F488262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1016 | 384 | 1003 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300025938|Ga0207704_10000458|Ga0207704_100004588 |
| Length | 115 |
| Sequence | MSDDERWSPPVGPIDPEHPECAAVIAEVWTLLDGECTAETRDKLRHHLEECPTCLRYYGVEERVKSLIAKKCSGEKAPDRLRERLRIEISRTTIIRGKLRRKAPLGIGALSVICL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 8 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 9 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 10 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 11 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 12 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 13 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 14 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 220 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 235 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 243 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 247 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 250 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 357 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 362 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 368 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 370 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 379 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 380 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.13 |
| Metatranscriptomes | 0.59 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.52 |
| Nodule | 0.1 |
| Rhizoplane | 10.63 |
| Rhizosphere | 65.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000300 | 3300000545 | Bacteria | 4777 |
| 2 | CNXas_1005113 | 3300000545 | Bacteria | 928 |
| 3 | JGI24746J21847_1011174 | 3300001977 | Bacteria | 1322 |
| 4 | JGI24747J21853_1015315 | 3300001978 | Bacteria | 803 |
| 5 | JGI24739J22299_10049710 | 3300001989 | Bacteria | 1358 |
| 6 | JGI24737J22298_10012890 | 3300001990 | Bacteria | 2725 |
| 7 | JGI24737J22298_10063782 | 3300001990 | Bacteria | 1106 |
| 8 | JGI24737J22298_10239371 | 3300001990 | Bacteria | 536 |
| 9 | JGI24743J22301_10122959 | 3300001991 | Bacteria | 570 |
| 10 | JGI24750J21931_1010814 | 3300002070 | Bacteria | 1194 |
| 11 | JGI24748J21848_1008609 | 3300002074 | Bacteria | 1200 |
| 12 | JGI24748J21848_1042239 | 3300002074 | Bacteria | 582 |
| 13 | JGI24749J21850_1027833 | 3300002076 | Bacteria | 807 |
| 14 | JGI24744J21845_10000131 | 3300002077 | Bacteria | 10464 |
| 15 | JGI24034J26672_10007839 | 3300002239 | Bacteria | 1554 |
| 16 | JGI24742J22300_10000618 | 3300002244 | Bacteria | 5345 |
| 17 | JGI24742J22300_10008441 | 3300002244 | Bacteria | 1699 |
| 18 | JGI24751J29686_10011383 | 3300002459 | Bacteria | 1835 |
| 19 | Ga0055528_1035658 | 3300003790 | Bacteria | 1203 |
| 20 | Ga0055540_1000040 | 3300003792 | Bacteria | 157728 |
| 21 | Ga0055540_1004993 | 3300003792 | Bacteria | 5768 |
| 22 | Ga0055540_1024706 | 3300003792 | Bacteria | 1486 |
| 23 | Ga0055540_1074105 | 3300003792 | Bacteria | 661 |
| 24 | Ga0065704_10454399 | 3300005289 | Bacteria | 702 |
| 25 | Ga0070676_10028426 | 3300005328 | Bacteria | 3176 |
| 26 | Ga0070676_11392526 | 3300005328 | Bacteria | 538 |
| 27 | Ga0070683_100183221 | 3300005329 | Bacteria | 1988 |
| 28 | Ga0070690_100007203 | 3300005330 | Bacteria | 6364 |
| 29 | Ga0070690_100730761 | 3300005330 | Bacteria | 763 |
| 30 | Ga0070670_100086471 | 3300005331 | Bacteria | 2694 |
| 31 | Ga0068869_100030180 | 3300005334 | Bacteria | 3804 |
| 32 | Ga0068869_100267775 | 3300005334 | Bacteria | 1370 |
| 33 | Ga0070666_10034273 | 3300005335 | Bacteria | 3365 |
| 34 | Ga0070666_10845948 | 3300005335 | Bacteria | 675 |
| 35 | Ga0070682_100047266 | 3300005337 | Bacteria | 2675 |
| 36 | Ga0070682_100084985 | 3300005337 | Bacteria | 2057 |
| 37 | Ga0070682_100210413 | 3300005337 | Bacteria | 1378 |
| 38 | Ga0070682_100524732 | 3300005337 | Bacteria | 922 |
| 39 | Ga0068868_100000203 | 3300005338 | Bacteria | 40057 |
| 40 | Ga0068868_100131427 | 3300005338 | Bacteria | 2049 |
| 41 | Ga0068868_100134492 | 3300005338 | Bacteria | 2025 |
| 42 | Ga0068868_100635871 | 3300005338 | Bacteria | 949 |
| 43 | Ga0068868_100826572 | 3300005338 | Bacteria | 838 |
| 44 | Ga0070660_100954421 | 3300005339 | Bacteria | 724 |
| 45 | Ga0070660_101627547 | 3300005339 | Bacteria | 550 |
| 46 | Ga0070689_100054776 | 3300005340 | Bacteria | 3088 |
| 47 | Ga0070689_101679834 | 3300005340 | Bacteria | 578 |
| 48 | Ga0070691_10000914 | 3300005341 | Bacteria | 11972 |
| 49 | Ga0070691_10134145 | 3300005341 | Bacteria | 1257 |
| 50 | Ga0070687_100124024 | 3300005343 | Bacteria | 1482 |
| 51 | Ga0070687_100549971 | 3300005343 | Bacteria | 785 |
| 52 | Ga0070692_10216409 | 3300005345 | Bacteria | 1130 |
| 53 | Ga0070692_10229364 | 3300005345 | Bacteria | 1102 |
| 54 | Ga0070692_10796338 | 3300005345 | Bacteria | 645 |
| 55 | Ga0070668_100000604 | 3300005347 | Bacteria | 24024 |
| 56 | Ga0070668_100015315 | 3300005347 | Bacteria | 5729 |
| 57 | Ga0070668_100053389 | 3300005347 | Bacteria | 3116 |
| 58 | Ga0070668_100269506 | 3300005347 | Bacteria | 1419 |
| 59 | Ga0070669_100000428 | 3300005353 | Bacteria | 32242 |
| 60 | Ga0070669_100005387 | 3300005353 | Bacteria | 9228 |
| 61 | Ga0070669_100211710 | 3300005353 | Bacteria | 1529 |
| 62 | Ga0070675_100745249 | 3300005354 | Bacteria | 894 |
| 63 | Ga0070671_100006503 | 3300005355 | Bacteria | 9343 |
| 64 | Ga0070671_100043463 | 3300005355 | Bacteria | 3733 |
| 65 | Ga0070671_100194584 | 3300005355 | Bacteria | 1719 |
| 66 | Ga0070674_100000244 | 3300005356 | Bacteria | 26961 |
| 67 | Ga0070674_100461193 | 3300005356 | Bacteria | 1051 |
| 68 | Ga0070674_100626987 | 3300005356 | Bacteria | 911 |
| 69 | Ga0070673_100304205 | 3300005364 | Bacteria | 1405 |
| 70 | Ga0070688_100002188 | 3300005365 | Bacteria | 9856 |
| 71 | Ga0070688_100026466 | 3300005365 | Bacteria | 3447 |
| 72 | Ga0070659_100100888 | 3300005366 | Bacteria | 2323 |
| 73 | Ga0070659_100636773 | 3300005366 | Bacteria | 918 |
| 74 | Ga0070659_100680368 | 3300005366 | Bacteria | 889 |
| 75 | Ga0070667_100000027 | 3300005367 | Bacteria | 181315 |
| 76 | Ga0070667_100004957 | 3300005367 | Bacteria | 11153 |
| 77 | Ga0070667_100016839 | 3300005367 | Bacteria | 6049 |
| 78 | Ga0070667_100095421 | 3300005367 | Bacteria | 2564 |
| 79 | Ga0070667_100123528 | 3300005367 | Bacteria | 2254 |
| 80 | Ga0070667_100446306 | 3300005367 | Bacteria | 1182 |
| 81 | Ga0070667_100448770 | 3300005367 | Bacteria | 1178 |
| 82 | Ga0070667_101050879 | 3300005367 | Bacteria | 761 |
| 83 | Ga0070703_10038930 | 3300005406 | Bacteria | 1472 |
| 84 | Ga0070709_10056739 | 3300005434 | Bacteria | 2478 |
| 85 | Ga0070709_10060096 | 3300005434 | Bacteria | 2415 |
| 86 | Ga0070714_100018869 | 3300005435 | Bacteria | 5611 |
| 87 | Ga0070714_100410244 | 3300005435 | Bacteria | 1282 |
| 88 | Ga0070714_100705152 | 3300005435 | Bacteria | 974 |
| 89 | Ga0070714_101606357 | 3300005435 | Bacteria | 635 |
| 90 | Ga0070713_100118670 | 3300005436 | Bacteria | 2316 |
| 91 | Ga0070710_10001501 | 3300005437 | Bacteria | 10996 |
| 92 | Ga0070710_10014703 | 3300005437 | Bacteria | 3943 |
| 93 | Ga0070710_11149494 | 3300005437 | Bacteria | 572 |
| 94 | Ga0070701_10016528 | 3300005438 | Bacteria | 3433 |
| 95 | Ga0070701_10394154 | 3300005438 | Bacteria | 876 |
| 96 | Ga0070711_100001734 | 3300005439 | Bacteria | 12097 |
| 97 | Ga0070711_100005574 | 3300005439 | Bacteria | 7537 |
| 98 | Ga0070711_101509120 | 3300005439 | Bacteria | 586 |
| 99 | Ga0070711_101877929 | 3300005439 | Bacteria | 526 |
| 100 | Ga0070705_100004544 | 3300005440 | Bacteria | 6751 |
| 101 | Ga0070705_100851348 | 3300005440 | Bacteria | 729 |
| 102 | Ga0070700_100321132 | 3300005441 | Bacteria | 1137 |
| 103 | Ga0070700_101227776 | 3300005441 | Bacteria | 627 |
| 104 | Ga0070694_100004367 | 3300005444 | Bacteria | 8504 |
| 105 | Ga0070694_100443404 | 3300005444 | Bacteria | 1024 |
| 106 | Ga0070663_100021341 | 3300005455 | Bacteria | 4306 |
| 107 | Ga0070663_100449770 | 3300005455 | Bacteria | 1061 |
| 108 | Ga0070663_100952689 | 3300005455 | Bacteria | 744 |
| 109 | Ga0070663_100969821 | 3300005455 | Bacteria | 738 |
| 110 | Ga0070663_101257211 | 3300005455 | Bacteria | 652 |
| 111 | Ga0070663_101855550 | 3300005455 | Bacteria | 541 |
| 112 | Ga0070678_100001046 | 3300005456 | Bacteria | 14474 |
| 113 | Ga0070678_100071210 | 3300005456 | Bacteria | 2602 |
| 114 | Ga0070678_100478191 | 3300005456 | Bacteria | 1096 |
| 115 | Ga0070678_101868519 | 3300005456 | Bacteria | 567 |
| 116 | Ga0070662_100003739 | 3300005457 | Bacteria | 9524 |
| 117 | Ga0070662_100196172 | 3300005457 | Bacteria | 1599 |
| 118 | Ga0070662_101374459 | 3300005457 | Bacteria | 608 |
| 119 | Ga0068867_100001211 | 3300005459 | Bacteria | 17725 |
| 120 | Ga0068867_101418114 | 3300005459 | Bacteria | 644 |
| 121 | Ga0068867_102030788 | 3300005459 | Bacteria | 544 |
| 122 | Ga0070685_10505789 | 3300005466 | Bacteria | 856 |
| 123 | Ga0070685_10525354 | 3300005466 | Bacteria | 841 |
| 124 | Ga0070685_11002428 | 3300005466 | Bacteria | 627 |
| 125 | Ga0070684_100281500 | 3300005535 | Bacteria | 1524 |
| 126 | Ga0068853_100164539 | 3300005539 | Bacteria | 2004 |
| 127 | Ga0068853_100849565 | 3300005539 | Bacteria | 875 |
| 128 | Ga0070672_100034746 | 3300005543 | Bacteria | 3828 |
| 129 | Ga0070672_100977005 | 3300005543 | Bacteria | 750 |
| 130 | Ga0070686_100081511 | 3300005544 | Bacteria | 2143 |
| 131 | Ga0070686_100577112 | 3300005544 | Bacteria | 883 |
| 132 | Ga0070686_100807117 | 3300005544 | Bacteria | 757 |
| 133 | Ga0070695_100002690 | 3300005545 | Bacteria | 10289 |
| 134 | Ga0070695_100057660 | 3300005545 | Bacteria | 2510 |
| 135 | Ga0070696_100004046 | 3300005546 | Bacteria | 9777 |
| 136 | Ga0070693_100025200 | 3300005547 | Bacteria | 3199 |
| 137 | Ga0070693_101118011 | 3300005547 | Bacteria | 602 |
| 138 | Ga0070665_100046895 | 3300005548 | Bacteria | 4337 |
| 139 | Ga0070665_100228267 | 3300005548 | Bacteria | 1862 |
| 140 | Ga0070665_100235874 | 3300005548 | Bacteria | 1830 |
| 141 | Ga0070665_100261070 | 3300005548 | Bacteria | 1733 |
| 142 | Ga0070665_100993248 | 3300005548 | Bacteria | 852 |
| 143 | Ga0070704_100002696 | 3300005549 | Bacteria | 10037 |
| 144 | Ga0070704_100137889 | 3300005549 | Bacteria | 1900 |
| 145 | Ga0068855_100181957 | 3300005563 | Bacteria | 2376 |
| 146 | Ga0068855_100623678 | 3300005563 | Bacteria | 1161 |
| 147 | Ga0068855_101245011 | 3300005563 | Bacteria | 772 |
| 148 | Ga0068854_100000262 | 3300005578 | Bacteria | 35841 |
| 149 | Ga0068854_100182885 | 3300005578 | Bacteria | 1638 |
| 150 | Ga0068856_100558649 | 3300005614 | Bacteria | 1166 |
| 151 | Ga0068856_102546793 | 3300005614 | Bacteria | 518 |
| 152 | Ga0070702_100415830 | 3300005615 | Bacteria | 966 |
| 153 | Ga0070702_101239923 | 3300005615 | Bacteria | 603 |
| 154 | Ga0068852_100031689 | 3300005616 | Bacteria | 4367 |
| 155 | Ga0068852_100210563 | 3300005616 | Bacteria | 1844 |
| 156 | Ga0068852_102414700 | 3300005616 | Bacteria | 546 |
| 157 | Ga0068859_100001466 | 3300005617 | Bacteria | 24023 |
| 158 | Ga0068859_100002266 | 3300005617 | Bacteria | 19509 |
| 159 | Ga0068859_100284757 | 3300005617 | Bacteria | 1745 |
| 160 | Ga0068859_102927705 | 3300005617 | Bacteria | 522 |
| 161 | Ga0068864_100093654 | 3300005618 | Bacteria | 2654 |
| 162 | Ga0068864_101253565 | 3300005618 | Bacteria | 741 |
| 163 | Ga0068866_10000681 | 3300005718 | Bacteria | 15451 |
| 164 | Ga0068866_10066644 | 3300005718 | Bacteria | 1887 |
| 165 | Ga0068866_10247575 | 3300005718 | Bacteria | 1089 |
| 166 | Ga0068861_100013167 | 3300005719 | Bacteria | 5786 |
| 167 | Ga0068861_100161744 | 3300005719 | Bacteria | 1847 |
| 168 | Ga0068861_100179195 | 3300005719 | Bacteria | 1762 |
| 169 | Ga0068861_101138994 | 3300005719 | Bacteria | 751 |
| 170 | Ga0068861_101384194 | 3300005719 | Bacteria | 687 |
| 171 | Ga0068851_10482902 | 3300005834 | Bacteria | 741 |
| 172 | Ga0068851_10581628 | 3300005834 | Bacteria | 680 |
| 173 | Ga0068870_10291984 | 3300005840 | Bacteria | 1026 |
| 174 | Ga0068870_10862670 | 3300005840 | Bacteria | 637 |
| 175 | Ga0068870_10983223 | 3300005840 | Bacteria | 601 |
| 176 | Ga0068870_11397895 | 3300005840 | Bacteria | 513 |
| 177 | Ga0068863_100003689 | 3300005841 | Bacteria | 15133 |
| 178 | Ga0068863_100006164 | 3300005841 | Bacteria | 11758 |
| 179 | Ga0068863_100869736 | 3300005841 | Bacteria | 901 |
| 180 | Ga0068863_100950870 | 3300005841 | Bacteria | 861 |
| 181 | Ga0068863_101677976 | 3300005841 | Bacteria | 645 |
| 182 | Ga0068863_101838165 | 3300005841 | Bacteria | 616 |
| 183 | Ga0068858_100001689 | 3300005842 | Bacteria | 22563 |
| 184 | Ga0068858_100096341 | 3300005842 | Bacteria | 2757 |
| 185 | Ga0068858_100126321 | 3300005842 | Bacteria | 2395 |
| 186 | Ga0068858_100218475 | 3300005842 | Bacteria | 1805 |
| 187 | Ga0068858_100547142 | 3300005842 | Bacteria | 1120 |
| 188 | Ga0068858_101644456 | 3300005842 | Bacteria | 634 |
| 189 | Ga0068858_101816941 | 3300005842 | Bacteria | 602 |
| 190 | Ga0068860_100000141 | 3300005843 | Bacteria | 117843 |
| 191 | Ga0068860_100001255 | 3300005843 | Bacteria | 27661 |
| 192 | Ga0068860_100149757 | 3300005843 | Bacteria | 2247 |
| 193 | Ga0068860_100197528 | 3300005843 | Bacteria | 1948 |
| 194 | Ga0068860_102567264 | 3300005843 | Bacteria | 529 |
| 195 | Ga0068860_102685411 | 3300005843 | Bacteria | 517 |
| 196 | Ga0068862_100000138 | 3300005844 | Bacteria | 82578 |
| 197 | Ga0068862_100001317 | 3300005844 | Bacteria | 23074 |
| 198 | Ga0068862_100316850 | 3300005844 | Bacteria | 1438 |
| 199 | Ga0068862_100746715 | 3300005844 | Bacteria | 952 |
| 200 | Ga0068862_101109055 | 3300005844 | Bacteria | 787 |
| 201 | Ga0081455_10036555 | 3300005937 | Bacteria | 4371 |
| 202 | Ga0081455_10177818 | 3300005937 | Bacteria | 1614 |
| 203 | Ga0081538_10035673 | 3300005981 | Bacteria | 3262 |
| 204 | Ga0075365_10018382 | 3300006038 | Bacteria | 4297 |
| 205 | Ga0075365_10046531 | 3300006038 | Bacteria | 2850 |
| 206 | Ga0075365_10047539 | 3300006038 | Bacteria | 2821 |
| 207 | Ga0075365_10055055 | 3300006038 | Bacteria | 2639 |
| 208 | Ga0075365_10154536 | 3300006038 | Bacteria | 1597 |
| 209 | Ga0075365_10286437 | 3300006038 | Bacteria | 1159 |
| 210 | Ga0075365_10459401 | 3300006038 | Bacteria | 899 |
| 211 | Ga0075365_10949959 | 3300006038 | Bacteria | 606 |
| 212 | Ga0075365_11117835 | 3300006038 | Bacteria | 555 |
| 213 | Ga0075368_10018592 | 3300006042 | Bacteria | 2612 |
| 214 | Ga0075363_100025097 | 3300006048 | Bacteria | 3036 |
| 215 | Ga0075363_100037020 | 3300006048 | Bacteria | 2561 |
| 216 | Ga0075363_100040183 | 3300006048 | Bacteria | 2465 |
| 217 | Ga0075363_100055671 | 3300006048 | Bacteria | 2119 |
| 218 | Ga0075363_100058629 | 3300006048 | Bacteria | 2068 |
| 219 | Ga0075363_100075522 | 3300006048 | Bacteria | 1836 |
| 220 | Ga0075363_100127918 | 3300006048 | Bacteria | 1423 |
| 221 | Ga0075363_100200914 | 3300006048 | Bacteria | 1139 |
| 222 | Ga0075363_100337741 | 3300006048 | Bacteria | 878 |
| 223 | Ga0075363_100897896 | 3300006048 | Bacteria | 542 |
| 224 | Ga0075363_101027628 | 3300006048 | Bacteria | 509 |
| 225 | Ga0075364_10001416 | 3300006051 | Bacteria | 13006 |
| 226 | Ga0075364_10026321 | 3300006051 | Bacteria | 3710 |
| 227 | Ga0075364_10038846 | 3300006051 | Bacteria | 3084 |
| 228 | Ga0075364_10068636 | 3300006051 | Bacteria | 2332 |
| 229 | Ga0075364_10078677 | 3300006051 | Bacteria | 2178 |
| 230 | Ga0075364_10091412 | 3300006051 | Bacteria | 2019 |
| 231 | Ga0075364_10103821 | 3300006051 | Bacteria | 1893 |
| 232 | Ga0075364_10154835 | 3300006051 | Bacteria | 1546 |
| 233 | Ga0075364_10176423 | 3300006051 | Bacteria | 1445 |
| 234 | Ga0075364_10188648 | 3300006051 | Bacteria | 1396 |
| 235 | Ga0075364_10304632 | 3300006051 | Bacteria | 1085 |
| 236 | Ga0075364_10437265 | 3300006051 | Bacteria | 894 |
| 237 | Ga0075364_10448407 | 3300006051 | Bacteria | 881 |
| 238 | Ga0075364_10487519 | 3300006051 | Bacteria | 843 |
| 239 | Ga0075364_10623698 | 3300006051 | Bacteria | 737 |
| 240 | Ga0075364_11065817 | 3300006051 | Bacteria | 549 |
| 241 | Ga0075432_10303066 | 3300006058 | Bacteria | 664 |
| 242 | Ga0070715_10002294 | 3300006163 | Bacteria | 5830 |
| 243 | Ga0070715_10405247 | 3300006163 | Bacteria | 759 |
| 244 | Ga0070715_10416240 | 3300006163 | Bacteria | 751 |
| 245 | Ga0070716_100001813 | 3300006173 | Bacteria | 9669 |
| 246 | Ga0070716_100847150 | 3300006173 | Bacteria | 711 |
| 247 | Ga0070716_101087791 | 3300006173 | Bacteria | 637 |
| 248 | Ga0070712_100001225 | 3300006175 | Bacteria | 15514 |
| 249 | Ga0070712_100004149 | 3300006175 | Bacteria | 8902 |
| 250 | Ga0070712_100529520 | 3300006175 | Bacteria | 991 |
| 251 | Ga0075362_10008854 | 3300006177 | Bacteria | 3868 |
| 252 | Ga0075362_10058899 | 3300006177 | Bacteria | 1733 |
| 253 | Ga0075362_10290559 | 3300006177 | Bacteria | 810 |
| 254 | Ga0075362_10379157 | 3300006177 | Bacteria | 711 |
