767 3300009176 Ga0105242_10062722 Ga0105242_100627222 254
768 3300009177 Ga0105248_10045067 Ga0105248_100450672 254
769 3300009177 Ga0105248_10526754 Ga0105248_105267541 254
770 3300009545 Ga0105237_10274718 Ga0105237_102747183 254
771 3300009545 Ga0105237_10633181 Ga0105237_106331811 254
772 3300009551 Ga0105238_10362786 Ga0105238_103627862 254
773 3300009553 Ga0105249_10876774 Ga0105249_108767741 254
774 3300010159 Ga0099796_10032242 Ga0099796_100322422 254
775 3300011119 Ga0105246_10022952 Ga0105246_100229521 254
776 3300011119 Ga0105246_10091653 Ga0105246_100916533 254
777 3300013296 Ga0157374_10023559 Ga0157374_100235597 254
778 3300013296 Ga0157374_10171265 Ga0157374_101712652 254
779 3300013297 Ga0157378_10001940 Ga0157378_100019408 254
780 3300013297 Ga0157378_10092125 Ga0157378_100921251 254
781 3300013297 Ga0157378_10177848 Ga0157378_101778482 254
782 3300013306 Ga0163162_10213580 Ga0163162_102135803 254
783 3300013306 Ga0163162_10330755 Ga0163162_103307552 254
784 3300013308 Ga0157375_10307361 Ga0157375_103073611 254
785 3300014325 Ga0163163_10053277 Ga0163163_100532772 254
786 3300014325 Ga0163163_10407568 Ga0163163_104075681 254
787 3300014325 Ga0163163_10474655 Ga0163163_104746552 254
788 3300014497 Ga0182008_10154516 Ga0182008_101545161 254
789 3300014968 Ga0157379_10006693 Ga0157379_100066936 254
790 3300014968 Ga0157379_10209695 Ga0157379_102096951 254
791 3300014968 Ga0157379_10252556 Ga0157379_102525561 254
792 3300014969 Ga0157376_10342880 Ga0157376_103428802 254
793 3300017792 Ga0163161_10543954 Ga0163161_105439541 254
794 3300021384 Ga0213876_10034704 Ga0213876_100347041 254
795 3300021388 Ga0213875_10000009 Ga0213875_10000009147 254
796 3300025297 Ga0209758_1000772 Ga0209758_100077219 254
797 3300025885 Ga0207653_10039405 Ga0207653_100394053 254
798 3300025893 Ga0207682_10099526 Ga0207682_100995261 254
799 3300025898 Ga0207692_10147891 Ga0207692_101478912 254
800 3300025898 Ga0207692_10183182 Ga0207692_101831821 254
801 3300025901 Ga0207688_10159357 Ga0207688_101593572 254
802 3300025905 Ga0207685_10065834 Ga0207685_100658341 254
803 3300025906 Ga0207699_10047550 Ga0207699_100475503 254
804 3300025910 Ga0207684_10040262 Ga0207684_100402625 254
805 3300025911 Ga0207654_10237492 Ga0207654_102374922 254
806 3300025912 Ga0207707_10000826 Ga0207707_1000082611 254
807 3300025915 Ga0207693_10015489 Ga0207693_100154899 254
808 3300025915 Ga0207693_10035034 Ga0207693_100350342 254
809 3300025916 Ga0207663_10106228 Ga0207663_101062281 254
810 3300025916 Ga0207663_10127861 Ga0207663_101278611 254
811 3300025916 Ga0207663_10390693 Ga0207663_103906931 254
812 3300025917 Ga0207660_10006793 Ga0207660_100067933 254
813 3300025921 Ga0207652_10139669 Ga0207652_101396693 254
814 3300025922 Ga0207646_10461763 Ga0207646_104617631 254
815 3300025925 Ga0207650_10223482 Ga0207650_102234821 254
