F488262

General Info

Members Datasets Scaffolds Average Seq Length
1016 384 1003 100

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10000458|Ga0207704_100004588
Length 115
Sequence MSDDERWSPPVGPIDPEHPECAAVIAEVWTLLDGECTAETRDKLRHHLEECPTCLRYYGVEERVKSLIAKKCSGEKAPDRLRERLRIEISRTTIIRGKLRRKAPLGIGALSVICL

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
14 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
220 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
236 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
244 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
356 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
373 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
379 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
380 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.59
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.52
Nodule 0.1
Rhizoplane 10.63
Rhizosphere 65.75
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000300 3300000545 Bacteria 4777
2 CNXas_1005113 3300000545 Bacteria 928
3 JGI24746J21847_1011174 3300001977 Bacteria 1322
4 JGI24747J21853_1015315 3300001978 Bacteria 803
5 JGI24739J22299_10049710 3300001989 Bacteria 1358
6 JGI24737J22298_10012890 3300001990 Bacteria 2725
7 JGI24737J22298_10063782 3300001990 Bacteria 1106
8 JGI24737J22298_10239371 3300001990 Bacteria 536
9 JGI24743J22301_10122959 3300001991 Bacteria 570
10 JGI24750J21931_1010814 3300002070 Bacteria 1194
11 JGI24748J21848_1008609 3300002074 Bacteria 1200
12 JGI24748J21848_1042239 3300002074 Bacteria 582
13 JGI24749J21850_1027833 3300002076 Bacteria 807
14 JGI24744J21845_10000131 3300002077 Bacteria 10464
15 JGI24034J26672_10007839 3300002239 Bacteria 1554
16 JGI24742J22300_10000618 3300002244 Bacteria 5345
17 JGI24742J22300_10008441 3300002244 Bacteria 1699
18 JGI24751J29686_10011383 3300002459 Bacteria 1835
19 Ga0055528_1035658 3300003790 Bacteria 1203
20 Ga0055540_1000040 3300003792 Bacteria 157728
21 Ga0055540_1004993 3300003792 Bacteria 5768
22 Ga0055540_1024706 3300003792 Bacteria 1486
23 Ga0055540_1074105 3300003792 Bacteria 661
24 Ga0065704_10454399 3300005289 Bacteria 702
25 Ga0070676_10028426 3300005328 Bacteria 3176
26 Ga0070676_11392526 3300005328 Bacteria 538
27 Ga0070683_100183221 3300005329 Bacteria 1988
28 Ga0070690_100007203 3300005330 Bacteria 6364
29 Ga0070690_100730761 3300005330 Bacteria 763
30 Ga0070670_100086471 3300005331 Bacteria 2694
31 Ga0068869_100030180 3300005334 Bacteria 3804
32 Ga0068869_100267775 3300005334 Bacteria 1370
33 Ga0070666_10034273 3300005335 Bacteria 3365
34 Ga0070666_10845948 3300005335 Bacteria 675
35 Ga0070682_100047266 3300005337 Bacteria 2675
36 Ga0070682_100084985 3300005337 Bacteria 2057
37 Ga0070682_100210413 3300005337 Bacteria 1378
38 Ga0070682_100524732 3300005337 Bacteria 922
39 Ga0068868_100000203 3300005338 Bacteria 40057
40 Ga0068868_100131427 3300005338 Bacteria 2049
41 Ga0068868_100134492 3300005338 Bacteria 2025
42 Ga0068868_100635871 3300005338 Bacteria 949
43 Ga0068868_100826572 3300005338 Bacteria 838
44 Ga0070660_100954421 3300005339 Bacteria 724
45 Ga0070660_101627547 3300005339 Bacteria 550
46 Ga0070689_100054776 3300005340 Bacteria 3088
47 Ga0070689_101679834 3300005340 Bacteria 578
48 Ga0070691_10000914 3300005341 Bacteria 11972
49 Ga0070691_10134145 3300005341 Bacteria 1257
50 Ga0070687_100124024 3300005343 Bacteria 1482
51 Ga0070687_100549971 3300005343 Bacteria 785
52 Ga0070692_10216409 3300005345 Bacteria 1130
53 Ga0070692_10229364 3300005345 Bacteria 1102
54 Ga0070692_10796338 3300005345 Bacteria 645
55 Ga0070668_100000604 3300005347 Bacteria 24024
56 Ga0070668_100015315 3300005347 Bacteria 5729
57 Ga0070668_100053389 3300005347 Bacteria 3116
58 Ga0070668_100269506 3300005347 Bacteria 1419
59 Ga0070669_100000428 3300005353 Bacteria 32242
60 Ga0070669_100005387 3300005353 Bacteria 9228
61 Ga0070669_100211710 3300005353 Bacteria 1529
62 Ga0070675_100745249 3300005354 Bacteria 894
63 Ga0070671_100006503 3300005355 Bacteria 9343
64 Ga0070671_100043463 3300005355 Bacteria 3733
65 Ga0070671_100194584 3300005355 Bacteria 1719
66 Ga0070674_100000244 3300005356 Bacteria 26961
67 Ga0070674_100461193 3300005356 Bacteria 1051
68 Ga0070674_100626987 3300005356 Bacteria 911
69 Ga0070673_100304205 3300005364 Bacteria 1405
70 Ga0070688_100002188 3300005365 Bacteria 9856
71 Ga0070688_100026466 3300005365 Bacteria 3447
72 Ga0070659_100100888 3300005366 Bacteria 2323
73 Ga0070659_100636773 3300005366 Bacteria 918
74 Ga0070659_100680368 3300005366 Bacteria 889
75 Ga0070667_100000027 3300005367 Bacteria 181315
76 Ga0070667_100004957 3300005367 Bacteria 11153
77 Ga0070667_100016839 3300005367 Bacteria 6049
78 Ga0070667_100095421 3300005367 Bacteria 2564
79 Ga0070667_100123528 3300005367 Bacteria 2254
80 Ga0070667_100446306 3300005367 Bacteria 1182
81 Ga0070667_100448770 3300005367 Bacteria 1178
82 Ga0070667_101050879 3300005367 Bacteria 761
83 Ga0070703_10038930 3300005406 Bacteria 1472
84 Ga0070709_10056739 3300005434 Bacteria 2478
85 Ga0070709_10060096 3300005434 Bacteria 2415
86 Ga0070714_100018869 3300005435 Bacteria 5611
87 Ga0070714_100410244 3300005435 Bacteria 1282
88 Ga0070714_100705152 3300005435 Bacteria 974
89 Ga0070714_101606357 3300005435 Bacteria 635
90 Ga0070713_100118670 3300005436 Bacteria 2316
91 Ga0070710_10001501 3300005437 Bacteria 10996
92 Ga0070710_10014703 3300005437 Bacteria 3943
93 Ga0070710_11149494 3300005437 Bacteria 572
94 Ga0070701_10016528 3300005438 Bacteria 3433
95 Ga0070701_10394154 3300005438 Bacteria 876
96 Ga0070711_100001734 3300005439 Bacteria 12097
97 Ga0070711_100005574 3300005439 Bacteria 7537
98 Ga0070711_101509120 3300005439 Bacteria 586
99 Ga0070711_101877929 3300005439 Bacteria 526
100 Ga0070705_100004544 3300005440 Bacteria 6751
101 Ga0070705_100851348 3300005440 Bacteria 729
102 Ga0070700_100321132 3300005441 Bacteria 1137
103 Ga0070700_101227776 3300005441 Bacteria 627
104 Ga0070694_100004367 3300005444 Bacteria 8504
105 Ga0070694_100443404 3300005444 Bacteria 1024
106 Ga0070663_100021341 3300005455 Bacteria 4306
107 Ga0070663_100449770 3300005455 Bacteria 1061
108 Ga0070663_100952689 3300005455 Bacteria 744
109 Ga0070663_100969821 3300005455 Bacteria 738
110 Ga0070663_101257211 3300005455 Bacteria 652
111 Ga0070663_101855550 3300005455 Bacteria 541
112 Ga0070678_100001046 3300005456 Bacteria 14474
113 Ga0070678_100071210 3300005456 Bacteria 2602
114 Ga0070678_100478191 3300005456 Bacteria 1096
115 Ga0070678_101868519 3300005456 Bacteria 567
116 Ga0070662_100003739 3300005457 Bacteria 9524
117 Ga0070662_100196172 3300005457 Bacteria 1599
118 Ga0070662_101374459 3300005457 Bacteria 608
119 Ga0068867_100001211 3300005459 Bacteria 17725
120 Ga0068867_101418114 3300005459 Bacteria 644
121 Ga0068867_102030788 3300005459 Bacteria 544
122 Ga0070685_10505789 3300005466 Bacteria 856
123 Ga0070685_10525354 3300005466 Bacteria 841
124 Ga0070685_11002428 3300005466 Bacteria 627
125 Ga0070684_100281500 3300005535 Bacteria 1524
126 Ga0068853_100164539 3300005539 Bacteria 2004
127 Ga0068853_100849565 3300005539 Bacteria 875
128 Ga0070672_100034746 3300005543 Bacteria 3828
129 Ga0070672_100977005 3300005543 Bacteria 750
130 Ga0070686_100081511 3300005544 Bacteria 2143
131 Ga0070686_100577112 3300005544 Bacteria 883
132 Ga0070686_100807117 3300005544 Bacteria 757
133 Ga0070695_100002690 3300005545 Bacteria 10289
134 Ga0070695_100057660 3300005545 Bacteria 2510
135 Ga0070696_100004046 3300005546 Bacteria 9777
136 Ga0070693_100025200 3300005547 Bacteria 3199
137 Ga0070693_101118011 3300005547 Bacteria 602
138 Ga0070665_100046895 3300005548 Bacteria 4337
139 Ga0070665_100228267 3300005548 Bacteria 1862
140 Ga0070665_100235874 3300005548 Bacteria 1830
141 Ga0070665_100261070 3300005548 Bacteria 1733
142 Ga0070665_100993248 3300005548 Bacteria 852
143 Ga0070704_100002696 3300005549 Bacteria 10037
144 Ga0070704_100137889 3300005549 Bacteria 1900
145 Ga0068855_100181957 3300005563 Bacteria 2376
146 Ga0068855_100623678 3300005563 Bacteria 1161
147 Ga0068855_101245011 3300005563 Bacteria 772
148 Ga0068854_100000262 3300005578 Bacteria 35841
149 Ga0068854_100182885 3300005578 Bacteria 1638
150 Ga0068856_100558649 3300005614 Bacteria 1166
151 Ga0068856_102546793 3300005614 Bacteria 518
152 Ga0070702_100415830 3300005615 Bacteria 966
153 Ga0070702_101239923 3300005615 Bacteria 603
154 Ga0068852_100031689 3300005616 Bacteria 4367
155 Ga0068852_100210563 3300005616 Bacteria 1844
156 Ga0068852_102414700 3300005616 Bacteria 546
157 Ga0068859_100001466 3300005617 Bacteria 24023
158 Ga0068859_100002266 3300005617 Bacteria 19509
159 Ga0068859_100284757 3300005617 Bacteria 1745
160 Ga0068859_102927705 3300005617 Bacteria 522
161 Ga0068864_100093654 3300005618 Bacteria 2654
162 Ga0068864_101253565 3300005618 Bacteria 741
163 Ga0068866_10000681 3300005718 Bacteria 15451
164 Ga0068866_10066644 3300005718 Bacteria 1887
165 Ga0068866_10247575 3300005718 Bacteria 1089
166 Ga0068861_100013167 3300005719 Bacteria 5786
167 Ga0068861_100161744 3300005719 Bacteria 1847
168 Ga0068861_100179195 3300005719 Bacteria 1762
169 Ga0068861_101138994 3300005719 Bacteria 751
170 Ga0068861_101384194 3300005719 Bacteria 687
171 Ga0068851_10482902 3300005834 Bacteria 741
172 Ga0068851_10581628 3300005834 Bacteria 680
173 Ga0068870_10291984 3300005840 Bacteria 1026
174 Ga0068870_10862670 3300005840 Bacteria 637
175 Ga0068870_10983223 3300005840 Bacteria 601
176 Ga0068870_11397895 3300005840 Bacteria 513
177 Ga0068863_100003689 3300005841 Bacteria 15133
178 Ga0068863_100006164 3300005841 Bacteria 11758
179 Ga0068863_100869736 3300005841 Bacteria 901
180 Ga0068863_100950870 3300005841 Bacteria 861
181 Ga0068863_101677976 3300005841 Bacteria 645
182 Ga0068863_101838165 3300005841 Bacteria 616
183 Ga0068858_100001689 3300005842 Bacteria 22563
184 Ga0068858_100096341 3300005842 Bacteria 2757
185 Ga0068858_100126321 3300005842 Bacteria 2395
186 Ga0068858_100218475 3300005842 Bacteria 1805
187 Ga0068858_100547142 3300005842 Bacteria 1120
188 Ga0068858_101644456 3300005842 Bacteria 634
189 Ga0068858_101816941 3300005842 Bacteria 602
190 Ga0068860_100000141 3300005843 Bacteria 117843
191 Ga0068860_100001255 3300005843 Bacteria 27661
192 Ga0068860_100149757 3300005843 Bacteria 2247
193 Ga0068860_100197528 3300005843 Bacteria 1948
194 Ga0068860_102567264 3300005843 Bacteria 529
195 Ga0068860_102685411 3300005843 Bacteria 517
196 Ga0068862_100000138 3300005844 Bacteria 82578
197 Ga0068862_100001317 3300005844 Bacteria 23074
198 Ga0068862_100316850 3300005844 Bacteria 1438
199 Ga0068862_100746715 3300005844 Bacteria 952
200 Ga0068862_101109055 3300005844 Bacteria 787
201 Ga0081455_10036555 3300005937 Bacteria 4371
202 Ga0081455_10177818 3300005937 Bacteria 1614
203 Ga0081538_10035673 3300005981 Bacteria 3262
204 Ga0075365_10018382 3300006038 Bacteria 4297
205 Ga0075365_10046531 3300006038 Bacteria 2850
206 Ga0075365_10047539 3300006038 Bacteria 2821
207 Ga0075365_10055055 3300006038 Bacteria 2639
208 Ga0075365_10154536 3300006038 Bacteria 1597
209 Ga0075365_10286437 3300006038 Bacteria 1159
210 Ga0075365_10459401 3300006038 Bacteria 899
211 Ga0075365_10949959 3300006038 Bacteria 606
212 Ga0075365_11117835 3300006038 Bacteria 555
213 Ga0075368_10018592 3300006042 Bacteria 2612
214 Ga0075363_100025097 3300006048 Bacteria 3036
215 Ga0075363_100037020 3300006048 Bacteria 2561
216 Ga0075363_100040183 3300006048 Bacteria 2465
217 Ga0075363_100055671 3300006048 Bacteria 2119
218 Ga0075363_100058629 3300006048 Bacteria 2068
219 Ga0075363_100075522 3300006048 Bacteria 1836
220 Ga0075363_100127918 3300006048 Bacteria 1423
221 Ga0075363_100200914 3300006048 Bacteria 1139
222 Ga0075363_100337741 3300006048 Bacteria 878
223 Ga0075363_100897896 3300006048 Bacteria 542
224 Ga0075363_101027628 3300006048 Bacteria 509
225 Ga0075364_10001416 3300006051 Bacteria 13006
226 Ga0075364_10026321 3300006051 Bacteria 3710
227 Ga0075364_10038846 3300006051 Bacteria 3084
228 Ga0075364_10068636 3300006051 Bacteria 2332
229 Ga0075364_10078677 3300006051 Bacteria 2178
230 Ga0075364_10091412 3300006051 Bacteria 2019
231 Ga0075364_10103821 3300006051 Bacteria 1893
232 Ga0075364_10154835 3300006051 Bacteria 1546
233 Ga0075364_10176423 3300006051 Bacteria 1445
234 Ga0075364_10188648 3300006051 Bacteria 1396
235 Ga0075364_10304632 3300006051 Bacteria 1085
236 Ga0075364_10437265 3300006051 Bacteria 894
237 Ga0075364_10448407 3300006051 Bacteria 881
238 Ga0075364_10487519 3300006051 Bacteria 843
239 Ga0075364_10623698 3300006051 Bacteria 737
240 Ga0075364_11065817 3300006051 Bacteria 549
241 Ga0075432_10303066 3300006058 Bacteria 664
242 Ga0070715_10002294 3300006163 Bacteria 5830
243 Ga0070715_10405247 3300006163 Bacteria 759
244 Ga0070715_10416240 3300006163 Bacteria 751
245 Ga0070716_100001813 3300006173 Bacteria 9669
246 Ga0070716_100847150 3300006173 Bacteria 711
247 Ga0070716_101087791 3300006173 Bacteria 637
248 Ga0070712_100001225 3300006175 Bacteria 15514
249 Ga0070712_100004149 3300006175 Bacteria 8902
250 Ga0070712_100529520 3300006175 Bacteria 991
251 Ga0075362_10008854 3300006177 Bacteria 3868
252 Ga0075362_10058899 3300006177 Bacteria 1733
253 Ga0075362_10290559 3300006177 Bacteria 810
254 Ga0075362_10379157 3300006177 Bacteria 711
255 Ga0075367_10049248 3300006178 Bacteria 2483
256 Ga0075367_10226510 3300006178 Bacteria 1170
257 Ga0075367_10530305 3300006178 Bacteria 747
258 Ga0075369_10000571 3300006186 Bacteria 11638
259 Ga0075369_10002109 3300006186 Bacteria 7028
260 Ga0075369_10125352 3300006186 Bacteria 1164
261 Ga0075369_10138350 3300006186 Bacteria 1109
262 Ga0075369_10142413 3300006186 Bacteria 1094
263 Ga0075369_10218259 3300006186 Bacteria 882
264 Ga0075369_10268637 3300006186 Bacteria 793
265 Ga0075369_10490169 3300006186 Bacteria 584
266 Ga0075369_10517450 3300006186 Bacteria 568
267 Ga0075369_10546101 3300006186 Bacteria 553