| 255 | Ga0075367_10049248 | 3300006178 | Bacteria | 2483 |
| 256 | Ga0075367_10226510 | 3300006178 | Bacteria | 1170 |
| 257 | Ga0075367_10530305 | 3300006178 | Bacteria | 747 |
| 258 | Ga0075369_10000571 | 3300006186 | Bacteria | 11638 |
| 259 | Ga0075369_10002109 | 3300006186 | Bacteria | 7028 |
| 260 | Ga0075369_10125352 | 3300006186 | Bacteria | 1164 |
| 261 | Ga0075369_10138350 | 3300006186 | Bacteria | 1109 |
| 262 | Ga0075369_10142413 | 3300006186 | Bacteria | 1094 |
| 263 | Ga0075369_10218259 | 3300006186 | Bacteria | 882 |
| 264 | Ga0075369_10268637 | 3300006186 | Bacteria | 793 |
| 265 | Ga0075369_10490169 | 3300006186 | Bacteria | 584 |
| 266 | Ga0075369_10517450 | 3300006186 | Bacteria | 568 |
| 267 | Ga0075369_10546101 | 3300006186 | Bacteria | 553 |
| 268 | Ga0075366_10147922 | 3300006195 | Bacteria | 1422 |
| 269 | Ga0097621_100763541 | 3300006237 | Bacteria | 894 |
| 270 | Ga0075370_10010995 | 3300006353 | Bacteria | 4746 |
| 271 | Ga0075370_10049938 | 3300006353 | Bacteria | 2372 |
| 272 | Ga0075370_10056762 | 3300006353 | Bacteria | 2225 |
| 273 | Ga0075370_10065681 | 3300006353 | Bacteria | 2069 |
| 274 | Ga0075370_10080869 | 3300006353 | Bacteria | 1867 |
| 275 | Ga0075370_10130598 | 3300006353 | Bacteria | 1465 |
| 276 | Ga0075370_10362970 | 3300006353 | Bacteria | 866 |
| 277 | Ga0075370_10607977 | 3300006353 | Bacteria | 662 |
| 278 | Ga0075370_10675245 | 3300006353 | Bacteria | 627 |
| 279 | Ga0068871_100819008 | 3300006358 | Bacteria | 859 |
| 280 | Ga0068871_100857918 | 3300006358 | Bacteria | 840 |
| 281 | Ga0068871_101336655 | 3300006358 | Bacteria | 675 |
| 282 | Ga0075428_100000939 | 3300006844 | Bacteria | 30809 |
| 283 | Ga0075430_100059016 | 3300006846 | Bacteria | 3225 |
| 284 | Ga0075430_100080000 | 3300006846 | Bacteria | 2738 |
| 285 | Ga0075431_100021617 | 3300006847 | Bacteria | 6582 |
| 286 | Ga0075434_100459143 | 3300006871 | Bacteria | 1295 |
| 287 | Ga0075434_101693453 | 3300006871 | Bacteria | 640 |
| 288 | Ga0068865_100004351 | 3300006881 | Bacteria | 8546 |
| 289 | Ga0068865_100093332 | 3300006881 | Bacteria | 2188 |
| 290 | Ga0068865_100550404 | 3300006881 | Bacteria | 969 |
| 291 | Ga0097620_100001464 | 3300006931 | Bacteria | 24023 |
| 292 | Ga0097620_100002267 | 3300006931 | Bacteria | 19509 |
| 293 | Ga0097620_100284752 | 3300006931 | Bacteria | 1745 |
| 294 | Ga0097620_102927781 | 3300006931 | Bacteria | 522 |
| 295 | Ga0105251_10233167 | 3300009011 | Bacteria | 829 |
| 296 | Ga0105250_10063025 | 3300009092 | Bacteria | 1492 |
| 297 | Ga0105250_10084209 | 3300009092 | Bacteria | 1290 |
| 298 | Ga0105250_10288945 | 3300009092 | Bacteria | 707 |
| 299 | Ga0105240_11204609 | 3300009093 | Bacteria | 802 |
| 300 | Ga0111539_13346294 | 3300009094 | Bacteria | 516 |
| 301 | Ga0105245_10007730 | 3300009098 | Bacteria | 9417 |
| 302 | Ga0105245_10674331 | 3300009098 | Bacteria | 1065 |
| 303 | Ga0105245_11493368 | 3300009098 | Bacteria | 726 |
| 304 | Ga0105247_10000237 | 3300009101 | Bacteria | 51740 |
| 305 | Ga0105247_10000372 | 3300009101 | Bacteria | 38190 |
| 306 | Ga0105247_10065096 | 3300009101 | Bacteria | 2267 |
| 307 | Ga0105247_10066172 | 3300009101 | Bacteria | 2250 |
| 308 | Ga0105247_10414385 | 3300009101 | Bacteria | 963 |
| 309 | Ga0105247_11583189 | 3300009101 | Bacteria | 537 |
| 310 | Ga0114129_10048020 | 3300009147 | Bacteria | 5998 |
| 311 | Ga0114129_12826612 | 3300009147 | Bacteria | 576 |
| 312 | Ga0105243_10000676 | 3300009148 | Bacteria | 33249 |
| 313 | Ga0105241_10007378 | 3300009174 | Bacteria | 8089 |
| 314 | Ga0105241_10149237 | 3300009174 | Bacteria | 1911 |
| 315 | Ga0105241_10830079 | 3300009174 | Bacteria | 853 |
| 316 | Ga0105241_11225082 | 3300009174 | Bacteria | 712 |
| 317 | Ga0105242_10000197 | 3300009176 | Bacteria | 46948 |
| 318 | Ga0105242_10208526 | 3300009176 | Bacteria | 1740 |
| 319 | Ga0105242_10499514 | 3300009176 | Bacteria | 1157 |
| 320 | Ga0105242_11927092 | 3300009176 | Bacteria | 632 |
| 321 | Ga0105248_10000337 | 3300009177 | Bacteria | 55206 |
| 322 | Ga0105248_10056212 | 3300009177 | Bacteria | 4415 |
| 323 | Ga0105248_10087668 | 3300009177 | Bacteria | 3503 |
| 324 | Ga0105248_10826344 | 3300009177 | Bacteria | 1046 |
| 325 | Ga0105248_10898500 | 3300009177 | Bacteria | 1000 |
| 326 | Ga0105248_11640690 | 3300009177 | Bacteria | 729 |
| 327 | Ga0105237_10005565 | 3300009545 | Bacteria | 14206 |
| 328 | Ga0105237_10015368 | 3300009545 | Bacteria | 7971 |
| 329 | Ga0105237_10085017 | 3300009545 | Bacteria | 3153 |
| 330 | Ga0105237_10689298 | 3300009545 | Bacteria | 1028 |
| 331 | Ga0105237_11484663 | 3300009545 | Bacteria | 684 |
| 332 | Ga0105238_10086299 | 3300009551 | Bacteria | 3126 |
| 333 | Ga0105238_10317361 | 3300009551 | Bacteria | 1544 |
| 334 | Ga0105238_10642662 | 3300009551 | Bacteria | 1071 |
| 335 | Ga0105238_11043982 | 3300009551 | Bacteria | 839 |
| 336 | Ga0105249_10000013 | 3300009553 | Bacteria | 283609 |
| 337 | Ga0105249_10004426 | 3300009553 | Bacteria | 12148 |
| 338 | Ga0105249_10022007 | 3300009553 | Bacteria | 5709 |
| 339 | Ga0105249_10543436 | 3300009553 | Bacteria | 1212 |
| 340 | Ga0105249_10816852 | 3300009553 | Bacteria | 997 |
| 341 | Ga0099796_10010920 | 3300010159 | Bacteria | 2515 |
| 342 | Ga0105239_10029337 | 3300010375 | Bacteria | 6048 |
| 343 | Ga0105239_10032396 | 3300010375 | Bacteria | 5744 |
| 344 | Ga0105239_10145014 | 3300010375 | Bacteria | 2647 |
| 345 | Ga0105239_10690655 | 3300010375 | Bacteria | 1167 |
| 346 | Ga0105239_10788219 | 3300010375 | Bacteria | 1089 |
| 347 | Ga0105239_10996822 | 3300010375 | Bacteria | 963 |
| 348 | Ga0105246_10217869 | 3300011119 | Bacteria | 1494 |
| 349 | Ga0105246_10244744 | 3300011119 | Bacteria | 1420 |
| 350 | Ga0105246_10667441 | 3300011119 | Bacteria | 907 |
| 351 | Ga0157342_1068323 | 3300012507 | Bacteria | 536 |
| 352 | Ga0157371_10312162 | 3300013102 | Bacteria | 1140 |
| 353 | Ga0157371_11224263 | 3300013102 | Bacteria | 579 |
| 354 | Ga0157369_10384304 | 3300013105 | Bacteria | 1457 |
| 355 | Ga0157369_10631717 | 3300013105 | Bacteria | 1105 |
| 356 | Ga0157374_10391860 | 3300013296 | Bacteria | 1384 |
| 357 | Ga0157374_10694656 | 3300013296 | Bacteria | 1030 |
| 358 | Ga0157378_10002889 | 3300013297 | Bacteria | 15295 |
| 359 | Ga0157378_10036468 | 3300013297 | Bacteria | 4351 |
| 360 | Ga0157378_10890388 | 3300013297 | Bacteria | 920 |
| 361 | Ga0157378_11122549 | 3300013297 | Bacteria | 824 |
| 362 | Ga0157378_12285943 | 3300013297 | Bacteria | 592 |
| 363 | Ga0163162_10002808 | 3300013306 | Bacteria | 16565 |
| 364 | Ga0163162_10091073 | 3300013306 | Bacteria | 3132 |
| 365 | Ga0163162_10733765 | 3300013306 | Bacteria | 1108 |
| 366 | Ga0163162_12823541 | 3300013306 | Bacteria | 559 |
| 367 | Ga0157372_10006319 | 3300013307 | Bacteria | 12605 |
| 368 | Ga0157372_10149591 | 3300013307 | Bacteria | 2694 |
| 369 | Ga0157372_11466986 | 3300013307 | Bacteria | 786 |
| 370 | Ga0157375_10017320 | 3300013308 | Bacteria | 6500 |
| 371 | Ga0157375_10139581 | 3300013308 | Bacteria | 2550 |
| 372 | Ga0157375_10225018 | 3300013308 | Bacteria | 2035 |
| 373 | Ga0157375_10769970 | 3300013308 | Bacteria | 1113 |
| 374 | Ga0157375_10786964 | 3300013308 | Bacteria | 1101 |
| 375 | Ga0157375_11157478 | 3300013308 | Bacteria | 906 |
| 376 | Ga0157375_11976728 | 3300013308 | Bacteria | 693 |
| 377 | Ga0163163_10058326 | 3300014325 | Bacteria | 3817 |
| 378 | Ga0163163_10191430 | 3300014325 | Bacteria | 2094 |
| 379 | Ga0163163_10423346 | 3300014325 | Bacteria | 1390 |
| 380 | Ga0163163_10756181 | 3300014325 | Bacteria | 1035 |
| 381 | Ga0157380_10000136 | 3300014326 | Bacteria | 41118 |
| 382 | Ga0157380_10249743 | 3300014326 | Bacteria | 1605 |
| 383 | Ga0157380_10429896 | 3300014326 | Bacteria | 1262 |
| 384 | Ga0157380_11649491 | 3300014326 | Bacteria | 698 |
| 385 | Ga0157377_10175419 | 3300014745 | Bacteria | 1344 |
| 386 | Ga0157377_10233756 | 3300014745 | Bacteria | 1183 |
| 387 | Ga0157377_10863597 | 3300014745 | Bacteria | 673 |
| 388 | Ga0157379_10038088 | 3300014968 | Bacteria | 4290 |
| 389 | Ga0157379_10070088 | 3300014968 | Bacteria | 3136 |
| 390 | Ga0157379_10130207 | 3300014968 | Bacteria | 2264 |
| 391 | Ga0157379_11428335 | 3300014968 | Bacteria | 671 |
| 392 | Ga0157376_10399308 | 3300014969 | Bacteria | 1329 |
| 393 | Ga0157376_10444398 | 3300014969 | Bacteria | 1263 |
| 394 | Ga0157376_12567272 | 3300014969 | Bacteria | 549 |
| 395 | Ga0163161_10014033 | 3300017792 | Bacteria | 5578 |
| 396 | Ga0163161_10083548 | 3300017792 | Bacteria | 2354 |
| 397 | Ga0163161_10180097 | 3300017792 | Bacteria | 1620 |
| 398 | Ga0163161_10839847 | 3300017792 | Bacteria | 774 |
| 399 | Ga0163161_11408352 | 3300017792 | Bacteria | 609 |
| 400 | Ga0213876_10530277 | 3300021384 | Bacteria | 627 |
| 401 | Ga0209673_1028999 | 3300025273 | Bacteria | 1769 |
| 402 | Ga0209025_1068996 | 3300025294 | Bacteria | 1266 |
| 403 | Ga0209051_1000107 | 3300025303 | Bacteria | 157903 |
| 404 | Ga0209051_1000122 | 3300025303 | Bacteria | 144507 |
| 405 | Ga0209051_1001174 | 3300025303 | Bacteria | 23776 |
| 406 | Ga0209051_1001471 | 3300025303 | Bacteria | 19929 |
| 407 | Ga0209051_1022917 | 3300025303 | Bacteria | 2613 |
| 408 | Ga0209051_1044453 | 3300025303 | Bacteria | 1546 |
| 409 | Ga0207653_10243734 | 3300025885 | Bacteria | 687 |
| 410 | Ga0207692_10001286 | 3300025898 | Bacteria | 9318 |
| 411 | Ga0207692_10014299 | 3300025898 | Bacteria | 3465 |
| 412 | Ga0207692_10283322 | 3300025898 | Bacteria | 1003 |
| 413 | Ga0207642_10001214 | 3300025899 | Bacteria | 7975 |
| 414 | Ga0207710_10000213 | 3300025900 | Bacteria | 51731 |
| 415 | Ga0207710_10008148 | 3300025900 | Bacteria | 4424 |
| 416 | Ga0207710_10185684 | 3300025900 | Bacteria | 1022 |
| 417 | Ga0207710_10676890 | 3300025900 | Bacteria | 541 |
| 418 | Ga0207688_10003068 | 3300025901 | Bacteria | 9113 |
| 419 | Ga0207688_10005491 | 3300025901 | Bacteria | 6895 |
| 420 | Ga0207688_10075820 | 3300025901 | Bacteria | 1915 |
| 421 | Ga0207688_10753573 | 3300025901 | Bacteria | 617 |
| 422 | Ga0207680_10072589 | 3300025903 | Bacteria | 2137 |
| 423 | Ga0207680_10138610 | 3300025903 | Bacteria | 1611 |
| 424 | Ga0207680_10338675 | 3300025903 | Bacteria | 1055 |
| 425 | Ga0207685_10199934 | 3300025905 | Bacteria | 938 |
| 426 | Ga0207685_10218094 | 3300025905 | Bacteria | 906 |
| 427 | Ga0207699_10060695 | 3300025906 | Bacteria | 2272 |
| 428 | Ga0207699_10417116 | 3300025906 | Bacteria | 958 |
| 429 | Ga0207699_11478221 | 3300025906 | Bacteria | 503 |
| 430 | Ga0207645_10004061 | 3300025907 | Bacteria | 10909 |
| 431 | Ga0207643_10253687 | 3300025908 | Bacteria | 1084 |
| 432 | Ga0207643_10487409 | 3300025908 | Bacteria | 787 |
| 433 | Ga0207654_10077866 | 3300025911 | Bacteria | 1989 |
| 434 | Ga0207654_10233114 | 3300025911 | Bacteria | 1227 |
| 435 | Ga0207671_10014745 | 3300025914 | Bacteria | 6162 |
| 436 | Ga0207671_10021340 | 3300025914 | Bacteria | 4914 |
| 437 | Ga0207671_10031936 | 3300025914 | Bacteria | 3921 |
| 438 | Ga0207693_10000507 | 3300025915 | Bacteria | 35136 |
| 439 | Ga0207693_10003394 | 3300025915 | Bacteria | 13607 |
| 440 | Ga0207663_10005170 | 3300025916 | Bacteria | 6565 |
| 441 | Ga0207662_10211461 | 3300025918 | Bacteria | 1259 |
| 442 | Ga0207662_10226473 | 3300025918 | Bacteria | 1219 |
| 443 | Ga0207657_10023320 | 3300025919 | Bacteria | 5765 |
| 444 | Ga0207657_10102233 | 3300025919 | Bacteria | 2377 |
| 445 | Ga0207652_11251564 | 3300025921 | Bacteria | 644 |
| 446 | Ga0207646_10399719 | 3300025922 | Bacteria | 1241 |
| 447 | Ga0207681_10000866 | 3300025923 | Bacteria | 19891 |
| 448 | Ga0207681_10042605 | 3300025923 | Bacteria | 3033 |
| 449 | Ga0207681_10130610 | 3300025923 | Bacteria | 1857 |
| 450 | Ga0207694_10145782 | 3300025924 | Bacteria | 1906 |
| 451 | Ga0207694_10155070 | 3300025924 | Bacteria | 1847 |
| 452 | Ga0207694_10837086 | 3300025924 | Bacteria | 777 |
| 453 | Ga0207694_11660843 | 3300025924 | Bacteria | 538 |
| 454 | Ga0207650_10109673 | 3300025925 | Bacteria | 2135 |
| 455 | Ga0207659_10426038 | 3300025926 | Bacteria | 1114 |
| 456 | Ga0207687_10009541 | 3300025927 | Bacteria | 6348 |
| 457 | Ga0207687_10013417 | 3300025927 | Bacteria | 5349 |
| 458 | Ga0207687_10350125 | 3300025927 | Bacteria | 1203 |
| 459 | Ga0207664_10156204 | 3300025929 | Bacteria | 1942 |
| 460 | Ga0207664_10396737 | 3300025929 | Bacteria | 1226 |
| 461 | Ga0207664_10427349 | 3300025929 | Bacteria | 1180 |
| 462 | Ga0207644_10027298 | 3300025931 | Bacteria | 3943 |
| 463 | Ga0207644_10158883 | 3300025931 | Bacteria | 1755 |
| 464 | Ga0207644_10197549 | 3300025931 | Bacteria | 1585 |
| 465 | Ga0207644_10266659 | 3300025931 | Bacteria | 1371 |
| 466 | Ga0207644_11423607 | 3300025931 | Bacteria | 582 |
| 467 | Ga0207690_10132747 | 3300025932 | Bacteria | 1824 |
| 468 | Ga0207690_10224812 | 3300025932 | Bacteria | 1438 |
| 469 | Ga0207690_11020278 | 3300025932 | Bacteria | 688 |
| 470 | Ga0207706_10001533 | 3300025933 | Bacteria | 22933 |
| 471 | Ga0207686_10001322 | 3300025934 | Bacteria | 14150 |
| 472 | Ga0207709_10085607 | 3300025935 | Bacteria | 2044 |
| 473 | Ga0207709_10412239 | 3300025935 | Bacteria | 1036 |
| 474 | Ga0207670_10104442 | 3300025936 | Bacteria | 2029 |
| 475 | Ga0207670_11074164 | 3300025936 | Bacteria | 679 |
| 476 | Ga0207670_11705969 | 3300025936 | Bacteria | 536 |
| 477 | Ga0207670_11936265 | 3300025936 | Bacteria | 501 |
| 478 | Ga0207669_10001482 | 3300025937 | Bacteria | 10023 |
| 479 | Ga0207669_10158989 | 3300025937 | Bacteria | 1593 |
| 480 | Ga0207669_10291106 | 3300025937 | Bacteria | 1237 |
| 481 | Ga0207704_10000458 | 3300025938 | Bacteria | 18202 |
| 482 | Ga0207704_10128721 | 3300025938 | Bacteria | 1748 |
| 483 | Ga0207665_10005493 | 3300025939 | Bacteria | 8460 |
| 484 | Ga0207665_10015885 | 3300025939 | Bacteria | 4942 |
| 485 | Ga0207665_10887760 | 3300025939 | Bacteria | 707 |
| 486 | Ga0207665_10901349 | 3300025939 | Bacteria | 701 |
| 487 | Ga0207691_10391942 | 3300025940 | Bacteria | 1185 |
| 488 | Ga0207691_10440882 | 3300025940 | Bacteria | 1109 |
| 489 | Ga0207711_10000753 | 3300025941 | Bacteria | 31755 |
| 490 | Ga0207711_10020273 | 3300025941 | Bacteria | 5541 |
| 491 | Ga0207711_10112050 | 3300025941 | Bacteria | 2428 |
| 492 | Ga0207711_10374239 | 3300025941 | Bacteria | 1321 |
| 493 | Ga0207711_10997712 | 3300025941 | Bacteria | 777 |
| 494 | Ga0207711_11023253 | 3300025941 | Bacteria | 766 |
| 495 | Ga0207689_10012131 | 3300025942 | Bacteria | 7375 |
| 496 | Ga0207689_10055897 | 3300025942 | Bacteria | 3247 |
| 497 | Ga0207667_10319758 | 3300025949 | Bacteria | 1585 |
| 498 | Ga0207667_10634600 | 3300025949 | Bacteria | 1075 |
| 499 | Ga0207651_11705602 | 3300025960 | Bacteria | 567 |
| 500 | Ga0207712_10000018 | 3300025961 | Bacteria | 317921 |
| 501 | Ga0207712_10130790 | 3300025961 | Bacteria | 1913 |
| 502 | Ga0207712_10269342 | 3300025961 | Bacteria | 1385 |
| 503 | Ga0207712_10313007 | 3300025961 | Bacteria | 1293 |
| 504 | Ga0207668_10000770 | 3300025972 | Bacteria | 19610 |
| 505 | Ga0207668_10016773 | 3300025972 | Bacteria | 4578 |
| 506 | Ga0207668_10208317 | 3300025972 | Bacteria | 1562 |
| 507 | Ga0207668_10232143 | 3300025972 | Bacteria | 1488 |
| 508 | Ga0207668_10723113 | 3300025972 | Bacteria | 876 |
| 509 | Ga0207640_10049671 | 3300025981 | Bacteria | 2717 |
| 510 | Ga0207640_10121950 | 3300025981 | Bacteria | 1869 |
| 511 | Ga0207658_10000383 | 3300025986 | Bacteria | 43201 |
| 512 | Ga0207658_10004854 | 3300025986 | Bacteria | 9293 |
| 513 | Ga0207658_10010991 | 3300025986 | Bacteria | 6165 |
| 514 | Ga0207658_10011237 | 3300025986 | Bacteria | 6100 |
| 515 | Ga0207658_10890683 | 3300025986 | Bacteria | 810 |
| 516 | Ga0207658_10917992 | 3300025986 | Bacteria | 797 |
| 517 | Ga0207658_10971359 | 3300025986 | Bacteria | 774 |
| 518 | Ga0207677_10002864 | 3300026023 | Bacteria | 9103 |
| 519 | Ga0207677_10201803 | 3300026023 | Bacteria | 1581 |
| 520 | Ga0207677_10364941 | 3300026023 | Bacteria | 1214 |
| 521 | Ga0207677_10622158 | 3300026023 | Bacteria | 950 |
| 522 | Ga0207703_10000920 | 3300026035 | Bacteria | 28669 |
| 523 | Ga0207703_10013422 | 3300026035 | Bacteria | 6381 |
| 524 | Ga0207703_10259384 | 3300026035 | Bacteria | 1571 |
| 525 | Ga0207703_10543410 | 3300026035 | Bacteria | 1095 |
| 526 | Ga0207703_10580612 | 3300026035 | Bacteria | 1059 |
| 527 | Ga0207703_10716983 | 3300026035 | Bacteria | 952 |
| 528 | Ga0207639_10005136 | 3300026041 | Bacteria | 8822 |
| 529 | Ga0207639_10016036 | 3300026041 | Bacteria | 5292 |
| 530 | Ga0207639_10973174 | 3300026041 | Bacteria | 794 |
| 531 | Ga0207678_10003253 | 3300026067 | Bacteria | 14661 |
| 532 | Ga0207678_10015024 | 3300026067 | Bacteria | 6812 |
| 533 | Ga0207678_10670745 | 3300026067 | Bacteria | 911 |
| 534 | Ga0207678_10904505 | 3300026067 | Bacteria | 780 |
| 535 | Ga0207708_10351959 | 3300026075 | Bacteria | 1208 |
| 536 | Ga0207702_10267532 | 3300026078 | Bacteria | 1611 |
| 537 | Ga0207641_10002928 | 3300026088 | Bacteria | 15449 |