816 3300025926 Ga0207659_10129719 Ga0207659_101297192 254
817 3300025928 Ga0207700_10306219 Ga0207700_103062191 254
818 3300025929 Ga0207664_10040534 Ga0207664_100405342 254
819 3300025929 Ga0207664_10127460 Ga0207664_101274602 254
820 3300025931 Ga0207644_10116157 Ga0207644_101161572 254
821 3300025931 Ga0207644_10247275 Ga0207644_102472751 254
822 3300025931 Ga0207644_10407824 Ga0207644_104078241 254
823 3300025934 Ga0207686_10218201 Ga0207686_102182011 254
824 3300025938 Ga0207704_10030866 Ga0207704_100308663 254
825 3300025938 Ga0207704_10068732 Ga0207704_100687322 254
826 3300025939 Ga0207665_10041256 Ga0207665_100412562 254
827 3300025940 Ga0207691_10148033 Ga0207691_101480332 254
828 3300025940 Ga0207691_10153588 Ga0207691_101535882 254
829 3300025941 Ga0207711_10020274 Ga0207711_100202745 254
830 3300025942 Ga0207689_10065447 Ga0207689_100654473 254
831 3300025949 Ga0207667_10389928 Ga0207667_103899282 254
832 3300025972 Ga0207668_10159755 Ga0207668_101597552 254
833 3300025972 Ga0207668_10570888 Ga0207668_105708881 254
834 3300026035 Ga0207703_10059696 Ga0207703_100596962 254
835 3300026041 Ga0207639_10013284 Ga0207639_100132842 254
836 3300026067 Ga0207678_10022356 Ga0207678_100223564 254
837 3300026067 Ga0207678_10023373 Ga0207678_100233736 254
838 3300026067 Ga0207678_10061720 Ga0207678_100617203 254
839 3300026075 Ga0207708_10059185 Ga0207708_100591851 254
840 3300026075 Ga0207708_10080554 Ga0207708_100805543 254
841 3300026095 Ga0207676_10241401 Ga0207676_102414011 254
842 3300026116 Ga0207674_10029348 Ga0207674_100293483 254
843 3300026118 Ga0207675_100174232 Ga0207675_1001742321 254
844 3300026118 Ga0207675_100358227 Ga0207675_1003582271 254
845 3300026118 Ga0207675_100491048 Ga0207675_1004910481 254
846 3300026142 Ga0207698_10218050 Ga0207698_102180501 254
847 3300026142 Ga0207698_10239002 Ga0207698_102390022 254
848 3300027671 Ga0209588_1010243 Ga0209588_10102435 254
849 3300027866 Ga0209813_10037515 Ga0209813_100375151 254
850 3300028379 Ga0268266_10008924 Ga0268266_100089245 254
851 3300028379 Ga0268266_10386239 Ga0268266_103862391 254
852 3300028379 Ga0268266_10551608 Ga0268266_105516081 254
853 3300028573 Ga0265334_10052047 Ga0265334_100520472 254
854 3300030763 Ga0265763_1000743 Ga0265763_10007431 254
855 3300031018 Ga0265773_1000831 Ga0265773_10008311 254
856 3300031241 Ga0265325_10092934 Ga0265325_100929341 254
857 3300031249 Ga0265339_10032717 Ga0265339_100327172 254
858 3300031250 Ga0265331_10110721 Ga0265331_101107211 254
859 3300031711 Ga0265314_10191221 Ga0265314_101912212 254
860 3300031712 Ga0265342_10011621 Ga0265342_100116215 254
861 3300031852 Ga0307410_10328407 Ga0307410_103284072 254
862 3300034816 Ga0373930_0009760 Ga0373930_0009760_761_1636 254
863 3300034819 Ga0373958_0014116 Ga0373958_0014116_53_928 254
864 3300034820 Ga0373959_0002069 Ga0373959_0002069_1929_2804 254