268 Ga0075366_10147922 3300006195 Bacteria 1422
269 Ga0097621_100763541 3300006237 Bacteria 894
270 Ga0075370_10010995 3300006353 Bacteria 4746
271 Ga0075370_10049938 3300006353 Bacteria 2372
272 Ga0075370_10056762 3300006353 Bacteria 2225
273 Ga0075370_10065681 3300006353 Bacteria 2069
274 Ga0075370_10080869 3300006353 Bacteria 1867
275 Ga0075370_10130598 3300006353 Bacteria 1465
276 Ga0075370_10362970 3300006353 Bacteria 866
277 Ga0075370_10607977 3300006353 Bacteria 662
278 Ga0075370_10675245 3300006353 Bacteria 627
279 Ga0068871_100819008 3300006358 Bacteria 859
280 Ga0068871_100857918 3300006358 Bacteria 840
281 Ga0068871_101336655 3300006358 Bacteria 675
282 Ga0075428_100000939 3300006844 Bacteria 30809
283 Ga0075430_100059016 3300006846 Bacteria 3225
284 Ga0075430_100080000 3300006846 Bacteria 2738
285 Ga0075431_100021617 3300006847 Bacteria 6582
286 Ga0075434_100459143 3300006871 Bacteria 1295
287 Ga0075434_101693453 3300006871 Bacteria 640
288 Ga0068865_100004351 3300006881 Bacteria 8546
289 Ga0068865_100093332 3300006881 Bacteria 2188
290 Ga0068865_100550404 3300006881 Bacteria 969
291 Ga0097620_100001464 3300006931 Bacteria 24023
292 Ga0097620_100002267 3300006931 Bacteria 19509
293 Ga0097620_100284752 3300006931 Bacteria 1745
294 Ga0097620_102927781 3300006931 Bacteria 522
295 Ga0105251_10233167 3300009011 Bacteria 829
296 Ga0105250_10063025 3300009092 Bacteria 1492
297 Ga0105250_10084209 3300009092 Bacteria 1290
298 Ga0105250_10288945 3300009092 Bacteria 707
299 Ga0105240_11204609 3300009093 Bacteria 802
300 Ga0111539_13346294 3300009094 Bacteria 516
301 Ga0105245_10007730 3300009098 Bacteria 9417
302 Ga0105245_10674331 3300009098 Bacteria 1065
303 Ga0105245_11493368 3300009098 Bacteria 726
304 Ga0105247_10000237 3300009101 Bacteria 51740
305 Ga0105247_10000372 3300009101 Bacteria 38190
306 Ga0105247_10065096 3300009101 Bacteria 2267
307 Ga0105247_10066172 3300009101 Bacteria 2250
308 Ga0105247_10414385 3300009101 Bacteria 963
309 Ga0105247_11583189 3300009101 Bacteria 537
310 Ga0114129_10048020 3300009147 Bacteria 5998
311 Ga0114129_12826612 3300009147 Bacteria 576
312 Ga0105243_10000676 3300009148 Bacteria 33249
313 Ga0105241_10007378 3300009174 Bacteria 8089
314 Ga0105241_10149237 3300009174 Bacteria 1911
315 Ga0105241_10830079 3300009174 Bacteria 853
316 Ga0105241_11225082 3300009174 Bacteria 712
317 Ga0105242_10000197 3300009176 Bacteria 46948
318 Ga0105242_10208526 3300009176 Bacteria 1740
319 Ga0105242_10499514 3300009176 Bacteria 1157
320 Ga0105242_11927092 3300009176 Bacteria 632
321 Ga0105248_10000337 3300009177 Bacteria 55206
322 Ga0105248_10056212 3300009177 Bacteria 4415
323 Ga0105248_10087668 3300009177 Bacteria 3503
324 Ga0105248_10826344 3300009177 Bacteria 1046
325 Ga0105248_10898500 3300009177 Bacteria 1000
326 Ga0105248_11640690 3300009177 Bacteria 729
327 Ga0105237_10005565 3300009545 Bacteria 14206
328 Ga0105237_10015368 3300009545 Bacteria 7971
329 Ga0105237_10085017 3300009545 Bacteria 3153
330 Ga0105237_10689298 3300009545 Bacteria 1028
331 Ga0105237_11484663 3300009545 Bacteria 684
332 Ga0105238_10086299 3300009551 Bacteria 3126
333 Ga0105238_10317361 3300009551 Bacteria 1544
334 Ga0105238_10642662 3300009551 Bacteria 1071
335 Ga0105238_11043982 3300009551 Bacteria 839
336 Ga0105249_10000013 3300009553 Bacteria 283609
337 Ga0105249_10004426 3300009553 Bacteria 12148
338 Ga0105249_10022007 3300009553 Bacteria 5709
339 Ga0105249_10543436 3300009553 Bacteria 1212
340 Ga0105249_10816852 3300009553 Bacteria 997
341 Ga0099796_10010920 3300010159 Bacteria 2515
342 Ga0105239_10029337 3300010375 Bacteria 6048
343 Ga0105239_10032396 3300010375 Bacteria 5744
344 Ga0105239_10145014 3300010375 Bacteria 2647
345 Ga0105239_10690655 3300010375 Bacteria 1167
346 Ga0105239_10788219 3300010375 Bacteria 1089
347 Ga0105239_10996822 3300010375 Bacteria 963
348 Ga0105246_10217869 3300011119 Bacteria 1494
349 Ga0105246_10244744 3300011119 Bacteria 1420
350 Ga0105246_10667441 3300011119 Bacteria 907
351 Ga0157342_1068323 3300012507 Bacteria 536
352 Ga0157371_10312162 3300013102 Bacteria 1140
353 Ga0157371_11224263 3300013102 Bacteria 579
354 Ga0157369_10384304 3300013105 Bacteria 1457
355 Ga0157369_10631717 3300013105 Bacteria 1105
356 Ga0157374_10391860 3300013296 Bacteria 1384
357 Ga0157374_10694656 3300013296 Bacteria 1030
358 Ga0157378_10002889 3300013297 Bacteria 15295
359 Ga0157378_10036468 3300013297 Bacteria 4351
360 Ga0157378_10890388 3300013297 Bacteria 920
361 Ga0157378_11122549 3300013297 Bacteria 824
362 Ga0157378_12285943 3300013297 Bacteria 592
363 Ga0163162_10002808 3300013306 Bacteria 16565
364 Ga0163162_10091073 3300013306 Bacteria 3132
365 Ga0163162_10733765 3300013306 Bacteria 1108
366 Ga0163162_12823541 3300013306 Bacteria 559
367 Ga0157372_10006319 3300013307 Bacteria 12605
368 Ga0157372_10149591 3300013307 Bacteria 2694
369 Ga0157372_11466986 3300013307 Bacteria 786
370 Ga0157375_10017320 3300013308 Bacteria 6500
371 Ga0157375_10139581 3300013308 Bacteria 2550
372 Ga0157375_10225018 3300013308 Bacteria 2035
373 Ga0157375_10769970 3300013308 Bacteria 1113
374 Ga0157375_10786964 3300013308 Bacteria 1101
375 Ga0157375_11157478 3300013308 Bacteria 906
376 Ga0157375_11976728 3300013308 Bacteria 693
377 Ga0163163_10058326 3300014325 Bacteria 3817
378 Ga0163163_10191430 3300014325 Bacteria 2094
379 Ga0163163_10423346 3300014325 Bacteria 1390
380 Ga0163163_10756181 3300014325 Bacteria 1035
381 Ga0157380_10000136 3300014326 Bacteria 41118
382 Ga0157380_10249743 3300014326 Bacteria 1605
383 Ga0157380_10429896 3300014326 Bacteria 1262
384 Ga0157380_11649491 3300014326 Bacteria 698
385 Ga0157377_10175419 3300014745 Bacteria 1344
386 Ga0157377_10233756 3300014745 Bacteria 1183
387 Ga0157377_10863597 3300014745 Bacteria 673
388 Ga0157379_10038088 3300014968 Bacteria 4290
389 Ga0157379_10070088 3300014968 Bacteria 3136
390 Ga0157379_10130207 3300014968 Bacteria 2264
391 Ga0157379_11428335 3300014968 Bacteria 671
392 Ga0157376_10399308 3300014969 Bacteria 1329
393 Ga0157376_10444398 3300014969 Bacteria 1263
394 Ga0157376_12567272 3300014969 Bacteria 549
395 Ga0163161_10014033 3300017792 Bacteria 5578
396 Ga0163161_10083548 3300017792 Bacteria 2354
397 Ga0163161_10180097 3300017792 Bacteria 1620
398 Ga0163161_10839847 3300017792 Bacteria 774
399 Ga0163161_11408352 3300017792 Bacteria 609
400 Ga0213876_10530277 3300021384 Bacteria 627
401 Ga0209673_1028999 3300025273 Bacteria 1769
402 Ga0209025_1068996 3300025294 Bacteria 1266
403 Ga0209051_1000107 3300025303 Bacteria 157903
404 Ga0209051_1000122 3300025303 Bacteria 144507
405 Ga0209051_1001174 3300025303 Bacteria 23776
406 Ga0209051_1001471 3300025303 Bacteria 19929
407 Ga0209051_1022917 3300025303 Bacteria 2613
408 Ga0209051_1044453 3300025303 Bacteria 1546
409 Ga0207653_10243734 3300025885 Bacteria 687
410 Ga0207692_10001286 3300025898 Bacteria 9318
411 Ga0207692_10014299 3300025898 Bacteria 3465
412 Ga0207692_10283322 3300025898 Bacteria 1003
413 Ga0207642_10001214 3300025899 Bacteria 7975
414 Ga0207710_10000213 3300025900 Bacteria 51731
415 Ga0207710_10008148 3300025900 Bacteria 4424
416 Ga0207710_10185684 3300025900 Bacteria 1022
417 Ga0207710_10676890 3300025900 Bacteria 541
418 Ga0207688_10003068 3300025901 Bacteria 9113
419 Ga0207688_10005491 3300025901 Bacteria 6895
420 Ga0207688_10075820 3300025901 Bacteria 1915
421 Ga0207688_10753573 3300025901 Bacteria 617
422 Ga0207680_10072589 3300025903 Bacteria 2137
423 Ga0207680_10138610 3300025903 Bacteria 1611
424 Ga0207680_10338675 3300025903 Bacteria 1055
425 Ga0207685_10199934 3300025905 Bacteria 938
426 Ga0207685_10218094 3300025905 Bacteria 906
427 Ga0207699_10060695 3300025906 Bacteria 2272
428 Ga0207699_10417116 3300025906 Bacteria 958
429 Ga0207699_11478221 3300025906 Bacteria 503
430 Ga0207645_10004061 3300025907 Bacteria 10909
431 Ga0207643_10253687 3300025908 Bacteria 1084
432 Ga0207643_10487409 3300025908 Bacteria 787
433 Ga0207654_10077866 3300025911 Bacteria 1989
434 Ga0207654_10233114 3300025911 Bacteria 1227
435 Ga0207671_10014745 3300025914 Bacteria 6162
436 Ga0207671_10021340 3300025914 Bacteria 4914
437 Ga0207671_10031936 3300025914 Bacteria 3921
438 Ga0207693_10000507 3300025915 Bacteria 35136
439 Ga0207693_10003394 3300025915 Bacteria 13607
440 Ga0207663_10005170 3300025916 Bacteria 6565
441 Ga0207662_10211461 3300025918 Bacteria 1259
442 Ga0207662_10226473 3300025918 Bacteria 1219
443 Ga0207657_10023320 3300025919 Bacteria 5765
444 Ga0207657_10102233 3300025919 Bacteria 2377
445 Ga0207652_11251564 3300025921 Bacteria 644
446 Ga0207646_10399719 3300025922 Bacteria 1241
447 Ga0207681_10000866 3300025923 Bacteria 19891
448 Ga0207681_10042605 3300025923 Bacteria 3033
449 Ga0207681_10130610 3300025923 Bacteria 1857
450 Ga0207694_10145782 3300025924 Bacteria 1906
451 Ga0207694_10155070 3300025924 Bacteria 1847
452 Ga0207694_10837086 3300025924 Bacteria 777
453 Ga0207694_11660843 3300025924 Bacteria 538
454 Ga0207650_10109673 3300025925 Bacteria 2135
455 Ga0207659_10426038 3300025926 Bacteria 1114
456 Ga0207687_10009541 3300025927 Bacteria 6348
457 Ga0207687_10013417 3300025927 Bacteria 5349
458 Ga0207687_10350125 3300025927 Bacteria 1203
459 Ga0207664_10156204 3300025929 Bacteria 1942
460 Ga0207664_10396737 3300025929 Bacteria 1226
461 Ga0207664_10427349 3300025929 Bacteria 1180
462 Ga0207644_10027298 3300025931 Bacteria 3943
463 Ga0207644_10158883 3300025931 Bacteria 1755
464 Ga0207644_10197549 3300025931 Bacteria 1585
465 Ga0207644_10266659 3300025931 Bacteria 1371
466 Ga0207644_11423607 3300025931 Bacteria 582
467 Ga0207690_10132747 3300025932 Bacteria 1824
468 Ga0207690_10224812 3300025932 Bacteria 1438
469 Ga0207690_11020278 3300025932 Bacteria 688
470 Ga0207706_10001533 3300025933 Bacteria 22933
471 Ga0207686_10001322 3300025934 Bacteria 14150
472 Ga0207709_10085607 3300025935 Bacteria 2044
473 Ga0207709_10412239 3300025935 Bacteria 1036
474 Ga0207670_10104442 3300025936 Bacteria 2029
475 Ga0207670_11074164 3300025936 Bacteria 679
476 Ga0207670_11705969 3300025936 Bacteria 536
477 Ga0207670_11936265 3300025936 Bacteria 501
478 Ga0207669_10001482 3300025937 Bacteria 10023
479 Ga0207669_10158989 3300025937 Bacteria 1593
480 Ga0207669_10291106 3300025937 Bacteria 1237
481 Ga0207704_10000458 3300025938 Bacteria 18202
482 Ga0207704_10128721 3300025938 Bacteria 1748
483 Ga0207665_10005493 3300025939 Bacteria 8460
484 Ga0207665_10015885 3300025939 Bacteria 4942
485 Ga0207665_10887760 3300025939 Bacteria 707
486 Ga0207665_10901349 3300025939 Bacteria 701
487 Ga0207691_10391942 3300025940 Bacteria 1185
488 Ga0207691_10440882 3300025940 Bacteria 1109
489 Ga0207711_10000753 3300025941 Bacteria 31755
490 Ga0207711_10020273 3300025941 Bacteria 5541
491 Ga0207711_10112050 3300025941 Bacteria 2428
492 Ga0207711_10374239 3300025941 Bacteria 1321
493 Ga0207711_10997712 3300025941 Bacteria 777
494 Ga0207711_11023253 3300025941 Bacteria 766
495 Ga0207689_10012131 3300025942 Bacteria 7375
496 Ga0207689_10055897 3300025942 Bacteria 3247
497 Ga0207667_10319758 3300025949 Bacteria 1585
498 Ga0207667_10634600 3300025949 Bacteria 1075
499 Ga0207651_11705602 3300025960 Bacteria 567
500 Ga0207712_10000018 3300025961 Bacteria 317921
501 Ga0207712_10130790 3300025961 Bacteria 1913
502 Ga0207712_10269342 3300025961 Bacteria 1385
503 Ga0207712_10313007 3300025961 Bacteria 1293
504 Ga0207668_10000770 3300025972 Bacteria 19610
505 Ga0207668_10016773 3300025972 Bacteria 4578
506 Ga0207668_10208317 3300025972 Bacteria 1562
507 Ga0207668_10232143 3300025972 Bacteria 1488
508 Ga0207668_10723113 3300025972 Bacteria 876
509 Ga0207640_10049671 3300025981 Bacteria 2717
510 Ga0207640_10121950 3300025981 Bacteria 1869
511 Ga0207658_10000383 3300025986 Bacteria 43201
512 Ga0207658_10004854 3300025986 Bacteria 9293
513 Ga0207658_10010991 3300025986 Bacteria 6165
514 Ga0207658_10011237 3300025986 Bacteria 6100
515 Ga0207658_10890683 3300025986 Bacteria 810
516 Ga0207658_10917992 3300025986 Bacteria 797
517 Ga0207658_10971359 3300025986 Bacteria 774
518 Ga0207677_10002864 3300026023 Bacteria 9103
519 Ga0207677_10201803 3300026023 Bacteria 1581
520 Ga0207677_10364941 3300026023 Bacteria 1214
521 Ga0207677_10622158 3300026023 Bacteria 950
522 Ga0207703_10000920 3300026035 Bacteria 28669
523 Ga0207703_10013422 3300026035 Bacteria 6381
524 Ga0207703_10259384 3300026035 Bacteria 1571
525 Ga0207703_10543410 3300026035 Bacteria 1095
526 Ga0207703_10580612 3300026035 Bacteria 1059
527 Ga0207703_10716983 3300026035 Bacteria 952
528 Ga0207639_10005136 3300026041 Bacteria 8822
529 Ga0207639_10016036 3300026041 Bacteria 5292
530 Ga0207639_10973174 3300026041 Bacteria 794
531 Ga0207678_10003253 3300026067 Bacteria 14661
532 Ga0207678_10015024 3300026067 Bacteria 6812
533 Ga0207678_10670745 3300026067 Bacteria 911
534 Ga0207678_10904505 3300026067 Bacteria 780
535 Ga0207708_10351959 3300026075 Bacteria 1208
536 Ga0207702_10267532 3300026078 Bacteria 1611
537 Ga0207641_10002928 3300026088 Bacteria 15449
538 Ga0207641_10029024 3300026088 Bacteria 4573
539 Ga0207641_10414173 3300026088 Bacteria 1296
540 Ga0207641_11833624 3300026088 Bacteria 608
541 Ga0207648_10021128 3300026089 Bacteria 5852
542 Ga0207648_10028299 3300026089 Bacteria 4970
543 Ga0207648_12033040 3300026089 Bacteria 536
544 Ga0207676_10070294 3300026095 Bacteria 2807
545 Ga0207676_10188226 3300026095 Bacteria 1814
546 Ga0207676_11258609 3300026095 Bacteria 734
547 Ga0207676_11469946 3300026095 Bacteria 678
548 Ga0207675_100000544 3300026118 Bacteria 36830
549 Ga0207675_100015163 3300026118 Bacteria 7187
550 Ga0207675_100172690 3300026118 Bacteria 2067
551 Ga0207675_100517790 3300026118 Bacteria 1189
552 Ga0207675_101833233 3300026118 Bacteria 626
553 Ga0207683_10000335 3300026121 Bacteria 42789
554 Ga0207683_10057779 3300026121 Bacteria 3405
555 Ga0207683_10451543 3300026121 Bacteria 1185
556 Ga0207683_10614671 3300026121 Bacteria 1006
557 Ga0207683_12012714 3300026121 Bacteria 526
558 Ga0207698_10138786 3300026142 Bacteria 2090
559 Ga0207698_10153911 3300026142 Bacteria 2000
560 Ga0207698_10229905 3300026142 Bacteria 1683
561 Ga0207428_10533328 3300027907 Bacteria 850
562 Ga0268266_10032648 3300028379 Bacteria 4423
563 Ga0268266_10190460 3300028379 Bacteria 1872
564 Ga0268266_10378892 3300028379 Bacteria 1334
565 Ga0268266_10590424 3300028379 Bacteria 1066
566 Ga0268266_10652806 3300028379 Bacteria 1012
567 Ga0268266_12060892 3300028379 Bacteria 544
568 Ga0268265_10000159 3300028380 Bacteria 82592
569 Ga0268265_10044071 3300028380 Bacteria 3320
570 Ga0268265_10194523 3300028380 Bacteria 1754
571 Ga0268265_10756464 3300028380 Bacteria 943
572 Ga0268264_10000005 3300028381 Bacteria 934972
573 Ga0268264_10001041 3300028381 Bacteria 27858
574 Ga0268264_10294371 3300028381 Bacteria 1526
575 Ga0268264_10511651 3300028381 Bacteria 1172
576 Ga0268264_11975181 3300028381 Bacteria 593
577 Ga0265327_10004280 3300031251 Bacteria 12774
578 Ga0307513_10743679 3300031456 Bacteria 686
579 Ga0307408_100762940 3300031548 Bacteria 875
580 Ga0307413_10115722 3300031824 Bacteria 1805
581 Ga0307413_10377010 3300031824 Bacteria 1104
582 Ga0307413_10500894 3300031824 Bacteria 975
583 Ga0307410_10015784 3300031852 Bacteria 4488
584 Ga0307410_11122565 3300031852 Bacteria 682
585 Ga0307406_10048745 3300031901 Bacteria 2677
586 Ga0307406_10539594 3300031901 Bacteria 952
587 Ga0307412_10041003 3300031911 Bacteria 2998
588 Ga0307409_100000649 3300031995 Bacteria 15381
589 Ga0307409_101232462 3300031995 Bacteria 772
590 Ga0307416_100002172 3300032002 Bacteria 11117
591 Ga0307416_101879339 3300032002 Bacteria 702
592 Ga0307414_11351095 3300032004 Bacteria 662
593 Ga0307411_10124695 3300032005 Bacteria 1871
594 Ga0307411_10188989 3300032005 Bacteria 1571
595 Ga0307411_10216432 3300032005 Bacteria 1483
596 Ga0307415_100043135 3300032126 Bacteria 3007
597 Ga0316580_10169555 3300032139 Bacteria 671
598 Ga0316593_10147375 3300032168 Bacteria 855
599 Ga0316592_1084493 3300033524 Bacteria 724
600 Ga0316596_1078760 3300033541 Bacteria 885
601 Ga0373949_0138647 3300035090 Bacteria 695
602 Ga0373951_0102485 3300035091 Bacteria 762
603 Ga0373943_0268297 3300035170 Bacteria 962
604 Ga0373962_0048327 3300035242 Bacteria 1220
605 Ga0373931_0042807 3300035691 Bacteria 2382
606 Ga0373931_0276572 3300035691 Bacteria 1029
607 Ga0373937_0616162 3300036401 Bacteria 1030
608 Ga0316584_0073524 3300036712 Bacteria 2562
609 Ga0436365_1279297 3300039437 Bacteria 559
610 Ga0436363_0907136 3300039450 Bacteria 886
611 Ga0436363_1032215 3300039450 Bacteria 2224
612 Ga0436363_1100965 3300039450 Bacteria 3035
613 Ga0439461_0017272 3300041410 Bacteria 1401
614 Ga0439461_0164438 3300041410 Bacteria 580
615 Ga0439466_0003336 3300041411 Bacteria 6244
616 Ga0439466_0005429 3300041411 Bacteria 4872
617 Ga0439466_0021376 3300041411 Bacteria 2294
618 Ga0439466_0044833 3300041411 Bacteria 1464
619 Ga0439465_0002390 3300041413 Bacteria 6141
620 Ga0439465_0007690 3300041413 Bacteria 3420
621 Ga0439465_0050299 3300041413 Bacteria 1363
622 Ga0451789_0678462 3300041443 Bacteria 895
623 Ga0451789_0888216 3300041443 Bacteria 1292
624 Ga0451794_05147 3300041446 Bacteria 562
625 Ga0451793_0184391 3300041452 Bacteria 2532
626 Ga0451793_0614440 3300041452 Bacteria 634
627 Ga0451797_1156091 3300041453 Bacteria 509
628 Ga0451798_0260113 3300041458 Bacteria 942
629 Ga0451802_1339380 3300041460 Bacteria 1854
630 Ga0451802_1992298 3300041460 Bacteria 641
631 Ga0451807_1241670 3300041486 Bacteria 1189
632 Ga0451841_0303713 3300041498 Bacteria 576
633 Ga0451841_1061137 3300041498 Bacteria 1461
634 Ga0451847_0431962 3300041503 Bacteria 843
635 Ga0451847_0576711 3300041503 Bacteria 842
636 Ga0451843_0772406 3300041509 Bacteria 724
637 Ga0451853_1496362 3300041512 Bacteria 521
638 Ga0439431_0000416 3300041997 Bacteria 8993
639 Ga0439431_0066392 3300041997 Bacteria 956
640 Ga0439442_034471 3300042002 Bacteria 1058
641 Ga0439442_082748 3300042002 Bacteria 688
642 Ga0439445_0001277 3300042004 Bacteria 5451
643 Ga0439445_0006277 3300042004 Bacteria 2730
644 Ga0439445_0009255 3300042004 Bacteria 2319
645 Ga0439448_0035093 3300042005 Bacteria 1605
646 Ga0439450_151198 3300042008 Bacteria 609
647 Ga0439434_0001827 3300042435 Bacteria 6189
648 Ga0439434_0002991 3300042435 Bacteria 4949
649 Ga0439434_0065829 3300042435 Bacteria 1137
650 Ga0439434_0112473 3300042435 Bacteria 883
651 Ga0466972_0014330 3300044658 Bacteria 3972
652 Ga0466972_0014708 3300044658 Bacteria 3915
653 Ga0466972_0044291 3300044658 Bacteria 2159
654 Ga0466972_0120226 3300044658 Bacteria 1239
655 Ga0466972_0566073 3300044658 Bacteria 536
656 Ga0466965_0002913 3300044683 Bacteria 7397
657 Ga0466965_0008663 3300044683 Bacteria 4708
658 Ga0466965_0029923 3300044683 Bacteria 2651
659 Ga0466965_0083523 3300044683 Bacteria 1617
660 Ga0466965_0102931 3300044683 Bacteria 1461
661 Ga0466965_0235939 3300044683 Bacteria 978
662 Ga0466965_0248482 3300044683 Bacteria 954
663 Ga0466965_0356052 3300044683 Bacteria 802
664 Ga0466961_0074698 3300044693 Bacteria 2149
665 Ga0466963_0228127 3300044694 Bacteria 1305
666 Ga0466964_0190974 3300044706 Bacteria 977
667 Ga0466971_0092650 3300044719 Bacteria 1384
668 Ga0466968_0004772 3300044735 Bacteria 5075
669 Ga0466968_0039664 3300044735 Bacteria 1983
670 Ga0466968_0048793 3300044735 Bacteria 1802
671 Ga0466970_0021122 3300044765 Bacteria 3388
672 Ga0466970_0027961 3300044765 Bacteria 2962
673 Ga0466970_0204061 3300044765 Bacteria 1100
674 Ga0466970_0223349 3300044765 Bacteria 1051
675 Ga0466970_0299152 3300044765 Bacteria 907
676 Ga0466970_0379278 3300044765 Bacteria 805
677 Ga0466957_0292223 3300044842 Bacteria 1093
678 Ga0466957_0311111 3300044842 Bacteria 1060
679 Ga0466957_0312379 3300044842 Bacteria 1059
680 Ga0466960_0001158 3300044901 Bacteria 9481
681 Ga0466960_0006575 3300044901 Bacteria 4669
682 Ga0466960_0282784 3300044901 Bacteria 930
683 Ga0466959_0030872 3300045049 Bacteria 3967
684 Ga0466959_0124827 3300045049 Bacteria 1827
685 Ga0466958_0079095 3300045836 Bacteria 2021
686 Ga0466967_0006912 3300045976 Bacteria 8109
687 Ga0466967_0032235 3300045976 Bacteria 4422
688 Ga0466967_0167085 3300045976 Bacteria 2068
689 Ga0466967_0176662 3300045976 Bacteria 2012
690 Ga0466967_0304473 3300045976 Bacteria 1534
691 Ga0466967_1395681 3300045976 Bacteria 698
692 Ga0495603_0049300 3300046455 Bacteria 2507
693 Ga0495629_0201647 3300046459 Bacteria 1375
694 Ga0495638_0007924 3300046460 Bacteria 7577
695 Ga0495638_0014570 3300046460 Bacteria 5308
696 Ga0495641_0012759 3300046461 Bacteria 4671
697 Ga0495582_0074468 3300046473 Bacteria 1880
698 Ga0495639_0079198 3300046475 Bacteria 1528
699 Ga0495664_0277376 3300046477 Bacteria 1013
700 Ga0495594_0174458 3300046499 Bacteria 1223
701 Ga0495596_0426665 3300046500 Bacteria 517
702 Ga0495606_0027477 3300046507 Bacteria 4034
703 Ga0495608_0723202 3300046511 Bacteria 591
704 Ga0495618_0911616 3300046514 Bacteria 507
705 Ga0495630_0145905 3300046517 Bacteria 1800
706 Ga0495648_0006968 3300046524 Bacteria 9115
707 Ga0495654_0076250 3300046530 Bacteria 1580
708 Ga0495665_0120992 3300046531 Bacteria 1371
709 Ga0495640_0077984 3300046533 Bacteria 2208
710 Ga0495668_0246567 3300046616 Bacteria 978
711 Ga0495634_0703167 3300046642 Bacteria 581
712 Ga0495611_0057947 3300046648 Bacteria 1756
713 Ga0495658_0078982 3300046683 Bacteria 1927
714 Ga0495671_0367385 3300046692 Bacteria 690
715 Ga0495604_0642552 3300047317 Bacteria 677
716 Ga0495674_0557760 3300047319 Bacteria 911
717 Ga0495672_0000892 3300047320 Bacteria 31349
718 Ga0495672_0085389 3300047320 Bacteria 1749
719 Ga0495672_0108020 3300047320 Bacteria 1498
720 Ga0495672_0130773 3300047320 Bacteria 1321
721 Ga0495680_0592854 3300047322 Bacteria 742
722 Ga0495673_0002880 3300047469 Bacteria 11698
723 Ga0495686_0139406 3300047472 Bacteria 1432
724 Ga0495593_0060093 3300047673 Bacteria 1990
725 Ga0495614_0535713 3300048089 Bacteria 559
726 Ga0495626_0174226 3300048091 Bacteria 895
727 Ga0495626_0257863 3300048091 Bacteria 698
728 Ga0496100_0000033 3300048903 Bacteria 98762
729 Ga0496100_0000307 3300048903 Bacteria 24158
730 Ga0496100_0000383 3300048903 Bacteria 21527
731 Ga0496100_0001064 3300048903 Bacteria 13233
732 Ga0496100_0025799 3300048903 Bacteria 3596
733 Ga0496100_0683213 3300048903 Bacteria 801
734 Ga0496101_0000008 3300048904 Bacteria 309720
735 Ga0496101_0000033 3300048904 Bacteria 183191
736 Ga0496101_0000270 3300048904 Bacteria 36620
737 Ga0496101_0003204 3300048904 Bacteria 10146
738 Ga0496101_0054409 3300048904 Bacteria 2890
739 Ga0496101_0155368 3300048904 Bacteria 1752
740 Ga0496101_0165900 3300048904 Bacteria 1695
741 Ga0496101_0431825 3300048904 Bacteria 1039
742 Ga0496101_0750292 3300048904 Bacteria 770
743 Ga0496102_0000005 3300048905 Bacteria 481937
744 Ga0496102_0000257 3300048905 Bacteria 69091
745 Ga0496102_0003067 3300048905 Bacteria 14142
746 Ga0496102_0004668 3300048905 Bacteria 11588
747 Ga0496102_0154202 3300048905 Bacteria 2159
748 Ga0496102_0285735 3300048905 Bacteria 1555
749 Ga0496102_0495546 3300048905 Bacteria 1143
750 Ga0496103_0000002 3300048906 Bacteria 605387
751 Ga0496103_0000393 3300048906 Bacteria 38826
752 Ga0496103_0000540 3300048906 Bacteria 30387
753 Ga0496103_0002854 3300048906 Bacteria 10742
754 Ga0496103_0374717 3300048906 Bacteria 915
755 Ga0496103_0512000 3300048906 Bacteria 767
756 Ga0496104_0004313 3300048907 Bacteria 12371
757 Ga0496104_0010659 3300048907 Bacteria 8214
758 Ga0496104_0229871 3300048907 Bacteria 1767
759 Ga0496104_0363310 3300048907 Bacteria 1360
760 Ga0496104_0754340 3300048907 Bacteria 880
761 Ga0496105_0019662 3300048908 Bacteria 5449
762 Ga0496105_0435057 3300048908 Bacteria 1037
763 Ga0496105_0484214 3300048908 Bacteria 973
764 Ga0496105_0506221 3300048908 Bacteria 947
765 Ga0496105_0758351 3300048908 Bacteria 741
766 Ga0496105_1221028 3300048908 Bacteria 553
767 Ga0496106_0000615 3300048909 Bacteria 25459
768 Ga0496106_0000777 3300048909 Bacteria 23032
769 Ga0496106_0012783 3300048909 Bacteria 6197
770 Ga0496106_0040081 3300048909 Bacteria 3506
771 Ga0496106_0174404 3300048909 Bacteria 1705
772 Ga0496106_0418838 3300048909 Bacteria 1076
773 Ga0496107_0000083 3300048910 Bacteria 45218
774 Ga0496107_0001171 3300048910 Bacteria 15903
775 Ga0496107_0005215 3300048910 Bacteria 8872
776 Ga0496107_0006327 3300048910 Bacteria 8140
777 Ga0496107_0062955 3300048910 Bacteria 2688
778 Ga0496107_0206319 3300048910 Bacteria 1461
779 Ga0496107_0206985 3300048910 Bacteria 1458
780 Ga0496108_0002478 3300048911 Bacteria 14776
781 Ga0496108_0003256 3300048911 Bacteria 13053
782 Ga0496108_0076780 3300048911 Bacteria 2824
783 Ga0496108_0093861 3300048911 Bacteria 2553
784 Ga0496108_0159426 3300048911 Bacteria 1949
785 Ga0496108_0248223 3300048911 Bacteria 1548
786 Ga0496108_0284525 3300048911 Bacteria 1439
787 Ga0496109_0000293 3300048912 Bacteria 47411
788 Ga0496109_0001978 3300048912 Bacteria 16987
789 Ga0496109_0038037 3300048912 Bacteria 4349
790 Ga0496109_0092322 3300048912 Bacteria 2800
791 Ga0496109_0167328 3300048912 Bacteria 2062
792 Ga0496109_0328787 3300048912 Bacteria 1443
793 Ga0496109_0473721 3300048912 Bacteria 1182
794 Ga0496109_0799007 3300048912 Bacteria 881
795 Ga0496110_0029596 3300048913 Bacteria 4715
796 Ga0496110_0042318 3300048913 Bacteria 3976
797 Ga0496110_0066830 3300048913 Bacteria 3179
798 Ga0496110_0251986 3300048913 Bacteria 1607
799 Ga0496110_0290617 3300048913 Bacteria 1489
800 Ga0496110_0600110 3300048913 Bacteria 999
801 Ga0496111_0016877 3300048914 Bacteria 5039
802 Ga0496111_0184564 3300048914 Bacteria 1551
803 Ga0496112_0047284 3300048915 Bacteria 4221
804 Ga0496112_0083953 3300048915 Bacteria 3150
805 Ga0496112_0086710 3300048915 Bacteria 3097
806 Ga0496112_0108326 3300048915 Bacteria 2748
807 Ga0496112_0278301 3300048915 Bacteria 1621
808 Ga0496112_0377459 3300048915 Bacteria 1359
809 Ga0496112_0489533 3300048915 Bacteria 1166
810 Ga0496112_0764416 3300048915 Bacteria 892
811 Ga0496113_0004725 3300048916 Bacteria 8408
812 Ga0496113_0073302 3300048916 Bacteria 2608
813 Ga0496113_0294515 3300048916 Bacteria 1299
814 Ga0496113_0372642 3300048916 Bacteria 1146
815 Ga0496113_0386083 3300048916 Bacteria 1124
816 Ga0496113_0858603 3300048916 Bacteria 719
817 Ga0496114_0000517 3300048917 Bacteria 28403
818 Ga0496114_0002766 3300048917 Bacteria 13427
819 Ga0496114_0010038 3300048917 Bacteria 7528
820 Ga0496114_0917726 3300048917 Bacteria 757
821 Ga0496114_1083034 3300048917 Bacteria 686
822 Ga0496115_0008855 3300048918 Bacteria 7460
823 Ga0496115_0134115 3300048918 Bacteria 2042
824 Ga0496115_1238275 3300048918 Bacteria 559
825 Ga0496115_1315795 3300048918 Bacteria 537
826 Ga0496116_0000034 3300048919 Bacteria 409567
827 Ga0496116_0001049 3300048919 Bacteria 33626
828 Ga0496116_0033542 3300048919 Bacteria 3642
829 Ga0496117_0000003 3300048920 Bacteria 1881097
830 Ga0496117_0000390 3300048920 Bacteria 75361
831 Ga0496117_0002218 3300048920 Bacteria 25147
832 Ga0496118_0000001 3300048921 Bacteria 1881100
833 Ga0496118_0002226 3300048921 Bacteria 26786
834 Ga0496118_0010693 3300048921 Bacteria 9047
835 Ga0496118_0509823 3300048921 Bacteria 596
836 Ga0496119_0001001 3300048922 Bacteria 36211
837 Ga0496119_0013888 3300048922 Bacteria 6357
838 Ga0496119_0015314 3300048922 Bacteria 5916
839 Ga0496119_0508129 3300048922 Bacteria 560
840 Ga0496120_0000241 3300048923 Bacteria 93282
841 Ga0496120_0047544 3300048923 Bacteria 2473
842 Ga0496120_0054340 3300048923 Bacteria 2270
843 Ga0496121_0000002 3300048924 Bacteria 1494588
844 Ga0496121_0000421 3300048924 Bacteria 83629
845 Ga0496121_0002203 3300048924 Bacteria 30428
846 Ga0496121_0401867 3300048924 Bacteria 897
847 Ga0496122_0000051 3300048925 Bacteria 265104
848 Ga0496122_0005578 3300048925 Bacteria 14897
849 Ga0496122_0514235 3300048925 Bacteria 579
850 Ga0496123_0001082 3300048926 Bacteria 41071
851 Ga0496123_0011189 3300048926 Bacteria 7809
852 Ga0496123_0179182 3300048926 Bacteria 1109
853 Ga0496124_0000002 3300048927 Bacteria 1494588
854 Ga0496124_0203268 3300048927 Bacteria 1504
855 Ga0496124_0925621 3300048927 Bacteria 526
856 Ga0496125_0000002 3300048928 Bacteria 1480920
857 Ga0496125_0023269 3300048928 Bacteria 5722
858 Ga0496126_0000011 3300048929 Bacteria 744275
859 Ga0496126_0000805 3300048929 Bacteria 56108
860 Ga0496126_0010992 3300048929 Bacteria 9418
861 Ga0496126_0012617 3300048929 Bacteria 8647
862 Ga0496126_0533481 3300048929 Bacteria 934
863 Ga0496126_0764614 3300048929 Bacteria 744
864 Ga0501032_0009298 3300049569 Bacteria 7119
865 Ga0501033_0212694 3300049570 Bacteria 1378
866 Ga0501034_0014878 3300049571 Bacteria 8003
867 Ga0501034_0061168 3300049571 Bacteria 3783
868 Ga0501036_0033970 3300049572 Bacteria 4314
869 Ga0501036_0216437 3300049572 Bacteria 1609
870 Ga0501037_0001465 3300049573 Bacteria 17304
871 Ga0501040_0268460 3300049576 Bacteria 1218
872 Ga0501043_0001059 3300049579 Bacteria 24169
873 Ga0501047_0001744 3300049581 Bacteria 21072
874 Ga0501047_0004294 3300049581 Bacteria 13412
875 Ga0501047_0911358 3300049581 Bacteria 692
876 Ga0501068_0635386 3300049584 Bacteria 696
877 Ga0501069_0015109 3300049585 Bacteria 4136
878 Ga0501070_0001045 3300049586 Bacteria 24930
879 Ga0501070_0090058 3300049586 Bacteria 2539
880 Ga0501070_0093122 3300049586 Bacteria 2493
881 Ga0501070_0331554 3300049586 Bacteria 1237
882 Ga0501071_0735291 3300049587 Bacteria 760
883 Ga0501077_0324311 3300049593 Bacteria 982
884 Ga0501079_0958133 3300049741 Bacteria 674
885 Ga0501080_0763685 3300049742 Bacteria 850
886 Ga0501080_1745031 3300049742 Bacteria 524
887 Ga0501035_0000824 3300049822 Bacteria 33083
888 Ga0501044_0000400 3300049823 Bacteria 53515
889 Ga0501044_0022680 3300049823 Bacteria 6685
890 Ga0501044_1245389 3300049823 Bacteria 611
891 nmdc:mga03683_282316_c1 3300050489 Bacteria 776
892 nmdc:mga03683_391298_c1 3300050489 Bacteria 663
893 nmdc:mga03683_41391_c1 3300050489 Bacteria 1892
894 nmdc:mga03683_47067_c1 3300050489 Bacteria 1789
895 nmdc:mga03683_4742_c1 3300050489 Bacteria 4535
896 nmdc:mga03683_49033_c1 3300050489 Bacteria 1242
897 nmdc:mga03683_63873_c1 3300050489 Bacteria 855
898 nmdc:mga03n38_14398_c1 3300050490 Bacteria 3030
899 nmdc:mga03n38_271052_c1 3300050490 Bacteria 903
900 nmdc:mga03n38_2737_c1 3300050490 Bacteria 5521
901 nmdc:mga03n38_284722_c1 3300050490 Bacteria 883
902 nmdc:mga03n38_294500_c1 3300050490 Bacteria 870
903 nmdc:mga03n38_336848_c1 3300050490 Bacteria 818
904 nmdc:mga03n38_355895_c1 3300050490 Bacteria 798
905 nmdc:mga03n38_561408_c1 3300050490 Bacteria 647
906 nmdc:mga03n38_7697_c1 3300050490 Bacteria 3823
907 nmdc:mga03n38_77171_c1 3300050490 Bacteria 1556
908 nmdc:mga03n38_7949_c1 3300050490 Bacteria 3777
909 nmdc:mga03n38_797118_c1 3300050490 Bacteria 550
910 nmdc:mga03n38_942519_c1 3300050490 Bacteria 509
911 nmdc:mga00v17_133133_c1 3300050491 Bacteria 1590
912 nmdc:mga00v17_166783_c1 3300050491 Bacteria 1419
913 nmdc:mga00v17_16828_c1 3300050491 Bacteria 4127
914 nmdc:mga00v17_182570_c1 3300050491 Bacteria 1354
915 nmdc:mga00v17_1839_c1 3300050491 Bacteria 10962
916 nmdc:mga00v17_208391_c1 3300050491 Bacteria 1264
917 nmdc:mga00v17_26886_c1 3300050491 Bacteria 3356
918 nmdc:mga00v17_28589_c1 3300050491 Bacteria 3266
919 nmdc:mga00v17_290297_c1 3300050491 Bacteria 1062
920 nmdc:mga00v17_312725_c1 3300050491 Bacteria 1021
921 nmdc:mga00v17_381401_c1 3300050491 Bacteria 916
922 nmdc:mga00v17_464724_c1 3300050491 Bacteria 821
923 nmdc:mga0yw44_1049171_c1 3300050492 Bacteria 551
924 nmdc:mga0yw44_111276_c1 3300050492 Bacteria 1755
925 nmdc:mga0yw44_135112_c1 3300050492 Bacteria 1599
926 nmdc:mga0yw44_143301_c1 3300050492 Bacteria 1554
927 nmdc:mga0yw44_161414_c1 3300050492 Bacteria 1467
928 nmdc:mga0yw44_217996_c1 3300050492 Bacteria 1264
929 nmdc:mga0yw44_263583_c1 3300050492 Bacteria 1149
930 nmdc:mga0yw44_424311_c1 3300050492 Bacteria 900
931 nmdc:mga0yw44_442646_c1 3300050492 Bacteria 574
932 nmdc:mga0yw44_465326_c1 3300050492 Bacteria 857
933 nmdc:mga0yw44_569474_c1 3300050492 Bacteria 769
934 nmdc:mga0yw44_890157_c1 3300050492 Bacteria 604
935 nmdc:mga0yw44_95642_c1 3300050492 Bacteria 1885
936 nmdc:mga0k408_41793_c1 3300050493 Bacteria 2639
937 nmdc:mga0k408_469831_c1 3300050493 Bacteria 746
938 nmdc:mga06z11_55944_c1 3300050494 Bacteria 2039
939 nmdc:mga06z11_603453_c1 3300050494 Bacteria 668
940 nmdc:mga06z11_795004_c1 3300050494 Bacteria 576
941 nmdc:mga04h51_21305_c1 3300050495 Bacteria 1948
942 nmdc:mga04h51_85760_c1 3300050495 Bacteria 1125
943 nmdc:mga07m45_10218_c1 3300050496 Bacteria 4895
944 nmdc:mga07m45_118121_c1 3300050496 Bacteria 1531
945 nmdc:mga07m45_27866_c1 3300050496 Bacteria 3116
946 nmdc:mga07m45_42475_c1 3300050496 Bacteria 2549
947 nmdc:mga07m45_45201_c1 3300050496 Bacteria 2472
948 nmdc:mga07m45_795161_c1 3300050496 Bacteria 542
949 nmdc:mga05p37_1568544_c1 3300050507 Bacteria 651
950 nmdc:mga05p37_87296_c1 3300050507 Bacteria 3844
951 nmdc:mga0qj67_19994_c1 3300050509 Bacteria 5124
952 nmdc:mga0qj67_51566_c1 3300050509 Bacteria 3254
953 nmdc:mga06r32_32424_c1 3300050510 Bacteria 4915
954 nmdc:mga08y16_1646474_c1 3300050511 Bacteria 598
955 nmdc:mga0n895_388641_c1 3300050512 Bacteria 1411
956 nmdc:mga0a205_331119_c1 3300050515 Bacteria 1392
957 nmdc:mga0sz30_103073_c2 3300050516 Bacteria 955
958 nmdc:mga0sz30_113708_c1 3300050516 Bacteria 1187
959 nmdc:mga0sz30_17777_c1 3300050516 Bacteria 2839
960 nmdc:mga0sz30_19424_c1 3300050516 Bacteria 1649
961 nmdc:mga0sz30_2053_c1 3300050516 Bacteria 7196
962 nmdc:mga0sz30_219_c1 3300050516 Bacteria 21835
963 nmdc:mga0sz30_239062_c1 3300050516 Bacteria 808
964 nmdc:mga0sz30_247223_c1 3300050516 Bacteria 794
965 nmdc:mga0sz30_27081_c2 3300050516 Bacteria 1707
966 nmdc:mga0sz30_279571_c1 3300050516 Bacteria 744
967 Ga0500610_0072788 3300053079 Bacteria 1792
968 Ga0500635_0033168 3300053080 Bacteria 1683
969 Ga0500635_0068357 3300053080 Bacteria 1255
970 Ga0495619_0045764 3300053085 Bacteria 2875
971 Ga0500578_0768663 3300053086 Bacteria 512
972 Ga0500643_002732 3300053087 Bacteria 8852
973 Ga0500643_003257 3300053087 Bacteria 7908
974 Ga0500581_301034 3300053089 Bacteria 638
975 Ga0500646_0039744 3300053090 Bacteria 1321
976 Ga0500583_0287899 3300053092 Bacteria 806
977 Ga0500651_0142671 3300053093 Bacteria 1443
978 Ga0500566_0429975 3300053094 Bacteria 583
979 Ga0500650_0434409 3300053098 Bacteria 564
980 Ga0500556_0001801 3300053104 Bacteria 7928
981 Ga0500556_0053181 3300053104 Bacteria 1471
982 Ga0500562_005249 3300053108 Bacteria 3255
983 Ga0500572_309658 3300053111 Bacteria 507
984 Ga0500642_0055010 3300053130 Bacteria 1769
985 Ga0500652_000992 3300053131 Bacteria 9298
986 Ga0500559_0251104 3300053136 Bacteria 833
987 Ga0500577_0092628 3300053142 Bacteria 1224
988 Ga0500588_0366193 3300053146 Bacteria 548
989 Ga0500604_0049468 3300053151 Bacteria 1293
990 Ga0500616_0002892 3300053153 Bacteria 13757
991 Ga0500616_0008826 3300053153 Bacteria 6200
992 Ga0500616_0089755 3300053153 Bacteria 1525
993 Ga0500620_040274 3300053155 Bacteria 1530
994 Ga0500627_0017142 3300053158 Bacteria 2840
995 Ga0500627_0202190 3300053158 Bacteria 890
996 Ga0500633_0047396 3300053160 Bacteria 1470
997 Ga0500634_0234517 3300053161 Bacteria 776
998 Ga0500638_268237 3300053162 Bacteria 677
999 Ga0500645_000110 3300053730 Bacteria 65408
1000 Ga0500645_013051 3300053730 Bacteria 2675
1001 Ga0587084_155780 3300059477 Bacteria 505
1002 Ga0587090_146616 3300059510 Bacteria 532
1003 Ga0466962_0024515 3300061719 Bacteria 2898

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100018869 Ga0070714_1000188695 89
2 3300005436 Ga0070713_100118670 Ga0070713_1001186703 89
3 3300005439 Ga0070711_101509120 Ga0070711_1015091201 89
4 3300006038 Ga0075365_10055055 Ga0075365_100550554 89
5 3300006173 Ga0070716_100847150 Ga0070716_1008471501 89
6 3300050492 nmdc:mga0yw44_1049171_c1 nmdc:mga0yw44_1049171_c1_184_507 89
7 iso_pu_bacteria 2643221687 2644489575 92
8 iso_pu_bacteria 2643221715 2644635318 92
9 iso_pu_bacteria 2738541264 2738666449 92
10 iso_pu_bacteria 2738541356 2739146373 92
11 iso_pu_bacteria 2842134933 2842137138 92
12 iso_pu_bacteria 2902792274 2902799266 92
13 iso_pu_bacteria 2902810491 2902813241 92
14 iso_pu_bacteria 2902837492 2902842358 92
15 iso_pu_bacteria 2939582691 2939588021 92
16 3300049570 Ga0501033_0212694 Ga0501033_0212694_959_1264 93
17 3300049572 Ga0501036_0216437 Ga0501036_0216437_1045_1350 93
18 3300049581 Ga0501047_0001744 Ga0501047_0001744_769_1065 93
19 3300049581 Ga0501047_0004294 Ga0501047_0004294_12295_12600 93
20 3300049585 Ga0501069_0015109 Ga0501069_0015109_1573_1869 93
21 3300049586 Ga0501070_0093122 Ga0501070_0093122_185_481 93
22 3300049822 Ga0501035_0000824 Ga0501035_0000824_21416_21721 93
23 3300049823 Ga0501044_0000400 Ga0501044_0000400_26005_26310 93
24 iso_pu_bacteria 2738541274 2738707059 93
25 iso_pu_bacteria 2738543028 2739333510 93
26 iso_pu_bacteria 2902799365 2902802144 93
27 iso_pu_bacteria 2929212328 2929214256 93
28 3300005455 Ga0070663_100969821 Ga0070663_1009698211 94
29 3300005981 Ga0081538_10035673 Ga0081538_100356733 94
30 3300006038 Ga0075365_10047539 Ga0075365_100475392 94
31 3300006048 Ga0075363_101027628 Ga0075363_1010276281 94
32 3300006051 Ga0075364_10154835 Ga0075364_101548352 94
33 3300006051 Ga0075364_10188648 Ga0075364_101886482 94
34 3300006051 Ga0075364_10623698 Ga0075364_106236982 94
35 3300006163 Ga0070715_10405247 Ga0070715_104052472 94
36 3300006173 Ga0070716_101087791 Ga0070716_1010877912 94
37 3300006177 Ga0075362_10379157 Ga0075362_103791572 94
38 3300006186 Ga0075369_10002109 Ga0075369_100021093 94
39 3300006186 Ga0075369_10517450 Ga0075369_105174502 94
40 3300006871 Ga0075434_100459143 Ga0075434_1004591432 94
41 3300014325 Ga0163163_10191430 Ga0163163_101914304 94
42 3300025929 Ga0207664_10156204 Ga0207664_101562043 94
43 3300025939 Ga0207665_10887760 Ga0207665_108877602 94
44 3300041411 Ga0439466_0021376 Ga0439466_0021376_1067_1357 94
45 3300041413 Ga0439465_0007690 Ga0439465_0007690_1666_1956 94
46 3300041458 Ga0451798_0260113 Ga0451798_0260113_417_713 94
47 3300042004 Ga0439445_0006277 Ga0439445_0006277_1136_1426 94
48 3300042435 Ga0439434_0065829 Ga0439434_0065829_742_1032 94
49 3300044842 Ga0466957_0312379 Ga0466957_0312379_373_666 94
50 3300046477 Ga0495664_0277376 Ga0495664_0277376_36_335 94
51 3300050489 nmdc:mga03683_391298_c1 nmdc:mga03683_391298_c1_178_468 94
52 3300050489 nmdc:mga03683_47067_c1 nmdc:mga03683_47067_c1_531_824 94
53 3300050490 nmdc:mga03n38_942519_c1 nmdc:mga03n38_942519_c1_65_355 94
54 3300050491 nmdc:mga00v17_133133_c1 nmdc:mga00v17_133133_c1_330_626 94
55 3300050491 nmdc:mga00v17_166783_c1 nmdc:mga00v17_166783_c1_567_857 94
56 3300050491 nmdc:mga00v17_381401_c1 nmdc:mga00v17_381401_c1_20_310 94
57 3300050492 nmdc:mga0yw44_217996_c1 nmdc:mga0yw44_217996_c1_379_669 94
58 3300050494 nmdc:mga06z11_795004_c1 nmdc:mga06z11_795004_c1_219_515 94
59 3300050512 nmdc:mga0n895_388641_c1 nmdc:mga0n895_388641_c1_568_858 94
60 3300050516 nmdc:mga0sz30_219_c1 nmdc:mga0sz30_219_c1_6819_7121 94
61 3300050516 nmdc:mga0sz30_239062_c1 nmdc:mga0sz30_239062_c1_441_734 94
62 3300053080 Ga0500635_0033168 Ga0500635_0033168_963_1259 94
63 3300053131 Ga0500652_000992 Ga0500652_000992_7489_7785 94
64 3300053153 Ga0500616_0089755 Ga0500616_0089755_995_1291 94
65 3300059477 Ga0587084_155780 Ga0587084_155780_194_484 94
66 3300000545 CNXas_1005113 CNXas_10051132 95
67 3300005329 Ga0070683_100183221 Ga0070683_1001832214 95
68 3300005337 Ga0070682_100084985 Ga0070682_1000849851 95
69 3300005338 Ga0068868_100131427 Ga0068868_1001314271 95
70 3300005338 Ga0068868_100826572 Ga0068868_1008265721 95
71 3300005343 Ga0070687_100549971 Ga0070687_1005499712 95
72 3300005366 Ga0070659_100680368 Ga0070659_1006803681 95
73 3300005439 Ga0070711_101877929 Ga0070711_1018779291 95
74 3300005441 Ga0070700_101227776 Ga0070700_1012277762 95
75 3300005455 Ga0070663_100952689 Ga0070663_1009526892 95
76 3300005456 Ga0070678_101868519 Ga0070678_1018685191 95
77 3300005457 Ga0070662_101374459 Ga0070662_1013744591 95
78 3300005535 Ga0070684_100281500 Ga0070684_1002815003 95
79 3300005548 Ga0070665_100228267 Ga0070665_1002282673 95
80 3300005614 Ga0068856_102546793 Ga0068856_1025467932 95
81 3300005615 Ga0070702_101239923 Ga0070702_1012399232 95
82 3300005616 Ga0068852_100210563 Ga0068852_1002105633 95
83 3300005617 Ga0068859_102927705 Ga0068859_1029277051 95
84 3300005618 Ga0068864_101253565 Ga0068864_1012535652 95
85 3300005719 Ga0068861_101138994 Ga0068861_1011389942 95
86 3300005834 Ga0068851_10482902 Ga0068851_104829022 95
87 3300005840 Ga0068870_10291984 Ga0068870_102919843 95
88 3300005840 Ga0068870_11397895 Ga0068870_113978952 95
89 3300005841 Ga0068863_101677976 Ga0068863_1016779762 95
90 3300005937 Ga0081455_10036555 Ga0081455_100365554 95
91 3300006048 Ga0075363_100040183 Ga0075363_1000401833 95
92 3300006051 Ga0075364_10304632 Ga0075364_103046322 95
93 3300006175 Ga0070712_100529520 Ga0070712_1005295202 95
94 3300006186 Ga0075369_10490169 Ga0075369_104901691 95
95 3300006353 Ga0075370_10607977 Ga0075370_106079771 95
96 3300006931 Ga0097620_102927781 Ga0097620_1029277811 95
97 3300009098 Ga0105245_11493368 Ga0105245_114933682 95
98 3300009101 Ga0105247_10065096 Ga0105247_100650963 95
99 3300009174 Ga0105241_10830079 Ga0105241_108300792 95
100 3300009174 Ga0105241_11225082 Ga0105241_112250822 95
101 3300009551 Ga0105238_10642662 Ga0105238_106426622 95
102 3300009553 Ga0105249_10816852 Ga0105249_108168522 95
103 3300011119 Ga0105246_10217869 Ga0105246_102178694 95
104 3300013297 Ga0157378_11122549 Ga0157378_111225492 95
105 3300013297 Ga0157378_12285943 Ga0157378_122859432 95
106 3300013306 Ga0163162_10733765 Ga0163162_107337651 95
107 3300013307 Ga0157372_11466986 Ga0157372_114669862 95
108 3300013308 Ga0157375_11976728 Ga0157375_119767281 95
109 3300014326 Ga0157380_11649491 Ga0157380_116494912 95
110 3300014745 Ga0157377_10233756 Ga0157377_102337563 95
111 3300014745 Ga0157377_10863597 Ga0157377_108635972 95
112 3300014969 Ga0157376_12567272 Ga0157376_125672722 95
113 3300017792 Ga0163161_10180097 Ga0163161_101800972 95
114 3300017792 Ga0163161_11408352 Ga0163161_114083522 95
115 3300021384 Ga0213876_10530277 Ga0213876_105302771 95
116 3300025294 Ga0209025_1068996 Ga0209025_10689964 95
117 3300025900 Ga0207710_10185684 Ga0207710_101856841 95
118 3300025901 Ga0207688_10075820 Ga0207688_100758204 95
119 3300025901 Ga0207688_10753573 Ga0207688_107535731 95
120 3300025908 Ga0207643_10253687 Ga0207643_102536873 95
121 3300025918 Ga0207662_10211461 Ga0207662_102114612 95
122 3300025924 Ga0207694_10155070 Ga0207694_101550703 95
123 3300025924 Ga0207694_11660843 Ga0207694_116608431 95
124 3300025927 Ga0207687_10350125 Ga0207687_103501253 95
125 3300025932 Ga0207690_10224812 Ga0207690_102248122 95
126 3300025936 Ga0207670_11705969 Ga0207670_117059691 95
127 3300025937 Ga0207669_10291106 Ga0207669_102911064 95
128 3300025941 Ga0207711_10997712 Ga0207711_109977122 95
129 3300025972 Ga0207668_10016773 Ga0207668_100167737 95
130 3300025972 Ga0207668_10208317 Ga0207668_102083172 95
131 3300026023 Ga0207677_10201803 Ga0207677_102018032 95
132 3300026067 Ga0207678_10904505 Ga0207678_109045051 95
133 3300026075 Ga0207708_10351959 Ga0207708_103519593 95
134 3300026088 Ga0207641_11833624 Ga0207641_118336242 95
135 3300026095 Ga0207676_11469946 Ga0207676_114699462 95
136 3300026118 Ga0207675_100517790 Ga0207675_1005177902 95
137 3300026121 Ga0207683_10614671 Ga0207683_106146712 95
138 3300026142 Ga0207698_10153911 Ga0207698_101539113 95
139 3300032004 Ga0307414_11351095 Ga0307414_113510952 95
140 3300032005 Ga0307411_10188989 Ga0307411_101889892 95
141 3300035170 Ga0373943_0268297 Ga0373943_0268297_215_508 95
142 3300036401 Ga0373937_0616162 Ga0373937_0616162_37_330 95
143 3300039450 Ga0436363_1100965 Ga0436363_1100965_1864_2187 95
144 3300041452 Ga0451793_0614440 Ga0451793_0614440_151_453 95
145 3300041503 Ga0451847_0431962 Ga0451847_0431962_84_386 95
146 3300042005 Ga0439448_0035093 Ga0439448_0035093_857_1153 95
147 3300044658 Ga0466972_0014708 Ga0466972_0014708_2342_2647 95
148 3300044683 Ga0466965_0008663 Ga0466965_0008663_2412_2717 95
149 3300044683 Ga0466965_0356052 Ga0466965_0356052_216_521 95
150 3300044765 Ga0466970_0204061 Ga0466970_0204061_267_572 95
151 3300044765 Ga0466970_0299152 Ga0466970_0299152_144_449 95
152 3300044901 Ga0466960_0001158 Ga0466960_0001158_1792_2097 95
153 3300046455 Ga0495603_0049300 Ga0495603_0049300_614_907 95
154 3300046459 Ga0495629_0201647 Ga0495629_0201647_291_584 95
155 3300046461 Ga0495641_0012759 Ga0495641_0012759_4006_4299 95
156 3300046473 Ga0495582_0074468 Ga0495582_0074468_601_894 95
157 3300046475 Ga0495639_0079198 Ga0495639_0079198_401_694 95
158 3300046499 Ga0495594_0174458 Ga0495594_0174458_559_852 95
159 3300046511 Ga0495608_0723202 Ga0495608_0723202_277_570 95
160 3300046514 Ga0495618_0911616 Ga0495618_0911616_163_456 95
161 3300046517 Ga0495630_0145905 Ga0495630_0145905_1100_1393 95
162 3300046531 Ga0495665_0120992 Ga0495665_0120992_550_843 95
163 3300046533 Ga0495640_0077984 Ga0495640_0077984_946_1239 95
164 3300046642 Ga0495634_0703167 Ga0495634_0703167_123_416 95
165 3300046683 Ga0495658_0078982 Ga0495658_0078982_1083_1376 95
166 3300047317 Ga0495604_0642552 Ga0495604_0642552_207_500 95
167 3300047319 Ga0495674_0557760 Ga0495674_0557760_444_737 95
168 3300047320 Ga0495672_0085389 Ga0495672_0085389_315_608 95
169 3300047320 Ga0495672_0108020 Ga0495672_0108020_23_319 95
170 3300047322 Ga0495680_0592854 Ga0495680_0592854_255_548 95
171 3300047673 Ga0495593_0060093 Ga0495593_0060093_1349_1642 95
172 3300048089 Ga0495614_0535713 Ga0495614_0535713_121_414 95
173 3300048904 Ga0496101_0155368 Ga0496101_0155368_1128_1430 95
174 3300048904 Ga0496101_0165900 Ga0496101_0165900_596_904 95
175 3300048905 Ga0496102_0285735 Ga0496102_0285735_281_604 95
176 3300048907 Ga0496104_0363310 Ga0496104_0363310_827_1150 95
177 3300048907 Ga0496104_0754340 Ga0496104_0754340_13_306 95
178 3300048908 Ga0496105_0506221 Ga0496105_0506221_498_821 95
179 3300048908 Ga0496105_1221028 Ga0496105_1221028_85_387 95
180 3300048909 Ga0496106_0418838 Ga0496106_0418838_162_455 95
181 3300048910 Ga0496107_0062955 Ga0496107_0062955_2061_2354 95
182 3300048911 Ga0496108_0159426 Ga0496108_0159426_169_471 95
183 3300048912 Ga0496109_0092322 Ga0496109_0092322_1373_1675 95
184 3300048912 Ga0496109_0328787 Ga0496109_0328787_803_1126 95
185 3300048913 Ga0496110_0600110 Ga0496110_0600110_331_654 95
186 3300048915 Ga0496112_0083953 Ga0496112_0083953_2258_2560 95
187 3300048915 Ga0496112_0086710 Ga0496112_0086710_1960_2268 95
188 3300048916 Ga0496113_0004725 Ga0496113_0004725_3744_4052 95
189 3300048917 Ga0496114_0917726 Ga0496114_0917726_398_691 95
190 3300048918 Ga0496115_1238275 Ga0496115_1238275_32_340 95
191 3300048925 Ga0496122_0005578 Ga0496122_0005578_3306_3614 95
192 3300048925 Ga0496122_0514235 Ga0496122_0514235_264_569 95
193 3300048926 Ga0496123_0011189 Ga0496123_0011189_3739_4047 95
194 3300048929 Ga0496126_0012617 Ga0496126_0012617_5083_5391 95
195 3300049571 Ga0501034_0061168 Ga0501034_0061168_322_618 95
196 3300049742 Ga0501080_1745031 Ga0501080_1745031_32_328 95
197 3300049823 Ga0501044_1245389 Ga0501044_1245389_278_574 95
198 3300050490 nmdc:mga03n38_14398_c1 nmdc:mga03n38_14398_c1_354_656 95
199 3300050490 nmdc:mga03n38_271052_c1 nmdc:mga03n38_271052_c1_469_768 95
200 3300050491 nmdc:mga00v17_290297_c1 nmdc:mga00v17_290297_c1_539_844 95
201 3300050516 nmdc:mga0sz30_19424_c1 nmdc:mga0sz30_19424_c1_1049_1342 95
202 3300053085 Ga0495619_0045764 Ga0495619_0045764_2031_2324 95
203 3300001977 JGI24746J21847_1011174 JGI24746J21847_10111742 96
204 3300001978 JGI24747J21853_1015315 JGI24747J21853_10153152 96
205 3300001989 JGI24739J22299_10049710 JGI24739J22299_100497102 96
206 3300001990 JGI24737J22298_10012890 JGI24737J22298_100128903 96
207 3300001990 JGI24737J22298_10063782 JGI24737J22298_100637822 96
208 3300001990 JGI24737J22298_10239371 JGI24737J22298_102393711 96
209 3300001991 JGI24743J22301_10122959 JGI24743J22301_101229591 96
210 3300002070 JGI24750J21931_1010814 JGI24750J21931_10108142 96
211 3300002074 JGI24748J21848_1008609 JGI24748J21848_10086091 96
212 3300002074 JGI24748J21848_1042239 JGI24748J21848_10422392 96
213 3300002076 JGI24749J21850_1027833 JGI24749J21850_10278331 96
214 3300002077 JGI24744J21845_10000131 JGI24744J21845_100001315 96
215 3300002239 JGI24034J26672_10007839 JGI24034J26672_100078392 96
216 3300002244 JGI24742J22300_10000618 JGI24742J22300_100006183 96
217 3300002244 JGI24742J22300_10008441 JGI24742J22300_100084412 96
218 3300003790 Ga0055528_1035658 Ga0055528_10356582 96
219 3300003792 Ga0055540_1000040 Ga0055540_1000040103 96
220 3300003792 Ga0055540_1004993 Ga0055540_10049936 96
221 3300003792 Ga0055540_1024706 Ga0055540_10247061 96
222 3300003792 Ga0055540_1074105 Ga0055540_10741052 96
223 3300005328 Ga0070676_10028426 Ga0070676_100284262 96
224 3300005328 Ga0070676_11392526 Ga0070676_113925262 96
225 3300005330 Ga0070690_100007203 Ga0070690_1000072033 96
226 3300005330 Ga0070690_100730761 Ga0070690_1007307612 96
227 3300005334 Ga0068869_100030180 Ga0068869_1000301806 96
228 3300005334 Ga0068869_100267775 Ga0068869_1002677751 96
229 3300005335 Ga0070666_10034273 Ga0070666_100342733 96
230 3300005337 Ga0070682_100047266 Ga0070682_1000472663 96
231 3300005337 Ga0070682_100210413 Ga0070682_1002104132 96
232 3300005337 Ga0070682_100524732 Ga0070682_1005247321 96
233 3300005338 Ga0068868_100000203 Ga0068868_10000020310 96
234 3300005338 Ga0068868_100134492 Ga0068868_1001344924 96
235 3300005338 Ga0068868_100635871 Ga0068868_1006358712 96
236 3300005339 Ga0070660_100954421 Ga0070660_1009544212 96
237 3300005339 Ga0070660_101627547 Ga0070660_1016275471 96
238 3300005340 Ga0070689_100054776 Ga0070689_1000547764 96
239 3300005340 Ga0070689_101679834 Ga0070689_1016798341 96
240 3300005341 Ga0070691_10000914 Ga0070691_100009143 96
241 3300005341 Ga0070691_10134145 Ga0070691_101341452 96
242 3300005343 Ga0070687_100124024 Ga0070687_1001240243 96
243 3300005345 Ga0070692_10216409 Ga0070692_102164093 96
244 3300005345 Ga0070692_10229364 Ga0070692_102293642 96
245 3300005345 Ga0070692_10796338 Ga0070692_107963382 96
246 3300005347 Ga0070668_100015315 Ga0070668_1000153152 96
247 3300005347 Ga0070668_100269506 Ga0070668_1002695062 96
248 3300005353 Ga0070669_100000428 Ga0070669_10000042830 96
249 3300005353 Ga0070669_100005387 Ga0070669_1000053876 96
250 3300005353 Ga0070669_100211710 Ga0070669_1002117102 96
251 3300005354 Ga0070675_100745249 Ga0070675_1007452491 96
252 3300005356 Ga0070674_100000244 Ga0070674_1000002447 96
253 3300005356 Ga0070674_100626987 Ga0070674_1006269871 96
254 3300005364 Ga0070673_100304205 Ga0070673_1003042051 96
255 3300005365 Ga0070688_100002188 Ga0070688_1000021883 96
256 3300005365 Ga0070688_100026466 Ga0070688_1000264662 96
257 3300005366 Ga0070659_100100888 Ga0070659_1001008882 96
258 3300005366 Ga0070659_100636773 Ga0070659_1006367731 96
259 3300005367 Ga0070667_100000027 Ga0070667_10000002740 96
260 3300005367 Ga0070667_100004957 Ga0070667_1000049577 96
261 3300005367 Ga0070667_100016839 Ga0070667_1000168393 96
262 3300005367 Ga0070667_100123528 Ga0070667_1001235284 96
263 3300005367 Ga0070667_100446306 Ga0070667_1004463062 96
264 3300005406 Ga0070703_10038930 Ga0070703_100389301 96
265 3300005434 Ga0070709_10056739 Ga0070709_100567393 96
266 3300005434 Ga0070709_10060096 Ga0070709_100600962 96
267 3300005435 Ga0070714_100410244 Ga0070714_1004102442 96
268 3300005435 Ga0070714_100705152 Ga0070714_1007051523 96
269 3300005435 Ga0070714_101606357 Ga0070714_1016063571 96
270 3300005437 Ga0070710_10001501 Ga0070710_100015018 96
271 3300005437 Ga0070710_10014703 Ga0070710_100147033 96
272 3300005438 Ga0070701_10016528 Ga0070701_100165283 96
273 3300005438 Ga0070701_10394154 Ga0070701_103941541 96
274 3300005439 Ga0070711_100001734 Ga0070711_1000017343 96
275 3300005439 Ga0070711_100005574 Ga0070711_1000055741 96
276 3300005440 Ga0070705_100004544 Ga0070705_1000045446 96
277 3300005440 Ga0070705_100851348 Ga0070705_1008513482 96
278 3300005441 Ga0070700_100321132 Ga0070700_1003211322 96
279 3300005444 Ga0070694_100004367 Ga0070694_1000043676 96
280 3300005444 Ga0070694_100443404 Ga0070694_1004434042 96
281 3300005455 Ga0070663_100021341 Ga0070663_1000213414 96
282 3300005455 Ga0070663_100449770 Ga0070663_1004497701 96
283 3300005455 Ga0070663_101855550 Ga0070663_1018555502 96
284 3300005456 Ga0070678_100001046 Ga0070678_1000010469 96
285 3300005456 Ga0070678_100071210 Ga0070678_1000712102 96
286 3300005457 Ga0070662_100003739 Ga0070662_1000037397 96
287 3300005457 Ga0070662_100196172 Ga0070662_1001961722 96
288 3300005459 Ga0068867_100001211 Ga0068867_10000121115 96
289 3300005459 Ga0068867_101418114 Ga0068867_1014181141 96
290 3300005459 Ga0068867_102030788 Ga0068867_1020307882 96
291 3300005466 Ga0070685_10525354 Ga0070685_105253542 96
292 3300005466 Ga0070685_11002428 Ga0070685_110024281 96
293 3300005539 Ga0068853_100164539 Ga0068853_1001645393 96
294 3300005539 Ga0068853_100849565 Ga0068853_1008495651 96
295 3300005543 Ga0070672_100034746 Ga0070672_1000347466 96
296 3300005543 Ga0070672_100977005 Ga0070672_1009770052 96
297 3300005544 Ga0070686_100577112 Ga0070686_1005771122 96
298 3300005545 Ga0070695_100002690 Ga0070695_10000269010 96
299 3300005545 Ga0070695_100057660 Ga0070695_1000576601 96
300 3300005546 Ga0070696_100004046 Ga0070696_1000040468 96
301 3300005547 Ga0070693_100025200 Ga0070693_1000252002 96
302 3300005547 Ga0070693_101118011 Ga0070693_1011180112 96
303 3300005548 Ga0070665_100046895 Ga0070665_1000468952 96
304 3300005548 Ga0070665_100235874 Ga0070665_1002358743 96
305 3300005548 Ga0070665_100261070 Ga0070665_1002610701 96
306 3300005549 Ga0070704_100002696 Ga0070704_1000026965 96
307 3300005549 Ga0070704_100137889 Ga0070704_1001378892 96
308 3300005563 Ga0068855_100181957 Ga0068855_1001819573 96
309 3300005563 Ga0068855_100623678 Ga0068855_1006236782 96
310 3300005563 Ga0068855_101245011 Ga0068855_1012450112 96
311 3300005578 Ga0068854_100000262 Ga0068854_1000002623 96
312 3300005578 Ga0068854_100182885 Ga0068854_1001828852 96
313 3300005614 Ga0068856_100558649 Ga0068856_1005586492 96
314 3300005616 Ga0068852_100031689 Ga0068852_1000316894 96
315 3300005617 Ga0068859_100001466 Ga0068859_10000146622 96
316 3300005617 Ga0068859_100002266 Ga0068859_10000226618 96
317 3300005617 Ga0068859_100284757 Ga0068859_1002847573 96
318 3300005618 Ga0068864_100093654 Ga0068864_1000936542 96
319 3300005718 Ga0068866_10000681 Ga0068866_1000068110 96
320 3300005718 Ga0068866_10066644 Ga0068866_100666443 96
321 3300005719 Ga0068861_100013167 Ga0068861_1000131677 96
322 3300005719 Ga0068861_100161744 Ga0068861_1001617442 96
323 3300005719 Ga0068861_100179195 Ga0068861_1001791952 96
324 3300005834 Ga0068851_10581628 Ga0068851_105816282 96
325 3300005840 Ga0068870_10983223 Ga0068870_109832232 96
326 3300005841 Ga0068863_100006164 Ga0068863_10000616411 96
327 3300005841 Ga0068863_100950870 Ga0068863_1009508703 96
328 3300005842 Ga0068858_100001689 Ga0068858_1000016893 96
329 3300005842 Ga0068858_100096341 Ga0068858_1000963413 96
330 3300005842 Ga0068858_100126321 Ga0068858_1001263212 96
331 3300005842 Ga0068858_101816941 Ga0068858_1018169411 96
332 3300005843 Ga0068860_100000141 Ga0068860_10000014140 96
333 3300005843 Ga0068860_100001255 Ga0068860_10000125521 96
334 3300005843 Ga0068860_100149757 Ga0068860_1001497573 96
335 3300005843 Ga0068860_100197528 Ga0068860_1001975282 96
336 3300005844 Ga0068862_100000138 Ga0068862_10000013844 96
337 3300005844 Ga0068862_100001317 Ga0068862_1000013174 96
338 3300005844 Ga0068862_100316850 Ga0068862_1003168502 96
339 3300005844 Ga0068862_100746715 Ga0068862_1007467152 96
340 3300006038 Ga0075365_10018382 Ga0075365_100183824 96
341 3300006038 Ga0075365_10046531 Ga0075365_100465315 96
342 3300006038 Ga0075365_10286437 Ga0075365_102864373 96
343 3300006038 Ga0075365_10459401 Ga0075365_104594012 96
344 3300006038 Ga0075365_10949959 Ga0075365_109499592 96
345 3300006038 Ga0075365_11117835 Ga0075365_111178351 96
346 3300006042 Ga0075368_10018592 Ga0075368_100185922 96
347 3300006048 Ga0075363_100037020 Ga0075363_1000370204 96
348 3300006048 Ga0075363_100055671 Ga0075363_1000556714 96
349 3300006048 Ga0075363_100058629 Ga0075363_1000586294 96
350 3300006048 Ga0075363_100075522 Ga0075363_1000755223 96
351 3300006048 Ga0075363_100127918 Ga0075363_1001279183 96
352 3300006048 Ga0075363_100200914 Ga0075363_1002009143 96
353 3300006048 Ga0075363_100897896 Ga0075363_1008978962 96
354 3300006051 Ga0075364_10026321 Ga0075364_100263216 96
355 3300006051 Ga0075364_10038846 Ga0075364_100388464 96
356 3300006051 Ga0075364_10068636 Ga0075364_100686364 96
357 3300006051 Ga0075364_10078677 Ga0075364_100786773 96
358 3300006051 Ga0075364_10091412 Ga0075364_100914122 96
359 3300006051 Ga0075364_10103821 Ga0075364_101038213 96
360 3300006051 Ga0075364_10176423 Ga0075364_101764234 96
361 3300006051 Ga0075364_10437265 Ga0075364_104372652 96
362 3300006051 Ga0075364_10448407 Ga0075364_104484072 96
363 3300006051 Ga0075364_11065817 Ga0075364_110658172 96
364 3300006058 Ga0075432_10303066 Ga0075432_103030662 96
365 3300006163 Ga0070715_10002294 Ga0070715_100022942 96
366 3300006163 Ga0070715_10416240 Ga0070715_104162402 96
367 3300006173 Ga0070716_100001813 Ga0070716_10000181310 96
368 3300006175 Ga0070712_100001225 Ga0070712_1000012251 96
369 3300006175 Ga0070712_100004149 Ga0070712_1000041498 96
370 3300006177 Ga0075362_10008854 Ga0075362_100088543 96
371 3300006177 Ga0075362_10058899 Ga0075362_100588993 96
372 3300006178 Ga0075367_10049248 Ga0075367_100492483 96
373 3300006178 Ga0075367_10226510 Ga0075367_102265103 96
374 3300006178 Ga0075367_10530305 Ga0075367_105303052 96
375 3300006186 Ga0075369_10125352 Ga0075369_101253522 96
376 3300006186 Ga0075369_10142413 Ga0075369_101424132 96
377 3300006186 Ga0075369_10218259 Ga0075369_102182592 96
378 3300006186 Ga0075369_10268637 Ga0075369_102686372 96
379 3300006186 Ga0075369_10546101 Ga0075369_105461012 96
380 3300006195 Ga0075366_10147922 Ga0075366_101479221 96
381 3300006237 Ga0097621_100763541 Ga0097621_1007635412 96
382 3300006353 Ga0075370_10010995 Ga0075370_100109953 96
383 3300006353 Ga0075370_10049938 Ga0075370_100499384 96
384 3300006353 Ga0075370_10056762 Ga0075370_100567623 96
385 3300006353 Ga0075370_10065681 Ga0075370_100656813 96
386 3300006353 Ga0075370_10080869 Ga0075370_100808693 96
387 3300006353 Ga0075370_10362970 Ga0075370_103629703 96
388 3300006353 Ga0075370_10675245 Ga0075370_106752452 96
389 3300006358 Ga0068871_100857918 Ga0068871_1008579182 96
390 3300006358 Ga0068871_101336655 Ga0068871_1013366553 96
391 3300006844 Ga0075428_100000939 Ga0075428_10000093925 96
392 3300006846 Ga0075430_100080000 Ga0075430_1000800004 96
393 3300006847 Ga0075431_100021617 Ga0075431_1000216175 96
394 3300006871 Ga0075434_101693453 Ga0075434_1016934532 96
395 3300006881 Ga0068865_100004351 Ga0068865_1000043519 96
396 3300006881 Ga0068865_100093332 Ga0068865_1000933324 96
397 3300006931 Ga0097620_100001464 Ga0097620_1000014644 96
398 3300006931 Ga0097620_100002267 Ga0097620_1000022673 96
399 3300006931 Ga0097620_100284752 Ga0097620_1002847523 96
400 3300009092 Ga0105250_10063025 Ga0105250_100630253 96
401 3300009093 Ga0105240_11204609 Ga0105240_112046091 96
402 3300009094 Ga0111539_13346294 Ga0111539_133462942 96
403 3300009098 Ga0105245_10007730 Ga0105245_100077306 96
404 3300009098 Ga0105245_10674331 Ga0105245_106743312 96
405 3300009101 Ga0105247_10000237 Ga0105247_1000023724 96
406 3300009101 Ga0105247_10000372 Ga0105247_100003724 96
407 3300009101 Ga0105247_10066172 Ga0105247_100661722 96
408 3300009101 Ga0105247_10414385 Ga0105247_104143851 96
409 3300009147 Ga0114129_10048020 Ga0114129_100480206 96
410 3300009147 Ga0114129_12826612 Ga0114129_128266121 96
411 3300009148 Ga0105243_10000676 Ga0105243_100006766 96
412 3300009174 Ga0105241_10007378 Ga0105241_100073789 96
413 3300009174 Ga0105241_10149237 Ga0105241_101492372 96
414 3300009176 Ga0105242_10000197 Ga0105242_1000019718 96
415 3300009176 Ga0105242_10499514 Ga0105242_104995142 96
416 3300009176 Ga0105242_11927092 Ga0105242_119270922 96
417 3300009177 Ga0105248_10000337 Ga0105248_1000033717 96
418 3300009177 Ga0105248_10056212 Ga0105248_100562124 96
419 3300009177 Ga0105248_10898500 Ga0105248_108985002 96
420 3300009177 Ga0105248_11640690 Ga0105248_116406902 96
421 3300009545 Ga0105237_10005565 Ga0105237_1000556511 96
422 3300009545 Ga0105237_10015368 Ga0105237_100153689 96
423 3300009545 Ga0105237_10085017 Ga0105237_100850173 96
424 3300009545 Ga0105237_10689298 Ga0105237_106892984 96
425 3300009545 Ga0105237_11484663 Ga0105237_114846633 96
426 3300009551 Ga0105238_10086299 Ga0105238_100862993 96
427 3300009551 Ga0105238_11043982 Ga0105238_110439821 96
428 3300009553 Ga0105249_10000013 Ga0105249_1000001339 96
429 3300009553 Ga0105249_10004426 Ga0105249_100044268 96
430 3300009553 Ga0105249_10543436 Ga0105249_105434364 96
431 3300010375 Ga0105239_10029337 Ga0105239_100293375 96
432 3300010375 Ga0105239_10032396 Ga0105239_100323966 96
433 3300010375 Ga0105239_10145014 Ga0105239_101450143 96
434 3300010375 Ga0105239_10690655 Ga0105239_106906553 96
435 3300010375 Ga0105239_10788219 Ga0105239_107882192 96
436 3300010375 Ga0105239_10996822 Ga0105239_109968223 96
437 3300011119 Ga0105246_10244744 Ga0105246_102447442 96
438 3300011119 Ga0105246_10667441 Ga0105246_106674412 96
439 3300012507 Ga0157342_1068323 Ga0157342_10683232 96
440 3300013102 Ga0157371_10312162 Ga0157371_103121622 96
441 3300013102 Ga0157371_11224263 Ga0157371_112242632 96
442 3300013105 Ga0157369_10384304 Ga0157369_103843044 96
443 3300013105 Ga0157369_10631717 Ga0157369_106317172 96
444 3300013296 Ga0157374_10391860 Ga0157374_103918601 96
445 3300013296 Ga0157374_10694656 Ga0157374_106946561 96
446 3300013297 Ga0157378_10002889 Ga0157378_100028896 96
447 3300013297 Ga0157378_10036468 Ga0157378_100364683 96
448 3300013306 Ga0163162_10002808 Ga0163162_100028083 96
449 3300013306 Ga0163162_10091073 Ga0163162_100910732 96
450 3300013306 Ga0163162_12823541 Ga0163162_128235412 96
451 3300013307 Ga0157372_10006319 Ga0157372_100063198 96
452 3300013307 Ga0157372_10149591 Ga0157372_101495914 96
453 3300013308 Ga0157375_10017320 Ga0157375_100173203 96
454 3300013308 Ga0157375_10225018 Ga0157375_102250184 96
455 3300013308 Ga0157375_10769970 Ga0157375_107699702 96
456 3300013308 Ga0157375_10786964 Ga0157375_107869642 96
457 3300013308 Ga0157375_11157478 Ga0157375_111574782 96
458 3300014325 Ga0163163_10058326 Ga0163163_100583265 96
459 3300014325 Ga0163163_10423346 Ga0163163_104233462 96
460 3300014326 Ga0157380_10000136 Ga0157380_100001369 96
461 3300014326 Ga0157380_10249743 Ga0157380_102497432 96
462 3300014745 Ga0157377_10175419 Ga0157377_101754194 96
463 3300014968 Ga0157379_10038088 Ga0157379_100380885 96
464 3300014968 Ga0157379_10070088 Ga0157379_100700886 96
465 3300014968 Ga0157379_10130207 Ga0157379_101302073 96
466 3300014969 Ga0157376_10399308 Ga0157376_103993082 96
467 3300014969 Ga0157376_10444398 Ga0157376_104443982 96
468 3300017792 Ga0163161_10014033 Ga0163161_100140332 96
469 3300017792 Ga0163161_10083548 Ga0163161_100835483 96
470 3300025273 Ga0209673_1028999 Ga0209673_10289993 96
471 3300025303 Ga0209051_1000107 Ga0209051_1000107103 96
472 3300025303 Ga0209051_1000122 Ga0209051_1000122126 96
473 3300025303 Ga0209051_1001174 Ga0209051_100117412 96
474 3300025303 Ga0209051_1001471 Ga0209051_10014716 96
475 3300025885 Ga0207653_10243734 Ga0207653_102437342 96
476 3300025898 Ga0207692_10001286 Ga0207692_100012867 96
477 3300025898 Ga0207692_10014299 Ga0207692_100142994 96
478 3300025898 Ga0207692_10283322 Ga0207692_102833222 96
479 3300025899 Ga0207642_10001214 Ga0207642_100012146 96
480 3300025900 Ga0207710_10000213 Ga0207710_1000021329 96
481 3300025900 Ga0207710_10008148 Ga0207710_100081481 96
482 3300025900 Ga0207710_10676890 Ga0207710_106768901 96
483 3300025901 Ga0207688_10003068 Ga0207688_100030686 96
484 3300025901 Ga0207688_10005491 Ga0207688_100054913 96
485 3300025903 Ga0207680_10072589 Ga0207680_100725892 96
486 3300025903 Ga0207680_10138610 Ga0207680_101386104 96
487 3300025905 Ga0207685_10199934 Ga0207685_101999341 96
488 3300025905 Ga0207685_10218094 Ga0207685_102180941 96
489 3300025906 Ga0207699_10060695 Ga0207699_100606952 96
490 3300025906 Ga0207699_10417116 Ga0207699_104171162 96
491 3300025906 Ga0207699_11478221 Ga0207699_114782211 96
492 3300025907 Ga0207645_10004061 Ga0207645_100040618 96
493 3300025908 Ga0207643_10487409 Ga0207643_104874091 96
494 3300025911 Ga0207654_10077866 Ga0207654_100778663 96
495 3300025911 Ga0207654_10233114 Ga0207654_102331142 96
496 3300025914 Ga0207671_10014745 Ga0207671_100147453 96
497 3300025914 Ga0207671_10021340 Ga0207671_100213406 96
498 3300025914 Ga0207671_10031936 Ga0207671_100319363 96
499 3300025915 Ga0207693_10000507 Ga0207693_100005076 96
500 3300025915 Ga0207693_10003394 Ga0207693_100033947 96
501 3300025916 Ga0207663_10005170 Ga0207663_100051708 96
502 3300025918 Ga0207662_10226473 Ga0207662_102264732 96
503 3300025919 Ga0207657_10023320 Ga0207657_100233203 96
504 3300025919 Ga0207657_10102233 Ga0207657_101022334 96
505 3300025921 Ga0207652_11251564 Ga0207652_112515642 96
506 3300025922 Ga0207646_10399719 Ga0207646_103997194 96
507 3300025923 Ga0207681_10000866 Ga0207681_1000086620 96
508 3300025923 Ga0207681_10042605 Ga0207681_100426051 96
509 3300025923 Ga0207681_10130610 Ga0207681_101306103 96
510 3300025924 Ga0207694_10837086 Ga0207694_108370862 96
511 3300025926 Ga0207659_10426038 Ga0207659_104260382 96
512 3300025927 Ga0207687_10009541 Ga0207687_100095414 96
513 3300025927 Ga0207687_10013417 Ga0207687_100134177 96
514 3300025929 Ga0207664_10396737 Ga0207664_103967372 96
515 3300025929 Ga0207664_10427349 Ga0207664_104273492 96
516 3300025931 Ga0207644_10266659 Ga0207644_102666592 96
517 3300025931 Ga0207644_11423607 Ga0207644_114236072 96
518 3300025932 Ga0207690_10132747 Ga0207690_101327472 96
519 3300025932 Ga0207690_11020278 Ga0207690_110202781 96
520 3300025933 Ga0207706_10001533 Ga0207706_1000153321 96
521 3300025934 Ga0207686_10001322 Ga0207686_100013225 96
522 3300025935 Ga0207709_10085607 Ga0207709_100856071 96
523 3300025935 Ga0207709_10412239 Ga0207709_104122392 96
524 3300025936 Ga0207670_10104442 Ga0207670_101044422 96
525 3300025936 Ga0207670_11936265 Ga0207670_119362651 96
526 3300025937 Ga0207669_10001482 Ga0207669_100014827 96
527 3300025938 Ga0207704_10000458 Ga0207704_100004588 96
528 3300025939 Ga0207665_10005493 Ga0207665_100054939 96
529 3300025939 Ga0207665_10015885 Ga0207665_100158852 96
530 3300025939 Ga0207665_10901349 Ga0207665_109013491 96
531 3300025940 Ga0207691_10391942 Ga0207691_103919422 96
532 3300025940 Ga0207691_10440882 Ga0207691_104408822 96
533 3300025941 Ga0207711_10000753 Ga0207711_1000075317 96
534 3300025941 Ga0207711_10020273 Ga0207711_100202735 96
535 3300025941 Ga0207711_10374239 Ga0207711_103742393 96
536 3300025941 Ga0207711_11023253 Ga0207711_110232532 96
537 3300025942 Ga0207689_10012131 Ga0207689_100121319 96
538 3300025942 Ga0207689_10055897 Ga0207689_100558975 96
539 3300025949 Ga0207667_10319758 Ga0207667_103197583 96
540 3300025949 Ga0207667_10634600 Ga0207667_106346002 96
541 3300025960 Ga0207651_11705602 Ga0207651_117056022 96
542 3300025961 Ga0207712_10000018 Ga0207712_10000018253 96
543 3300025961 Ga0207712_10130790 Ga0207712_101307902 96
544 3300025961 Ga0207712_10313007 Ga0207712_103130074 96
545 3300025972 Ga0207668_10723113 Ga0207668_107231132 96
546 3300025981 Ga0207640_10049671 Ga0207640_100496711 96
547 3300025981 Ga0207640_10121950 Ga0207640_101219504 96
548 3300025986 Ga0207658_10000383 Ga0207658_1000038340 96
549 3300025986 Ga0207658_10010991 Ga0207658_100109916 96
550 3300025986 Ga0207658_10011237 Ga0207658_100112376 96
551 3300025986 Ga0207658_10890683 Ga0207658_108906833 96
552 3300025986 Ga0207658_10971359 Ga0207658_109713592 96
553 3300026023 Ga0207677_10002864 Ga0207677_100028647 96
554 3300026023 Ga0207677_10364941 Ga0207677_103649414 96
555 3300026023 Ga0207677_10622158 Ga0207677_106221582 96
556 3300026035 Ga0207703_10000920 Ga0207703_100009206 96
557 3300026035 Ga0207703_10013422 Ga0207703_100134229 96
558 3300026035 Ga0207703_10259384 Ga0207703_102593843 96
559 3300026041 Ga0207639_10005136 Ga0207639_100051366 96
560 3300026041 Ga0207639_10973174 Ga0207639_109731741 96
561 3300026067 Ga0207678_10003253 Ga0207678_100032535 96
562 3300026067 Ga0207678_10015024 Ga0207678_100150249 96
563 3300026078 Ga0207702_10267532 Ga0207702_102675322 96
564 3300026088 Ga0207641_10002928 Ga0207641_1000292814 96
565 3300026089 Ga0207648_10021128 Ga0207648_100211288 96
566 3300026089 Ga0207648_10028299 Ga0207648_100282997 96
567 3300026095 Ga0207676_10070294 Ga0207676_100702941 96
568 3300026095 Ga0207676_10188226 Ga0207676_101882262 96
569 3300026095 Ga0207676_11258609 Ga0207676_112586092 96
570 3300026118 Ga0207675_100000544 Ga0207675_10000054435 96
571 3300026118 Ga0207675_100015163 Ga0207675_1000151636 96
572 3300026118 Ga0207675_100172690 Ga0207675_1001726904 96
573 3300026118 Ga0207675_101833233 Ga0207675_1018332331 96
574 3300026121 Ga0207683_10000335 Ga0207683_1000033536 96
575 3300026121 Ga0207683_10057779 Ga0207683_100577795 96
576 3300026121 Ga0207683_12012714 Ga0207683_120127141 96
577 3300026142 Ga0207698_10138786 Ga0207698_101387864 96
578 3300026142 Ga0207698_10229905 Ga0207698_102299054 96
579 3300027907 Ga0207428_10533328 Ga0207428_105333281 96
580 3300028379 Ga0268266_10032648 Ga0268266_100326486 96
581 3300028379 Ga0268266_10190460 Ga0268266_101904601 96
582 3300028379 Ga0268266_10590424 Ga0268266_105904242 96
583 3300028379 Ga0268266_12060892 Ga0268266_120608922 96
584 3300028380 Ga0268265_10000159 Ga0268265_1000015936 96
585 3300028380 Ga0268265_10044071 Ga0268265_100440716 96
586 3300028380 Ga0268265_10194523 Ga0268265_101945234 96
587 3300028380 Ga0268265_10756464 Ga0268265_107564641 96
588 3300028381 Ga0268264_10000005 Ga0268264_10000005851 96
589 3300028381 Ga0268264_10001041 Ga0268264_1000104121 96
590 3300028381 Ga0268264_10294371 Ga0268264_102943712 96
591 3300028381 Ga0268264_10511651 Ga0268264_105116513 96
592 3300031251 Ga0265327_10004280 Ga0265327_1000428010 96
593 3300031456 Ga0307513_10743679 Ga0307513_107436792 96
594 3300031548 Ga0307408_100762940 Ga0307408_1007629401 96
595 3300031824 Ga0307413_10115722 Ga0307413_101157223 96
596 3300031824 Ga0307413_10377010 Ga0307413_103770102 96
597 3300031824 Ga0307413_10500894 Ga0307413_105008943 96
598 3300031852 Ga0307410_10015784 Ga0307410_100157844 96
599 3300031852 Ga0307410_11122565 Ga0307410_111225652 96
600 3300031901 Ga0307406_10048745 Ga0307406_100487453 96
601 3300031901 Ga0307406_10539594 Ga0307406_105395941 96
602 3300031911 Ga0307412_10041003 Ga0307412_100410034 96
603 3300031995 Ga0307409_100000649 Ga0307409_1000006492 96
604 3300031995 Ga0307409_101232462 Ga0307409_1012324622 96
605 3300032002 Ga0307416_100002172 Ga0307416_1000021728 96
606 3300032002 Ga0307416_101879339 Ga0307416_1018793392 96
607 3300032005 Ga0307411_10124695 Ga0307411_101246952 96
608 3300032005 Ga0307411_10216432 Ga0307411_102164322 96
609 3300032126 Ga0307415_100043135 Ga0307415_1000431354 96
610 3300035090 Ga0373949_0138647 Ga0373949_0138647_164_460 96
611 3300035091 Ga0373951_0102485 Ga0373951_0102485_49_345 96
612 3300035242 Ga0373962_0048327 Ga0373962_0048327_624_920 96
613 3300035691 Ga0373931_0042807 Ga0373931_0042807_910_1206 96
614 3300035691 Ga0373931_0276572 Ga0373931_0276572_721_1017 96
615 3300039437 Ga0436365_1279297 Ga0436365_1279297_224_526 96
616 3300039450 Ga0436363_0907136 Ga0436363_0907136_152_454 96
617 3300039450 Ga0436363_1032215 Ga0436363_1032215_607_915 96
618 3300041410 Ga0439461_0017272 Ga0439461_0017272_433_729 96
619 3300041410 Ga0439461_0164438 Ga0439461_0164438_117_422 96
620 3300041411 Ga0439466_0003336 Ga0439466_0003336_1841_2137 96
621 3300041411 Ga0439466_0005429 Ga0439466_0005429_2388_2690 96
622 3300041413 Ga0439465_0002390 Ga0439465_0002390_3746_4042 96
623 3300041443 Ga0451789_0678462 Ga0451789_0678462_44_355 96
624 3300041443 Ga0451789_0888216 Ga0451789_0888216_779_1075 96
625 3300041446 Ga0451794_05147 Ga0451794_05147_143_454 96
626 3300041452 Ga0451793_0184391 Ga0451793_0184391_1551_1862 96
627 3300041453 Ga0451797_1156091 Ga0451797_1156091_41_352 96
628 3300041460 Ga0451802_1339380 Ga0451802_1339380_426_737 96
629 3300041460 Ga0451802_1992298 Ga0451802_1992298_290_601 96
630 3300041486 Ga0451807_1241670 Ga0451807_1241670_142_453 96
631 3300041498 Ga0451841_0303713 Ga0451841_0303713_198_512 96
632 3300041498 Ga0451841_1061137 Ga0451841_1061137_889_1200 96
633 3300041503 Ga0451847_0576711 Ga0451847_0576711_399_710 96
634 3300041509 Ga0451843_0772406 Ga0451843_0772406_359_670 96
635 3300041512 Ga0451853_1496362 Ga0451853_1496362_64_375 96
636 3300041997 Ga0439431_0000416 Ga0439431_0000416_4453_4755 96
637 3300041997 Ga0439431_0066392 Ga0439431_0066392_122_418 96
638 3300042002 Ga0439442_034471 Ga0439442_034471_236_532 96
639 3300042004 Ga0439445_0001277 Ga0439445_0001277_1294_1596 96
640 3300042004 Ga0439445_0009255 Ga0439445_0009255_1694_1990 96
641 3300042008 Ga0439450_151198 Ga0439450_151198_88_384 96
642 3300042435 Ga0439434_0001827 Ga0439434_0001827_3819_4121 96
643 3300042435 Ga0439434_0002991 Ga0439434_0002991_3971_4267 96
644 3300044658 Ga0466972_0014330 Ga0466972_0014330_166_468 96
645 3300044658 Ga0466972_0120226 Ga0466972_0120226_819_1115 96
646 3300044683 Ga0466965_0002913 Ga0466965_0002913_3972_4283 96
647 3300044683 Ga0466965_0029923 Ga0466965_0029923_1473_1775 96
648 3300044683 Ga0466965_0083523 Ga0466965_0083523_1117_1419 96
649 3300044683 Ga0466965_0102931 Ga0466965_0102931_976_1287 96
650 3300044683 Ga0466965_0235939 Ga0466965_0235939_646_945 96
651 3300044683 Ga0466965_0248482 Ga0466965_0248482_415_717 96
652 3300044693 Ga0466961_0074698 Ga0466961_0074698_1408_1710 96
653 3300044694 Ga0466963_0228127 Ga0466963_0228127_514_807 96
654 3300044706 Ga0466964_0190974 Ga0466964_0190974_345_647 96
655 3300044719 Ga0466971_0092650 Ga0466971_0092650_319_621 96
656 3300044735 Ga0466968_0004772 Ga0466968_0004772_2160_2471 96
657 3300044735 Ga0466968_0048793 Ga0466968_0048793_340_636 96
658 3300044765 Ga0466970_0021122 Ga0466970_0021122_3003_3314 96
659 3300044765 Ga0466970_0223349 Ga0466970_0223349_160_462 96
660 3300044765 Ga0466970_0379278 Ga0466970_0379278_469_765 96
661 3300044842 Ga0466957_0292223 Ga0466957_0292223_247_579 96
662 3300044842 Ga0466957_0311111 Ga0466957_0311111_675_986 96
663 3300044901 Ga0466960_0006575 Ga0466960_0006575_3053_3364 96
664 3300044901 Ga0466960_0282784 Ga0466960_0282784_443_739 96
665 3300045049 Ga0466959_0030872 Ga0466959_0030872_2219_2521 96
666 3300045049 Ga0466959_0124827 Ga0466959_0124827_65_376 96
667 3300045836 Ga0466958_0079095 Ga0466958_0079095_594_896 96
668 3300045976 Ga0466967_0006912 Ga0466967_0006912_4540_4851 96
669 3300045976 Ga0466967_0032235 Ga0466967_0032235_3096_3407 96
670 3300045976 Ga0466967_0167085 Ga0466967_0167085_899_1234 96
671 3300045976 Ga0466967_0176662 Ga0466967_0176662_153_452 96
672 3300045976 Ga0466967_0304473 Ga0466967_0304473_21_314 96
673 3300045976 Ga0466967_1395681 Ga0466967_1395681_80_376 96
674 3300046500 Ga0495596_0426665 Ga0495596_0426665_22_342 96
675 3300046507 Ga0495606_0027477 Ga0495606_0027477_1545_1856 96
676 3300046524 Ga0495648_0006968 Ga0495648_0006968_3499_3810 96
677 3300046530 Ga0495654_0076250 Ga0495654_0076250_112_423 96
678 3300046648 Ga0495611_0057947 Ga0495611_0057947_628_939 96
679 3300047320 Ga0495672_0000892 Ga0495672_0000892_6672_6983 96
680 3300047469 Ga0495673_0002880 Ga0495673_0002880_5200_5511 96
681 3300047472 Ga0495686_0139406 Ga0495686_0139406_51_362 96
682 3300048903 Ga0496100_0000033 Ga0496100_0000033_63073_63384 96
683 3300048903 Ga0496100_0000307 Ga0496100_0000307_21207_21518 96
684 3300048903 Ga0496100_0000383 Ga0496100_0000383_18750_19046 96
685 3300048903 Ga0496100_0025799 Ga0496100_0025799_188_496 96
686 3300048904 Ga0496101_0000008 Ga0496101_0000008_67680_67991 96
687 3300048904 Ga0496101_0000033 Ga0496101_0000033_145116_145427 96
688 3300048904 Ga0496101_0003204 Ga0496101_0003204_4625_4921 96
689 3300048904 Ga0496101_0431825 Ga0496101_0431825_517_825 96
690 3300048905 Ga0496102_0000005 Ga0496102_0000005_217762_218073 96
691 3300048905 Ga0496102_0000257 Ga0496102_0000257_41859_42167 96
692 3300048905 Ga0496102_0004668 Ga0496102_0004668_4300_4596 96
693 3300048905 Ga0496102_0154202 Ga0496102_0154202_1545_1841 96
694 3300048905 Ga0496102_0495546 Ga0496102_0495546_92_388 96
695 3300048906 Ga0496103_0000002 Ga0496103_0000002_263895_264206 96
696 3300048906 Ga0496103_0000393 Ga0496103_0000393_23684_23995 96
697 3300048906 Ga0496103_0000540 Ga0496103_0000540_1417_1725 96
698 3300048906 Ga0496103_0002854 Ga0496103_0002854_10135_10431 96
699 3300048906 Ga0496103_0374717 Ga0496103_0374717_349_645 96
700 3300048906 Ga0496103_0512000 Ga0496103_0512000_385_681 96
701 3300048907 Ga0496104_0229871 Ga0496104_0229871_999_1295 96
702 3300048908 Ga0496105_0484214 Ga0496105_0484214_250_546 96
703 3300048908 Ga0496105_0758351 Ga0496105_0758351_337_648 96
704 3300048909 Ga0496106_0000615 Ga0496106_0000615_20177_20473 96
705 3300048909 Ga0496106_0000777 Ga0496106_0000777_21124_21435 96
706 3300048909 Ga0496106_0012783 Ga0496106_0012783_3966_4262 96
707 3300048909 Ga0496106_0040081 Ga0496106_0040081_1238_1549 96
708 3300048910 Ga0496107_0000083 Ga0496107_0000083_30823_31134 96
709 3300048910 Ga0496107_0001171 Ga0496107_0001171_15580_15876 96
710 3300048910 Ga0496107_0006327 Ga0496107_0006327_1020_1331 96
711 3300048910 Ga0496107_0206985 Ga0496107_0206985_642_950 96
712 3300048911 Ga0496108_0002478 Ga0496108_0002478_7947_8258 96
713 3300048911 Ga0496108_0003256 Ga0496108_0003256_10899_11195 96
714 3300048911 Ga0496108_0076780 Ga0496108_0076780_225_551 96
715 3300048912 Ga0496109_0000293 Ga0496109_0000293_39218_39529 96
716 3300048912 Ga0496109_0001978 Ga0496109_0001978_13126_13422 96
717 3300048912 Ga0496109_0167328 Ga0496109_0167328_805_1107 96
718 3300048912 Ga0496109_0473721 Ga0496109_0473721_465_791 96
719 3300048913 Ga0496110_0066830 Ga0496110_0066830_1221_1532 96
720 3300048913 Ga0496110_0251986 Ga0496110_0251986_272_568 96
721 3300048915 Ga0496112_0047284 Ga0496112_0047284_230_526 96
722 3300048915 Ga0496112_0377459 Ga0496112_0377459_876_1172 96
723 3300048915 Ga0496112_0489533 Ga0496112_0489533_421_723 96
724 3300048915 Ga0496112_0764416 Ga0496112_0764416_506_808 96
725 3300048916 Ga0496113_0294515 Ga0496113_0294515_164_475 96
726 3300048916 Ga0496113_0372642 Ga0496113_0372642_493_789 96
727 3300048916 Ga0496113_0858603 Ga0496113_0858603_326_622 96
728 3300048917 Ga0496114_0000517 Ga0496114_0000517_21877_22173 96
729 3300048917 Ga0496114_0002766 Ga0496114_0002766_8218_8529 96
730 3300048918 Ga0496115_1315795 Ga0496115_1315795_119_415 96
731 3300048919 Ga0496116_0000034 Ga0496116_0000034_145628_145939 96
732 3300048919 Ga0496116_0001049 Ga0496116_0001049_10848_11159 96
733 3300048919 Ga0496116_0033542 Ga0496116_0033542_2763_3071 96
734 3300048920 Ga0496117_0000003 Ga0496117_0000003_856031_856342 96
735 3300048920 Ga0496117_0000390 Ga0496117_0000390_57527_57835 96
736 3300048920 Ga0496117_0002218 Ga0496117_0002218_19268_19579 96
737 3300048921 Ga0496118_0000001 Ga0496118_0000001_856034_856345 96
738 3300048921 Ga0496118_0002226 Ga0496118_0002226_21134_21442 96
739 3300048921 Ga0496118_0010693 Ga0496118_0010693_176_487 96
740 3300048921 Ga0496118_0509823 Ga0496118_0509823_168_464 96
741 3300048922 Ga0496119_0001001 Ga0496119_0001001_12668_12979 96
742 3300048922 Ga0496119_0013888 Ga0496119_0013888_2756_3067 96
743 3300048922 Ga0496119_0015314 Ga0496119_0015314_1036_1344 96
744 3300048922 Ga0496119_0508129 Ga0496119_0508129_13_324 96
745 3300048923 Ga0496120_0000241 Ga0496120_0000241_3419_3730 96
746 3300048923 Ga0496120_0047544 Ga0496120_0047544_1589_1900 96
747 3300048923 Ga0496120_0054340 Ga0496120_0054340_1275_1583 96
748 3300048924 Ga0496121_0000002 Ga0496121_0000002_1349633_1349944 96
749 3300048924 Ga0496121_0000421 Ga0496121_0000421_45319_45630 96
750 3300048924 Ga0496121_0002203 Ga0496121_0002203_1512_1820 96
751 3300048925 Ga0496122_0000051 Ga0496122_0000051_9269_9580 96
752 3300048926 Ga0496123_0001082 Ga0496123_0001082_20891_21202 96
753 3300048926 Ga0496123_0179182 Ga0496123_0179182_727_1038 96
754 3300048927 Ga0496124_0000002 Ga0496124_0000002_144645_144956 96
755 3300048927 Ga0496124_0203268 Ga0496124_0203268_334_642 96
756 3300048928 Ga0496125_0000002 Ga0496125_0000002_1349633_1349944 96
757 3300048928 Ga0496125_0023269 Ga0496125_0023269_5105_5413 96
758 3300048929 Ga0496126_0000011 Ga0496126_0000011_144645_144956 96
759 3300048929 Ga0496126_0000805 Ga0496126_0000805_11948_12259 96
760 3300048929 Ga0496126_0533481 Ga0496126_0533481_382_693 96
761 3300048929 Ga0496126_0764614 Ga0496126_0764614_401_709 96
762 3300049569 Ga0501032_0009298 Ga0501032_0009298_5258_5560 96
763 3300049571 Ga0501034_0014878 Ga0501034_0014878_655_957 96
764 3300049572 Ga0501036_0033970 Ga0501036_0033970_1478_1780 96
765 3300049573 Ga0501037_0001465 Ga0501037_0001465_414_716 96
766 3300049576 Ga0501040_0268460 Ga0501040_0268460_640_942 96
767 3300049579 Ga0501043_0001059 Ga0501043_0001059_16238_16540 96
768 3300049581 Ga0501047_0911358 Ga0501047_0911358_258_560 96
769 3300049584 Ga0501068_0635386 Ga0501068_0635386_261_563 96
770 3300049586 Ga0501070_0001045 Ga0501070_0001045_7874_8176 96
771 3300049586 Ga0501070_0090058 Ga0501070_0090058_2176_2481 96
772 3300049586 Ga0501070_0331554 Ga0501070_0331554_399_698 96
773 3300049587 Ga0501071_0735291 Ga0501071_0735291_33_335 96
774 3300049593 Ga0501077_0324311 Ga0501077_0324311_254_556 96
775 3300049741 Ga0501079_0958133 Ga0501079_0958133_320_622 96
776 3300049742 Ga0501080_0763685 Ga0501080_0763685_427_729 96
777 3300050489 nmdc:mga03683_282316_c1 nmdc:mga03683_282316_c1_71_376 96
778 3300050489 nmdc:mga03683_41391_c1 nmdc:mga03683_41391_c1_221_526 96
779 3300050489 nmdc:mga03683_4742_c1 nmdc:mga03683_4742_c1_1593_1886 96
780 3300050489 nmdc:mga03683_63873_c1 nmdc:mga03683_63873_c1_115_417 96
781 3300050490 nmdc:mga03n38_2737_c1 nmdc:mga03n38_2737_c1_2806_3111 96
782 3300050490 nmdc:mga03n38_294500_c1 nmdc:mga03n38_294500_c1_355_660 96
783 3300050490 nmdc:mga03n38_336848_c1 nmdc:mga03n38_336848_c1_111_416 96
784 3300050490 nmdc:mga03n38_355895_c1 nmdc:mga03n38_355895_c1_191_493 96
785 3300050490 nmdc:mga03n38_561408_c1 nmdc:mga03n38_561408_c1_198_503 96
786 3300050490 nmdc:mga03n38_7697_c1 nmdc:mga03n38_7697_c1_2082_2387 96
787 3300050490 nmdc:mga03n38_77171_c1 nmdc:mga03n38_77171_c1_974_1279 96
788 3300050490 nmdc:mga03n38_797118_c1 nmdc:mga03n38_797118_c1_205_501 96
789 3300050491 nmdc:mga00v17_16828_c1 nmdc:mga00v17_16828_c1_3466_3771 96
790 3300050491 nmdc:mga00v17_182570_c1 nmdc:mga00v17_182570_c1_649_954 96
791 3300050491 nmdc:mga00v17_26886_c1 nmdc:mga00v17_26886_c1_1509_1802 96
792 3300050491 nmdc:mga00v17_28589_c1 nmdc:mga00v17_28589_c1_2198_2500 96
793 3300050491 nmdc:mga00v17_312725_c1 nmdc:mga00v17_312725_c1_376_681 96
794 3300050491 nmdc:mga00v17_464724_c1 nmdc:mga00v17_464724_c1_230_541 96
795 3300050492 nmdc:mga0yw44_135112_c1 nmdc:mga0yw44_135112_c1_282_584 96
796 3300050492 nmdc:mga0yw44_143301_c1 nmdc:mga0yw44_143301_c1_60_353 96
797 3300050492 nmdc:mga0yw44_161414_c1 nmdc:mga0yw44_161414_c1_887_1198 96