| 538 | Ga0207641_10029024 | 3300026088 | Bacteria | 4573 |
| 539 | Ga0207641_10414173 | 3300026088 | Bacteria | 1296 |
| 540 | Ga0207641_11833624 | 3300026088 | Bacteria | 608 |
| 541 | Ga0207648_10021128 | 3300026089 | Bacteria | 5852 |
| 542 | Ga0207648_10028299 | 3300026089 | Bacteria | 4970 |
| 543 | Ga0207648_12033040 | 3300026089 | Bacteria | 536 |
| 544 | Ga0207676_10070294 | 3300026095 | Bacteria | 2807 |
| 545 | Ga0207676_10188226 | 3300026095 | Bacteria | 1814 |
| 546 | Ga0207676_11258609 | 3300026095 | Bacteria | 734 |
| 547 | Ga0207676_11469946 | 3300026095 | Bacteria | 678 |
| 548 | Ga0207675_100000544 | 3300026118 | Bacteria | 36830 |
| 549 | Ga0207675_100015163 | 3300026118 | Bacteria | 7187 |
| 550 | Ga0207675_100172690 | 3300026118 | Bacteria | 2067 |
| 551 | Ga0207675_100517790 | 3300026118 | Bacteria | 1189 |
| 552 | Ga0207675_101833233 | 3300026118 | Bacteria | 626 |
| 553 | Ga0207683_10000335 | 3300026121 | Bacteria | 42789 |
| 554 | Ga0207683_10057779 | 3300026121 | Bacteria | 3405 |
| 555 | Ga0207683_10451543 | 3300026121 | Bacteria | 1185 |
| 556 | Ga0207683_10614671 | 3300026121 | Bacteria | 1006 |
| 557 | Ga0207683_12012714 | 3300026121 | Bacteria | 526 |
| 558 | Ga0207698_10138786 | 3300026142 | Bacteria | 2090 |
| 559 | Ga0207698_10153911 | 3300026142 | Bacteria | 2000 |
| 560 | Ga0207698_10229905 | 3300026142 | Bacteria | 1683 |
| 561 | Ga0207428_10533328 | 3300027907 | Bacteria | 850 |
| 562 | Ga0268266_10032648 | 3300028379 | Bacteria | 4423 |
| 563 | Ga0268266_10190460 | 3300028379 | Bacteria | 1872 |
| 564 | Ga0268266_10378892 | 3300028379 | Bacteria | 1334 |
| 565 | Ga0268266_10590424 | 3300028379 | Bacteria | 1066 |
| 566 | Ga0268266_10652806 | 3300028379 | Bacteria | 1012 |
| 567 | Ga0268266_12060892 | 3300028379 | Bacteria | 544 |
| 568 | Ga0268265_10000159 | 3300028380 | Bacteria | 82592 |
| 569 | Ga0268265_10044071 | 3300028380 | Bacteria | 3320 |
| 570 | Ga0268265_10194523 | 3300028380 | Bacteria | 1754 |
| 571 | Ga0268265_10756464 | 3300028380 | Bacteria | 943 |
| 572 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 573 | Ga0268264_10001041 | 3300028381 | Bacteria | 27858 |
| 574 | Ga0268264_10294371 | 3300028381 | Bacteria | 1526 |
| 575 | Ga0268264_10511651 | 3300028381 | Bacteria | 1172 |
| 576 | Ga0268264_11975181 | 3300028381 | Bacteria | 593 |
| 577 | Ga0265327_10004280 | 3300031251 | Bacteria | 12774 |
| 578 | Ga0307513_10743679 | 3300031456 | Bacteria | 686 |
| 579 | Ga0307408_100762940 | 3300031548 | Bacteria | 875 |
| 580 | Ga0307413_10115722 | 3300031824 | Bacteria | 1805 |
| 581 | Ga0307413_10377010 | 3300031824 | Bacteria | 1104 |
| 582 | Ga0307413_10500894 | 3300031824 | Bacteria | 975 |
| 583 | Ga0307410_10015784 | 3300031852 | Bacteria | 4488 |
| 584 | Ga0307410_11122565 | 3300031852 | Bacteria | 682 |
| 585 | Ga0307406_10048745 | 3300031901 | Bacteria | 2677 |
| 586 | Ga0307406_10539594 | 3300031901 | Bacteria | 952 |
| 587 | Ga0307412_10041003 | 3300031911 | Bacteria | 2998 |
| 588 | Ga0307409_100000649 | 3300031995 | Bacteria | 15381 |
| 589 | Ga0307409_101232462 | 3300031995 | Bacteria | 772 |
| 590 | Ga0307416_100002172 | 3300032002 | Bacteria | 11117 |
| 591 | Ga0307416_101879339 | 3300032002 | Bacteria | 702 |
| 592 | Ga0307414_11351095 | 3300032004 | Bacteria | 662 |
| 593 | Ga0307411_10124695 | 3300032005 | Bacteria | 1871 |
| 594 | Ga0307411_10188989 | 3300032005 | Bacteria | 1571 |
| 595 | Ga0307411_10216432 | 3300032005 | Bacteria | 1483 |
| 596 | Ga0307415_100043135 | 3300032126 | Bacteria | 3007 |
| 597 | Ga0316580_10169555 | 3300032139 | Bacteria | 671 |
| 598 | Ga0316593_10147375 | 3300032168 | Bacteria | 855 |
| 599 | Ga0316592_1084493 | 3300033524 | Bacteria | 724 |
| 600 | Ga0316596_1078760 | 3300033541 | Bacteria | 885 |
| 601 | Ga0373949_0138647 | 3300035090 | Bacteria | 695 |
| 602 | Ga0373951_0102485 | 3300035091 | Bacteria | 762 |
| 603 | Ga0373943_0268297 | 3300035170 | Bacteria | 962 |
| 604 | Ga0373962_0048327 | 3300035242 | Bacteria | 1220 |
| 605 | Ga0373931_0042807 | 3300035691 | Bacteria | 2382 |
| 606 | Ga0373931_0276572 | 3300035691 | Bacteria | 1029 |
| 607 | Ga0373937_0616162 | 3300036401 | Bacteria | 1030 |
| 608 | Ga0316584_0073524 | 3300036712 | Bacteria | 2562 |
| 609 | Ga0436365_1279297 | 3300039437 | Bacteria | 559 |
| 610 | Ga0436363_0907136 | 3300039450 | Bacteria | 886 |
| 611 | Ga0436363_1032215 | 3300039450 | Bacteria | 2224 |
| 612 | Ga0436363_1100965 | 3300039450 | Bacteria | 3035 |
| 613 | Ga0439461_0017272 | 3300041410 | Bacteria | 1401 |
| 614 | Ga0439461_0164438 | 3300041410 | Bacteria | 580 |
| 615 | Ga0439466_0003336 | 3300041411 | Bacteria | 6244 |
| 616 | Ga0439466_0005429 | 3300041411 | Bacteria | 4872 |
| 617 | Ga0439466_0021376 | 3300041411 | Bacteria | 2294 |
| 618 | Ga0439466_0044833 | 3300041411 | Bacteria | 1464 |
| 619 | Ga0439465_0002390 | 3300041413 | Bacteria | 6141 |
| 620 | Ga0439465_0007690 | 3300041413 | Bacteria | 3420 |
| 621 | Ga0439465_0050299 | 3300041413 | Bacteria | 1363 |
| 622 | Ga0451789_0678462 | 3300041443 | Bacteria | 895 |
| 623 | Ga0451789_0888216 | 3300041443 | Bacteria | 1292 |
| 624 | Ga0451794_05147 | 3300041446 | Bacteria | 562 |
| 625 | Ga0451793_0184391 | 3300041452 | Bacteria | 2532 |
| 626 | Ga0451793_0614440 | 3300041452 | Bacteria | 634 |
| 627 | Ga0451797_1156091 | 3300041453 | Bacteria | 509 |
| 628 | Ga0451798_0260113 | 3300041458 | Bacteria | 942 |
| 629 | Ga0451802_1339380 | 3300041460 | Bacteria | 1854 |
| 630 | Ga0451802_1992298 | 3300041460 | Bacteria | 641 |
| 631 | Ga0451807_1241670 | 3300041486 | Bacteria | 1189 |
| 632 | Ga0451841_0303713 | 3300041498 | Bacteria | 576 |
| 633 | Ga0451841_1061137 | 3300041498 | Bacteria | 1461 |
| 634 | Ga0451847_0431962 | 3300041503 | Bacteria | 843 |
| 635 | Ga0451847_0576711 | 3300041503 | Bacteria | 842 |
| 636 | Ga0451843_0772406 | 3300041509 | Bacteria | 724 |
| 637 | Ga0451853_1496362 | 3300041512 | Bacteria | 521 |
| 638 | Ga0439431_0000416 | 3300041997 | Bacteria | 8993 |
| 639 | Ga0439431_0066392 | 3300041997 | Bacteria | 956 |
| 640 | Ga0439442_034471 | 3300042002 | Bacteria | 1058 |
| 641 | Ga0439442_082748 | 3300042002 | Bacteria | 688 |
| 642 | Ga0439445_0001277 | 3300042004 | Bacteria | 5451 |
| 643 | Ga0439445_0006277 | 3300042004 | Bacteria | 2730 |
| 644 | Ga0439445_0009255 | 3300042004 | Bacteria | 2319 |
| 645 | Ga0439448_0035093 | 3300042005 | Bacteria | 1605 |
| 646 | Ga0439450_151198 | 3300042008 | Bacteria | 609 |
| 647 | Ga0439434_0001827 | 3300042435 | Bacteria | 6189 |
| 648 | Ga0439434_0002991 | 3300042435 | Bacteria | 4949 |
| 649 | Ga0439434_0065829 | 3300042435 | Bacteria | 1137 |
| 650 | Ga0439434_0112473 | 3300042435 | Bacteria | 883 |
| 651 | Ga0466972_0014330 | 3300044658 | Bacteria | 3972 |
| 652 | Ga0466972_0014708 | 3300044658 | Bacteria | 3915 |
| 653 | Ga0466972_0044291 | 3300044658 | Bacteria | 2159 |
| 654 | Ga0466972_0120226 | 3300044658 | Bacteria | 1239 |
| 655 | Ga0466972_0566073 | 3300044658 | Bacteria | 536 |
| 656 | Ga0466965_0002913 | 3300044683 | Bacteria | 7397 |
| 657 | Ga0466965_0008663 | 3300044683 | Bacteria | 4708 |
| 658 | Ga0466965_0029923 | 3300044683 | Bacteria | 2651 |
| 659 | Ga0466965_0083523 | 3300044683 | Bacteria | 1617 |
| 660 | Ga0466965_0102931 | 3300044683 | Bacteria | 1461 |
| 661 | Ga0466965_0235939 | 3300044683 | Bacteria | 978 |
| 662 | Ga0466965_0248482 | 3300044683 | Bacteria | 954 |
| 663 | Ga0466965_0356052 | 3300044683 | Bacteria | 802 |
| 664 | Ga0466961_0074698 | 3300044693 | Bacteria | 2149 |
| 665 | Ga0466963_0228127 | 3300044694 | Bacteria | 1305 |
| 666 | Ga0466964_0190974 | 3300044706 | Bacteria | 977 |
| 667 | Ga0466971_0092650 | 3300044719 | Bacteria | 1384 |
| 668 | Ga0466968_0004772 | 3300044735 | Bacteria | 5075 |
| 669 | Ga0466968_0039664 | 3300044735 | Bacteria | 1983 |
| 670 | Ga0466968_0048793 | 3300044735 | Bacteria | 1802 |
| 671 | Ga0466970_0021122 | 3300044765 | Bacteria | 3388 |
| 672 | Ga0466970_0027961 | 3300044765 | Bacteria | 2962 |
| 673 | Ga0466970_0204061 | 3300044765 | Bacteria | 1100 |
| 674 | Ga0466970_0223349 | 3300044765 | Bacteria | 1051 |
| 675 | Ga0466970_0299152 | 3300044765 | Bacteria | 907 |
| 676 | Ga0466970_0379278 | 3300044765 | Bacteria | 805 |
| 677 | Ga0466957_0292223 | 3300044842 | Bacteria | 1093 |
| 678 | Ga0466957_0311111 | 3300044842 | Bacteria | 1060 |
| 679 | Ga0466957_0312379 | 3300044842 | Bacteria | 1059 |
| 680 | Ga0466960_0001158 | 3300044901 | Bacteria | 9481 |
| 681 | Ga0466960_0006575 | 3300044901 | Bacteria | 4669 |
| 682 | Ga0466960_0282784 | 3300044901 | Bacteria | 930 |
| 683 | Ga0466959_0030872 | 3300045049 | Bacteria | 3967 |
| 684 | Ga0466959_0124827 | 3300045049 | Bacteria | 1827 |
| 685 | Ga0466958_0079095 | 3300045836 | Bacteria | 2021 |
| 686 | Ga0466967_0006912 | 3300045976 | Bacteria | 8109 |
| 687 | Ga0466967_0032235 | 3300045976 | Bacteria | 4422 |
| 688 | Ga0466967_0167085 | 3300045976 | Bacteria | 2068 |
| 689 | Ga0466967_0176662 | 3300045976 | Bacteria | 2012 |
| 690 | Ga0466967_0304473 | 3300045976 | Bacteria | 1534 |
| 691 | Ga0466967_1395681 | 3300045976 | Bacteria | 698 |
| 692 | Ga0495603_0049300 | 3300046455 | Bacteria | 2507 |
| 693 | Ga0495629_0201647 | 3300046459 | Bacteria | 1375 |
| 694 | Ga0495638_0007924 | 3300046460 | Bacteria | 7577 |
| 695 | Ga0495638_0014570 | 3300046460 | Bacteria | 5308 |
| 696 | Ga0495641_0012759 | 3300046461 | Bacteria | 4671 |
| 697 | Ga0495582_0074468 | 3300046473 | Bacteria | 1880 |
| 698 | Ga0495639_0079198 | 3300046475 | Bacteria | 1528 |
| 699 | Ga0495664_0277376 | 3300046477 | Bacteria | 1013 |
| 700 | Ga0495594_0174458 | 3300046499 | Bacteria | 1223 |
| 701 | Ga0495596_0426665 | 3300046500 | Bacteria | 517 |
| 702 | Ga0495606_0027477 | 3300046507 | Bacteria | 4034 |
| 703 | Ga0495608_0723202 | 3300046511 | Bacteria | 591 |
| 704 | Ga0495618_0911616 | 3300046514 | Bacteria | 507 |
| 705 | Ga0495630_0145905 | 3300046517 | Bacteria | 1800 |
| 706 | Ga0495648_0006968 | 3300046524 | Bacteria | 9115 |
| 707 | Ga0495654_0076250 | 3300046530 | Bacteria | 1580 |
| 708 | Ga0495665_0120992 | 3300046531 | Bacteria | 1371 |
| 709 | Ga0495640_0077984 | 3300046533 | Bacteria | 2208 |
| 710 | Ga0495668_0246567 | 3300046616 | Bacteria | 978 |
| 711 | Ga0495634_0703167 | 3300046642 | Bacteria | 581 |
| 712 | Ga0495611_0057947 | 3300046648 | Bacteria | 1756 |
| 713 | Ga0495658_0078982 | 3300046683 | Bacteria | 1927 |
| 714 | Ga0495671_0367385 | 3300046692 | Bacteria | 690 |
| 715 | Ga0495604_0642552 | 3300047317 | Bacteria | 677 |
| 716 | Ga0495674_0557760 | 3300047319 | Bacteria | 911 |
| 717 | Ga0495672_0000892 | 3300047320 | Bacteria | 31349 |
| 718 | Ga0495672_0085389 | 3300047320 | Bacteria | 1749 |
| 719 | Ga0495672_0108020 | 3300047320 | Bacteria | 1498 |
| 720 | Ga0495672_0130773 | 3300047320 | Bacteria | 1321 |
| 721 | Ga0495680_0592854 | 3300047322 | Bacteria | 742 |
| 722 | Ga0495673_0002880 | 3300047469 | Bacteria | 11698 |
| 723 | Ga0495686_0139406 | 3300047472 | Bacteria | 1432 |
| 724 | Ga0495593_0060093 | 3300047673 | Bacteria | 1990 |
| 725 | Ga0495614_0535713 | 3300048089 | Bacteria | 559 |
| 726 | Ga0495626_0174226 | 3300048091 | Bacteria | 895 |
| 727 | Ga0495626_0257863 | 3300048091 | Bacteria | 698 |
| 728 | Ga0496100_0000033 | 3300048903 | Bacteria | 98762 |
| 729 | Ga0496100_0000307 | 3300048903 | Bacteria | 24158 |
| 730 | Ga0496100_0000383 | 3300048903 | Bacteria | 21527 |
| 731 | Ga0496100_0001064 | 3300048903 | Bacteria | 13233 |
| 732 | Ga0496100_0025799 | 3300048903 | Bacteria | 3596 |
| 733 | Ga0496100_0683213 | 3300048903 | Bacteria | 801 |
| 734 | Ga0496101_0000008 | 3300048904 | Bacteria | 309720 |
| 735 | Ga0496101_0000033 | 3300048904 | Bacteria | 183191 |
| 736 | Ga0496101_0000270 | 3300048904 | Bacteria | 36620 |
| 737 | Ga0496101_0003204 | 3300048904 | Bacteria | 10146 |
| 738 | Ga0496101_0054409 | 3300048904 | Bacteria | 2890 |
| 739 | Ga0496101_0155368 | 3300048904 | Bacteria | 1752 |
| 740 | Ga0496101_0165900 | 3300048904 | Bacteria | 1695 |
| 741 | Ga0496101_0431825 | 3300048904 | Bacteria | 1039 |
| 742 | Ga0496101_0750292 | 3300048904 | Bacteria | 770 |
| 743 | Ga0496102_0000005 | 3300048905 | Bacteria | 481937 |
| 744 | Ga0496102_0000257 | 3300048905 | Bacteria | 69091 |
| 745 | Ga0496102_0003067 | 3300048905 | Bacteria | 14142 |
| 746 | Ga0496102_0004668 | 3300048905 | Bacteria | 11588 |
| 747 | Ga0496102_0154202 | 3300048905 | Bacteria | 2159 |
| 748 | Ga0496102_0285735 | 3300048905 | Bacteria | 1555 |
| 749 | Ga0496102_0495546 | 3300048905 | Bacteria | 1143 |
| 750 | Ga0496103_0000002 | 3300048906 | Bacteria | 605387 |
| 751 | Ga0496103_0000393 | 3300048906 | Bacteria | 38826 |
| 752 | Ga0496103_0000540 | 3300048906 | Bacteria | 30387 |
| 753 | Ga0496103_0002854 | 3300048906 | Bacteria | 10742 |
| 754 | Ga0496103_0374717 | 3300048906 | Bacteria | 915 |
| 755 | Ga0496103_0512000 | 3300048906 | Bacteria | 767 |
| 756 | Ga0496104_0004313 | 3300048907 | Bacteria | 12371 |
| 757 | Ga0496104_0010659 | 3300048907 | Bacteria | 8214 |
| 758 | Ga0496104_0229871 | 3300048907 | Bacteria | 1767 |
| 759 | Ga0496104_0363310 | 3300048907 | Bacteria | 1360 |
| 760 | Ga0496104_0754340 | 3300048907 | Bacteria | 880 |
| 761 | Ga0496105_0019662 | 3300048908 | Bacteria | 5449 |
| 762 | Ga0496105_0435057 | 3300048908 | Bacteria | 1037 |
| 763 | Ga0496105_0484214 | 3300048908 | Bacteria | 973 |
| 764 | Ga0496105_0506221 | 3300048908 | Bacteria | 947 |
| 765 | Ga0496105_0758351 | 3300048908 | Bacteria | 741 |
| 766 | Ga0496105_1221028 | 3300048908 | Bacteria | 553 |
| 767 | Ga0496106_0000615 | 3300048909 | Bacteria | 25459 |
| 768 | Ga0496106_0000777 | 3300048909 | Bacteria | 23032 |
| 769 | Ga0496106_0012783 | 3300048909 | Bacteria | 6197 |
| 770 | Ga0496106_0040081 | 3300048909 | Bacteria | 3506 |
| 771 | Ga0496106_0174404 | 3300048909 | Bacteria | 1705 |
| 772 | Ga0496106_0418838 | 3300048909 | Bacteria | 1076 |
| 773 | Ga0496107_0000083 | 3300048910 | Bacteria | 45218 |
| 774 | Ga0496107_0001171 | 3300048910 | Bacteria | 15903 |
| 775 | Ga0496107_0005215 | 3300048910 | Bacteria | 8872 |
| 776 | Ga0496107_0006327 | 3300048910 | Bacteria | 8140 |
| 777 | Ga0496107_0062955 | 3300048910 | Bacteria | 2688 |
| 778 | Ga0496107_0206319 | 3300048910 | Bacteria | 1461 |
| 779 | Ga0496107_0206985 | 3300048910 | Bacteria | 1458 |
| 780 | Ga0496108_0002478 | 3300048911 | Bacteria | 14776 |
| 781 | Ga0496108_0003256 | 3300048911 | Bacteria | 13053 |
| 782 | Ga0496108_0076780 | 3300048911 | Bacteria | 2824 |
| 783 | Ga0496108_0093861 | 3300048911 | Bacteria | 2553 |
| 784 | Ga0496108_0159426 | 3300048911 | Bacteria | 1949 |
| 785 | Ga0496108_0248223 | 3300048911 | Bacteria | 1548 |
| 786 | Ga0496108_0284525 | 3300048911 | Bacteria | 1439 |
| 787 | Ga0496109_0000293 | 3300048912 | Bacteria | 47411 |
| 788 | Ga0496109_0001978 | 3300048912 | Bacteria | 16987 |
| 789 | Ga0496109_0038037 | 3300048912 | Bacteria | 4349 |
| 790 | Ga0496109_0092322 | 3300048912 | Bacteria | 2800 |
| 791 | Ga0496109_0167328 | 3300048912 | Bacteria | 2062 |
| 792 | Ga0496109_0328787 | 3300048912 | Bacteria | 1443 |
| 793 | Ga0496109_0473721 | 3300048912 | Bacteria | 1182 |
| 794 | Ga0496109_0799007 | 3300048912 | Bacteria | 881 |
| 795 | Ga0496110_0029596 | 3300048913 | Bacteria | 4715 |
| 796 | Ga0496110_0042318 | 3300048913 | Bacteria | 3976 |
| 797 | Ga0496110_0066830 | 3300048913 | Bacteria | 3179 |
| 798 | Ga0496110_0251986 | 3300048913 | Bacteria | 1607 |
| 799 | Ga0496110_0290617 | 3300048913 | Bacteria | 1489 |
| 800 | Ga0496110_0600110 | 3300048913 | Bacteria | 999 |
| 801 | Ga0496111_0016877 | 3300048914 | Bacteria | 5039 |
| 802 | Ga0496111_0184564 | 3300048914 | Bacteria | 1551 |
| 803 | Ga0496112_0047284 | 3300048915 | Bacteria | 4221 |
| 804 | Ga0496112_0083953 | 3300048915 | Bacteria | 3150 |
| 805 | Ga0496112_0086710 | 3300048915 | Bacteria | 3097 |
| 806 | Ga0496112_0108326 | 3300048915 | Bacteria | 2748 |
| 807 | Ga0496112_0278301 | 3300048915 | Bacteria | 1621 |
| 808 | Ga0496112_0377459 | 3300048915 | Bacteria | 1359 |
| 809 | Ga0496112_0489533 | 3300048915 | Bacteria | 1166 |
| 810 | Ga0496112_0764416 | 3300048915 | Bacteria | 892 |
| 811 | Ga0496113_0004725 | 3300048916 | Bacteria | 8408 |
| 812 | Ga0496113_0073302 | 3300048916 | Bacteria | 2608 |
| 813 | Ga0496113_0294515 | 3300048916 | Bacteria | 1299 |
| 814 | Ga0496113_0372642 | 3300048916 | Bacteria | 1146 |
| 815 | Ga0496113_0386083 | 3300048916 | Bacteria | 1124 |
| 816 | Ga0496113_0858603 | 3300048916 | Bacteria | 719 |
| 817 | Ga0496114_0000517 | 3300048917 | Bacteria | 28403 |
| 818 | Ga0496114_0002766 | 3300048917 | Bacteria | 13427 |
| 819 | Ga0496114_0010038 | 3300048917 | Bacteria | 7528 |
| 820 | Ga0496114_0917726 | 3300048917 | Bacteria | 757 |
| 821 | Ga0496114_1083034 | 3300048917 | Bacteria | 686 |
| 822 | Ga0496115_0008855 | 3300048918 | Bacteria | 7460 |
| 823 | Ga0496115_0134115 | 3300048918 | Bacteria | 2042 |
| 824 | Ga0496115_1238275 | 3300048918 | Bacteria | 559 |