865 3300034820 Ga0373959_0010829 Ga0373959_0010829_167_1042 254
866 3300034957 Ga0373938_0003206 Ga0373938_0003206_1087_1962 254
867 3300035088 Ga0373940_0024313 Ga0373940_0024313_548_1423 254
868 3300035089 Ga0373944_0091453 Ga0373944_0091453_27_902 254
869 3300035091 Ga0373951_0036107 Ga0373951_0036107_42_917 254
870 3300035111 Ga0373923_0060800 Ga0373923_0060800_43_855 254
871 3300035113 Ga0373936_0047359 Ga0373936_0047359_599_1474 254
872 3300035115 Ga0373941_0083401 Ga0373941_0083401_100_975 254
873 3300035116 Ga0373945_0075529 Ga0373945_0075529_127_1002 254
874 3300035117 Ga0373953_0075244 Ga0373953_0075244_513_1325 254
875 3300035118 Ga0373954_0006655 Ga0373954_0006655_822_1634 254
876 3300035119 Ga0373956_0042926 Ga0373956_0042926_158_970 254
877 3300035121 Ga0373960_0006938 Ga0373960_0006938_173_1048 254
878 3300035121 Ga0373960_0028381 Ga0373960_0028381_536_1411 254
879 3300035121 Ga0373960_0050417 Ga0373960_0050417_300_1175 254
880 3300035172 Ga0373955_0068572 Ga0373955_0068572_850_1725 254
881 3300035241 Ga0373961_0014464 Ga0373961_0014464_118_993 254
882 3300035410 Ga0373924_0037176 Ga0373924_0037176_181_993 254
883 3300035692 Ga0373935_0037806 Ga0373935_0037806_1277_2089 254
884 3300035692 Ga0373935_0569430 Ga0373935_0569430_19_783 254
885 3300035695 Ga0373927_0168063 Ga0373927_0168063_341_1216 254
886 3300035724 Ga0373933_0177325 Ga0373933_0177325_46_921 254
887 3300035725 Ga0373947_0007231 Ga0373947_0007231_3772_4584 254
888 3300035725 Ga0373947_0045158 Ga0373947_0045158_530_1405 254
889 3300036401 Ga0373937_0091262 Ga0373937_0091262_1599_2411 254
890 3300036401 Ga0373937_0244830 Ga0373937_0244830_278_1153 254
891 3300036459 Ga0372808_016532 Ga0372808_016532_159_1034 254
892 3300037068 Ga0373925_0044707 Ga0373925_0044707_1441_2352 254
893 3300037853 Ga0436364_0174146 Ga0436364_0174146_34911_35786 254
894 3300039437 Ga0436365_0502355 Ga0436365_0502355_1174_2151 254
895 3300039437 Ga0436365_0536902 Ga0436365_0536902_4786_5661 254
896 3300039437 Ga0436365_1534158 Ga0436365_1534158_61_852 254
897 3300039438 Ga0436360_0736047 Ga0436360_0736047_62_982 254
898 3300041451 Ga0451791_1395462 Ga0451791_1395462_14_889 254
899 3300042461 Ga0439460_0027138 Ga0439460_0027138_205_1038 254
900 3300044694 Ga0466963_0137965 Ga0466963_0137965_197_1069 254
901 3300045049 Ga0466959_0276615 Ga0466959_0276615_264_1139 254
902 3300045976 Ga0466967_0025189 Ga0466967_0025189_1308_2180 254
903 3300046453 Ga0495627_050764 Ga0495627_050764_64_939 254
904 3300046455 Ga0495603_0026171 Ga0495603_0026171_959_1834 254
905 3300046455 Ga0495603_0165408 Ga0495603_0165408_228_1109 254
906 3300046471 Ga0495650_0089444 Ga0495650_0089444_126_1001 254
907 3300046472 Ga0495580_0379804 Ga0495580_0379804_138_941 254
908 3300046474 Ga0495605_0032275 Ga0495605_0032275_737_1612 254
909 3300046474 Ga0495605_0154621 Ga0495605_0154621_28_903 254