798 3300050492 nmdc:mga0yw44_263583_c1 nmdc:mga0yw44_263583_c1_487_792 96
799 3300050492 nmdc:mga0yw44_442646_c1 nmdc:mga0yw44_442646_c1_152_475 96
800 3300050492 nmdc:mga0yw44_465326_c1 nmdc:mga0yw44_465326_c1_288_599 96
801 3300050492 nmdc:mga0yw44_569474_c1 nmdc:mga0yw44_569474_c1_280_585 96
802 3300050492 nmdc:mga0yw44_890157_c1 nmdc:mga0yw44_890157_c1_129_452 96
803 3300050492 nmdc:mga0yw44_95642_c1 nmdc:mga0yw44_95642_c1_1201_1506 96
804 3300050493 nmdc:mga0k408_41793_c1 nmdc:mga0k408_41793_c1_160_465 96
805 3300050493 nmdc:mga0k408_469831_c1 nmdc:mga0k408_469831_c1_252_545 96
806 3300050494 nmdc:mga06z11_55944_c1 nmdc:mga06z11_55944_c1_1376_1681 96
807 3300050494 nmdc:mga06z11_603453_c1 nmdc:mga06z11_603453_c1_213_506 96
808 3300050495 nmdc:mga04h51_21305_c1 nmdc:mga04h51_21305_c1_471_776 96
809 3300050495 nmdc:mga04h51_85760_c1 nmdc:mga04h51_85760_c1_276_569 96
810 3300050496 nmdc:mga07m45_10218_c1 nmdc:mga07m45_10218_c1_377_682 96
811 3300050496 nmdc:mga07m45_118121_c1 nmdc:mga07m45_118121_c1_734_1030 96
812 3300050496 nmdc:mga07m45_27866_c1 nmdc:mga07m45_27866_c1_1967_2269 96
813 3300050496 nmdc:mga07m45_42475_c1 nmdc:mga07m45_42475_c1_1844_2149 96
814 3300050496 nmdc:mga07m45_45201_c1 nmdc:mga07m45_45201_c1_566_862 96
815 3300050507 nmdc:mga05p37_1568544_c1 nmdc:mga05p37_1568544_c1_271_564 96
816 3300050507 nmdc:mga05p37_87296_c1 nmdc:mga05p37_87296_c1_2054_2350 96
817 3300050509 nmdc:mga0qj67_19994_c1 nmdc:mga0qj67_19994_c1_4179_4475 96
818 3300050510 nmdc:mga06r32_32424_c1 nmdc:mga06r32_32424_c1_2026_2322 96
819 3300050511 nmdc:mga08y16_1646474_c1 nmdc:mga08y16_1646474_c1_64_414 96
820 3300050515 nmdc:mga0a205_331119_c1 nmdc:mga0a205_331119_c1_1025_1327 96
821 3300050516 nmdc:mga0sz30_103073_c2 nmdc:mga0sz30_103073_c2_220_525 96
822 3300050516 nmdc:mga0sz30_17777_c1 nmdc:mga0sz30_17777_c1_1559_1852 96
823 3300050516 nmdc:mga0sz30_27081_c2 nmdc:mga0sz30_27081_c2_1220_1516 96
824 3300050516 nmdc:mga0sz30_279571_c1 nmdc:mga0sz30_279571_c1_389_685 96
825 3300053087 Ga0500643_002732 Ga0500643_002732_3892_4203 96
826 3300053090 Ga0500646_0039744 Ga0500646_0039744_107_400 96
827 3300053094 Ga0500566_0429975 Ga0500566_0429975_95_388 96
828 3300053153 Ga0500616_0002892 Ga0500616_0002892_5071_5382 96
829 3300053155 Ga0500620_040274 Ga0500620_040274_955_1248 96
830 3300053160 Ga0500633_0047396 Ga0500633_0047396_510_821 96
831 3300059510 Ga0587090_146616 Ga0587090_146616_101_412 96
832 3300061719 Ga0466962_0024515 Ga0466962_0024515_1050_1352 96
833 3300000545 CNXas_1000300 CNXas_10003003 97
834 3300002459 JGI24751J29686_10011383 JGI24751J29686_100113832 97
835 3300005289 Ga0065704_10454399 Ga0065704_104543991 97
836 3300005331 Ga0070670_100086471 Ga0070670_1000864713 97
837 3300005335 Ga0070666_10845948 Ga0070666_108459481 97
838 3300005347 Ga0070668_100000604 Ga0070668_10000060416 97
839 3300005347 Ga0070668_100053389 Ga0070668_1000533892 97
840 3300005355 Ga0070671_100006503 Ga0070671_1000065036 97
841 3300005355 Ga0070671_100043463 Ga0070671_1000434633 97
842 3300005355 Ga0070671_100194584 Ga0070671_1001945843 97
843 3300005356 Ga0070674_100461193 Ga0070674_1004611932 97
844 3300005367 Ga0070667_100095421 Ga0070667_1000954212 97
845 3300005367 Ga0070667_100448770 Ga0070667_1004487701 97
846 3300005367 Ga0070667_101050879 Ga0070667_1010508791 97
847 3300005437 Ga0070710_11149494 Ga0070710_111494942 97
848 3300005455 Ga0070663_101257211 Ga0070663_1012572111 97
849 3300005456 Ga0070678_100478191 Ga0070678_1004781912 97
850 3300005466 Ga0070685_10505789 Ga0070685_105057892 97
851 3300005544 Ga0070686_100081511 Ga0070686_1000815112 97
852 3300005544 Ga0070686_100807117 Ga0070686_1008071172 97
853 3300005548 Ga0070665_100993248 Ga0070665_1009932482 97
854 3300005615 Ga0070702_100415830 Ga0070702_1004158302 97
855 3300005616 Ga0068852_102414700 Ga0068852_1024147002 97
856 3300005718 Ga0068866_10247575 Ga0068866_102475753 97
857 3300005719 Ga0068861_101384194 Ga0068861_1013841941 97
858 3300005840 Ga0068870_10862670 Ga0068870_108626703 97
859 3300005841 Ga0068863_100003689 Ga0068863_10000368916 97
860 3300005841 Ga0068863_100869736 Ga0068863_1008697362 97
861 3300005841 Ga0068863_101838165 Ga0068863_1018381651 97
862 3300005842 Ga0068858_100218475 Ga0068858_1002184752 97
863 3300005842 Ga0068858_100547142 Ga0068858_1005471422 97
864 3300005842 Ga0068858_101644456 Ga0068858_1016444562 97
865 3300005843 Ga0068860_102567264 Ga0068860_1025672642 97
866 3300005843 Ga0068860_102685411 Ga0068860_1026854111 97
867 3300005844 Ga0068862_101109055 Ga0068862_1011090552 97
868 3300005937 Ga0081455_10177818 Ga0081455_101778181 97
869 3300006038 Ga0075365_10154536 Ga0075365_101545364 97
870 3300006048 Ga0075363_100025097 Ga0075363_1000250972 97
871 3300006048 Ga0075363_100337741 Ga0075363_1003377412 97
872 3300006051 Ga0075364_10001416 Ga0075364_1000141611 97
873 3300006051 Ga0075364_10487519 Ga0075364_104875192 97
874 3300006177 Ga0075362_10290559 Ga0075362_102905592 97
875 3300006186 Ga0075369_10000571 Ga0075369_1000057114 97
876 3300006186 Ga0075369_10138350 Ga0075369_101383502 97
877 3300006353 Ga0075370_10130598 Ga0075370_101305982 97
878 3300006358 Ga0068871_100819008 Ga0068871_1008190082 97
879 3300006846 Ga0075430_100059016 Ga0075430_1000590161 97
880 3300006881 Ga0068865_100550404 Ga0068865_1005504042 97
881 3300009011 Ga0105251_10233167 Ga0105251_102331671 97
882 3300009092 Ga0105250_10084209 Ga0105250_100842093 97
883 3300009092 Ga0105250_10288945 Ga0105250_102889451 97
884 3300009101 Ga0105247_11583189 Ga0105247_115831891 97
885 3300009176 Ga0105242_10208526 Ga0105242_102085263 97
886 3300009177 Ga0105248_10087668 Ga0105248_100876683 97
887 3300009177 Ga0105248_10826344 Ga0105248_108263441 97
888 3300009551 Ga0105238_10317361 Ga0105238_103173613 97
889 3300009553 Ga0105249_10022007 Ga0105249_100220073 97
890 3300010159 Ga0099796_10010920 Ga0099796_100109203 97
891 3300013297 Ga0157378_10890388 Ga0157378_108903882 97
892 3300013308 Ga0157375_10139581 Ga0157375_101395814 97
893 3300014325 Ga0163163_10756181 Ga0163163_107561812 97
894 3300014326 Ga0157380_10429896 Ga0157380_104298964 97
895 3300014968 Ga0157379_11428335 Ga0157379_114283352 97
896 3300017792 Ga0163161_10839847 Ga0163161_108398472 97
897 3300025303 Ga0209051_1022917 Ga0209051_10229172 97
898 3300025303 Ga0209051_1044453 Ga0209051_10444533 97
899 3300025903 Ga0207680_10338675 Ga0207680_103386752 97
900 3300025924 Ga0207694_10145782 Ga0207694_101457824 97
901 3300025925 Ga0207650_10109673 Ga0207650_101096733 97
902 3300025931 Ga0207644_10027298 Ga0207644_100272981 97
903 3300025931 Ga0207644_10158883 Ga0207644_101588833 97
904 3300025931 Ga0207644_10197549 Ga0207644_101975491 97
905 3300025936 Ga0207670_11074164 Ga0207670_110741642 97
906 3300025937 Ga0207669_10158989 Ga0207669_101589892 97
907 3300025938 Ga0207704_10128721 Ga0207704_101287213 97
908 3300025941 Ga0207711_10112050 Ga0207711_101120503 97
909 3300025961 Ga0207712_10269342 Ga0207712_102693422 97
910 3300025972 Ga0207668_10000770 Ga0207668_1000077013 97
911 3300025972 Ga0207668_10232143 Ga0207668_102321432 97
912 3300025986 Ga0207658_10004854 Ga0207658_100048542 97
913 3300025986 Ga0207658_10917992 Ga0207658_109179922 97
914 3300026035 Ga0207703_10543410 Ga0207703_105434102 97
915 3300026035 Ga0207703_10580612 Ga0207703_105806122 97
916 3300026035 Ga0207703_10716983 Ga0207703_107169832 97
917 3300026041 Ga0207639_10016036 Ga0207639_100160366 97
918 3300026067 Ga0207678_10670745 Ga0207678_106707453 97
919 3300026088 Ga0207641_10029024 Ga0207641_100290245 97
920 3300026088 Ga0207641_10414173 Ga0207641_104141732 97
921 3300026089 Ga0207648_12033040 Ga0207648_120330402 97
922 3300026121 Ga0207683_10451543 Ga0207683_104515433 97
923 3300028379 Ga0268266_10378892 Ga0268266_103788921 97
924 3300028379 Ga0268266_10652806 Ga0268266_106528062 97
925 3300028381 Ga0268264_11975181 Ga0268264_119751812 97
926 3300032139 Ga0316580_10169555 Ga0316580_101695552 97
927 3300032168 Ga0316593_10147375 Ga0316593_101473752 97
928 3300033524 Ga0316592_1084493 Ga0316592_10844932 97
929 3300033541 Ga0316596_1078760 Ga0316596_10787601 97
930 3300036712 Ga0316584_0073524 Ga0316584_0073524_1093_1416 97
931 3300041411 Ga0439466_0044833 Ga0439466_0044833_1042_1335 97
932 3300041413 Ga0439465_0050299 Ga0439465_0050299_99_392 97
933 3300042002 Ga0439442_082748 Ga0439442_082748_257_550 97
934 3300042435 Ga0439434_0112473 Ga0439434_0112473_127_420 97
935 3300044658 Ga0466972_0044291 Ga0466972_0044291_1571_1876 97
936 3300044658 Ga0466972_0566073 Ga0466972_0566073_71_376 97
937 3300044735 Ga0466968_0039664 Ga0466968_0039664_339_644 97
938 3300044765 Ga0466970_0027961 Ga0466970_0027961_1428_1733 97
939 3300046460 Ga0495638_0007924 Ga0495638_0007924_6461_6772 97
940 3300046460 Ga0495638_0014570 Ga0495638_0014570_1917_2228 97
941 3300046616 Ga0495668_0246567 Ga0495668_0246567_268_579 97
942 3300046692 Ga0495671_0367385 Ga0495671_0367385_192_497 97
943 3300047320 Ga0495672_0130773 Ga0495672_0130773_709_1020 97
944 3300048091 Ga0495626_0174226 Ga0495626_0174226_282_593 97
945 3300048091 Ga0495626_0257863 Ga0495626_0257863_19_330 97
946 3300048903 Ga0496100_0001064 Ga0496100_0001064_4286_4597 97
947 3300048903 Ga0496100_0683213 Ga0496100_0683213_108_413 97
948 3300048904 Ga0496101_0000270 Ga0496101_0000270_27532_27843 97
949 3300048904 Ga0496101_0054409 Ga0496101_0054409_1889_2200 97
950 3300048904 Ga0496101_0750292 Ga0496101_0750292_157_462 97
951 3300048905 Ga0496102_0003067 Ga0496102_0003067_3703_4008 97
952 3300048907 Ga0496104_0004313 Ga0496104_0004313_5282_5593 97
953 3300048907 Ga0496104_0010659 Ga0496104_0010659_2713_3018 97
954 3300048908 Ga0496105_0019662 Ga0496105_0019662_178_483 97
955 3300048908 Ga0496105_0435057 Ga0496105_0435057_342_653 97
956 3300048909 Ga0496106_0174404 Ga0496106_0174404_1280_1591 97
957 3300048910 Ga0496107_0005215 Ga0496107_0005215_3232_3543 97
958 3300048910 Ga0496107_0206319 Ga0496107_0206319_886_1191 97
959 3300048911 Ga0496108_0093861 Ga0496108_0093861_2076_2381 97
960 3300048911 Ga0496108_0248223 Ga0496108_0248223_337_648 97
961 3300048911 Ga0496108_0284525 Ga0496108_0284525_925_1230 97
962 3300048912 Ga0496109_0038037 Ga0496109_0038037_2381_2686 97
963 3300048912 Ga0496109_0799007 Ga0496109_0799007_138_443 97
964 3300048913 Ga0496110_0029596 Ga0496110_0029596_2187_2492 97
965 3300048913 Ga0496110_0042318 Ga0496110_0042318_2924_3229 97
966 3300048913 Ga0496110_0290617 Ga0496110_0290617_374_685 97
967 3300048914 Ga0496111_0016877 Ga0496111_0016877_1115_1420 97
968 3300048914 Ga0496111_0184564 Ga0496111_0184564_1218_1523 97
969 3300048915 Ga0496112_0108326 Ga0496112_0108326_1213_1518 97
970 3300048915 Ga0496112_0278301 Ga0496112_0278301_259_564 97
971 3300048916 Ga0496113_0073302 Ga0496113_0073302_1511_1816 97
972 3300048916 Ga0496113_0386083 Ga0496113_0386083_267_578 97
973 3300048917 Ga0496114_0010038 Ga0496114_0010038_5536_5847 97
974 3300048917 Ga0496114_1083034 Ga0496114_1083034_269_580 97
975 3300048918 Ga0496115_0008855 Ga0496115_0008855_2177_2488 97
976 3300048918 Ga0496115_0134115 Ga0496115_0134115_1415_1726 97
977 3300048924 Ga0496121_0401867 Ga0496121_0401867_19_330 97
978 3300048927 Ga0496124_0925621 Ga0496124_0925621_85_396 97
979 3300048929 Ga0496126_0010992 Ga0496126_0010992_6406_6717 97
980 3300049823 Ga0501044_0022680 Ga0501044_0022680_4056_4373 97
981 3300050489 nmdc:mga03683_49033_c1 nmdc:mga03683_49033_c1_192_497 97
982 3300050490 nmdc:mga03n38_284722_c1 nmdc:mga03n38_284722_c1_233_535 97
983 3300050490 nmdc:mga03n38_7949_c1 nmdc:mga03n38_7949_c1_3368_3673 97
984 3300050491 nmdc:mga00v17_1839_c1 nmdc:mga00v17_1839_c1_3558_3863 97
985 3300050491 nmdc:mga00v17_208391_c1 nmdc:mga00v17_208391_c1_226_549 97
986 3300050492 nmdc:mga0yw44_111276_c1 nmdc:mga0yw44_111276_c1_599_910 97
987 3300050492 nmdc:mga0yw44_424311_c1 nmdc:mga0yw44_424311_c1_418_720 97
988 3300050496 nmdc:mga07m45_795161_c1 nmdc:mga07m45_795161_c1_89_394 97
989 3300050509 nmdc:mga0qj67_51566_c1 nmdc:mga0qj67_51566_c1_2933_3238 97
990 3300050516 nmdc:mga0sz30_113708_c1 nmdc:mga0sz30_113708_c1_553_864 97
991 3300050516 nmdc:mga0sz30_2053_c1 nmdc:mga0sz30_2053_c1_4325_4630 97
992 3300050516 nmdc:mga0sz30_247223_c1 nmdc:mga0sz30_247223_c1_67_378 97
993 3300053079 Ga0500610_0072788 Ga0500610_0072788_279_590 97
994 3300053080 Ga0500635_0068357 Ga0500635_0068357_273_584 97
995 3300053086 Ga0500578_0768663 Ga0500578_0768663_127_438 97
996 3300053087 Ga0500643_003257 Ga0500643_003257_6968_7279 97
997 3300053089 Ga0500581_301034 Ga0500581_301034_192_503 97
998 3300053092 Ga0500583_0287899 Ga0500583_0287899_335_646 97
999 3300053093 Ga0500651_0142671 Ga0500651_0142671_451_762 97
1000 3300053098 Ga0500650_0434409 Ga0500650_0434409_222_533 97
1001 3300053104 Ga0500556_0001801 Ga0500556_0001801_6585_6896 97
1002 3300053104 Ga0500556_0053181 Ga0500556_0053181_340_651 97
1003 3300053108 Ga0500562_005249 Ga0500562_005249_1016_1327 97
1004 3300053111 Ga0500572_309658 Ga0500572_309658_34_345 97
1005 3300053130 Ga0500642_0055010 Ga0500642_0055010_673_984 97
1006 3300053136 Ga0500559_0251104 Ga0500559_0251104_139_450 97
1007 3300053142 Ga0500577_0092628 Ga0500577_0092628_489_800 97
1008 3300053146 Ga0500588_0366193 Ga0500588_0366193_131_442 97
1009 3300053151 Ga0500604_0049468 Ga0500604_0049468_315_626 97
1010 3300053153 Ga0500616_0008826 Ga0500616_0008826_94_405 97
1011 3300053158 Ga0500627_0017142 Ga0500627_0017142_1055_1366 97
1012 3300053158 Ga0500627_0202190 Ga0500627_0202190_303_614 97
1013 3300053161 Ga0500634_0234517 Ga0500634_0234517_216_527 97
1014 3300053162 Ga0500638_268237 Ga0500638_268237_58_369 97
1015 3300053730 Ga0500645_000110 Ga0500645_000110_21187_21498 97
1016 3300053730 Ga0500645_013051 Ga0500645_013051_2174_2488 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

21

55

0.97

Feature Viewer

pLDDT pTM Quality
61.86 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map