| 825 | Ga0496115_1315795 | 3300048918 | Bacteria | 537 |
| 826 | Ga0496116_0000034 | 3300048919 | Bacteria | 409567 |
| 827 | Ga0496116_0001049 | 3300048919 | Bacteria | 33626 |
| 828 | Ga0496116_0033542 | 3300048919 | Bacteria | 3642 |
| 829 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 830 | Ga0496117_0000390 | 3300048920 | Bacteria | 75361 |
| 831 | Ga0496117_0002218 | 3300048920 | Bacteria | 25147 |
| 832 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 833 | Ga0496118_0002226 | 3300048921 | Bacteria | 26786 |
| 834 | Ga0496118_0010693 | 3300048921 | Bacteria | 9047 |
| 835 | Ga0496118_0509823 | 3300048921 | Bacteria | 596 |
| 836 | Ga0496119_0001001 | 3300048922 | Bacteria | 36211 |
| 837 | Ga0496119_0013888 | 3300048922 | Bacteria | 6357 |
| 838 | Ga0496119_0015314 | 3300048922 | Bacteria | 5916 |
| 839 | Ga0496119_0508129 | 3300048922 | Bacteria | 560 |
| 840 | Ga0496120_0000241 | 3300048923 | Bacteria | 93282 |
| 841 | Ga0496120_0047544 | 3300048923 | Bacteria | 2473 |
| 842 | Ga0496120_0054340 | 3300048923 | Bacteria | 2270 |
| 843 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 844 | Ga0496121_0000421 | 3300048924 | Bacteria | 83629 |
| 845 | Ga0496121_0002203 | 3300048924 | Bacteria | 30428 |
| 846 | Ga0496121_0401867 | 3300048924 | Bacteria | 897 |
| 847 | Ga0496122_0000051 | 3300048925 | Bacteria | 265104 |
| 848 | Ga0496122_0005578 | 3300048925 | Bacteria | 14897 |
| 849 | Ga0496122_0514235 | 3300048925 | Bacteria | 579 |
| 850 | Ga0496123_0001082 | 3300048926 | Bacteria | 41071 |
| 851 | Ga0496123_0011189 | 3300048926 | Bacteria | 7809 |
| 852 | Ga0496123_0179182 | 3300048926 | Bacteria | 1109 |
| 853 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 854 | Ga0496124_0203268 | 3300048927 | Bacteria | 1504 |
| 855 | Ga0496124_0925621 | 3300048927 | Bacteria | 526 |
| 856 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 857 | Ga0496125_0023269 | 3300048928 | Bacteria | 5722 |
| 858 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 859 | Ga0496126_0000805 | 3300048929 | Bacteria | 56108 |
| 860 | Ga0496126_0010992 | 3300048929 | Bacteria | 9418 |
| 861 | Ga0496126_0012617 | 3300048929 | Bacteria | 8647 |
| 862 | Ga0496126_0533481 | 3300048929 | Bacteria | 934 |
| 863 | Ga0496126_0764614 | 3300048929 | Bacteria | 744 |
| 864 | Ga0501032_0009298 | 3300049569 | Bacteria | 7119 |
| 865 | Ga0501033_0212694 | 3300049570 | Bacteria | 1378 |
| 866 | Ga0501034_0014878 | 3300049571 | Bacteria | 8003 |
| 867 | Ga0501034_0061168 | 3300049571 | Bacteria | 3783 |
| 868 | Ga0501036_0033970 | 3300049572 | Bacteria | 4314 |
| 869 | Ga0501036_0216437 | 3300049572 | Bacteria | 1609 |
| 870 | Ga0501037_0001465 | 3300049573 | Bacteria | 17304 |
| 871 | Ga0501040_0268460 | 3300049576 | Bacteria | 1218 |
| 872 | Ga0501043_0001059 | 3300049579 | Bacteria | 24169 |
| 873 | Ga0501047_0001744 | 3300049581 | Bacteria | 21072 |
| 874 | Ga0501047_0004294 | 3300049581 | Bacteria | 13412 |
| 875 | Ga0501047_0911358 | 3300049581 | Bacteria | 692 |
| 876 | Ga0501068_0635386 | 3300049584 | Bacteria | 696 |
| 877 | Ga0501069_0015109 | 3300049585 | Bacteria | 4136 |
| 878 | Ga0501070_0001045 | 3300049586 | Bacteria | 24930 |
| 879 | Ga0501070_0090058 | 3300049586 | Bacteria | 2539 |
| 880 | Ga0501070_0093122 | 3300049586 | Bacteria | 2493 |
| 881 | Ga0501070_0331554 | 3300049586 | Bacteria | 1237 |
| 882 | Ga0501071_0735291 | 3300049587 | Bacteria | 760 |
| 883 | Ga0501077_0324311 | 3300049593 | Bacteria | 982 |
| 884 | Ga0501079_0958133 | 3300049741 | Bacteria | 674 |
| 885 | Ga0501080_0763685 | 3300049742 | Bacteria | 850 |
| 886 | Ga0501080_1745031 | 3300049742 | Bacteria | 524 |
| 887 | Ga0501035_0000824 | 3300049822 | Bacteria | 33083 |
| 888 | Ga0501044_0000400 | 3300049823 | Bacteria | 53515 |
| 889 | Ga0501044_0022680 | 3300049823 | Bacteria | 6685 |
| 890 | Ga0501044_1245389 | 3300049823 | Bacteria | 611 |
| 891 | nmdc:mga03683_282316_c1 | 3300050489 | Bacteria | 776 |
| 892 | nmdc:mga03683_391298_c1 | 3300050489 | Bacteria | 663 |
| 893 | nmdc:mga03683_41391_c1 | 3300050489 | Bacteria | 1892 |
| 894 | nmdc:mga03683_47067_c1 | 3300050489 | Bacteria | 1789 |
| 895 | nmdc:mga03683_4742_c1 | 3300050489 | Bacteria | 4535 |
| 896 | nmdc:mga03683_49033_c1 | 3300050489 | Bacteria | 1242 |
| 897 | nmdc:mga03683_63873_c1 | 3300050489 | Bacteria | 855 |
| 898 | nmdc:mga03n38_14398_c1 | 3300050490 | Bacteria | 3030 |
| 899 | nmdc:mga03n38_271052_c1 | 3300050490 | Bacteria | 903 |
| 900 | nmdc:mga03n38_2737_c1 | 3300050490 | Bacteria | 5521 |
| 901 | nmdc:mga03n38_284722_c1 | 3300050490 | Bacteria | 883 |
| 902 | nmdc:mga03n38_294500_c1 | 3300050490 | Bacteria | 870 |
| 903 | nmdc:mga03n38_336848_c1 | 3300050490 | Bacteria | 818 |
| 904 | nmdc:mga03n38_355895_c1 | 3300050490 | Bacteria | 798 |
| 905 | nmdc:mga03n38_561408_c1 | 3300050490 | Bacteria | 647 |
| 906 | nmdc:mga03n38_7697_c1 | 3300050490 | Bacteria | 3823 |
| 907 | nmdc:mga03n38_77171_c1 | 3300050490 | Bacteria | 1556 |
| 908 | nmdc:mga03n38_7949_c1 | 3300050490 | Bacteria | 3777 |
| 909 | nmdc:mga03n38_797118_c1 | 3300050490 | Bacteria | 550 |
| 910 | nmdc:mga03n38_942519_c1 | 3300050490 | Bacteria | 509 |
| 911 | nmdc:mga00v17_133133_c1 | 3300050491 | Bacteria | 1590 |
| 912 | nmdc:mga00v17_166783_c1 | 3300050491 | Bacteria | 1419 |
| 913 | nmdc:mga00v17_16828_c1 | 3300050491 | Bacteria | 4127 |
| 914 | nmdc:mga00v17_182570_c1 | 3300050491 | Bacteria | 1354 |
| 915 | nmdc:mga00v17_1839_c1 | 3300050491 | Bacteria | 10962 |
| 916 | nmdc:mga00v17_208391_c1 | 3300050491 | Bacteria | 1264 |
| 917 | nmdc:mga00v17_26886_c1 | 3300050491 | Bacteria | 3356 |
| 918 | nmdc:mga00v17_28589_c1 | 3300050491 | Bacteria | 3266 |
| 919 | nmdc:mga00v17_290297_c1 | 3300050491 | Bacteria | 1062 |
| 920 | nmdc:mga00v17_312725_c1 | 3300050491 | Bacteria | 1021 |
| 921 | nmdc:mga00v17_381401_c1 | 3300050491 | Bacteria | 916 |
| 922 | nmdc:mga00v17_464724_c1 | 3300050491 | Bacteria | 821 |
| 923 | nmdc:mga0yw44_1049171_c1 | 3300050492 | Bacteria | 551 |
| 924 | nmdc:mga0yw44_111276_c1 | 3300050492 | Bacteria | 1755 |
| 925 | nmdc:mga0yw44_135112_c1 | 3300050492 | Bacteria | 1599 |
| 926 | nmdc:mga0yw44_143301_c1 | 3300050492 | Bacteria | 1554 |
| 927 | nmdc:mga0yw44_161414_c1 | 3300050492 | Bacteria | 1467 |
| 928 | nmdc:mga0yw44_217996_c1 | 3300050492 | Bacteria | 1264 |
| 929 | nmdc:mga0yw44_263583_c1 | 3300050492 | Bacteria | 1149 |
| 930 | nmdc:mga0yw44_424311_c1 | 3300050492 | Bacteria | 900 |
| 931 | nmdc:mga0yw44_442646_c1 | 3300050492 | Bacteria | 574 |
| 932 | nmdc:mga0yw44_465326_c1 | 3300050492 | Bacteria | 857 |
| 933 | nmdc:mga0yw44_569474_c1 | 3300050492 | Bacteria | 769 |
| 934 | nmdc:mga0yw44_890157_c1 | 3300050492 | Bacteria | 604 |
| 935 | nmdc:mga0yw44_95642_c1 | 3300050492 | Bacteria | 1885 |
| 936 | nmdc:mga0k408_41793_c1 | 3300050493 | Bacteria | 2639 |
| 937 | nmdc:mga0k408_469831_c1 | 3300050493 | Bacteria | 746 |
| 938 | nmdc:mga06z11_55944_c1 | 3300050494 | Bacteria | 2039 |
| 939 | nmdc:mga06z11_603453_c1 | 3300050494 | Bacteria | 668 |
| 940 | nmdc:mga06z11_795004_c1 | 3300050494 | Bacteria | 576 |
| 941 | nmdc:mga04h51_21305_c1 | 3300050495 | Bacteria | 1948 |
| 942 | nmdc:mga04h51_85760_c1 | 3300050495 | Bacteria | 1125 |
| 943 | nmdc:mga07m45_10218_c1 | 3300050496 | Bacteria | 4895 |
| 944 | nmdc:mga07m45_118121_c1 | 3300050496 | Bacteria | 1531 |
| 945 | nmdc:mga07m45_27866_c1 | 3300050496 | Bacteria | 3116 |
| 946 | nmdc:mga07m45_42475_c1 | 3300050496 | Bacteria | 2549 |
| 947 | nmdc:mga07m45_45201_c1 | 3300050496 | Bacteria | 2472 |
| 948 | nmdc:mga07m45_795161_c1 | 3300050496 | Bacteria | 542 |
| 949 | nmdc:mga05p37_1568544_c1 | 3300050507 | Bacteria | 651 |
| 950 | nmdc:mga05p37_87296_c1 | 3300050507 | Bacteria | 3844 |
| 951 | nmdc:mga0qj67_19994_c1 | 3300050509 | Bacteria | 5124 |
| 952 | nmdc:mga0qj67_51566_c1 | 3300050509 | Bacteria | 3254 |
| 953 | nmdc:mga06r32_32424_c1 | 3300050510 | Bacteria | 4915 |
| 954 | nmdc:mga08y16_1646474_c1 | 3300050511 | Bacteria | 598 |
| 955 | nmdc:mga0n895_388641_c1 | 3300050512 | Bacteria | 1411 |
| 956 | nmdc:mga0a205_331119_c1 | 3300050515 | Bacteria | 1392 |
| 957 | nmdc:mga0sz30_103073_c2 | 3300050516 | Bacteria | 955 |
| 958 | nmdc:mga0sz30_113708_c1 | 3300050516 | Bacteria | 1187 |
| 959 | nmdc:mga0sz30_17777_c1 | 3300050516 | Bacteria | 2839 |
| 960 | nmdc:mga0sz30_19424_c1 | 3300050516 | Bacteria | 1649 |
| 961 | nmdc:mga0sz30_2053_c1 | 3300050516 | Bacteria | 7196 |
| 962 | nmdc:mga0sz30_219_c1 | 3300050516 | Bacteria | 21835 |
| 963 | nmdc:mga0sz30_239062_c1 | 3300050516 | Bacteria | 808 |
| 964 | nmdc:mga0sz30_247223_c1 | 3300050516 | Bacteria | 794 |
| 965 | nmdc:mga0sz30_27081_c2 | 3300050516 | Bacteria | 1707 |
| 966 | nmdc:mga0sz30_279571_c1 | 3300050516 | Bacteria | 744 |
| 967 | Ga0500610_0072788 | 3300053079 | Bacteria | 1792 |
| 968 | Ga0500635_0033168 | 3300053080 | Bacteria | 1683 |
| 969 | Ga0500635_0068357 | 3300053080 | Bacteria | 1255 |
| 970 | Ga0495619_0045764 | 3300053085 | Bacteria | 2875 |
| 971 | Ga0500578_0768663 | 3300053086 | Bacteria | 512 |
| 972 | Ga0500643_002732 | 3300053087 | Bacteria | 8852 |
| 973 | Ga0500643_003257 | 3300053087 | Bacteria | 7908 |
| 974 | Ga0500581_301034 | 3300053089 | Bacteria | 638 |
| 975 | Ga0500646_0039744 | 3300053090 | Bacteria | 1321 |
| 976 | Ga0500583_0287899 | 3300053092 | Bacteria | 806 |
| 977 | Ga0500651_0142671 | 3300053093 | Bacteria | 1443 |
| 978 | Ga0500566_0429975 | 3300053094 | Bacteria | 583 |
| 979 | Ga0500650_0434409 | 3300053098 | Bacteria | 564 |
| 980 | Ga0500556_0001801 | 3300053104 | Bacteria | 7928 |
| 981 | Ga0500556_0053181 | 3300053104 | Bacteria | 1471 |
| 982 | Ga0500562_005249 | 3300053108 | Bacteria | 3255 |
| 983 | Ga0500572_309658 | 3300053111 | Bacteria | 507 |
| 984 | Ga0500642_0055010 | 3300053130 | Bacteria | 1769 |
| 985 | Ga0500652_000992 | 3300053131 | Bacteria | 9298 |
| 986 | Ga0500559_0251104 | 3300053136 | Bacteria | 833 |
| 987 | Ga0500577_0092628 | 3300053142 | Bacteria | 1224 |
| 988 | Ga0500588_0366193 | 3300053146 | Bacteria | 548 |
| 989 | Ga0500604_0049468 | 3300053151 | Bacteria | 1293 |
| 990 | Ga0500616_0002892 | 3300053153 | Bacteria | 13757 |
| 991 | Ga0500616_0008826 | 3300053153 | Bacteria | 6200 |
| 992 | Ga0500616_0089755 | 3300053153 | Bacteria | 1525 |
| 993 | Ga0500620_040274 | 3300053155 | Bacteria | 1530 |
| 994 | Ga0500627_0017142 | 3300053158 | Bacteria | 2840 |
| 995 | Ga0500627_0202190 | 3300053158 | Bacteria | 890 |
| 996 | Ga0500633_0047396 | 3300053160 | Bacteria | 1470 |
| 997 | Ga0500634_0234517 | 3300053161 | Bacteria | 776 |
| 998 | Ga0500638_268237 | 3300053162 | Bacteria | 677 |
| 999 | Ga0500645_000110 | 3300053730 | Bacteria | 65408 |
| 1000 | Ga0500645_013051 | 3300053730 | Bacteria | 2675 |
| 1001 | Ga0587084_155780 | 3300059477 | Bacteria | 505 |
| 1002 | Ga0587090_146616 | 3300059510 | Bacteria | 532 |
| 1003 | Ga0466962_0024515 | 3300061719 | Bacteria | 2898 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100018869 | Ga0070714_1000188695 | 89 |
| 2 | 3300005436 | Ga0070713_100118670 | Ga0070713_1001186703 | 89 |
| 3 | 3300005439 | Ga0070711_101509120 | Ga0070711_1015091201 | 89 |
| 4 | 3300006038 | Ga0075365_10055055 | Ga0075365_100550554 | 89 |
| 5 | 3300006173 | Ga0070716_100847150 | Ga0070716_1008471501 | 89 |
| 6 | 3300050492 | nmdc:mga0yw44_1049171_c1 | nmdc:mga0yw44_1049171_c1_184_507 | 89 |
| 7 | iso_pu_bacteria | 2643221687 | 2644489575 | 92 |
| 8 | iso_pu_bacteria | 2643221715 | 2644635318 | 92 |
| 9 | iso_pu_bacteria | 2738541264 | 2738666449 | 92 |
| 10 | iso_pu_bacteria | 2738541356 | 2739146373 | 92 |
| 11 | iso_pu_bacteria | 2842134933 | 2842137138 | 92 |
| 12 | iso_pu_bacteria | 2902792274 | 2902799266 | 92 |
| 13 | iso_pu_bacteria | 2902810491 | 2902813241 | 92 |
| 14 | iso_pu_bacteria | 2902837492 | 2902842358 | 92 |
| 15 | iso_pu_bacteria | 2939582691 | 2939588021 | 92 |
| 16 | 3300049570 | Ga0501033_0212694 | Ga0501033_0212694_959_1264 | 93 |
| 17 | 3300049572 | Ga0501036_0216437 | Ga0501036_0216437_1045_1350 | 93 |
| 18 | 3300049581 | Ga0501047_0001744 | Ga0501047_0001744_769_1065 | 93 |
| 19 | 3300049581 | Ga0501047_0004294 | Ga0501047_0004294_12295_12600 | 93 |
| 20 | 3300049585 | Ga0501069_0015109 | Ga0501069_0015109_1573_1869 | 93 |
| 21 | 3300049586 | Ga0501070_0093122 | Ga0501070_0093122_185_481 | 93 |
| 22 | 3300049822 | Ga0501035_0000824 | Ga0501035_0000824_21416_21721 | 93 |
| 23 | 3300049823 | Ga0501044_0000400 | Ga0501044_0000400_26005_26310 | 93 |
| 24 | iso_pu_bacteria | 2738541274 | 2738707059 | 93 |
| 25 | iso_pu_bacteria | 2738543028 | 2739333510 | 93 |
| 26 | iso_pu_bacteria | 2902799365 | 2902802144 | 93 |
| 27 | iso_pu_bacteria | 2929212328 | 2929214256 | 93 |
| 28 | 3300005455 | Ga0070663_100969821 | Ga0070663_1009698211 | 94 |
| 29 | 3300005981 | Ga0081538_10035673 | Ga0081538_100356733 | 94 |
| 30 | 3300006038 | Ga0075365_10047539 | Ga0075365_100475392 | 94 |
| 31 | 3300006048 | Ga0075363_101027628 | Ga0075363_1010276281 | 94 |
| 32 | 3300006051 | Ga0075364_10154835 | Ga0075364_101548352 | 94 |
| 33 | 3300006051 | Ga0075364_10188648 | Ga0075364_101886482 | 94 |
| 34 | 3300006051 | Ga0075364_10623698 | Ga0075364_106236982 | 94 |
| 35 | 3300006163 | Ga0070715_10405247 | Ga0070715_104052472 | 94 |
| 36 | 3300006173 | Ga0070716_101087791 | Ga0070716_1010877912 | 94 |
| 37 | 3300006177 | Ga0075362_10379157 | Ga0075362_103791572 | 94 |
| 38 | 3300006186 | Ga0075369_10002109 | Ga0075369_100021093 | 94 |
| 39 | 3300006186 | Ga0075369_10517450 | Ga0075369_105174502 | 94 |
| 40 | 3300006871 | Ga0075434_100459143 | Ga0075434_1004591432 | 94 |
| 41 | 3300014325 | Ga0163163_10191430 | Ga0163163_101914304 | 94 |
| 42 | 3300025929 | Ga0207664_10156204 | Ga0207664_101562043 | 94 |
| 43 | 3300025939 | Ga0207665_10887760 | Ga0207665_108877602 | 94 |
| 44 | 3300041411 | Ga0439466_0021376 | Ga0439466_0021376_1067_1357 | 94 |
| 45 | 3300041413 | Ga0439465_0007690 | Ga0439465_0007690_1666_1956 | 94 |
| 46 | 3300041458 | Ga0451798_0260113 | Ga0451798_0260113_417_713 | 94 |
| 47 | 3300042004 | Ga0439445_0006277 | Ga0439445_0006277_1136_1426 | 94 |
| 48 | 3300042435 | Ga0439434_0065829 | Ga0439434_0065829_742_1032 | 94 |
| 49 | 3300044842 | Ga0466957_0312379 | Ga0466957_0312379_373_666 | 94 |
| 50 | 3300046477 | Ga0495664_0277376 | Ga0495664_0277376_36_335 | 94 |
| 51 | 3300050489 | nmdc:mga03683_391298_c1 | nmdc:mga03683_391298_c1_178_468 | 94 |
| 52 | 3300050489 | nmdc:mga03683_47067_c1 | nmdc:mga03683_47067_c1_531_824 | 94 |
| 53 | 3300050490 | nmdc:mga03n38_942519_c1 | nmdc:mga03n38_942519_c1_65_355 | 94 |
| 54 | 3300050491 | nmdc:mga00v17_133133_c1 | nmdc:mga00v17_133133_c1_330_626 | 94 |
| 55 | 3300050491 | nmdc:mga00v17_166783_c1 | nmdc:mga00v17_166783_c1_567_857 | 94 |
| 56 | 3300050491 | nmdc:mga00v17_381401_c1 | nmdc:mga00v17_381401_c1_20_310 | 94 |
| 57 | 3300050492 | nmdc:mga0yw44_217996_c1 | nmdc:mga0yw44_217996_c1_379_669 | 94 |
| 58 | 3300050494 | nmdc:mga06z11_795004_c1 | nmdc:mga06z11_795004_c1_219_515 | 94 |
| 59 | 3300050512 | nmdc:mga0n895_388641_c1 | nmdc:mga0n895_388641_c1_568_858 | 94 |
| 60 | 3300050516 | nmdc:mga0sz30_219_c1 | nmdc:mga0sz30_219_c1_6819_7121 | 94 |
| 61 | 3300050516 | nmdc:mga0sz30_239062_c1 | nmdc:mga0sz30_239062_c1_441_734 | 94 |
| 62 | 3300053080 | Ga0500635_0033168 | Ga0500635_0033168_963_1259 | 94 |
| 63 | 3300053131 | Ga0500652_000992 | Ga0500652_000992_7489_7785 | 94 |
| 64 | 3300053153 | Ga0500616_0089755 | Ga0500616_0089755_995_1291 | 94 |
| 65 | 3300059477 | Ga0587084_155780 | Ga0587084_155780_194_484 | 94 |
| 66 | 3300000545 | CNXas_1005113 | CNXas_10051132 | 95 |
| 67 | 3300005329 | Ga0070683_100183221 | Ga0070683_1001832214 | 95 |
| 68 | 3300005337 | Ga0070682_100084985 | Ga0070682_1000849851 | 95 |
| 69 | 3300005338 | Ga0068868_100131427 | Ga0068868_1001314271 | 95 |
| 70 | 3300005338 | Ga0068868_100826572 | Ga0068868_1008265721 | 95 |
| 71 | 3300005343 | Ga0070687_100549971 | Ga0070687_1005499712 | 95 |
| 72 | 3300005366 | Ga0070659_100680368 | Ga0070659_1006803681 | 95 |
| 73 | 3300005439 | Ga0070711_101877929 | Ga0070711_1018779291 | 95 |
| 74 | 3300005441 | Ga0070700_101227776 | Ga0070700_1012277762 | 95 |
| 75 | 3300005455 | Ga0070663_100952689 | Ga0070663_1009526892 | 95 |
| 76 | 3300005456 | Ga0070678_101868519 | Ga0070678_1018685191 | 95 |
| 77 | 3300005457 | Ga0070662_101374459 | Ga0070662_1013744591 | 95 |
| 78 | 3300005535 | Ga0070684_100281500 | Ga0070684_1002815003 | 95 |
| 79 | 3300005548 | Ga0070665_100228267 | Ga0070665_1002282673 | 95 |
| 80 | 3300005614 | Ga0068856_102546793 | Ga0068856_1025467932 | 95 |
| 81 | 3300005615 | Ga0070702_101239923 | Ga0070702_1012399232 | 95 |
| 82 | 3300005616 | Ga0068852_100210563 | Ga0068852_1002105633 | 95 |
| 83 | 3300005617 | Ga0068859_102927705 | Ga0068859_1029277051 | 95 |
| 84 | 3300005618 | Ga0068864_101253565 | Ga0068864_1012535652 | 95 |
| 85 | 3300005719 | Ga0068861_101138994 | Ga0068861_1011389942 | 95 |