910 3300046475 Ga0495639_0027441 Ga0495639_0027441_366_1178 254
911 3300046477 Ga0495664_0099885 Ga0495664_0099885_411_1223 254
912 3300046492 Ga0495585_0031747 Ga0495585_0031747_230_1042 254
913 3300046492 Ga0495585_0141051 Ga0495585_0141051_160_1035 254
914 3300046499 Ga0495594_0201253 Ga0495594_0201253_196_1071 254
915 3300046500 Ga0495596_0042107 Ga0495596_0042107_623_1498 254
916 3300046513 Ga0495616_0104194 Ga0495616_0104194_185_1060 254
917 3300046514 Ga0495618_0029155 Ga0495618_0029155_268_1080 254
918 3300046517 Ga0495630_0052129 Ga0495630_0052129_1929_2804 254
919 3300046517 Ga0495630_0164878 Ga0495630_0164878_448_1260 254
920 3300046517 Ga0495630_0446629 Ga0495630_0446629_103_978 254
921 3300046519 Ga0495632_0122309 Ga0495632_0122309_232_1107 254
922 3300046520 Ga0495637_0110886 Ga0495637_0110886_63_938 254
923 3300046526 Ga0495666_0121148 Ga0495666_0121148_10_885 254
924 3300046531 Ga0495665_0031706 Ga0495665_0031706_1015_1827 254
925 3300046533 Ga0495640_0118297 Ga0495640_0118297_162_974 254
926 3300046537 Ga0495598_0040224 Ga0495598_0040224_199_1074 254
927 3300046558 Ga0495633_0141254 Ga0495633_0141254_36_911 254
928 3300046559 Ga0495667_0171686 Ga0495667_0171686_283_1095 254
929 3300046616 Ga0495668_0228320 Ga0495668_0228320_28_903 254
930 3300046663 Ga0495635_0047055 Ga0495635_0047055_1119_1931 254
931 3300046663 Ga0495635_0113006 Ga0495635_0113006_1012_1824 254
932 3300046664 Ga0495659_0144296 Ga0495659_0144296_12_872 254
933 3300046689 Ga0495613_0099585 Ga0495613_0099585_715_1527 254
934 3300046689 Ga0495613_0110784 Ga0495613_0110784_771_1646 254
935 3300046690 Ga0495624_0377068 Ga0495624_0377068_16_780 254
936 3300046691 Ga0495670_0223965 Ga0495670_0223965_22_834 254
937 3300046794 Ga0495589_0166944 Ga0495589_0166944_86_961 254
938 3300047317 Ga0495604_0225285 Ga0495604_0225285_363_1238 254
939 3300047319 Ga0495674_0092387 Ga0495674_0092387_580_1392 254
940 3300047320 Ga0495672_0137765 Ga0495672_0137765_198_1085 254
941 3300047321 Ga0495676_0297060 Ga0495676_0297060_196_1008 254
942 3300047471 Ga0495684_0056398 Ga0495684_0056398_1213_2025 254
943 3300047471 Ga0495684_0139669 Ga0495684_0139669_39_914 254
944 3300047673 Ga0495593_0044108 Ga0495593_0044108_1538_2350 254
945 3300048089 Ga0495614_0129833 Ga0495614_0129833_281_1084 254
946 3300048091 Ga0495626_0146195 Ga0495626_0146195_22_897 254
947 3300048903 Ga0496100_0005415 Ga0496100_0005415_3162_4037 254
948 3300048903 Ga0496100_0016994 Ga0496100_0016994_3204_4079 254
949 3300048904 Ga0496101_0002908 Ga0496101_0002908_9423_10298 254
950 3300048905 Ga0496102_0034692 Ga0496102_0034692_653_1528 254
951 3300048905 Ga0496102_0176027 Ga0496102_0176027_268_1143 254
952 3300048905 Ga0496102_0288922 Ga0496102_0288922_352_1227 254
953 3300048906 Ga0496103_0104527 Ga0496103_0104527_334_1209 254
954 3300048907 Ga0496104_0000406 Ga0496104_0000406_11783_12712 254
955 3300048907 Ga0496104_0011780 Ga0496104_0011780_4975_5850 254
956 3300048907 Ga0496104_0046997 Ga0496104_0046997_3232_4044 254
957 3300048907 Ga0496104_0118048 Ga0496104_0118048_1313_2188 254
958 3300048908 Ga0496105_0006511 Ga0496105_0006511_68_943 254
959 3300048908 Ga0496105_0045525 Ga0496105_0045525_687_1616 254
960 3300048908 Ga0496105_0153463 Ga0496105_0153463_507_1382 254
961 3300048908 Ga0496105_0269211 Ga0496105_0269211_233_1105 254
962 3300048909 Ga0496106_0009563 Ga0496106_0009563_221_1096 254
963 3300048909 Ga0496106_0025869 Ga0496106_0025869_2780_3655 254
964 3300048910 Ga0496107_0065981 Ga0496107_0065981_100_972 254
965 3300048910 Ga0496107_0069604 Ga0496107_0069604_101_976 254
966 3300048910 Ga0496107_0198228 Ga0496107_0198228_328_1203 254
967 3300048911 Ga0496108_0121307 Ga0496108_0121307_358_1233 254
968 3300048911 Ga0496108_0266269 Ga0496108_0266269_417_1292 254
969 3300048912 Ga0496109_0028898 Ga0496109_0028898_1003_1878 254
970 3300048912 Ga0496109_0386913 Ga0496109_0386913_397_1272 254
971 3300048913 Ga0496110_0011457 Ga0496110_0011457_632_1507 254
972 3300048913 Ga0496110_0017778 Ga0496110_0017778_941_1816 254
973 3300048913 Ga0496110_0043652 Ga0496110_0043652_2831_3706 254
974 3300048914 Ga0496111_0188218 Ga0496111_0188218_511_1386 254
975 3300048915 Ga0496112_0018293 Ga0496112_0018293_575_1450 254
976 3300048915 Ga0496112_0086701 Ga0496112_0086701_1868_2743 254
977 3300048915 Ga0496112_0567934 Ga0496112_0567934_45_920 254
978 3300048916 Ga0496113_0080132 Ga0496113_0080132_1710_2474 254
979 3300048917 Ga0496114_0002985 Ga0496114_0002985_170_1045 254
980 3300048917 Ga0496114_0568657 Ga0496114_0568657_25_930 254
981 3300048918 Ga0496115_0019674 Ga0496115_0019674_1457_2332 254
982 3300048918 Ga0496115_0032525 Ga0496115_0032525_561_1445 254
983 3300048918 Ga0496115_0082880 Ga0496115_0082880_1345_2220 254
984 3300048921 Ga0496118_0242857 Ga0496118_0242857_33_920 254
985 3300048924 Ga0496121_0023126 Ga0496121_0023126_2862_3746 254
986 3300048924 Ga0496121_0051252 Ga0496121_0051252_1481_2356 254
987 3300048929 Ga0496126_0017149 Ga0496126_0017149_2055_2939 254
988 3300048929 Ga0496126_0039939 Ga0496126_0039939_749_1636 254
989 3300048929 Ga0496126_0109813 Ga0496126_0109813_1059_1847 254
990 3300048929 Ga0496126_0120611 Ga0496126_0120611_392_1183 254
991 3300049580 Ga0501046_0049382 Ga0501046_0049382_2512_3306 254
992 3300049584 Ga0501068_0095855 Ga0501068_0095855_610_1485 254
993 3300049586 Ga0501070_0111390 Ga0501070_0111390_810_1604 254
994 3300049742 Ga0501080_0062421 Ga0501080_0062421_1048_1842 254
995 3300050490 nmdc:mga03n38_870_c1 nmdc:mga03n38_870_c1_4743_5615 254
996 3300050491 nmdc:mga00v17_47431_c1 nmdc:mga00v17_47431_c1_431_1303 254
997 3300050492 nmdc:mga0yw44_16746_c1 nmdc:mga0yw44_16746_c1_1293_2165 254
998 3300050494 nmdc:mga06z11_18660_c1 nmdc:mga06z11_18660_c1_1209_2084 254