| 86 | 3300005834 | Ga0068851_10482902 | Ga0068851_104829022 | 95 |
| 87 | 3300005840 | Ga0068870_10291984 | Ga0068870_102919843 | 95 |
| 88 | 3300005840 | Ga0068870_11397895 | Ga0068870_113978952 | 95 |
| 89 | 3300005841 | Ga0068863_101677976 | Ga0068863_1016779762 | 95 |
| 90 | 3300005937 | Ga0081455_10036555 | Ga0081455_100365554 | 95 |
| 91 | 3300006048 | Ga0075363_100040183 | Ga0075363_1000401833 | 95 |
| 92 | 3300006051 | Ga0075364_10304632 | Ga0075364_103046322 | 95 |
| 93 | 3300006175 | Ga0070712_100529520 | Ga0070712_1005295202 | 95 |
| 94 | 3300006186 | Ga0075369_10490169 | Ga0075369_104901691 | 95 |
| 95 | 3300006353 | Ga0075370_10607977 | Ga0075370_106079771 | 95 |
| 96 | 3300006931 | Ga0097620_102927781 | Ga0097620_1029277811 | 95 |
| 97 | 3300009098 | Ga0105245_11493368 | Ga0105245_114933682 | 95 |
| 98 | 3300009101 | Ga0105247_10065096 | Ga0105247_100650963 | 95 |
| 99 | 3300009174 | Ga0105241_10830079 | Ga0105241_108300792 | 95 |
| 100 | 3300009174 | Ga0105241_11225082 | Ga0105241_112250822 | 95 |
| 101 | 3300009551 | Ga0105238_10642662 | Ga0105238_106426622 | 95 |
| 102 | 3300009553 | Ga0105249_10816852 | Ga0105249_108168522 | 95 |
| 103 | 3300011119 | Ga0105246_10217869 | Ga0105246_102178694 | 95 |
| 104 | 3300013297 | Ga0157378_11122549 | Ga0157378_111225492 | 95 |
| 105 | 3300013297 | Ga0157378_12285943 | Ga0157378_122859432 | 95 |
| 106 | 3300013306 | Ga0163162_10733765 | Ga0163162_107337651 | 95 |
| 107 | 3300013307 | Ga0157372_11466986 | Ga0157372_114669862 | 95 |
| 108 | 3300013308 | Ga0157375_11976728 | Ga0157375_119767281 | 95 |
| 109 | 3300014326 | Ga0157380_11649491 | Ga0157380_116494912 | 95 |
| 110 | 3300014745 | Ga0157377_10233756 | Ga0157377_102337563 | 95 |
| 111 | 3300014745 | Ga0157377_10863597 | Ga0157377_108635972 | 95 |
| 112 | 3300014969 | Ga0157376_12567272 | Ga0157376_125672722 | 95 |
| 113 | 3300017792 | Ga0163161_10180097 | Ga0163161_101800972 | 95 |
| 114 | 3300017792 | Ga0163161_11408352 | Ga0163161_114083522 | 95 |
| 115 | 3300021384 | Ga0213876_10530277 | Ga0213876_105302771 | 95 |
| 116 | 3300025294 | Ga0209025_1068996 | Ga0209025_10689964 | 95 |
| 117 | 3300025900 | Ga0207710_10185684 | Ga0207710_101856841 | 95 |
| 118 | 3300025901 | Ga0207688_10075820 | Ga0207688_100758204 | 95 |
| 119 | 3300025901 | Ga0207688_10753573 | Ga0207688_107535731 | 95 |
| 120 | 3300025908 | Ga0207643_10253687 | Ga0207643_102536873 | 95 |
| 121 | 3300025918 | Ga0207662_10211461 | Ga0207662_102114612 | 95 |
| 122 | 3300025924 | Ga0207694_10155070 | Ga0207694_101550703 | 95 |
| 123 | 3300025924 | Ga0207694_11660843 | Ga0207694_116608431 | 95 |
| 124 | 3300025927 | Ga0207687_10350125 | Ga0207687_103501253 | 95 |
| 125 | 3300025932 | Ga0207690_10224812 | Ga0207690_102248122 | 95 |
| 126 | 3300025936 | Ga0207670_11705969 | Ga0207670_117059691 | 95 |
| 127 | 3300025937 | Ga0207669_10291106 | Ga0207669_102911064 | 95 |
| 128 | 3300025941 | Ga0207711_10997712 | Ga0207711_109977122 | 95 |
| 129 | 3300025972 | Ga0207668_10016773 | Ga0207668_100167737 | 95 |
| 130 | 3300025972 | Ga0207668_10208317 | Ga0207668_102083172 | 95 |
| 131 | 3300026023 | Ga0207677_10201803 | Ga0207677_102018032 | 95 |
| 132 | 3300026067 | Ga0207678_10904505 | Ga0207678_109045051 | 95 |
| 133 | 3300026075 | Ga0207708_10351959 | Ga0207708_103519593 | 95 |
| 134 | 3300026088 | Ga0207641_11833624 | Ga0207641_118336242 | 95 |
| 135 | 3300026095 | Ga0207676_11469946 | Ga0207676_114699462 | 95 |
| 136 | 3300026118 | Ga0207675_100517790 | Ga0207675_1005177902 | 95 |
| 137 | 3300026121 | Ga0207683_10614671 | Ga0207683_106146712 | 95 |
| 138 | 3300026142 | Ga0207698_10153911 | Ga0207698_101539113 | 95 |
| 139 | 3300032004 | Ga0307414_11351095 | Ga0307414_113510952 | 95 |
| 140 | 3300032005 | Ga0307411_10188989 | Ga0307411_101889892 | 95 |
| 141 | 3300035170 | Ga0373943_0268297 | Ga0373943_0268297_215_508 | 95 |
| 142 | 3300036401 | Ga0373937_0616162 | Ga0373937_0616162_37_330 | 95 |
| 143 | 3300039450 | Ga0436363_1100965 | Ga0436363_1100965_1864_2187 | 95 |
| 144 | 3300041452 | Ga0451793_0614440 | Ga0451793_0614440_151_453 | 95 |
| 145 | 3300041503 | Ga0451847_0431962 | Ga0451847_0431962_84_386 | 95 |
| 146 | 3300042005 | Ga0439448_0035093 | Ga0439448_0035093_857_1153 | 95 |
| 147 | 3300044658 | Ga0466972_0014708 | Ga0466972_0014708_2342_2647 | 95 |
| 148 | 3300044683 | Ga0466965_0008663 | Ga0466965_0008663_2412_2717 | 95 |
| 149 | 3300044683 | Ga0466965_0356052 | Ga0466965_0356052_216_521 | 95 |
| 150 | 3300044765 | Ga0466970_0204061 | Ga0466970_0204061_267_572 | 95 |
| 151 | 3300044765 | Ga0466970_0299152 | Ga0466970_0299152_144_449 | 95 |
| 152 | 3300044901 | Ga0466960_0001158 | Ga0466960_0001158_1792_2097 | 95 |
| 153 | 3300046455 | Ga0495603_0049300 | Ga0495603_0049300_614_907 | 95 |
| 154 | 3300046459 | Ga0495629_0201647 | Ga0495629_0201647_291_584 | 95 |
| 155 | 3300046461 | Ga0495641_0012759 | Ga0495641_0012759_4006_4299 | 95 |
| 156 | 3300046473 | Ga0495582_0074468 | Ga0495582_0074468_601_894 | 95 |
| 157 | 3300046475 | Ga0495639_0079198 | Ga0495639_0079198_401_694 | 95 |
| 158 | 3300046499 | Ga0495594_0174458 | Ga0495594_0174458_559_852 | 95 |
| 159 | 3300046511 | Ga0495608_0723202 | Ga0495608_0723202_277_570 | 95 |
| 160 | 3300046514 | Ga0495618_0911616 | Ga0495618_0911616_163_456 | 95 |
| 161 | 3300046517 | Ga0495630_0145905 | Ga0495630_0145905_1100_1393 | 95 |
| 162 | 3300046531 | Ga0495665_0120992 | Ga0495665_0120992_550_843 | 95 |
| 163 | 3300046533 | Ga0495640_0077984 | Ga0495640_0077984_946_1239 | 95 |
| 164 | 3300046642 | Ga0495634_0703167 | Ga0495634_0703167_123_416 | 95 |
| 165 | 3300046683 | Ga0495658_0078982 | Ga0495658_0078982_1083_1376 | 95 |
| 166 | 3300047317 | Ga0495604_0642552 | Ga0495604_0642552_207_500 | 95 |
| 167 | 3300047319 | Ga0495674_0557760 | Ga0495674_0557760_444_737 | 95 |
| 168 | 3300047320 | Ga0495672_0085389 | Ga0495672_0085389_315_608 | 95 |
| 169 | 3300047320 | Ga0495672_0108020 | Ga0495672_0108020_23_319 | 95 |
| 170 | 3300047322 | Ga0495680_0592854 | Ga0495680_0592854_255_548 | 95 |
| 171 | 3300047673 | Ga0495593_0060093 | Ga0495593_0060093_1349_1642 | 95 |
| 172 | 3300048089 | Ga0495614_0535713 | Ga0495614_0535713_121_414 | 95 |
| 173 | 3300048904 | Ga0496101_0155368 | Ga0496101_0155368_1128_1430 | 95 |
| 174 | 3300048904 | Ga0496101_0165900 | Ga0496101_0165900_596_904 | 95 |
| 175 | 3300048905 | Ga0496102_0285735 | Ga0496102_0285735_281_604 | 95 |
| 176 | 3300048907 | Ga0496104_0363310 | Ga0496104_0363310_827_1150 | 95 |
| 177 | 3300048907 | Ga0496104_0754340 | Ga0496104_0754340_13_306 | 95 |
| 178 | 3300048908 | Ga0496105_0506221 | Ga0496105_0506221_498_821 | 95 |
| 179 | 3300048908 | Ga0496105_1221028 | Ga0496105_1221028_85_387 | 95 |
| 180 | 3300048909 | Ga0496106_0418838 | Ga0496106_0418838_162_455 | 95 |
| 181 | 3300048910 | Ga0496107_0062955 | Ga0496107_0062955_2061_2354 | 95 |
| 182 | 3300048911 | Ga0496108_0159426 | Ga0496108_0159426_169_471 | 95 |
| 183 | 3300048912 | Ga0496109_0092322 | Ga0496109_0092322_1373_1675 | 95 |
| 184 | 3300048912 | Ga0496109_0328787 | Ga0496109_0328787_803_1126 | 95 |
| 185 | 3300048913 | Ga0496110_0600110 | Ga0496110_0600110_331_654 | 95 |
| 186 | 3300048915 | Ga0496112_0083953 | Ga0496112_0083953_2258_2560 | 95 |
| 187 | 3300048915 | Ga0496112_0086710 | Ga0496112_0086710_1960_2268 | 95 |
| 188 | 3300048916 | Ga0496113_0004725 | Ga0496113_0004725_3744_4052 | 95 |
| 189 | 3300048917 | Ga0496114_0917726 | Ga0496114_0917726_398_691 | 95 |
| 190 | 3300048918 | Ga0496115_1238275 | Ga0496115_1238275_32_340 | 95 |
| 191 | 3300048925 | Ga0496122_0005578 | Ga0496122_0005578_3306_3614 | 95 |
| 192 | 3300048925 | Ga0496122_0514235 | Ga0496122_0514235_264_569 | 95 |
| 193 | 3300048926 | Ga0496123_0011189 | Ga0496123_0011189_3739_4047 | 95 |
| 194 | 3300048929 | Ga0496126_0012617 | Ga0496126_0012617_5083_5391 | 95 |
| 195 | 3300049571 | Ga0501034_0061168 | Ga0501034_0061168_322_618 | 95 |
| 196 | 3300049742 | Ga0501080_1745031 | Ga0501080_1745031_32_328 | 95 |
| 197 | 3300049823 | Ga0501044_1245389 | Ga0501044_1245389_278_574 | 95 |
| 198 | 3300050490 | nmdc:mga03n38_14398_c1 | nmdc:mga03n38_14398_c1_354_656 | 95 |
| 199 | 3300050490 | nmdc:mga03n38_271052_c1 | nmdc:mga03n38_271052_c1_469_768 | 95 |
| 200 | 3300050491 | nmdc:mga00v17_290297_c1 | nmdc:mga00v17_290297_c1_539_844 | 95 |
| 201 | 3300050516 | nmdc:mga0sz30_19424_c1 | nmdc:mga0sz30_19424_c1_1049_1342 | 95 |
| 202 | 3300053085 | Ga0495619_0045764 | Ga0495619_0045764_2031_2324 | 95 |
| 203 | 3300001977 | JGI24746J21847_1011174 | JGI24746J21847_10111742 | 96 |
| 204 | 3300001978 | JGI24747J21853_1015315 | JGI24747J21853_10153152 | 96 |
| 205 | 3300001989 | JGI24739J22299_10049710 | JGI24739J22299_100497102 | 96 |
| 206 | 3300001990 | JGI24737J22298_10012890 | JGI24737J22298_100128903 | 96 |
| 207 | 3300001990 | JGI24737J22298_10063782 | JGI24737J22298_100637822 | 96 |
| 208 | 3300001990 | JGI24737J22298_10239371 | JGI24737J22298_102393711 | 96 |
| 209 | 3300001991 | JGI24743J22301_10122959 | JGI24743J22301_101229591 | 96 |
| 210 | 3300002070 | JGI24750J21931_1010814 | JGI24750J21931_10108142 | 96 |
| 211 | 3300002074 | JGI24748J21848_1008609 | JGI24748J21848_10086091 | 96 |
| 212 | 3300002074 | JGI24748J21848_1042239 | JGI24748J21848_10422392 | 96 |
| 213 | 3300002076 | JGI24749J21850_1027833 | JGI24749J21850_10278331 | 96 |
| 214 | 3300002077 | JGI24744J21845_10000131 | JGI24744J21845_100001315 | 96 |
| 215 | 3300002239 | JGI24034J26672_10007839 | JGI24034J26672_100078392 | 96 |
| 216 | 3300002244 | JGI24742J22300_10000618 | JGI24742J22300_100006183 | 96 |
| 217 | 3300002244 | JGI24742J22300_10008441 | JGI24742J22300_100084412 | 96 |
| 218 | 3300003790 | Ga0055528_1035658 | Ga0055528_10356582 | 96 |
| 219 | 3300003792 | Ga0055540_1000040 | Ga0055540_1000040103 | 96 |
| 220 | 3300003792 | Ga0055540_1004993 | Ga0055540_10049936 | 96 |
| 221 | 3300003792 | Ga0055540_1024706 | Ga0055540_10247061 | 96 |
| 222 | 3300003792 | Ga0055540_1074105 | Ga0055540_10741052 | 96 |
| 223 | 3300005328 | Ga0070676_10028426 | Ga0070676_100284262 | 96 |
| 224 | 3300005328 | Ga0070676_11392526 | Ga0070676_113925262 | 96 |
| 225 | 3300005330 | Ga0070690_100007203 | Ga0070690_1000072033 | 96 |
| 226 | 3300005330 | Ga0070690_100730761 | Ga0070690_1007307612 | 96 |
| 227 | 3300005334 | Ga0068869_100030180 | Ga0068869_1000301806 | 96 |
| 228 | 3300005334 | Ga0068869_100267775 | Ga0068869_1002677751 | 96 |
| 229 | 3300005335 | Ga0070666_10034273 | Ga0070666_100342733 | 96 |
| 230 | 3300005337 | Ga0070682_100047266 | Ga0070682_1000472663 | 96 |
| 231 | 3300005337 | Ga0070682_100210413 | Ga0070682_1002104132 | 96 |
| 232 | 3300005337 | Ga0070682_100524732 | Ga0070682_1005247321 | 96 |
| 233 | 3300005338 | Ga0068868_100000203 | Ga0068868_10000020310 | 96 |
| 234 | 3300005338 | Ga0068868_100134492 | Ga0068868_1001344924 | 96 |
| 235 | 3300005338 | Ga0068868_100635871 | Ga0068868_1006358712 | 96 |
| 236 | 3300005339 | Ga0070660_100954421 | Ga0070660_1009544212 | 96 |
| 237 | 3300005339 | Ga0070660_101627547 | Ga0070660_1016275471 | 96 |
| 238 | 3300005340 | Ga0070689_100054776 | Ga0070689_1000547764 | 96 |
| 239 | 3300005340 | Ga0070689_101679834 | Ga0070689_1016798341 | 96 |
| 240 | 3300005341 | Ga0070691_10000914 | Ga0070691_100009143 | 96 |
| 241 | 3300005341 | Ga0070691_10134145 | Ga0070691_101341452 | 96 |
| 242 | 3300005343 | Ga0070687_100124024 | Ga0070687_1001240243 | 96 |
| 243 | 3300005345 | Ga0070692_10216409 | Ga0070692_102164093 | 96 |
| 244 | 3300005345 | Ga0070692_10229364 | Ga0070692_102293642 | 96 |
| 245 | 3300005345 | Ga0070692_10796338 | Ga0070692_107963382 | 96 |
| 246 | 3300005347 | Ga0070668_100015315 | Ga0070668_1000153152 | 96 |
| 247 | 3300005347 | Ga0070668_100269506 | Ga0070668_1002695062 | 96 |
| 248 | 3300005353 | Ga0070669_100000428 | Ga0070669_10000042830 | 96 |
| 249 | 3300005353 | Ga0070669_100005387 | Ga0070669_1000053876 | 96 |
| 250 | 3300005353 | Ga0070669_100211710 | Ga0070669_1002117102 | 96 |
| 251 | 3300005354 | Ga0070675_100745249 | Ga0070675_1007452491 | 96 |
| 252 | 3300005356 | Ga0070674_100000244 | Ga0070674_1000002447 | 96 |
| 253 | 3300005356 | Ga0070674_100626987 | Ga0070674_1006269871 | 96 |
| 254 | 3300005364 | Ga0070673_100304205 | Ga0070673_1003042051 | 96 |
| 255 | 3300005365 | Ga0070688_100002188 | Ga0070688_1000021883 | 96 |
| 256 | 3300005365 | Ga0070688_100026466 | Ga0070688_1000264662 | 96 |
| 257 | 3300005366 | Ga0070659_100100888 | Ga0070659_1001008882 | 96 |
| 258 | 3300005366 | Ga0070659_100636773 | Ga0070659_1006367731 | 96 |
| 259 | 3300005367 | Ga0070667_100000027 | Ga0070667_10000002740 | 96 |
| 260 | 3300005367 | Ga0070667_100004957 | Ga0070667_1000049577 | 96 |
| 261 | 3300005367 | Ga0070667_100016839 | Ga0070667_1000168393 | 96 |
| 262 | 3300005367 | Ga0070667_100123528 | Ga0070667_1001235284 | 96 |
| 263 | 3300005367 | Ga0070667_100446306 | Ga0070667_1004463062 | 96 |
| 264 | 3300005406 | Ga0070703_10038930 | Ga0070703_100389301 | 96 |
| 265 | 3300005434 | Ga0070709_10056739 | Ga0070709_100567393 | 96 |
| 266 | 3300005434 | Ga0070709_10060096 | Ga0070709_100600962 | 96 |
| 267 | 3300005435 | Ga0070714_100410244 | Ga0070714_1004102442 | 96 |
| 268 | 3300005435 | Ga0070714_100705152 | Ga0070714_1007051523 | 96 |
| 269 | 3300005435 | Ga0070714_101606357 | Ga0070714_1016063571 | 96 |
| 270 | 3300005437 | Ga0070710_10001501 | Ga0070710_100015018 | 96 |
| 271 | 3300005437 | Ga0070710_10014703 | Ga0070710_100147033 | 96 |
| 272 | 3300005438 | Ga0070701_10016528 | Ga0070701_100165283 | 96 |
| 273 | 3300005438 | Ga0070701_10394154 | Ga0070701_103941541 | 96 |
| 274 | 3300005439 | Ga0070711_100001734 | Ga0070711_1000017343 | 96 |
| 275 | 3300005439 | Ga0070711_100005574 | Ga0070711_1000055741 | 96 |
| 276 | 3300005440 | Ga0070705_100004544 | Ga0070705_1000045446 | 96 |
| 277 | 3300005440 | Ga0070705_100851348 | Ga0070705_1008513482 | 96 |
| 278 | 3300005441 | Ga0070700_100321132 | Ga0070700_1003211322 | 96 |
| 279 | 3300005444 | Ga0070694_100004367 | Ga0070694_1000043676 | 96 |
| 280 | 3300005444 | Ga0070694_100443404 | Ga0070694_1004434042 | 96 |
| 281 | 3300005455 | Ga0070663_100021341 | Ga0070663_1000213414 | 96 |
| 282 | 3300005455 | Ga0070663_100449770 | Ga0070663_1004497701 | 96 |
| 283 | 3300005455 | Ga0070663_101855550 | Ga0070663_1018555502 | 96 |
| 284 | 3300005456 | Ga0070678_100001046 | Ga0070678_1000010469 | 96 |
| 285 | 3300005456 | Ga0070678_100071210 | Ga0070678_1000712102 | 96 |
| 286 | 3300005457 | Ga0070662_100003739 | Ga0070662_1000037397 | 96 |
| 287 | 3300005457 | Ga0070662_100196172 | Ga0070662_1001961722 | 96 |
| 288 | 3300005459 | Ga0068867_100001211 | Ga0068867_10000121115 | 96 |
| 289 | 3300005459 | Ga0068867_101418114 | Ga0068867_1014181141 | 96 |
| 290 | 3300005459 | Ga0068867_102030788 | Ga0068867_1020307882 | 96 |
| 291 | 3300005466 | Ga0070685_10525354 | Ga0070685_105253542 | 96 |
| 292 | 3300005466 | Ga0070685_11002428 | Ga0070685_110024281 | 96 |
| 293 | 3300005539 | Ga0068853_100164539 | Ga0068853_1001645393 | 96 |
| 294 | 3300005539 | Ga0068853_100849565 | Ga0068853_1008495651 | 96 |
| 295 | 3300005543 | Ga0070672_100034746 | Ga0070672_1000347466 | 96 |
| 296 | 3300005543 | Ga0070672_100977005 | Ga0070672_1009770052 | 96 |
| 297 | 3300005544 | Ga0070686_100577112 | Ga0070686_1005771122 | 96 |
| 298 | 3300005545 | Ga0070695_100002690 | Ga0070695_10000269010 | 96 |
| 299 | 3300005545 | Ga0070695_100057660 | Ga0070695_1000576601 | 96 |
| 300 | 3300005546 | Ga0070696_100004046 | Ga0070696_1000040468 | 96 |
| 301 | 3300005547 | Ga0070693_100025200 | Ga0070693_1000252002 | 96 |
| 302 | 3300005547 | Ga0070693_101118011 | Ga0070693_1011180112 | 96 |
| 303 | 3300005548 | Ga0070665_100046895 | Ga0070665_1000468952 | 96 |
| 304 | 3300005548 | Ga0070665_100235874 | Ga0070665_1002358743 | 96 |
| 305 | 3300005548 | Ga0070665_100261070 | Ga0070665_1002610701 | 96 |
| 306 | 3300005549 | Ga0070704_100002696 | Ga0070704_1000026965 | 96 |
| 307 | 3300005549 | Ga0070704_100137889 | Ga0070704_1001378892 | 96 |
| 308 | 3300005563 | Ga0068855_100181957 | Ga0068855_1001819573 | 96 |
| 309 | 3300005563 | Ga0068855_100623678 | Ga0068855_1006236782 | 96 |
| 310 | 3300005563 | Ga0068855_101245011 | Ga0068855_1012450112 | 96 |
| 311 | 3300005578 | Ga0068854_100000262 | Ga0068854_1000002623 | 96 |
| 312 | 3300005578 | Ga0068854_100182885 | Ga0068854_1001828852 | 96 |
| 313 | 3300005614 | Ga0068856_100558649 | Ga0068856_1005586492 | 96 |
| 314 | 3300005616 | Ga0068852_100031689 | Ga0068852_1000316894 | 96 |
| 315 | 3300005617 | Ga0068859_100001466 | Ga0068859_10000146622 | 96 |
| 316 | 3300005617 | Ga0068859_100002266 | Ga0068859_10000226618 | 96 |
| 317 | 3300005617 | Ga0068859_100284757 | Ga0068859_1002847573 | 96 |
| 318 | 3300005618 | Ga0068864_100093654 | Ga0068864_1000936542 | 96 |
| 319 | 3300005718 | Ga0068866_10000681 | Ga0068866_1000068110 | 96 |
| 320 | 3300005718 | Ga0068866_10066644 | Ga0068866_100666443 | 96 |
| 321 | 3300005719 | Ga0068861_100013167 | Ga0068861_1000131677 | 96 |
| 322 | 3300005719 | Ga0068861_100161744 | Ga0068861_1001617442 | 96 |
| 323 | 3300005719 | Ga0068861_100179195 | Ga0068861_1001791952 | 96 |
| 324 | 3300005834 | Ga0068851_10581628 | Ga0068851_105816282 | 96 |
| 325 | 3300005840 | Ga0068870_10983223 | Ga0068870_109832232 | 96 |
| 326 | 3300005841 | Ga0068863_100006164 | Ga0068863_10000616411 | 96 |
| 327 | 3300005841 | Ga0068863_100950870 | Ga0068863_1009508703 | 96 |
| 328 | 3300005842 | Ga0068858_100001689 | Ga0068858_1000016893 | 96 |
| 329 | 3300005842 | Ga0068858_100096341 | Ga0068858_1000963413 | 96 |
| 330 | 3300005842 | Ga0068858_100126321 | Ga0068858_1001263212 | 96 |
| 331 | 3300005842 | Ga0068858_101816941 | Ga0068858_1018169411 | 96 |
| 332 | 3300005843 | Ga0068860_100000141 | Ga0068860_10000014140 | 96 |
| 333 | 3300005843 | Ga0068860_100001255 | Ga0068860_10000125521 | 96 |
| 334 | 3300005843 | Ga0068860_100149757 | Ga0068860_1001497573 | 96 |
| 335 | 3300005843 | Ga0068860_100197528 | Ga0068860_1001975282 | 96 |
| 336 | 3300005844 | Ga0068862_100000138 | Ga0068862_10000013844 | 96 |
| 337 | 3300005844 | Ga0068862_100001317 | Ga0068862_1000013174 | 96 |
| 338 | 3300005844 | Ga0068862_100316850 | Ga0068862_1003168502 | 96 |
| 339 | 3300005844 | Ga0068862_100746715 | Ga0068862_1007467152 | 96 |
| 340 | 3300006038 | Ga0075365_10018382 | Ga0075365_100183824 | 96 |
| 341 | 3300006038 | Ga0075365_10046531 | Ga0075365_100465315 | 96 |
| 342 | 3300006038 | Ga0075365_10286437 | Ga0075365_102864373 | 96 |
| 343 | 3300006038 | Ga0075365_10459401 | Ga0075365_104594012 | 96 |
| 344 | 3300006038 | Ga0075365_10949959 | Ga0075365_109499592 | 96 |
| 345 | 3300006038 | Ga0075365_11117835 | Ga0075365_111178351 | 96 |
| 346 | 3300006042 | Ga0075368_10018592 | Ga0075368_100185922 | 96 |
| 347 | 3300006048 | Ga0075363_100037020 | Ga0075363_1000370204 | 96 |
| 348 | 3300006048 | Ga0075363_100055671 | Ga0075363_1000556714 | 96 |
| 349 | 3300006048 | Ga0075363_100058629 | Ga0075363_1000586294 | 96 |
| 350 | 3300006048 | Ga0075363_100075522 | Ga0075363_1000755223 | 96 |
| 351 | 3300006048 | Ga0075363_100127918 | Ga0075363_1001279183 | 96 |
| 352 | 3300006048 | Ga0075363_100200914 | Ga0075363_1002009143 | 96 |
| 353 | 3300006048 | Ga0075363_100897896 | Ga0075363_1008978962 | 96 |
| 354 | 3300006051 | Ga0075364_10026321 | Ga0075364_100263216 | 96 |
| 355 | 3300006051 | Ga0075364_10038846 | Ga0075364_100388464 | 96 |
| 356 | 3300006051 | Ga0075364_10068636 | Ga0075364_100686364 | 96 |
| 357 | 3300006051 | Ga0075364_10078677 | Ga0075364_100786773 | 96 |
| 358 | 3300006051 | Ga0075364_10091412 | Ga0075364_100914122 | 96 |
| 359 | 3300006051 | Ga0075364_10103821 | Ga0075364_101038213 | 96 |
| 360 | 3300006051 | Ga0075364_10176423 | Ga0075364_101764234 | 96 |
| 361 | 3300006051 | Ga0075364_10437265 | Ga0075364_104372652 | 96 |
| 362 | 3300006051 | Ga0075364_10448407 | Ga0075364_104484072 | 96 |
| 363 | 3300006051 | Ga0075364_11065817 | Ga0075364_110658172 | 96 |
| 364 | 3300006058 | Ga0075432_10303066 | Ga0075432_103030662 | 96 |
| 365 | 3300006163 | Ga0070715_10002294 | Ga0070715_100022942 | 96 |
| 366 | 3300006163 | Ga0070715_10416240 | Ga0070715_104162402 | 96 |
| 367 | 3300006173 | Ga0070716_100001813 | Ga0070716_10000181310 | 96 |
| 368 | 3300006175 | Ga0070712_100001225 | Ga0070712_1000012251 | 96 |
| 369 | 3300006175 | Ga0070712_100004149 | Ga0070712_1000041498 | 96 |
| 370 | 3300006177 | Ga0075362_10008854 | Ga0075362_100088543 | 96 |
| 371 | 3300006177 | Ga0075362_10058899 | Ga0075362_100588993 | 96 |
| 372 | 3300006178 | Ga0075367_10049248 | Ga0075367_100492483 | 96 |
| 373 | 3300006178 | Ga0075367_10226510 | Ga0075367_102265103 | 96 |
| 374 | 3300006178 | Ga0075367_10530305 | Ga0075367_105303052 | 96 |
| 375 | 3300006186 | Ga0075369_10125352 | Ga0075369_101253522 | 96 |
| 376 | 3300006186 | Ga0075369_10142413 | Ga0075369_101424132 | 96 |
| 377 | 3300006186 | Ga0075369_10218259 | Ga0075369_102182592 | 96 |
| 378 | 3300006186 | Ga0075369_10268637 | Ga0075369_102686372 | 96 |
| 379 | 3300006186 | Ga0075369_10546101 | Ga0075369_105461012 | 96 |
| 380 | 3300006195 | Ga0075366_10147922 | Ga0075366_101479221 | 96 |
| 381 | 3300006237 | Ga0097621_100763541 | Ga0097621_1007635412 | 96 |
| 382 | 3300006353 | Ga0075370_10010995 | Ga0075370_100109953 | 96 |
| 383 | 3300006353 | Ga0075370_10049938 | Ga0075370_100499384 | 96 |
| 384 | 3300006353 | Ga0075370_10056762 | Ga0075370_100567623 | 96 |
| 385 | 3300006353 | Ga0075370_10065681 | Ga0075370_100656813 | 96 |
| 386 | 3300006353 | Ga0075370_10080869 | Ga0075370_100808693 | 96 |
| 387 | 3300006353 | Ga0075370_10362970 | Ga0075370_103629703 | 96 |
| 388 | 3300006353 | Ga0075370_10675245 | Ga0075370_106752452 | 96 |
| 389 | 3300006358 | Ga0068871_100857918 | Ga0068871_1008579182 | 96 |
| 390 | 3300006358 | Ga0068871_101336655 | Ga0068871_1013366553 | 96 |
| 391 | 3300006844 | Ga0075428_100000939 | Ga0075428_10000093925 | 96 |
| 392 | 3300006846 | Ga0075430_100080000 | Ga0075430_1000800004 | 96 |
| 393 | 3300006847 | Ga0075431_100021617 | Ga0075431_1000216175 | 96 |
| 394 | 3300006871 | Ga0075434_101693453 | Ga0075434_1016934532 | 96 |
| 395 | 3300006881 | Ga0068865_100004351 | Ga0068865_1000043519 | 96 |
| 396 | 3300006881 | Ga0068865_100093332 | Ga0068865_1000933324 | 96 |
| 397 | 3300006931 | Ga0097620_100001464 | Ga0097620_1000014644 | 96 |
| 398 | 3300006931 | Ga0097620_100002267 | Ga0097620_1000022673 | 96 |
| 399 | 3300006931 | Ga0097620_100284752 | Ga0097620_1002847523 | 96 |
| 400 | 3300009092 | Ga0105250_10063025 | Ga0105250_100630253 | 96 |
| 401 | 3300009093 | Ga0105240_11204609 | Ga0105240_112046091 | 96 |
| 402 | 3300009094 | Ga0111539_13346294 | Ga0111539_133462942 | 96 |
| 403 | 3300009098 | Ga0105245_10007730 | Ga0105245_100077306 | 96 |
| 404 | 3300009098 | Ga0105245_10674331 | Ga0105245_106743312 | 96 |
| 405 | 3300009101 | Ga0105247_10000237 | Ga0105247_1000023724 | 96 |
| 406 | 3300009101 | Ga0105247_10000372 | Ga0105247_100003724 | 96 |
| 407 | 3300009101 | Ga0105247_10066172 | Ga0105247_100661722 | 96 |
| 408 | 3300009101 | Ga0105247_10414385 | Ga0105247_104143851 | 96 |
| 409 | 3300009147 | Ga0114129_10048020 | Ga0114129_100480206 | 96 |
| 410 | 3300009147 | Ga0114129_12826612 | Ga0114129_128266121 | 96 |
| 411 | 3300009148 | Ga0105243_10000676 | Ga0105243_100006766 | 96 |
| 412 | 3300009174 | Ga0105241_10007378 | Ga0105241_100073789 | 96 |
| 413 | 3300009174 | Ga0105241_10149237 | Ga0105241_101492372 | 96 |
| 414 | 3300009176 | Ga0105242_10000197 | Ga0105242_1000019718 | 96 |
| 415 | 3300009176 | Ga0105242_10499514 | Ga0105242_104995142 | 96 |
| 416 | 3300009176 | Ga0105242_11927092 | Ga0105242_119270922 | 96 |
| 417 | 3300009177 | Ga0105248_10000337 | Ga0105248_1000033717 | 96 |
| 418 | 3300009177 | Ga0105248_10056212 | Ga0105248_100562124 | 96 |
| 419 | 3300009177 | Ga0105248_10898500 | Ga0105248_108985002 | 96 |
| 420 | 3300009177 | Ga0105248_11640690 | Ga0105248_116406902 | 96 |
| 421 | 3300009545 | Ga0105237_10005565 | Ga0105237_1000556511 | 96 |
| 422 | 3300009545 | Ga0105237_10015368 | Ga0105237_100153689 | 96 |
| 423 | 3300009545 | Ga0105237_10085017 | Ga0105237_100850173 | 96 |
| 424 | 3300009545 | Ga0105237_10689298 | Ga0105237_106892984 | 96 |
| 425 | 3300009545 | Ga0105237_11484663 | Ga0105237_114846633 | 96 |
| 426 | 3300009551 | Ga0105238_10086299 | Ga0105238_100862993 | 96 |
| 427 | 3300009551 | Ga0105238_11043982 | Ga0105238_110439821 | 96 |
| 428 | 3300009553 | Ga0105249_10000013 | Ga0105249_1000001339 | 96 |
| 429 | 3300009553 | Ga0105249_10004426 | Ga0105249_100044268 | 96 |
| 430 | 3300009553 | Ga0105249_10543436 | Ga0105249_105434364 | 96 |
| 431 | 3300010375 | Ga0105239_10029337 | Ga0105239_100293375 | 96 |
| 432 | 3300010375 | Ga0105239_10032396 | Ga0105239_100323966 | 96 |
| 433 | 3300010375 | Ga0105239_10145014 | Ga0105239_101450143 | 96 |
| 434 | 3300010375 | Ga0105239_10690655 | Ga0105239_106906553 | 96 |
| 435 | 3300010375 | Ga0105239_10788219 | Ga0105239_107882192 | 96 |
| 436 | 3300010375 | Ga0105239_10996822 | Ga0105239_109968223 | 96 |
| 437 | 3300011119 | Ga0105246_10244744 | Ga0105246_102447442 | 96 |
| 438 | 3300011119 | Ga0105246_10667441 | Ga0105246_106674412 | 96 |
| 439 | 3300012507 | Ga0157342_1068323 | Ga0157342_10683232 | 96 |
| 440 | 3300013102 | Ga0157371_10312162 | Ga0157371_103121622 | 96 |
| 441 | 3300013102 | Ga0157371_11224263 | Ga0157371_112242632 | 96 |
| 442 | 3300013105 | Ga0157369_10384304 | Ga0157369_103843044 | 96 |
| 443 | 3300013105 | Ga0157369_10631717 | Ga0157369_106317172 | 96 |
| 444 | 3300013296 | Ga0157374_10391860 | Ga0157374_103918601 | 96 |
| 445 | 3300013296 | Ga0157374_10694656 | Ga0157374_106946561 | 96 |
| 446 | 3300013297 | Ga0157378_10002889 | Ga0157378_100028896 | 96 |
| 447 | 3300013297 | Ga0157378_10036468 | Ga0157378_100364683 | 96 |
| 448 | 3300013306 | Ga0163162_10002808 | Ga0163162_100028083 | 96 |
| 449 | 3300013306 | Ga0163162_10091073 | Ga0163162_100910732 | 96 |
| 450 | 3300013306 | Ga0163162_12823541 | Ga0163162_128235412 | 96 |
| 451 | 3300013307 | Ga0157372_10006319 | Ga0157372_100063198 | 96 |
| 452 | 3300013307 | Ga0157372_10149591 | Ga0157372_101495914 | 96 |
| 453 | 3300013308 | Ga0157375_10017320 | Ga0157375_100173203 | 96 |
| 454 | 3300013308 | Ga0157375_10225018 | Ga0157375_102250184 | 96 |
| 455 | 3300013308 | Ga0157375_10769970 | Ga0157375_107699702 | 96 |
| 456 | 3300013308 | Ga0157375_10786964 | Ga0157375_107869642 | 96 |
| 457 | 3300013308 | Ga0157375_11157478 | Ga0157375_111574782 | 96 |
| 458 | 3300014325 | Ga0163163_10058326 | Ga0163163_100583265 | 96 |
| 459 | 3300014325 | Ga0163163_10423346 | Ga0163163_104233462 | 96 |
| 460 | 3300014326 | Ga0157380_10000136 | Ga0157380_100001369 | 96 |
| 461 | 3300014326 | Ga0157380_10249743 | Ga0157380_102497432 | 96 |
| 462 | 3300014745 | Ga0157377_10175419 | Ga0157377_101754194 | 96 |
| 463 | 3300014968 | Ga0157379_10038088 | Ga0157379_100380885 | 96 |
| 464 | 3300014968 | Ga0157379_10070088 | Ga0157379_100700886 | 96 |
| 465 | 3300014968 | Ga0157379_10130207 | Ga0157379_101302073 | 96 |
| 466 | 3300014969 | Ga0157376_10399308 | Ga0157376_103993082 | 96 |
| 467 | 3300014969 | Ga0157376_10444398 | Ga0157376_104443982 | 96 |
| 468 | 3300017792 | Ga0163161_10014033 | Ga0163161_100140332 | 96 |
| 469 | 3300017792 | Ga0163161_10083548 | Ga0163161_100835483 | 96 |
| 470 | 3300025273 | Ga0209673_1028999 | Ga0209673_10289993 | 96 |
| 471 | 3300025303 | Ga0209051_1000107 | Ga0209051_1000107103 | 96 |
| 472 | 3300025303 | Ga0209051_1000122 | Ga0209051_1000122126 | 96 |
| 473 | 3300025303 | Ga0209051_1001174 | Ga0209051_100117412 | 96 |
| 474 | 3300025303 | Ga0209051_1001471 | Ga0209051_10014716 | 96 |
| 475 | 3300025885 | Ga0207653_10243734 | Ga0207653_102437342 | 96 |
| 476 | 3300025898 | Ga0207692_10001286 | Ga0207692_100012867 | 96 |
| 477 | 3300025898 | Ga0207692_10014299 | Ga0207692_100142994 | 96 |
| 478 | 3300025898 | Ga0207692_10283322 | Ga0207692_102833222 | 96 |
| 479 | 3300025899 | Ga0207642_10001214 | Ga0207642_100012146 | 96 |
| 480 | 3300025900 | Ga0207710_10000213 | Ga0207710_1000021329 | 96 |
| 481 | 3300025900 | Ga0207710_10008148 | Ga0207710_100081481 | 96 |
| 482 | 3300025900 | Ga0207710_10676890 | Ga0207710_106768901 | 96 |
| 483 | 3300025901 | Ga0207688_10003068 | Ga0207688_100030686 | 96 |
| 484 | 3300025901 | Ga0207688_10005491 | Ga0207688_100054913 | 96 |
| 485 | 3300025903 | Ga0207680_10072589 | Ga0207680_100725892 | 96 |
| 486 | 3300025903 | Ga0207680_10138610 | Ga0207680_101386104 | 96 |
| 487 | 3300025905 | Ga0207685_10199934 | Ga0207685_101999341 | 96 |
| 488 | 3300025905 | Ga0207685_10218094 | Ga0207685_102180941 | 96 |
| 489 | 3300025906 | Ga0207699_10060695 | Ga0207699_100606952 | 96 |
| 490 | 3300025906 | Ga0207699_10417116 | Ga0207699_104171162 | 96 |
| 491 | 3300025906 | Ga0207699_11478221 | Ga0207699_114782211 | 96 |
| 492 | 3300025907 | Ga0207645_10004061 | Ga0207645_100040618 | 96 |
| 493 | 3300025908 | Ga0207643_10487409 | Ga0207643_104874091 | 96 |
| 494 | 3300025911 | Ga0207654_10077866 | Ga0207654_100778663 | 96 |
| 495 | 3300025911 | Ga0207654_10233114 | Ga0207654_102331142 | 96 |
| 496 | 3300025914 | Ga0207671_10014745 | Ga0207671_100147453 | 96 |
| 497 | 3300025914 | Ga0207671_10021340 | Ga0207671_100213406 | 96 |
| 498 | 3300025914 | Ga0207671_10031936 | Ga0207671_100319363 | 96 |
| 499 | 3300025915 | Ga0207693_10000507 | Ga0207693_100005076 | 96 |
| 500 | 3300025915 | Ga0207693_10003394 | Ga0207693_100033947 | 96 |
| 501 | 3300025916 | Ga0207663_10005170 | Ga0207663_100051708 | 96 |
| 502 | 3300025918 | Ga0207662_10226473 | Ga0207662_102264732 | 96 |
| 503 | 3300025919 | Ga0207657_10023320 | Ga0207657_100233203 | 96 |
| 504 | 3300025919 | Ga0207657_10102233 | Ga0207657_101022334 | 96 |
| 505 | 3300025921 | Ga0207652_11251564 | Ga0207652_112515642 | 96 |
| 506 | 3300025922 | Ga0207646_10399719 | Ga0207646_103997194 | 96 |
| 507 | 3300025923 | Ga0207681_10000866 | Ga0207681_1000086620 | 96 |
| 508 | 3300025923 | Ga0207681_10042605 | Ga0207681_100426051 | 96 |
| 509 | 3300025923 | Ga0207681_10130610 | Ga0207681_101306103 | 96 |
| 510 | 3300025924 | Ga0207694_10837086 | Ga0207694_108370862 | 96 |
| 511 | 3300025926 | Ga0207659_10426038 | Ga0207659_104260382 | 96 |
| 512 | 3300025927 | Ga0207687_10009541 | Ga0207687_100095414 | 96 |
| 513 | 3300025927 | Ga0207687_10013417 | Ga0207687_100134177 | 96 |
| 514 | 3300025929 | Ga0207664_10396737 | Ga0207664_103967372 | 96 |
| 515 | 3300025929 | Ga0207664_10427349 | Ga0207664_104273492 | 96 |
| 516 | 3300025931 | Ga0207644_10266659 | Ga0207644_102666592 | 96 |
| 517 | 3300025931 | Ga0207644_11423607 | Ga0207644_114236072 | 96 |
| 518 | 3300025932 | Ga0207690_10132747 | Ga0207690_101327472 | 96 |
| 519 | 3300025932 | Ga0207690_11020278 | Ga0207690_110202781 | 96 |
| 520 | 3300025933 | Ga0207706_10001533 | Ga0207706_1000153321 | 96 |
| 521 | 3300025934 | Ga0207686_10001322 | Ga0207686_100013225 | 96 |
| 522 | 3300025935 | Ga0207709_10085607 | Ga0207709_100856071 | 96 |
| 523 | 3300025935 | Ga0207709_10412239 | Ga0207709_104122392 | 96 |
| 524 | 3300025936 | Ga0207670_10104442 | Ga0207670_101044422 | 96 |
| 525 | 3300025936 | Ga0207670_11936265 | Ga0207670_119362651 | 96 |
| 526 | 3300025937 | Ga0207669_10001482 | Ga0207669_100014827 | 96 |
| 527 | 3300025938 | Ga0207704_10000458 | Ga0207704_100004588 | 96 |
| 528 | 3300025939 | Ga0207665_10005493 | Ga0207665_100054939 | 96 |
| 529 | 3300025939 | Ga0207665_10015885 | Ga0207665_100158852 | 96 |
| 530 | 3300025939 | Ga0207665_10901349 | Ga0207665_109013491 | 96 |
| 531 | 3300025940 | Ga0207691_10391942 | Ga0207691_103919422 | 96 |
| 532 | 3300025940 | Ga0207691_10440882 | Ga0207691_104408822 | 96 |
| 533 | 3300025941 | Ga0207711_10000753 | Ga0207711_1000075317 | 96 |
| 534 | 3300025941 | Ga0207711_10020273 | Ga0207711_100202735 | 96 |
| 535 | 3300025941 | Ga0207711_10374239 | Ga0207711_103742393 | 96 |
| 536 | 3300025941 | Ga0207711_11023253 | Ga0207711_110232532 | 96 |
| 537 | 3300025942 | Ga0207689_10012131 | Ga0207689_100121319 | 96 |
| 538 | 3300025942 | Ga0207689_10055897 | Ga0207689_100558975 | 96 |
| 539 | 3300025949 | Ga0207667_10319758 | Ga0207667_103197583 | 96 |
| 540 | 3300025949 | Ga0207667_10634600 | Ga0207667_106346002 | 96 |
| 541 | 3300025960 | Ga0207651_11705602 | Ga0207651_117056022 | 96 |
| 542 | 3300025961 | Ga0207712_10000018 | Ga0207712_10000018253 | 96 |
| 543 | 3300025961 | Ga0207712_10130790 | Ga0207712_101307902 | 96 |
| 544 | 3300025961 | Ga0207712_10313007 | Ga0207712_103130074 | 96 |
| 545 | 3300025972 | Ga0207668_10723113 | Ga0207668_107231132 | 96 |
| 546 | 3300025981 | Ga0207640_10049671 | Ga0207640_100496711 | 96 |
| 547 | 3300025981 | Ga0207640_10121950 | Ga0207640_101219504 | 96 |
| 548 | 3300025986 | Ga0207658_10000383 | Ga0207658_1000038340 | 96 |
| 549 | 3300025986 | Ga0207658_10010991 | Ga0207658_100109916 | 96 |
| 550 | 3300025986 | Ga0207658_10011237 | Ga0207658_100112376 | 96 |
| 551 | 3300025986 | Ga0207658_10890683 | Ga0207658_108906833 | 96 |
| 552 | 3300025986 | Ga0207658_10971359 | Ga0207658_109713592 | 96 |
| 553 | 3300026023 | Ga0207677_10002864 | Ga0207677_100028647 | 96 |
| 554 | 3300026023 | Ga0207677_10364941 | Ga0207677_103649414 | 96 |
| 555 | 3300026023 | Ga0207677_10622158 | Ga0207677_106221582 | 96 |
| 556 | 3300026035 | Ga0207703_10000920 | Ga0207703_100009206 | 96 |
| 557 | 3300026035 | Ga0207703_10013422 | Ga0207703_100134229 | 96 |
| 558 | 3300026035 | Ga0207703_10259384 | Ga0207703_102593843 | 96 |
| 559 | 3300026041 | Ga0207639_10005136 | Ga0207639_100051366 | 96 |
| 560 | 3300026041 | Ga0207639_10973174 | Ga0207639_109731741 | 96 |
| 561 | 3300026067 | Ga0207678_10003253 | Ga0207678_100032535 | 96 |
| 562 | 3300026067 | Ga0207678_10015024 | Ga0207678_100150249 | 96 |
| 563 | 3300026078 | Ga0207702_10267532 | Ga0207702_102675322 | 96 |
| 564 | 3300026088 | Ga0207641_10002928 | Ga0207641_1000292814 | 96 |