999 3300050507 nmdc:mga05p37_578_c1 nmdc:mga05p37_578_c1_22076_22951 254
1000 3300050508 nmdc:mga09592_3930_c1 nmdc:mga09592_3930_c1_7055_7930 254
1001 3300050509 nmdc:mga0qj67_171_c1 nmdc:mga0qj67_171_c1_29577_30428 254
1002 3300050510 nmdc:mga06r32_134128_c1 nmdc:mga06r32_134128_c1_219_1091 254
1003 3300050510 nmdc:mga06r32_457_c1 nmdc:mga06r32_457_c1_22043_22918 254
1004 3300050510 nmdc:mga06r32_642505_c1 nmdc:mga06r32_642505_c1_22_897 254
1005 3300050511 nmdc:mga08y16_275912_c1 nmdc:mga08y16_275912_c1_825_1700 254
1006 3300050511 nmdc:mga08y16_402576_c1 nmdc:mga08y16_402576_c1_11_901 254
1007 3300050511 nmdc:mga08y16_482921_c1 nmdc:mga08y16_482921_c1_306_1181 254
1008 3300050512 nmdc:mga0n895_11714_c1 nmdc:mga0n895_11714_c1_4334_5209 254
1009 3300050512 nmdc:mga0n895_258275_c1 nmdc:mga0n895_258275_c1_254_1129 254
1010 3300050515 nmdc:mga0a205_133457_c1 nmdc:mga0a205_133457_c1_1489_2364 254
1011 3300050515 nmdc:mga0a205_246756_c1 nmdc:mga0a205_246756_c1_88_963 254
1012 3300050515 nmdc:mga0a205_478035_c1 nmdc:mga0a205_478035_c1_317_1081 254
1013 3300050515 nmdc:mga0a205_59046_c1 nmdc:mga0a205_59046_c1_2304_3179 254
1014 3300053077 Ga0495601_0085827 Ga0495601_0085827_312_1175 254
1015 3300053093 Ga0500651_0117561 Ga0500651_0117561_72_947 254
1016 3300053096 Ga0500641_0047437 Ga0500641_0047437_734_1621 254
1017 3300053153 Ga0500616_0096090 Ga0500616_0096090_338_1213 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

49

230

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8096 6 133
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.744 4 246
8b6q-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 with an insertion of calmodulin-m13 fusion at position 154-156 that mimic the structure of caprola, an calcium gated protein labeling technology 0.7359 4 150
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7311 4 246
1c4x-assembly1.cif.gz_A 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1 0.7307 5 243
ID Description Score Start End Superfamily
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7637 6 130 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7622 4 119 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7321 19 133 3.40.50.1820
1c4xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7307 5 243 3.40.50.1820
2yysB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7283 5 252 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6ZPU4-F1-model_v4 Alpha/beta hydrolase 0.9986 8 253 GO:0016787
AF-A0A533ITP0-F1-model_v4 deleted 0.9983 1 253
AF-A0A537TW24-F1-model_v4 Alpha/beta hydrolase 0.9969 2 197 GO:0016787
AF-A0A537NFW6-F1-model_v4 Alpha/beta hydrolase 0.9961 3 190 GO:0016787
AF-A0A6N9BDZ1-F1-model_v4 Alpha/beta hydrolase 0.996 8 254 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.94 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map