| 565 | 3300026089 | Ga0207648_10021128 | Ga0207648_100211288 | 96 |
| 566 | 3300026089 | Ga0207648_10028299 | Ga0207648_100282997 | 96 |
| 567 | 3300026095 | Ga0207676_10070294 | Ga0207676_100702941 | 96 |
| 568 | 3300026095 | Ga0207676_10188226 | Ga0207676_101882262 | 96 |
| 569 | 3300026095 | Ga0207676_11258609 | Ga0207676_112586092 | 96 |
| 570 | 3300026118 | Ga0207675_100000544 | Ga0207675_10000054435 | 96 |
| 571 | 3300026118 | Ga0207675_100015163 | Ga0207675_1000151636 | 96 |
| 572 | 3300026118 | Ga0207675_100172690 | Ga0207675_1001726904 | 96 |
| 573 | 3300026118 | Ga0207675_101833233 | Ga0207675_1018332331 | 96 |
| 574 | 3300026121 | Ga0207683_10000335 | Ga0207683_1000033536 | 96 |
| 575 | 3300026121 | Ga0207683_10057779 | Ga0207683_100577795 | 96 |
| 576 | 3300026121 | Ga0207683_12012714 | Ga0207683_120127141 | 96 |
| 577 | 3300026142 | Ga0207698_10138786 | Ga0207698_101387864 | 96 |
| 578 | 3300026142 | Ga0207698_10229905 | Ga0207698_102299054 | 96 |
| 579 | 3300027907 | Ga0207428_10533328 | Ga0207428_105333281 | 96 |
| 580 | 3300028379 | Ga0268266_10032648 | Ga0268266_100326486 | 96 |
| 581 | 3300028379 | Ga0268266_10190460 | Ga0268266_101904601 | 96 |
| 582 | 3300028379 | Ga0268266_10590424 | Ga0268266_105904242 | 96 |
| 583 | 3300028379 | Ga0268266_12060892 | Ga0268266_120608922 | 96 |
| 584 | 3300028380 | Ga0268265_10000159 | Ga0268265_1000015936 | 96 |
| 585 | 3300028380 | Ga0268265_10044071 | Ga0268265_100440716 | 96 |
| 586 | 3300028380 | Ga0268265_10194523 | Ga0268265_101945234 | 96 |
| 587 | 3300028380 | Ga0268265_10756464 | Ga0268265_107564641 | 96 |
| 588 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005851 | 96 |
| 589 | 3300028381 | Ga0268264_10001041 | Ga0268264_1000104121 | 96 |
| 590 | 3300028381 | Ga0268264_10294371 | Ga0268264_102943712 | 96 |
| 591 | 3300028381 | Ga0268264_10511651 | Ga0268264_105116513 | 96 |
| 592 | 3300031251 | Ga0265327_10004280 | Ga0265327_1000428010 | 96 |
| 593 | 3300031456 | Ga0307513_10743679 | Ga0307513_107436792 | 96 |
| 594 | 3300031548 | Ga0307408_100762940 | Ga0307408_1007629401 | 96 |
| 595 | 3300031824 | Ga0307413_10115722 | Ga0307413_101157223 | 96 |
| 596 | 3300031824 | Ga0307413_10377010 | Ga0307413_103770102 | 96 |
| 597 | 3300031824 | Ga0307413_10500894 | Ga0307413_105008943 | 96 |
| 598 | 3300031852 | Ga0307410_10015784 | Ga0307410_100157844 | 96 |
| 599 | 3300031852 | Ga0307410_11122565 | Ga0307410_111225652 | 96 |
| 600 | 3300031901 | Ga0307406_10048745 | Ga0307406_100487453 | 96 |
| 601 | 3300031901 | Ga0307406_10539594 | Ga0307406_105395941 | 96 |
| 602 | 3300031911 | Ga0307412_10041003 | Ga0307412_100410034 | 96 |
| 603 | 3300031995 | Ga0307409_100000649 | Ga0307409_1000006492 | 96 |
| 604 | 3300031995 | Ga0307409_101232462 | Ga0307409_1012324622 | 96 |
| 605 | 3300032002 | Ga0307416_100002172 | Ga0307416_1000021728 | 96 |
| 606 | 3300032002 | Ga0307416_101879339 | Ga0307416_1018793392 | 96 |
| 607 | 3300032005 | Ga0307411_10124695 | Ga0307411_101246952 | 96 |
| 608 | 3300032005 | Ga0307411_10216432 | Ga0307411_102164322 | 96 |
| 609 | 3300032126 | Ga0307415_100043135 | Ga0307415_1000431354 | 96 |
| 610 | 3300035090 | Ga0373949_0138647 | Ga0373949_0138647_164_460 | 96 |
| 611 | 3300035091 | Ga0373951_0102485 | Ga0373951_0102485_49_345 | 96 |
| 612 | 3300035242 | Ga0373962_0048327 | Ga0373962_0048327_624_920 | 96 |
| 613 | 3300035691 | Ga0373931_0042807 | Ga0373931_0042807_910_1206 | 96 |
| 614 | 3300035691 | Ga0373931_0276572 | Ga0373931_0276572_721_1017 | 96 |
| 615 | 3300039437 | Ga0436365_1279297 | Ga0436365_1279297_224_526 | 96 |
| 616 | 3300039450 | Ga0436363_0907136 | Ga0436363_0907136_152_454 | 96 |
| 617 | 3300039450 | Ga0436363_1032215 | Ga0436363_1032215_607_915 | 96 |
| 618 | 3300041410 | Ga0439461_0017272 | Ga0439461_0017272_433_729 | 96 |
| 619 | 3300041410 | Ga0439461_0164438 | Ga0439461_0164438_117_422 | 96 |
| 620 | 3300041411 | Ga0439466_0003336 | Ga0439466_0003336_1841_2137 | 96 |
| 621 | 3300041411 | Ga0439466_0005429 | Ga0439466_0005429_2388_2690 | 96 |
| 622 | 3300041413 | Ga0439465_0002390 | Ga0439465_0002390_3746_4042 | 96 |
| 623 | 3300041443 | Ga0451789_0678462 | Ga0451789_0678462_44_355 | 96 |
| 624 | 3300041443 | Ga0451789_0888216 | Ga0451789_0888216_779_1075 | 96 |
| 625 | 3300041446 | Ga0451794_05147 | Ga0451794_05147_143_454 | 96 |
| 626 | 3300041452 | Ga0451793_0184391 | Ga0451793_0184391_1551_1862 | 96 |
| 627 | 3300041453 | Ga0451797_1156091 | Ga0451797_1156091_41_352 | 96 |
| 628 | 3300041460 | Ga0451802_1339380 | Ga0451802_1339380_426_737 | 96 |
| 629 | 3300041460 | Ga0451802_1992298 | Ga0451802_1992298_290_601 | 96 |
| 630 | 3300041486 | Ga0451807_1241670 | Ga0451807_1241670_142_453 | 96 |
| 631 | 3300041498 | Ga0451841_0303713 | Ga0451841_0303713_198_512 | 96 |
| 632 | 3300041498 | Ga0451841_1061137 | Ga0451841_1061137_889_1200 | 96 |
| 633 | 3300041503 | Ga0451847_0576711 | Ga0451847_0576711_399_710 | 96 |
| 634 | 3300041509 | Ga0451843_0772406 | Ga0451843_0772406_359_670 | 96 |
| 635 | 3300041512 | Ga0451853_1496362 | Ga0451853_1496362_64_375 | 96 |
| 636 | 3300041997 | Ga0439431_0000416 | Ga0439431_0000416_4453_4755 | 96 |
| 637 | 3300041997 | Ga0439431_0066392 | Ga0439431_0066392_122_418 | 96 |
| 638 | 3300042002 | Ga0439442_034471 | Ga0439442_034471_236_532 | 96 |
| 639 | 3300042004 | Ga0439445_0001277 | Ga0439445_0001277_1294_1596 | 96 |
| 640 | 3300042004 | Ga0439445_0009255 | Ga0439445_0009255_1694_1990 | 96 |
| 641 | 3300042008 | Ga0439450_151198 | Ga0439450_151198_88_384 | 96 |
| 642 | 3300042435 | Ga0439434_0001827 | Ga0439434_0001827_3819_4121 | 96 |
| 643 | 3300042435 | Ga0439434_0002991 | Ga0439434_0002991_3971_4267 | 96 |
| 644 | 3300044658 | Ga0466972_0014330 | Ga0466972_0014330_166_468 | 96 |
| 645 | 3300044658 | Ga0466972_0120226 | Ga0466972_0120226_819_1115 | 96 |
| 646 | 3300044683 | Ga0466965_0002913 | Ga0466965_0002913_3972_4283 | 96 |
| 647 | 3300044683 | Ga0466965_0029923 | Ga0466965_0029923_1473_1775 | 96 |
| 648 | 3300044683 | Ga0466965_0083523 | Ga0466965_0083523_1117_1419 | 96 |
| 649 | 3300044683 | Ga0466965_0102931 | Ga0466965_0102931_976_1287 | 96 |
| 650 | 3300044683 | Ga0466965_0235939 | Ga0466965_0235939_646_945 | 96 |
| 651 | 3300044683 | Ga0466965_0248482 | Ga0466965_0248482_415_717 | 96 |
| 652 | 3300044693 | Ga0466961_0074698 | Ga0466961_0074698_1408_1710 | 96 |
| 653 | 3300044694 | Ga0466963_0228127 | Ga0466963_0228127_514_807 | 96 |
| 654 | 3300044706 | Ga0466964_0190974 | Ga0466964_0190974_345_647 | 96 |
| 655 | 3300044719 | Ga0466971_0092650 | Ga0466971_0092650_319_621 | 96 |
| 656 | 3300044735 | Ga0466968_0004772 | Ga0466968_0004772_2160_2471 | 96 |
| 657 | 3300044735 | Ga0466968_0048793 | Ga0466968_0048793_340_636 | 96 |
| 658 | 3300044765 | Ga0466970_0021122 | Ga0466970_0021122_3003_3314 | 96 |
| 659 | 3300044765 | Ga0466970_0223349 | Ga0466970_0223349_160_462 | 96 |
| 660 | 3300044765 | Ga0466970_0379278 | Ga0466970_0379278_469_765 | 96 |
| 661 | 3300044842 | Ga0466957_0292223 | Ga0466957_0292223_247_579 | 96 |
| 662 | 3300044842 | Ga0466957_0311111 | Ga0466957_0311111_675_986 | 96 |
| 663 | 3300044901 | Ga0466960_0006575 | Ga0466960_0006575_3053_3364 | 96 |
| 664 | 3300044901 | Ga0466960_0282784 | Ga0466960_0282784_443_739 | 96 |
| 665 | 3300045049 | Ga0466959_0030872 | Ga0466959_0030872_2219_2521 | 96 |
| 666 | 3300045049 | Ga0466959_0124827 | Ga0466959_0124827_65_376 | 96 |
| 667 | 3300045836 | Ga0466958_0079095 | Ga0466958_0079095_594_896 | 96 |
| 668 | 3300045976 | Ga0466967_0006912 | Ga0466967_0006912_4540_4851 | 96 |
| 669 | 3300045976 | Ga0466967_0032235 | Ga0466967_0032235_3096_3407 | 96 |
| 670 | 3300045976 | Ga0466967_0167085 | Ga0466967_0167085_899_1234 | 96 |
| 671 | 3300045976 | Ga0466967_0176662 | Ga0466967_0176662_153_452 | 96 |
| 672 | 3300045976 | Ga0466967_0304473 | Ga0466967_0304473_21_314 | 96 |
| 673 | 3300045976 | Ga0466967_1395681 | Ga0466967_1395681_80_376 | 96 |
| 674 | 3300046500 | Ga0495596_0426665 | Ga0495596_0426665_22_342 | 96 |
| 675 | 3300046507 | Ga0495606_0027477 | Ga0495606_0027477_1545_1856 | 96 |
| 676 | 3300046524 | Ga0495648_0006968 | Ga0495648_0006968_3499_3810 | 96 |
| 677 | 3300046530 | Ga0495654_0076250 | Ga0495654_0076250_112_423 | 96 |
| 678 | 3300046648 | Ga0495611_0057947 | Ga0495611_0057947_628_939 | 96 |
| 679 | 3300047320 | Ga0495672_0000892 | Ga0495672_0000892_6672_6983 | 96 |
| 680 | 3300047469 | Ga0495673_0002880 | Ga0495673_0002880_5200_5511 | 96 |
| 681 | 3300047472 | Ga0495686_0139406 | Ga0495686_0139406_51_362 | 96 |
| 682 | 3300048903 | Ga0496100_0000033 | Ga0496100_0000033_63073_63384 | 96 |
| 683 | 3300048903 | Ga0496100_0000307 | Ga0496100_0000307_21207_21518 | 96 |
| 684 | 3300048903 | Ga0496100_0000383 | Ga0496100_0000383_18750_19046 | 96 |
| 685 | 3300048903 | Ga0496100_0025799 | Ga0496100_0025799_188_496 | 96 |
| 686 | 3300048904 | Ga0496101_0000008 | Ga0496101_0000008_67680_67991 | 96 |
| 687 | 3300048904 | Ga0496101_0000033 | Ga0496101_0000033_145116_145427 | 96 |
| 688 | 3300048904 | Ga0496101_0003204 | Ga0496101_0003204_4625_4921 | 96 |
| 689 | 3300048904 | Ga0496101_0431825 | Ga0496101_0431825_517_825 | 96 |
| 690 | 3300048905 | Ga0496102_0000005 | Ga0496102_0000005_217762_218073 | 96 |
| 691 | 3300048905 | Ga0496102_0000257 | Ga0496102_0000257_41859_42167 | 96 |
| 692 | 3300048905 | Ga0496102_0004668 | Ga0496102_0004668_4300_4596 | 96 |
| 693 | 3300048905 | Ga0496102_0154202 | Ga0496102_0154202_1545_1841 | 96 |
| 694 | 3300048905 | Ga0496102_0495546 | Ga0496102_0495546_92_388 | 96 |
| 695 | 3300048906 | Ga0496103_0000002 | Ga0496103_0000002_263895_264206 | 96 |
| 696 | 3300048906 | Ga0496103_0000393 | Ga0496103_0000393_23684_23995 | 96 |
| 697 | 3300048906 | Ga0496103_0000540 | Ga0496103_0000540_1417_1725 | 96 |
| 698 | 3300048906 | Ga0496103_0002854 | Ga0496103_0002854_10135_10431 | 96 |
| 699 | 3300048906 | Ga0496103_0374717 | Ga0496103_0374717_349_645 | 96 |
| 700 | 3300048906 | Ga0496103_0512000 | Ga0496103_0512000_385_681 | 96 |
| 701 | 3300048907 | Ga0496104_0229871 | Ga0496104_0229871_999_1295 | 96 |
| 702 | 3300048908 | Ga0496105_0484214 | Ga0496105_0484214_250_546 | 96 |
| 703 | 3300048908 | Ga0496105_0758351 | Ga0496105_0758351_337_648 | 96 |
| 704 | 3300048909 | Ga0496106_0000615 | Ga0496106_0000615_20177_20473 | 96 |
| 705 | 3300048909 | Ga0496106_0000777 | Ga0496106_0000777_21124_21435 | 96 |
| 706 | 3300048909 | Ga0496106_0012783 | Ga0496106_0012783_3966_4262 | 96 |
| 707 | 3300048909 | Ga0496106_0040081 | Ga0496106_0040081_1238_1549 | 96 |
| 708 | 3300048910 | Ga0496107_0000083 | Ga0496107_0000083_30823_31134 | 96 |
| 709 | 3300048910 | Ga0496107_0001171 | Ga0496107_0001171_15580_15876 | 96 |
| 710 | 3300048910 | Ga0496107_0006327 | Ga0496107_0006327_1020_1331 | 96 |
| 711 | 3300048910 | Ga0496107_0206985 | Ga0496107_0206985_642_950 | 96 |
| 712 | 3300048911 | Ga0496108_0002478 | Ga0496108_0002478_7947_8258 | 96 |
| 713 | 3300048911 | Ga0496108_0003256 | Ga0496108_0003256_10899_11195 | 96 |
| 714 | 3300048911 | Ga0496108_0076780 | Ga0496108_0076780_225_551 | 96 |
| 715 | 3300048912 | Ga0496109_0000293 | Ga0496109_0000293_39218_39529 | 96 |
| 716 | 3300048912 | Ga0496109_0001978 | Ga0496109_0001978_13126_13422 | 96 |
| 717 | 3300048912 | Ga0496109_0167328 | Ga0496109_0167328_805_1107 | 96 |
| 718 | 3300048912 | Ga0496109_0473721 | Ga0496109_0473721_465_791 | 96 |
| 719 | 3300048913 | Ga0496110_0066830 | Ga0496110_0066830_1221_1532 | 96 |
| 720 | 3300048913 | Ga0496110_0251986 | Ga0496110_0251986_272_568 | 96 |
| 721 | 3300048915 | Ga0496112_0047284 | Ga0496112_0047284_230_526 | 96 |
| 722 | 3300048915 | Ga0496112_0377459 | Ga0496112_0377459_876_1172 | 96 |
| 723 | 3300048915 | Ga0496112_0489533 | Ga0496112_0489533_421_723 | 96 |
| 724 | 3300048915 | Ga0496112_0764416 | Ga0496112_0764416_506_808 | 96 |
| 725 | 3300048916 | Ga0496113_0294515 | Ga0496113_0294515_164_475 | 96 |
| 726 | 3300048916 | Ga0496113_0372642 | Ga0496113_0372642_493_789 | 96 |
| 727 | 3300048916 | Ga0496113_0858603 | Ga0496113_0858603_326_622 | 96 |
| 728 | 3300048917 | Ga0496114_0000517 | Ga0496114_0000517_21877_22173 | 96 |
| 729 | 3300048917 | Ga0496114_0002766 | Ga0496114_0002766_8218_8529 | 96 |
| 730 | 3300048918 | Ga0496115_1315795 | Ga0496115_1315795_119_415 | 96 |
| 731 | 3300048919 | Ga0496116_0000034 | Ga0496116_0000034_145628_145939 | 96 |
| 732 | 3300048919 | Ga0496116_0001049 | Ga0496116_0001049_10848_11159 | 96 |
| 733 | 3300048919 | Ga0496116_0033542 | Ga0496116_0033542_2763_3071 | 96 |
| 734 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_856031_856342 | 96 |
| 735 | 3300048920 | Ga0496117_0000390 | Ga0496117_0000390_57527_57835 | 96 |
| 736 | 3300048920 | Ga0496117_0002218 | Ga0496117_0002218_19268_19579 | 96 |
| 737 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_856034_856345 | 96 |
| 738 | 3300048921 | Ga0496118_0002226 | Ga0496118_0002226_21134_21442 | 96 |
| 739 | 3300048921 | Ga0496118_0010693 | Ga0496118_0010693_176_487 | 96 |
| 740 | 3300048921 | Ga0496118_0509823 | Ga0496118_0509823_168_464 | 96 |
| 741 | 3300048922 | Ga0496119_0001001 | Ga0496119_0001001_12668_12979 | 96 |
| 742 | 3300048922 | Ga0496119_0013888 | Ga0496119_0013888_2756_3067 | 96 |
| 743 | 3300048922 | Ga0496119_0015314 | Ga0496119_0015314_1036_1344 | 96 |
| 744 | 3300048922 | Ga0496119_0508129 | Ga0496119_0508129_13_324 | 96 |
| 745 | 3300048923 | Ga0496120_0000241 | Ga0496120_0000241_3419_3730 | 96 |
| 746 | 3300048923 | Ga0496120_0047544 | Ga0496120_0047544_1589_1900 | 96 |
| 747 | 3300048923 | Ga0496120_0054340 | Ga0496120_0054340_1275_1583 | 96 |
| 748 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_1349633_1349944 | 96 |
| 749 | 3300048924 | Ga0496121_0000421 | Ga0496121_0000421_45319_45630 | 96 |
| 750 | 3300048924 | Ga0496121_0002203 | Ga0496121_0002203_1512_1820 | 96 |
| 751 | 3300048925 | Ga0496122_0000051 | Ga0496122_0000051_9269_9580 | 96 |
| 752 | 3300048926 | Ga0496123_0001082 | Ga0496123_0001082_20891_21202 | 96 |
| 753 | 3300048926 | Ga0496123_0179182 | Ga0496123_0179182_727_1038 | 96 |
| 754 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_144645_144956 | 96 |
| 755 | 3300048927 | Ga0496124_0203268 | Ga0496124_0203268_334_642 | 96 |
| 756 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_1349633_1349944 | 96 |
| 757 | 3300048928 | Ga0496125_0023269 | Ga0496125_0023269_5105_5413 | 96 |
| 758 | 3300048929 | Ga0496126_0000011 | Ga0496126_0000011_144645_144956 | 96 |
| 759 | 3300048929 | Ga0496126_0000805 | Ga0496126_0000805_11948_12259 | 96 |
| 760 | 3300048929 | Ga0496126_0533481 | Ga0496126_0533481_382_693 | 96 |
| 761 | 3300048929 | Ga0496126_0764614 | Ga0496126_0764614_401_709 | 96 |
| 762 | 3300049569 | Ga0501032_0009298 | Ga0501032_0009298_5258_5560 | 96 |
| 763 | 3300049571 | Ga0501034_0014878 | Ga0501034_0014878_655_957 | 96 |
| 764 | 3300049572 | Ga0501036_0033970 | Ga0501036_0033970_1478_1780 | 96 |
| 765 | 3300049573 | Ga0501037_0001465 | Ga0501037_0001465_414_716 | 96 |
| 766 | 3300049576 | Ga0501040_0268460 | Ga0501040_0268460_640_942 | 96 |
| 767 | 3300049579 | Ga0501043_0001059 | Ga0501043_0001059_16238_16540 | 96 |
| 768 | 3300049581 | Ga0501047_0911358 | Ga0501047_0911358_258_560 | 96 |
| 769 | 3300049584 | Ga0501068_0635386 | Ga0501068_0635386_261_563 | 96 |
| 770 | 3300049586 | Ga0501070_0001045 | Ga0501070_0001045_7874_8176 | 96 |
| 771 | 3300049586 | Ga0501070_0090058 | Ga0501070_0090058_2176_2481 | 96 |
| 772 | 3300049586 | Ga0501070_0331554 | Ga0501070_0331554_399_698 | 96 |
| 773 | 3300049587 | Ga0501071_0735291 | Ga0501071_0735291_33_335 | 96 |
| 774 | 3300049593 | Ga0501077_0324311 | Ga0501077_0324311_254_556 | 96 |
| 775 | 3300049741 | Ga0501079_0958133 | Ga0501079_0958133_320_622 | 96 |
| 776 | 3300049742 | Ga0501080_0763685 | Ga0501080_0763685_427_729 | 96 |
| 777 | 3300050489 | nmdc:mga03683_282316_c1 | nmdc:mga03683_282316_c1_71_376 | 96 |
| 778 | 3300050489 | nmdc:mga03683_41391_c1 | nmdc:mga03683_41391_c1_221_526 | 96 |
| 779 | 3300050489 | nmdc:mga03683_4742_c1 | nmdc:mga03683_4742_c1_1593_1886 | 96 |
| 780 | 3300050489 | nmdc:mga03683_63873_c1 | nmdc:mga03683_63873_c1_115_417 | 96 |
| 781 | 3300050490 | nmdc:mga03n38_2737_c1 | nmdc:mga03n38_2737_c1_2806_3111 | 96 |
| 782 | 3300050490 | nmdc:mga03n38_294500_c1 | nmdc:mga03n38_294500_c1_355_660 | 96 |
| 783 | 3300050490 | nmdc:mga03n38_336848_c1 | nmdc:mga03n38_336848_c1_111_416 | 96 |
| 784 | 3300050490 | nmdc:mga03n38_355895_c1 | nmdc:mga03n38_355895_c1_191_493 | 96 |
| 785 | 3300050490 | nmdc:mga03n38_561408_c1 | nmdc:mga03n38_561408_c1_198_503 | 96 |
| 786 | 3300050490 | nmdc:mga03n38_7697_c1 | nmdc:mga03n38_7697_c1_2082_2387 | 96 |
| 787 | 3300050490 | nmdc:mga03n38_77171_c1 | nmdc:mga03n38_77171_c1_974_1279 | 96 |
| 788 | 3300050490 | nmdc:mga03n38_797118_c1 | nmdc:mga03n38_797118_c1_205_501 | 96 |
| 789 | 3300050491 | nmdc:mga00v17_16828_c1 | nmdc:mga00v17_16828_c1_3466_3771 | 96 |
| 790 | 3300050491 | nmdc:mga00v17_182570_c1 | nmdc:mga00v17_182570_c1_649_954 | 96 |
| 791 | 3300050491 | nmdc:mga00v17_26886_c1 | nmdc:mga00v17_26886_c1_1509_1802 | 96 |
| 792 | 3300050491 | nmdc:mga00v17_28589_c1 | nmdc:mga00v17_28589_c1_2198_2500 | 96 |
| 793 | 3300050491 | nmdc:mga00v17_312725_c1 | nmdc:mga00v17_312725_c1_376_681 | 96 |
| 794 | 3300050491 | nmdc:mga00v17_464724_c1 | nmdc:mga00v17_464724_c1_230_541 | 96 |
| 795 | 3300050492 | nmdc:mga0yw44_135112_c1 | nmdc:mga0yw44_135112_c1_282_584 | 96 |
| 796 | 3300050492 | nmdc:mga0yw44_143301_c1 | nmdc:mga0yw44_143301_c1_60_353 | 96 |
| 797 | 3300050492 | nmdc:mga0yw44_161414_c1 | nmdc:mga0yw44_161414_c1_887_1198 | 96 |
| 798 | 3300050492 | nmdc:mga0yw44_263583_c1 | nmdc:mga0yw44_263583_c1_487_792 | 96 |
| 799 | 3300050492 | nmdc:mga0yw44_442646_c1 | nmdc:mga0yw44_442646_c1_152_475 | 96 |
| 800 | 3300050492 | nmdc:mga0yw44_465326_c1 | nmdc:mga0yw44_465326_c1_288_599 | 96 |
| 801 | 3300050492 | nmdc:mga0yw44_569474_c1 | nmdc:mga0yw44_569474_c1_280_585 | 96 |
| 802 | 3300050492 | nmdc:mga0yw44_890157_c1 | nmdc:mga0yw44_890157_c1_129_452 | 96 |
| 803 | 3300050492 | nmdc:mga0yw44_95642_c1 | nmdc:mga0yw44_95642_c1_1201_1506 | 96 |
| 804 | 3300050493 | nmdc:mga0k408_41793_c1 | nmdc:mga0k408_41793_c1_160_465 | 96 |
| 805 | 3300050493 | nmdc:mga0k408_469831_c1 | nmdc:mga0k408_469831_c1_252_545 | 96 |
| 806 | 3300050494 | nmdc:mga06z11_55944_c1 | nmdc:mga06z11_55944_c1_1376_1681 | 96 |
| 807 | 3300050494 | nmdc:mga06z11_603453_c1 | nmdc:mga06z11_603453_c1_213_506 | 96 |
| 808 | 3300050495 | nmdc:mga04h51_21305_c1 | nmdc:mga04h51_21305_c1_471_776 | 96 |
| 809 | 3300050495 | nmdc:mga04h51_85760_c1 | nmdc:mga04h51_85760_c1_276_569 | 96 |
| 810 | 3300050496 | nmdc:mga07m45_10218_c1 | nmdc:mga07m45_10218_c1_377_682 | 96 |
| 811 | 3300050496 | nmdc:mga07m45_118121_c1 | nmdc:mga07m45_118121_c1_734_1030 | 96 |
| 812 | 3300050496 | nmdc:mga07m45_27866_c1 | nmdc:mga07m45_27866_c1_1967_2269 | 96 |
| 813 | 3300050496 | nmdc:mga07m45_42475_c1 | nmdc:mga07m45_42475_c1_1844_2149 | 96 |
| 814 | 3300050496 | nmdc:mga07m45_45201_c1 | nmdc:mga07m45_45201_c1_566_862 | 96 |
| 815 | 3300050507 | nmdc:mga05p37_1568544_c1 | nmdc:mga05p37_1568544_c1_271_564 | 96 |
| 816 | 3300050507 | nmdc:mga05p37_87296_c1 | nmdc:mga05p37_87296_c1_2054_2350 | 96 |
| 817 | 3300050509 | nmdc:mga0qj67_19994_c1 | nmdc:mga0qj67_19994_c1_4179_4475 | 96 |
| 818 | 3300050510 | nmdc:mga06r32_32424_c1 | nmdc:mga06r32_32424_c1_2026_2322 | 96 |
| 819 | 3300050511 | nmdc:mga08y16_1646474_c1 | nmdc:mga08y16_1646474_c1_64_414 | 96 |
| 820 | 3300050515 | nmdc:mga0a205_331119_c1 | nmdc:mga0a205_331119_c1_1025_1327 | 96 |
| 821 | 3300050516 | nmdc:mga0sz30_103073_c2 | nmdc:mga0sz30_103073_c2_220_525 | 96 |
| 822 | 3300050516 | nmdc:mga0sz30_17777_c1 | nmdc:mga0sz30_17777_c1_1559_1852 | 96 |
| 823 | 3300050516 | nmdc:mga0sz30_27081_c2 | nmdc:mga0sz30_27081_c2_1220_1516 | 96 |
| 824 | 3300050516 | nmdc:mga0sz30_279571_c1 | nmdc:mga0sz30_279571_c1_389_685 | 96 |
| 825 | 3300053087 | Ga0500643_002732 | Ga0500643_002732_3892_4203 | 96 |
| 826 | 3300053090 | Ga0500646_0039744 | Ga0500646_0039744_107_400 | 96 |
| 827 | 3300053094 | Ga0500566_0429975 | Ga0500566_0429975_95_388 | 96 |
| 828 | 3300053153 | Ga0500616_0002892 | Ga0500616_0002892_5071_5382 | 96 |
| 829 | 3300053155 | Ga0500620_040274 | Ga0500620_040274_955_1248 | 96 |
| 830 | 3300053160 | Ga0500633_0047396 | Ga0500633_0047396_510_821 | 96 |
| 831 | 3300059510 | Ga0587090_146616 | Ga0587090_146616_101_412 | 96 |
| 832 | 3300061719 | Ga0466962_0024515 | Ga0466962_0024515_1050_1352 | 96 |
| 833 | 3300000545 | CNXas_1000300 | CNXas_10003003 | 97 |
| 834 | 3300002459 | JGI24751J29686_10011383 | JGI24751J29686_100113832 | 97 |
| 835 | 3300005289 | Ga0065704_10454399 | Ga0065704_104543991 | 97 |
| 836 | 3300005331 | Ga0070670_100086471 | Ga0070670_1000864713 | 97 |
| 837 | 3300005335 | Ga0070666_10845948 | Ga0070666_108459481 | 97 |
| 838 | 3300005347 | Ga0070668_100000604 | Ga0070668_10000060416 | 97 |
| 839 | 3300005347 | Ga0070668_100053389 | Ga0070668_1000533892 | 97 |
| 840 | 3300005355 | Ga0070671_100006503 | Ga0070671_1000065036 | 97 |
| 841 | 3300005355 | Ga0070671_100043463 | Ga0070671_1000434633 | 97 |
| 842 | 3300005355 | Ga0070671_100194584 | Ga0070671_1001945843 | 97 |
| 843 | 3300005356 | Ga0070674_100461193 | Ga0070674_1004611932 | 97 |
| 844 | 3300005367 | Ga0070667_100095421 | Ga0070667_1000954212 | 97 |
| 845 | 3300005367 | Ga0070667_100448770 | Ga0070667_1004487701 | 97 |
| 846 | 3300005367 | Ga0070667_101050879 | Ga0070667_1010508791 | 97 |
| 847 | 3300005437 | Ga0070710_11149494 | Ga0070710_111494942 | 97 |
| 848 | 3300005455 | Ga0070663_101257211 | Ga0070663_1012572111 | 97 |
| 849 | 3300005456 | Ga0070678_100478191 | Ga0070678_1004781912 | 97 |
| 850 | 3300005466 | Ga0070685_10505789 | Ga0070685_105057892 | 97 |
| 851 | 3300005544 | Ga0070686_100081511 | Ga0070686_1000815112 | 97 |
| 852 | 3300005544 | Ga0070686_100807117 | Ga0070686_1008071172 | 97 |
| 853 | 3300005548 | Ga0070665_100993248 | Ga0070665_1009932482 | 97 |
| 854 | 3300005615 | Ga0070702_100415830 | Ga0070702_1004158302 | 97 |
| 855 | 3300005616 | Ga0068852_102414700 | Ga0068852_1024147002 | 97 |
| 856 | 3300005718 | Ga0068866_10247575 | Ga0068866_102475753 | 97 |
| 857 | 3300005719 | Ga0068861_101384194 | Ga0068861_1013841941 | 97 |
| 858 | 3300005840 | Ga0068870_10862670 | Ga0068870_108626703 | 97 |
| 859 | 3300005841 | Ga0068863_100003689 | Ga0068863_10000368916 | 97 |
| 860 | 3300005841 | Ga0068863_100869736 | Ga0068863_1008697362 | 97 |
| 861 | 3300005841 | Ga0068863_101838165 | Ga0068863_1018381651 | 97 |
| 862 | 3300005842 | Ga0068858_100218475 | Ga0068858_1002184752 | 97 |
| 863 | 3300005842 | Ga0068858_100547142 | Ga0068858_1005471422 | 97 |
| 864 | 3300005842 | Ga0068858_101644456 | Ga0068858_1016444562 | 97 |
| 865 | 3300005843 | Ga0068860_102567264 | Ga0068860_1025672642 | 97 |
| 866 | 3300005843 | Ga0068860_102685411 | Ga0068860_1026854111 | 97 |
| 867 | 3300005844 | Ga0068862_101109055 | Ga0068862_1011090552 | 97 |
| 868 | 3300005937 | Ga0081455_10177818 | Ga0081455_101778181 | 97 |
| 869 | 3300006038 | Ga0075365_10154536 | Ga0075365_101545364 | 97 |
| 870 | 3300006048 | Ga0075363_100025097 | Ga0075363_1000250972 | 97 |
| 871 | 3300006048 | Ga0075363_100337741 | Ga0075363_1003377412 | 97 |
| 872 | 3300006051 | Ga0075364_10001416 | Ga0075364_1000141611 | 97 |
| 873 | 3300006051 | Ga0075364_10487519 | Ga0075364_104875192 | 97 |
| 874 | 3300006177 | Ga0075362_10290559 | Ga0075362_102905592 | 97 |
| 875 | 3300006186 | Ga0075369_10000571 | Ga0075369_1000057114 | 97 |
| 876 | 3300006186 | Ga0075369_10138350 | Ga0075369_101383502 | 97 |
| 877 | 3300006353 | Ga0075370_10130598 | Ga0075370_101305982 | 97 |
| 878 | 3300006358 | Ga0068871_100819008 | Ga0068871_1008190082 | 97 |
| 879 | 3300006846 | Ga0075430_100059016 | Ga0075430_1000590161 | 97 |
| 880 | 3300006881 | Ga0068865_100550404 | Ga0068865_1005504042 | 97 |
| 881 | 3300009011 | Ga0105251_10233167 | Ga0105251_102331671 | 97 |
| 882 | 3300009092 | Ga0105250_10084209 | Ga0105250_100842093 | 97 |
| 883 | 3300009092 | Ga0105250_10288945 | Ga0105250_102889451 | 97 |
| 884 | 3300009101 | Ga0105247_11583189 | Ga0105247_115831891 | 97 |
| 885 | 3300009176 | Ga0105242_10208526 | Ga0105242_102085263 | 97 |
| 886 | 3300009177 | Ga0105248_10087668 | Ga0105248_100876683 | 97 |
| 887 | 3300009177 | Ga0105248_10826344 | Ga0105248_108263441 | 97 |
| 888 | 3300009551 | Ga0105238_10317361 | Ga0105238_103173613 | 97 |
| 889 | 3300009553 | Ga0105249_10022007 | Ga0105249_100220073 | 97 |
| 890 | 3300010159 | Ga0099796_10010920 | Ga0099796_100109203 | 97 |
| 891 | 3300013297 | Ga0157378_10890388 | Ga0157378_108903882 | 97 |
| 892 | 3300013308 | Ga0157375_10139581 | Ga0157375_101395814 | 97 |
| 893 | 3300014325 | Ga0163163_10756181 | Ga0163163_107561812 | 97 |
| 894 | 3300014326 | Ga0157380_10429896 | Ga0157380_104298964 | 97 |
| 895 | 3300014968 | Ga0157379_11428335 | Ga0157379_114283352 | 97 |
| 896 | 3300017792 | Ga0163161_10839847 | Ga0163161_108398472 | 97 |
| 897 | 3300025303 | Ga0209051_1022917 | Ga0209051_10229172 | 97 |
| 898 | 3300025303 | Ga0209051_1044453 | Ga0209051_10444533 | 97 |
| 899 | 3300025903 | Ga0207680_10338675 | Ga0207680_103386752 | 97 |
| 900 | 3300025924 | Ga0207694_10145782 | Ga0207694_101457824 | 97 |
| 901 | 3300025925 | Ga0207650_10109673 | Ga0207650_101096733 | 97 |
| 902 | 3300025931 | Ga0207644_10027298 | Ga0207644_100272981 | 97 |
| 903 | 3300025931 | Ga0207644_10158883 | Ga0207644_101588833 | 97 |
| 904 | 3300025931 | Ga0207644_10197549 | Ga0207644_101975491 | 97 |
| 905 | 3300025936 | Ga0207670_11074164 | Ga0207670_110741642 | 97 |
| 906 | 3300025937 | Ga0207669_10158989 | Ga0207669_101589892 | 97 |
| 907 | 3300025938 | Ga0207704_10128721 | Ga0207704_101287213 | 97 |
| 908 | 3300025941 | Ga0207711_10112050 | Ga0207711_101120503 | 97 |
| 909 | 3300025961 | Ga0207712_10269342 | Ga0207712_102693422 | 97 |
| 910 | 3300025972 | Ga0207668_10000770 | Ga0207668_1000077013 | 97 |
| 911 | 3300025972 | Ga0207668_10232143 | Ga0207668_102321432 | 97 |
| 912 | 3300025986 | Ga0207658_10004854 | Ga0207658_100048542 | 97 |
| 913 | 3300025986 | Ga0207658_10917992 | Ga0207658_109179922 | 97 |
| 914 | 3300026035 | Ga0207703_10543410 | Ga0207703_105434102 | 97 |
| 915 | 3300026035 | Ga0207703_10580612 | Ga0207703_105806122 | 97 |
| 916 | 3300026035 | Ga0207703_10716983 | Ga0207703_107169832 | 97 |
| 917 | 3300026041 | Ga0207639_10016036 | Ga0207639_100160366 | 97 |
| 918 | 3300026067 | Ga0207678_10670745 | Ga0207678_106707453 | 97 |
| 919 | 3300026088 | Ga0207641_10029024 | Ga0207641_100290245 | 97 |
| 920 | 3300026088 | Ga0207641_10414173 | Ga0207641_104141732 | 97 |
| 921 | 3300026089 | Ga0207648_12033040 | Ga0207648_120330402 | 97 |
| 922 | 3300026121 | Ga0207683_10451543 | Ga0207683_104515433 | 97 |
| 923 | 3300028379 | Ga0268266_10378892 | Ga0268266_103788921 | 97 |
| 924 | 3300028379 | Ga0268266_10652806 | Ga0268266_106528062 | 97 |
| 925 | 3300028381 | Ga0268264_11975181 | Ga0268264_119751812 | 97 |
| 926 | 3300032139 | Ga0316580_10169555 | Ga0316580_101695552 | 97 |
| 927 | 3300032168 | Ga0316593_10147375 | Ga0316593_101473752 | 97 |
| 928 | 3300033524 | Ga0316592_1084493 | Ga0316592_10844932 | 97 |
| 929 | 3300033541 | Ga0316596_1078760 | Ga0316596_10787601 | 97 |
| 930 | 3300036712 | Ga0316584_0073524 | Ga0316584_0073524_1093_1416 | 97 |
| 931 | 3300041411 | Ga0439466_0044833 | Ga0439466_0044833_1042_1335 | 97 |
| 932 | 3300041413 | Ga0439465_0050299 | Ga0439465_0050299_99_392 | 97 |
| 933 | 3300042002 | Ga0439442_082748 | Ga0439442_082748_257_550 | 97 |
| 934 | 3300042435 | Ga0439434_0112473 | Ga0439434_0112473_127_420 | 97 |
| 935 | 3300044658 | Ga0466972_0044291 | Ga0466972_0044291_1571_1876 | 97 |
| 936 | 3300044658 | Ga0466972_0566073 | Ga0466972_0566073_71_376 | 97 |
| 937 | 3300044735 | Ga0466968_0039664 | Ga0466968_0039664_339_644 | 97 |
| 938 | 3300044765 | Ga0466970_0027961 | Ga0466970_0027961_1428_1733 | 97 |
| 939 | 3300046460 | Ga0495638_0007924 | Ga0495638_0007924_6461_6772 | 97 |
| 940 | 3300046460 | Ga0495638_0014570 | Ga0495638_0014570_1917_2228 | 97 |
| 941 | 3300046616 | Ga0495668_0246567 | Ga0495668_0246567_268_579 | 97 |
| 942 | 3300046692 | Ga0495671_0367385 | Ga0495671_0367385_192_497 | 97 |
| 943 | 3300047320 | Ga0495672_0130773 | Ga0495672_0130773_709_1020 | 97 |
| 944 | 3300048091 | Ga0495626_0174226 | Ga0495626_0174226_282_593 | 97 |
| 945 | 3300048091 | Ga0495626_0257863 | Ga0495626_0257863_19_330 | 97 |
| 946 | 3300048903 | Ga0496100_0001064 | Ga0496100_0001064_4286_4597 | 97 |
| 947 | 3300048903 | Ga0496100_0683213 | Ga0496100_0683213_108_413 | 97 |
| 948 | 3300048904 | Ga0496101_0000270 | Ga0496101_0000270_27532_27843 | 97 |
| 949 | 3300048904 | Ga0496101_0054409 | Ga0496101_0054409_1889_2200 | 97 |
| 950 | 3300048904 | Ga0496101_0750292 | Ga0496101_0750292_157_462 | 97 |
| 951 | 3300048905 | Ga0496102_0003067 | Ga0496102_0003067_3703_4008 | 97 |
| 952 | 3300048907 | Ga0496104_0004313 | Ga0496104_0004313_5282_5593 | 97 |
| 953 | 3300048907 | Ga0496104_0010659 | Ga0496104_0010659_2713_3018 | 97 |
| 954 | 3300048908 | Ga0496105_0019662 | Ga0496105_0019662_178_483 | 97 |
| 955 | 3300048908 | Ga0496105_0435057 | Ga0496105_0435057_342_653 | 97 |
| 956 | 3300048909 | Ga0496106_0174404 | Ga0496106_0174404_1280_1591 | 97 |
| 957 | 3300048910 | Ga0496107_0005215 | Ga0496107_0005215_3232_3543 | 97 |
| 958 | 3300048910 | Ga0496107_0206319 | Ga0496107_0206319_886_1191 | 97 |
| 959 | 3300048911 | Ga0496108_0093861 | Ga0496108_0093861_2076_2381 | 97 |
| 960 | 3300048911 | Ga0496108_0248223 | Ga0496108_0248223_337_648 | 97 |
| 961 | 3300048911 | Ga0496108_0284525 | Ga0496108_0284525_925_1230 | 97 |
| 962 | 3300048912 | Ga0496109_0038037 | Ga0496109_0038037_2381_2686 | 97 |
| 963 | 3300048912 | Ga0496109_0799007 | Ga0496109_0799007_138_443 | 97 |
| 964 | 3300048913 | Ga0496110_0029596 | Ga0496110_0029596_2187_2492 | 97 |
| 965 | 3300048913 | Ga0496110_0042318 | Ga0496110_0042318_2924_3229 | 97 |
| 966 | 3300048913 | Ga0496110_0290617 | Ga0496110_0290617_374_685 | 97 |
| 967 | 3300048914 | Ga0496111_0016877 | Ga0496111_0016877_1115_1420 | 97 |
| 968 | 3300048914 | Ga0496111_0184564 | Ga0496111_0184564_1218_1523 | 97 |
| 969 | 3300048915 | Ga0496112_0108326 | Ga0496112_0108326_1213_1518 | 97 |
| 970 | 3300048915 | Ga0496112_0278301 | Ga0496112_0278301_259_564 | 97 |
| 971 | 3300048916 | Ga0496113_0073302 | Ga0496113_0073302_1511_1816 | 97 |
| 972 | 3300048916 | Ga0496113_0386083 | Ga0496113_0386083_267_578 | 97 |
| 973 | 3300048917 | Ga0496114_0010038 | Ga0496114_0010038_5536_5847 | 97 |
| 974 | 3300048917 | Ga0496114_1083034 | Ga0496114_1083034_269_580 | 97 |
| 975 | 3300048918 | Ga0496115_0008855 | Ga0496115_0008855_2177_2488 | 97 |
| 976 | 3300048918 | Ga0496115_0134115 | Ga0496115_0134115_1415_1726 | 97 |
| 977 | 3300048924 | Ga0496121_0401867 | Ga0496121_0401867_19_330 | 97 |
| 978 | 3300048927 | Ga0496124_0925621 | Ga0496124_0925621_85_396 | 97 |
| 979 | 3300048929 | Ga0496126_0010992 | Ga0496126_0010992_6406_6717 | 97 |
| 980 | 3300049823 | Ga0501044_0022680 | Ga0501044_0022680_4056_4373 | 97 |
| 981 | 3300050489 | nmdc:mga03683_49033_c1 | nmdc:mga03683_49033_c1_192_497 | 97 |
| 982 | 3300050490 | nmdc:mga03n38_284722_c1 | nmdc:mga03n38_284722_c1_233_535 | 97 |
| 983 | 3300050490 | nmdc:mga03n38_7949_c1 | nmdc:mga03n38_7949_c1_3368_3673 | 97 |
| 984 | 3300050491 | nmdc:mga00v17_1839_c1 | nmdc:mga00v17_1839_c1_3558_3863 | 97 |
| 985 | 3300050491 | nmdc:mga00v17_208391_c1 | nmdc:mga00v17_208391_c1_226_549 | 97 |
| 986 | 3300050492 | nmdc:mga0yw44_111276_c1 | nmdc:mga0yw44_111276_c1_599_910 | 97 |
| 987 | 3300050492 | nmdc:mga0yw44_424311_c1 | nmdc:mga0yw44_424311_c1_418_720 | 97 |
| 988 | 3300050496 | nmdc:mga07m45_795161_c1 | nmdc:mga07m45_795161_c1_89_394 | 97 |
| 989 | 3300050509 | nmdc:mga0qj67_51566_c1 | nmdc:mga0qj67_51566_c1_2933_3238 | 97 |
| 990 | 3300050516 | nmdc:mga0sz30_113708_c1 | nmdc:mga0sz30_113708_c1_553_864 | 97 |
| 991 | 3300050516 | nmdc:mga0sz30_2053_c1 | nmdc:mga0sz30_2053_c1_4325_4630 | 97 |
| 992 | 3300050516 | nmdc:mga0sz30_247223_c1 | nmdc:mga0sz30_247223_c1_67_378 | 97 |
| 993 | 3300053079 | Ga0500610_0072788 | Ga0500610_0072788_279_590 | 97 |
| 994 | 3300053080 | Ga0500635_0068357 | Ga0500635_0068357_273_584 | 97 |
| 995 | 3300053086 | Ga0500578_0768663 | Ga0500578_0768663_127_438 | 97 |
| 996 | 3300053087 | Ga0500643_003257 | Ga0500643_003257_6968_7279 | 97 |
| 997 | 3300053089 | Ga0500581_301034 | Ga0500581_301034_192_503 | 97 |
| 998 | 3300053092 | Ga0500583_0287899 | Ga0500583_0287899_335_646 | 97 |
| 999 | 3300053093 | Ga0500651_0142671 | Ga0500651_0142671_451_762 | 97 |
| 1000 | 3300053098 | Ga0500650_0434409 | Ga0500650_0434409_222_533 | 97 |
| 1001 | 3300053104 | Ga0500556_0001801 | Ga0500556_0001801_6585_6896 | 97 |
| 1002 | 3300053104 | Ga0500556_0053181 | Ga0500556_0053181_340_651 | 97 |
| 1003 | 3300053108 | Ga0500562_005249 | Ga0500562_005249_1016_1327 | 97 |
| 1004 | 3300053111 | Ga0500572_309658 | Ga0500572_309658_34_345 | 97 |
| 1005 | 3300053130 | Ga0500642_0055010 | Ga0500642_0055010_673_984 | 97 |
| 1006 | 3300053136 | Ga0500559_0251104 | Ga0500559_0251104_139_450 | 97 |
| 1007 | 3300053142 | Ga0500577_0092628 | Ga0500577_0092628_489_800 | 97 |
| 1008 | 3300053146 | Ga0500588_0366193 | Ga0500588_0366193_131_442 | 97 |
| 1009 | 3300053151 | Ga0500604_0049468 | Ga0500604_0049468_315_626 | 97 |
| 1010 | 3300053153 | Ga0500616_0008826 | Ga0500616_0008826_94_405 | 97 |
| 1011 | 3300053158 | Ga0500627_0017142 | Ga0500627_0017142_1055_1366 | 97 |
| 1012 | 3300053158 | Ga0500627_0202190 | Ga0500627_0202190_303_614 | 97 |
| 1013 | 3300053161 | Ga0500634_0234517 | Ga0500634_0234517_216_527 | 97 |
| 1014 | 3300053162 | Ga0500638_268237 | Ga0500638_268237_58_369 | 97 |
| 1015 | 3300053730 | Ga0500645_000110 | Ga0500645_000110_21187_21498 | 97 |
| 1016 | 3300053730 | Ga0500645_013051 | Ga0500645_013051_2174_2488 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar