F488203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 364 | 2026 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0008540|Ga0501047_0008540_4551_5456 |
| Length | 264 |
| Sequence | MLFMGERPYTLLSCGMSIDGYLDGATDERLLLSNDADFDRVDAVRAECDAILVGAETVRQDNPRLLVRSKARRDDRVARGLRPSPVKVTVTQRGRLDPCARFFVTGESDKLVYCASRTIDDARRRLGPVATVVDAGDPVNLRRVTEDLYARGIARLMVEGGGTVHTQFLTADLADELHLVVAPFFVGDSRARRFVDDGRFPWHPGRRATLAEVRQIGDVVLLRYALSERFGSGRFDSPGQRPRRAAVPDGPDPLRIGPASLGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 356 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 363 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 364 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 1.09 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 16.78 |
| Rhizosphere | 81.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501047_0008540 | 3300049581 | Bacteria | 9662 |
| 2 | JGI24737J22298_10106451 | 3300001990 | Bacteria | 830 |
| 3 | Ga0070658_10012228 | 3300005327 | Bacteria | 6890 |
| 4 | Ga0070676_10378054 | 3300005328 | Bacteria | 980 |
| 5 | Ga0070683_100009018 | 3300005329 | Bacteria | 8509 |
| 6 | Ga0070683_100016184 | 3300005329 | Bacteria | 6569 |
| 7 | Ga0070683_100044245 | 3300005329 | Bacteria | 4106 |
| 8 | Ga0070683_100080515 | 3300005329 | Bacteria | 3049 |
| 9 | Ga0070683_100143935 | 3300005329 | Bacteria | 2258 |
| 10 | Ga0070683_100174470 | 3300005329 | Bacteria | 2041 |
| 11 | Ga0070683_100482419 | 3300005329 | Bacteria | 1184 |
| 12 | Ga0070690_100108110 | 3300005330 | Bacteria | 1852 |
| 13 | Ga0070670_100146353 | 3300005331 | Bacteria | 2044 |
| 14 | Ga0068869_100094719 | 3300005334 | Bacteria | 2252 |
| 15 | Ga0068869_100384366 | 3300005334 | Bacteria | 1151 |
| 16 | Ga0070666_10110019 | 3300005335 | Bacteria | 1905 |
| 17 | Ga0070680_100053920 | 3300005336 | Bacteria | 3282 |
| 18 | Ga0070680_100328131 | 3300005336 | Bacteria | 1300 |
| 19 | Ga0070680_100408909 | 3300005336 | Bacteria | 1157 |
| 20 | Ga0070680_100690582 | 3300005336 | Bacteria | 878 |
| 21 | Ga0070682_100082916 | 3300005337 | Bacteria | 2079 |
| 22 | Ga0070682_100201688 | 3300005337 | Bacteria | 1404 |
| 23 | Ga0070682_100201997 | 3300005337 | Bacteria | 1403 |
| 24 | Ga0070682_100423449 | 3300005337 | Bacteria | 1012 |
| 25 | Ga0068868_100182206 | 3300005338 | Bacteria | 1743 |
| 26 | Ga0068868_100264178 | 3300005338 | Bacteria | 1452 |
| 27 | Ga0068868_100339716 | 3300005338 | Bacteria | 1284 |
| 28 | Ga0068868_100372062 | 3300005338 | Bacteria | 1228 |
| 29 | Ga0070660_100001285 | 3300005339 | Bacteria | 17109 |
| 30 | Ga0070660_100005389 | 3300005339 | Bacteria | 8854 |
| 31 | Ga0070660_100065198 | 3300005339 | Bacteria | 2835 |
| 32 | Ga0070660_100126528 | 3300005339 | Bacteria | 2042 |
| 33 | Ga0070660_100586805 | 3300005339 | Bacteria | 931 |
| 34 | Ga0070689_100125086 | 3300005340 | Bacteria | 2057 |
| 35 | Ga0070689_100183860 | 3300005340 | Bacteria | 1699 |
| 36 | Ga0070691_10062517 | 3300005341 | Bacteria | 1793 |
| 37 | Ga0070691_10112908 | 3300005341 | Bacteria | 1361 |
| 38 | Ga0070691_10151530 | 3300005341 | Bacteria | 1189 |
| 39 | Ga0070687_100106867 | 3300005343 | Bacteria | 1577 |
| 40 | Ga0070687_100224790 | 3300005343 | Bacteria | 1152 |
| 41 | Ga0070661_100149213 | 3300005344 | Bacteria | 1767 |
| 42 | Ga0070692_10054177 | 3300005345 | Bacteria | 2093 |
| 43 | Ga0070692_10103983 | 3300005345 | Bacteria | 1561 |
| 44 | Ga0070692_10253420 | 3300005345 | Bacteria | 1055 |
| 45 | Ga0070668_100007547 | 3300005347 | Bacteria | 8075 |
| 46 | Ga0070671_100012587 | 3300005355 | Bacteria | 6814 |
| 47 | Ga0070671_100432482 | 3300005355 | Bacteria | 1128 |
| 48 | Ga0070674_100159742 | 3300005356 | Bacteria | 1709 |
| 49 | Ga0070674_100212603 | 3300005356 | Bacteria | 1500 |
| 50 | Ga0070674_100486923 | 3300005356 | Bacteria | 1025 |
| 51 | Ga0070673_100224025 | 3300005364 | Bacteria | 1629 |
| 52 | Ga0070659_100002112 | 3300005366 | Bacteria | 14160 |
| 53 | Ga0070659_100035528 | 3300005366 | Bacteria | 3881 |
| 54 | Ga0070659_100138576 | 3300005366 | Bacteria | 1980 |
| 55 | Ga0070659_100180359 | 3300005366 | Bacteria | 1733 |
| 56 | Ga0070659_100265179 | 3300005366 | Bacteria | 1426 |
| 57 | Ga0070659_100317224 | 3300005366 | Bacteria | 1302 |
| 58 | Ga0070667_100041998 | 3300005367 | Bacteria | 3835 |
| 59 | Ga0070703_10006246 | 3300005406 | Bacteria | 3338 |
| 60 | Ga0070709_10023197 | 3300005434 | Bacteria | 3641 |
| 61 | Ga0070709_10118497 | 3300005434 | Bacteria | 1790 |
| 62 | Ga0070709_10145309 | 3300005434 | Bacteria | 1633 |
| 63 | Ga0070709_10537536 | 3300005434 | Bacteria | 893 |
| 64 | Ga0070714_100000894 | 3300005435 | Bacteria | 21143 |
| 65 | Ga0070714_100040769 | 3300005435 | Bacteria | 3915 |
| 66 | Ga0070714_100203415 | 3300005435 | Bacteria | 1812 |
| 67 | Ga0070714_100258495 | 3300005435 | Bacteria | 1612 |
| 68 | Ga0070714_100305226 | 3300005435 | Bacteria | 1485 |
| 69 | Ga0070714_100879266 | 3300005435 | Bacteria | 870 |
| 70 | Ga0070713_100027607 | 3300005436 | Bacteria | 4470 |
| 71 | Ga0070713_100065337 | 3300005436 | Bacteria | 3056 |
| 72 | Ga0070713_100101830 | 3300005436 | Bacteria | 2489 |
| 73 | Ga0070713_100130668 | 3300005436 | Bacteria | 2214 |
| 74 | Ga0070713_100853264 | 3300005436 | Bacteria | 874 |
| 75 | Ga0070710_10017218 | 3300005437 | Bacteria | 3694 |
| 76 | Ga0070710_10035441 | 3300005437 | Bacteria | 2720 |
| 77 | Ga0070710_10267480 | 3300005437 | Bacteria | 1104 |
| 78 | Ga0070711_100011836 | 3300005439 | Bacteria | 5429 |
| 79 | Ga0070711_100140480 | 3300005439 | Bacteria | 1810 |
| 80 | Ga0070711_100173013 | 3300005439 | Bacteria | 1647 |
| 81 | Ga0070711_100231475 | 3300005439 | Bacteria | 1441 |
| 82 | Ga0070711_100240861 | 3300005439 | Bacteria | 1414 |
| 83 | Ga0070711_100252691 | 3300005439 | Bacteria | 1383 |
| 84 | Ga0070705_100015867 | 3300005440 | Bacteria | 3902 |
| 85 | Ga0070700_100100786 | 3300005441 | Bacteria | 1902 |
| 86 | Ga0070700_100136824 | 3300005441 | Bacteria | 1660 |
| 87 | Ga0070700_100463669 | 3300005441 | Bacteria | 967 |
| 88 | Ga0070694_100111554 | 3300005444 | Bacteria | 1949 |
| 89 | Ga0070694_100352407 | 3300005444 | Bacteria | 1141 |
| 90 | Ga0070694_100561933 | 3300005444 | Bacteria | 915 |
| 91 | Ga0070708_100706627 | 3300005445 | Bacteria | 949 |
| 92 | Ga0070663_100043131 | 3300005455 | Bacteria | 3173 |
| 93 | Ga0070663_100211538 | 3300005455 | Bacteria | 1518 |
| 94 | Ga0070663_100626514 | 3300005455 | Bacteria | 907 |
| 95 | Ga0070678_100029931 | 3300005456 | Bacteria | 3735 |
| 96 | Ga0070678_100077314 | 3300005456 | Bacteria | 2510 |
| 97 | Ga0070662_100116546 | 3300005457 | Bacteria | 2042 |
| 98 | Ga0070662_100143536 | 3300005457 | Bacteria | 1852 |
| 99 | Ga0070662_100621682 | 3300005457 | Bacteria | 910 |
| 100 | Ga0070681_10064650 | 3300005458 | Bacteria | 3628 |
| 101 | Ga0070681_10302911 | 3300005458 | Bacteria | 1508 |
| 102 | Ga0068867_100181007 | 3300005459 | Bacteria | 1676 |
| 103 | Ga0070685_10259144 | 3300005466 | Bacteria | 1156 |
| 104 | Ga0070707_100455379 | 3300005468 | Bacteria | 1240 |
| 105 | Ga0070679_100016072 | 3300005530 | Bacteria | 7209 |
| 106 | Ga0070679_100036601 | 3300005530 | Bacteria | 4871 |
| 107 | Ga0070679_100457522 | 3300005530 | Bacteria | 1221 |
| 108 | Ga0070679_100572839 | 3300005530 | Bacteria | 1073 |
| 109 | Ga0070684_100003769 | 3300005535 | Bacteria | 11448 |
| 110 | Ga0070684_100032430 | 3300005535 | Bacteria | 4452 |
| 111 | Ga0070684_100033498 | 3300005535 | Bacteria | 4386 |
| 112 | Ga0070684_100036808 | 3300005535 | Bacteria | 4194 |
| 113 | Ga0070684_100056138 | 3300005535 | Bacteria | 3435 |
| 114 | Ga0070684_100056369 | 3300005535 | Bacteria | 3429 |
| 115 | Ga0070684_100141597 | 3300005535 | Bacteria | 2175 |
| 116 | Ga0070684_100197372 | 3300005535 | Bacteria | 1832 |
| 117 | Ga0070684_100700963 | 3300005535 | Bacteria | 944 |
| 118 | Ga0068853_100110199 | 3300005539 | Bacteria | 2445 |
| 119 | Ga0068853_100380756 | 3300005539 | Bacteria | 1317 |
| 120 | Ga0070686_100037841 | 3300005544 | Bacteria | 2995 |
| 121 | Ga0070686_100042074 | 3300005544 | Bacteria | 2860 |
| 122 | Ga0070686_100138609 | 3300005544 | Bacteria | 1691 |
| 123 | Ga0070686_100256874 | 3300005544 | Bacteria | 1279 |
| 124 | Ga0070695_100424844 | 3300005545 | Bacteria | 1013 |
| 125 | Ga0070696_100010038 | 3300005546 | Bacteria | 6334 |
| 126 | Ga0070696_100022542 | 3300005546 | Bacteria | 4279 |
| 127 | Ga0070696_100078536 | 3300005546 | Bacteria | 2334 |
| 128 | Ga0070696_100138758 | 3300005546 | Bacteria | 1775 |
| 129 | Ga0070696_100144071 | 3300005546 | Bacteria | 1744 |
| 130 | Ga0070693_100007320 | 3300005547 | Bacteria | 5390 |
| 131 | Ga0070693_100042559 | 3300005547 | Bacteria | 2559 |
| 132 | Ga0070665_100341887 | 3300005548 | Bacteria | 1501 |
| 133 | Ga0070665_100362696 | 3300005548 | Bacteria | 1455 |
| 134 | Ga0070665_100377053 | 3300005548 | Bacteria | 1426 |
| 135 | Ga0070704_100013449 | 3300005549 | Bacteria | 5080 |
| 136 | Ga0070704_100068922 | 3300005549 | Bacteria | 2561 |
| 137 | Ga0068855_100012401 | 3300005563 | Bacteria | 10293 |
| 138 | Ga0068855_100023543 | 3300005563 | Bacteria | 7374 |
| 139 | Ga0068855_100321570 | 3300005563 | Bacteria | 1710 |
| 140 | Ga0068855_100486488 | 3300005563 | Bacteria | 1343 |
| 141 | Ga0070664_100195323 | 3300005564 | Bacteria | 1804 |
| 142 | Ga0070664_100206575 | 3300005564 | Bacteria | 1754 |
| 143 | Ga0070664_100367883 | 3300005564 | Bacteria | 1310 |
| 144 | Ga0070664_100581342 | 3300005564 | Bacteria | 1038 |
| 145 | Ga0068857_100001692 | 3300005577 | Bacteria | 17733 |
| 146 | Ga0068857_100014191 | 3300005577 | Bacteria | 6938 |
| 147 | Ga0068857_100722924 | 3300005577 | Bacteria | 947 |
| 148 | Ga0068854_100056597 | 3300005578 | Bacteria | 2827 |
| 149 | Ga0068854_100195568 | 3300005578 | Bacteria | 1587 |
| 150 | Ga0068856_100013828 | 3300005614 | Bacteria | 7802 |
| 151 | Ga0068856_100024559 | 3300005614 | Bacteria | 5868 |
| 152 | Ga0068856_100088553 | 3300005614 | Bacteria | 3078 |
| 153 | Ga0068856_100376453 | 3300005614 | Bacteria | 1439 |
| 154 | Ga0068856_100601052 | 3300005614 | Bacteria | 1121 |
| 155 | Ga0070702_100067949 | 3300005615 | Bacteria | 2096 |
| 156 | Ga0068852_100009339 | 3300005616 | Bacteria | 7280 |
| 157 | Ga0068852_100593127 | 3300005616 | Bacteria | 1112 |
| 158 | Ga0068859_100013627 | 3300005617 | Bacteria | 8151 |
| 159 | Ga0068859_100271115 | 3300005617 | Bacteria | 1789 |
| 160 | Ga0068859_100403685 | 3300005617 | Bacteria | 1463 |
| 161 | Ga0068859_100432310 | 3300005617 | Bacteria | 1413 |
| 162 | Ga0068864_100064564 | 3300005618 | Bacteria | 3175 |
| 163 | Ga0068861_100150032 | 3300005719 | Bacteria | 1912 |
| 164 | Ga0068870_10134947 | 3300005840 | Bacteria | 1438 |
| 165 | Ga0068870_10255196 | 3300005840 | Bacteria | 1089 |
| 166 | Ga0068870_10321776 | 3300005840 | Bacteria | 983 |
| 167 | Ga0068863_100083410 | 3300005841 | Bacteria | 3029 |
| 168 | Ga0068858_100077971 | 3300005842 | Bacteria | 3078 |
| 169 | Ga0068860_100084965 | 3300005843 | Bacteria | 3010 |
| 170 | Ga0068862_100707180 | 3300005844 | Bacteria | 977 |
| 171 | Ga0081455_10024797 | 3300005937 | Bacteria | 5545 |
| 172 | Ga0081455_10025518 | 3300005937 | Bacteria | 5453 |
| 173 | Ga0081455_10170847 | 3300005937 | Bacteria | 1656 |
| 174 | Ga0081538_10021579 | 3300005981 | Bacteria | 4691 |
| 175 | Ga0081540_1003230 | 3300005983 | Bacteria | 12988 |
| 176 | Ga0081540_1004696 | 3300005983 | Bacteria | 10338 |
| 177 | Ga0081540_1014407 | 3300005983 | Bacteria | 5064 |
| 178 | Ga0081539_10001518 | 3300005985 | Bacteria | 38975 |
| 179 | Ga0081539_10006277 | 3300005985 | Bacteria | 11490 |
| 180 | Ga0081539_10059860 | 3300005985 | Bacteria | 2094 |
| 181 | Ga0070717_10001730 | 3300006028 | Bacteria | 15232 |
| 182 | Ga0070717_10039495 | 3300006028 | Bacteria | 3840 |
| 183 | Ga0070717_10040314 | 3300006028 | Bacteria | 3803 |
| 184 | Ga0070717_10246009 | 3300006028 | Bacteria | 1579 |
| 185 | Ga0070717_10370869 | 3300006028 | Bacteria | 1282 |
| 186 | Ga0075432_10019292 | 3300006058 | Bacteria | 2329 |
| 187 | Ga0070716_100016508 | 3300006173 | Bacteria | 3812 |
| 188 | Ga0070716_100166307 | 3300006173 | Bacteria | 1434 |
| 189 | Ga0070716_100347385 | 3300006173 | Bacteria | 1049 |
| 190 | Ga0070712_100022962 | 3300006175 | Bacteria | 4113 |
| 191 | Ga0070712_100384053 | 3300006175 | Bacteria | 1157 |
| 192 | Ga0070712_100645992 | 3300006175 | Bacteria | 899 |
| 193 | Ga0097621_100053228 | 3300006237 | Bacteria | 3299 |
| 194 | Ga0097621_100113335 | 3300006237 | Bacteria | 2294 |
| 195 | Ga0097621_100378741 | 3300006237 | Bacteria | 1263 |
| 196 | Ga0068871_100065208 | 3300006358 | Bacteria | 2982 |
| 197 | Ga0075428_100023749 | 3300006844 | Bacteria | 6785 |
| 198 | Ga0075430_100043862 | 3300006846 | Bacteria | 3782 |
| 199 | Ga0075431_100068089 | 3300006847 | Bacteria | 3674 |
| 200 | Ga0075433_10284126 | 3300006852 | Bacteria | 1466 |
| 201 | Ga0075434_100000357 | 3300006871 | Bacteria | 33121 |
| 202 | Ga0075434_100022375 | 3300006871 | Bacteria | 6156 |
| 203 | Ga0075434_100043392 | 3300006871 | Bacteria | 4461 |
| 204 | Ga0075434_100047366 | 3300006871 | Bacteria | 4266 |
| 205 | Ga0068865_100093452 | 3300006881 | Bacteria | 2187 |
| 206 | Ga0068865_100121384 | 3300006881 | Bacteria | 1944 |
| 207 | Ga0068865_100334097 | 3300006881 | Bacteria | 1223 |
| 208 | Ga0075436_100010725 | 3300006914 | Bacteria | 6285 |
| 209 | Ga0075436_100021002 | 3300006914 | Bacteria | 4479 |
| 210 | Ga0075436_100168380 | 3300006914 | Bacteria | 1547 |
| 211 | Ga0097620_100013627 | 3300006931 | Bacteria | 8151 |
| 212 | Ga0097620_100271117 | 3300006931 | Bacteria | 1789 |
| 213 | Ga0097620_100403685 | 3300006931 | Bacteria | 1463 |
| 214 | Ga0097620_100432341 | 3300006931 | Bacteria | 1413 |
| 215 | Ga0075435_100002080 | 3300007076 | Bacteria | 13133 |
| 216 | Ga0075435_100060922 | 3300007076 | Bacteria | 3060 |
| 217 | Ga0075435_100153173 | 3300007076 | Bacteria | 1939 |
| 218 | Ga0075435_100291479 | 3300007076 | Bacteria | 1394 |
| 219 | Ga0105240_10012384 | 3300009093 | Bacteria | 11778 |
| 220 | Ga0105240_10058663 | 3300009093 | Bacteria | 4805 |
| 221 | Ga0105240_10124671 | 3300009093 | Bacteria | 3097 |
| 222 | Ga0111539_10010762 | 3300009094 | Bacteria | 11514 |
| 223 | Ga0111539_10018092 | 3300009094 | Bacteria | 8730 |
| 224 | Ga0111539_10057998 | 3300009094 | Bacteria | 4595 |
| 225 | Ga0111539_10290047 | 3300009094 | Bacteria | 1904 |
| 226 | Ga0111539_10389091 | 3300009094 | Bacteria | 1624 |
| 227 | Ga0111539_10500846 | 3300009094 | Bacteria | 1415 |
| 228 | Ga0111539_10616445 | 3300009094 | Bacteria | 1264 |
| 229 | Ga0111539_11381875 | 3300009094 | Bacteria | 817 |
| 230 | Ga0105245_10014744 | 3300009098 | Bacteria | 6807 |
| 231 | Ga0105245_10024857 | 3300009098 | Bacteria | 5264 |
| 232 | Ga0105245_10055645 | 3300009098 | Bacteria | 3554 |
| 233 | Ga0105245_10077160 | 3300009098 | Bacteria | 3037 |
| 234 | Ga0105245_10172545 | 3300009098 | Bacteria | 2060 |
| 235 | Ga0105245_10288170 | 3300009098 | Bacteria | 1607 |
| 236 | Ga0105247_10006155 | 3300009101 | Bacteria | 7453 |
| 237 | Ga0105247_10060638 | 3300009101 | Bacteria | 2345 |
| 238 | Ga0105247_10148665 | 3300009101 | Bacteria | 1542 |
| 239 | Ga0114129_10000964 | 3300009147 | Bacteria | 37590 |
| 240 | Ga0114129_10160851 | 3300009147 | Bacteria | 3067 |
| 241 | Ga0114129_10240886 | 3300009147 | Bacteria | 2431 |
| 242 | Ga0114129_10384152 | 3300009147 | Bacteria | 1854 |
| 243 | Ga0114129_10816256 | 3300009147 | Bacteria | 1189 |
| 244 | Ga0105243_10007690 | 3300009148 | Bacteria | 8282 |
| 245 | Ga0105243_10467465 | 3300009148 | Bacteria | 1187 |
| 246 | Ga0105241_10007849 | 3300009174 | Bacteria | 7849 |
| 247 | Ga0105241_10063163 | 3300009174 | Bacteria | 2856 |
| 248 | Ga0105242_10169251 | 3300009176 | Bacteria | 1919 |
| 249 | Ga0105242_10322018 | 3300009176 | Bacteria | 1418 |
| 250 | Ga0105242_10382403 | 3300009176 | Bacteria | 1309 |
| 251 | Ga0105242_10954151 | 3300009176 | Bacteria | 862 |
| 252 | Ga0105248_10084082 | 3300009177 | Bacteria | 3580 |
| 253 | Ga0105248_10467329 | 3300009177 | Bacteria | 1422 |
| 254 | Ga0105237_10019190 | 3300009545 | Bacteria | 7064 |
| 255 | Ga0105237_10077168 | 3300009545 | Bacteria | 3322 |
| 256 | Ga0105237_10117776 | 3300009545 | Bacteria | 2650 |
| 257 | Ga0105237_10632288 | 3300009545 | Bacteria | 1077 |
| 258 | Ga0105237_10851122 | 3300009545 | Bacteria | 919 |
| 259 | Ga0105238_10011067 | 3300009551 | Bacteria | 9066 |
| 260 | Ga0105238_10056023 | 3300009551 | Bacteria | 3955 |
| 261 | Ga0105238_10314471 | 3300009551 | Bacteria | 1551 |
| 262 | Ga0105249_10003207 | 3300009553 | Bacteria | 14156 |
| 263 | Ga0105249_10214729 | 3300009553 | Bacteria | 1890 |
| 264 | Ga0105239_10015168 | 3300010375 | Bacteria | 8540 |
| 265 | Ga0105239_10218383 | 3300010375 | Bacteria | 2138 |
| 266 | Ga0105239_10237974 | 3300010375 | Bacteria | 2043 |
| 267 | Ga0105239_10347378 | 3300010375 | Bacteria | 1675 |
| 268 | Ga0105239_10581810 | 3300010375 | Bacteria | 1276 |
| 269 | Ga0105239_10589137 | 3300010375 | Bacteria | 1268 |
| 270 | Ga0105246_10004642 | 3300011119 | Bacteria | 8361 |
| 271 | Ga0105246_10054641 | 3300011119 | Bacteria | 2753 |
| 272 | Ga0105246_10147892 | 3300011119 | Bacteria | 1775 |
| 273 | Ga0105246_10442329 | 3300011119 | Bacteria | 1090 |
| 274 | Ga0157373_10093518 | 3300013100 | Bacteria | 2117 |
| 275 | Ga0157373_10256934 | 3300013100 | Bacteria | 1236 |
| 276 | Ga0157370_10070259 | 3300013104 | Bacteria | 3305 |
| 277 | Ga0157370_10210702 | 3300013104 | Bacteria | 1801 |
| 278 | Ga0157370_10519018 | 3300013104 | Bacteria | 1093 |
| 279 | Ga0157369_10004927 | 3300013105 | Bacteria | 15642 |
| 280 | Ga0157369_10024850 | 3300013105 | Bacteria | 6656 |
| 281 | Ga0157369_10034367 | 3300013105 | Bacteria | 5564 |
| 282 | Ga0157369_10131855 | 3300013105 | Bacteria | 2648 |
| 283 | Ga0157369_10261093 | 3300013105 | Bacteria | 1806 |
| 284 | Ga0157369_10460022 | 3300013105 | Bacteria | 1317 |
| 285 | Ga0157369_11024190 | 3300013105 | Bacteria | 845 |
| 286 | Ga0157374_10032740 | 3300013296 | Bacteria | 4736 |
| 287 | Ga0157374_10076470 | 3300013296 | Bacteria | 3166 |
| 288 | Ga0157374_11001503 | 3300013296 | Bacteria | 855 |
| 289 | Ga0157378_10304914 | 3300013297 | Bacteria | 1542 |
| 290 | Ga0157378_10602955 | 3300013297 | Bacteria | 1110 |
| 291 | Ga0163162_10042103 | 3300013306 | Bacteria | 4570 |
| 292 | Ga0163162_10071429 | 3300013306 | Bacteria | 3524 |
| 293 | Ga0163162_10135036 | 3300013306 | Bacteria | 2578 |
| 294 | Ga0163162_10409778 | 3300013306 | Bacteria | 1488 |
| 295 | Ga0157372_10034956 | 3300013307 | Bacteria | 5530 |
| 296 | Ga0157372_10179199 | 3300013307 | Bacteria | 2453 |
| 297 | Ga0157372_10228743 | 3300013307 | Bacteria | 2156 |
| 298 | Ga0157372_10284266 | 3300013307 | Bacteria | 1924 |
| 299 | Ga0157372_10975662 | 3300013307 | Bacteria | 982 |
| 300 | Ga0157375_10583298 | 3300013308 | Bacteria | 1278 |
| 301 | Ga0157375_10600903 | 3300013308 | Bacteria | 1259 |
| 302 | Ga0157375_10614609 | 3300013308 | Bacteria | 1245 |
| 303 | Ga0157375_10666074 | 3300013308 | Bacteria | 1196 |
| 304 | Ga0163163_10096785 | 3300014325 | Bacteria | 2972 |
| 305 | Ga0157380_10813770 | 3300014326 | Bacteria | 952 |
| 306 | Ga0157380_11109977 | 3300014326 | Bacteria | 830 |
| 307 | Ga0182008_10042296 | 3300014497 | Bacteria | 2270 |
| 308 | Ga0157377_10018950 | 3300014745 | Bacteria | 3588 |
| 309 | Ga0157377_10045124 | 3300014745 | Bacteria | 2461 |
| 310 | Ga0157377_10404210 | 3300014745 | Bacteria | 931 |
| 311 | Ga0157379_10073420 | 3300014968 | Bacteria | 3062 |
| 312 | Ga0157379_10100042 | 3300014968 | Bacteria | 2603 |
| 313 | Ga0157376_10242432 | 3300014969 | Bacteria | 1680 |
| 314 | Ga0163161_10010967 | 3300017792 | Bacteria | 6279 |
| 315 | Ga0197907_11206444 | 3300020069 | Bacteria | 1054 |
| 316 | Ga0206349_1873883 | 3300020075 | Bacteria | 1268 |
| 317 | Ga0206352_11153564 | 3300020078 | Bacteria | 1428 |
| 318 | Ga0206350_11033092 | 3300020080 | Bacteria | 2101 |
| 319 | Ga0206354_10061286 | 3300020081 | Bacteria | 960 |
| 320 | Ga0206354_10185715 | 3300020081 | Bacteria | 832 |
| 321 | Ga0206353_10429344 | 3300020082 | Bacteria | 2195 |
| 322 | Ga0206353_10573116 | 3300020082 | Bacteria | 3211 |
| 323 | Ga0206353_11625264 | 3300020082 | Bacteria | 3426 |
| 324 | Ga0206353_11644797 | 3300020082 | Bacteria | 5711 |
| 325 | Ga0213876_10174384 | 3300021384 | Bacteria | 1144 |
| 326 | Ga0224712_10009451 | 3300022467 | Bacteria | 2939 |
| 327 | Ga0207653_10010934 | 3300025885 | Bacteria | 2833 |
| 328 | Ga0207692_10020153 | 3300025898 | Bacteria | 3027 |
| 329 | Ga0207642_10042375 | 3300025899 | Bacteria | 2000 |
| 330 | Ga0207642_10267953 | 3300025899 | Bacteria | 977 |
| 331 | Ga0207710_10005704 | 3300025900 | Bacteria | 5346 |
| 332 | Ga0207688_10003011 | 3300025901 | Bacteria | 9179 |
| 333 | Ga0207688_10137833 | 3300025901 | Bacteria | 1434 |
| 334 | Ga0207688_10401540 | 3300025901 | Bacteria | 850 |
| 335 | Ga0207680_10211107 | 3300025903 | Bacteria | 1327 |
| 336 | Ga0207699_10131636 | 3300025906 | Bacteria | 1632 |
| 337 | Ga0207699_10143776 | 3300025906 | Bacteria | 1570 |
| 338 | Ga0207699_10298930 | 3300025906 | Bacteria | 1123 |
| 339 | Ga0207699_10449417 | 3300025906 | Bacteria | 924 |
| 340 | Ga0207643_10093787 | 3300025908 | Bacteria | 1753 |
| 341 | Ga0207643_10212103 | 3300025908 | Bacteria | 1182 |
| 342 | Ga0207643_10305642 | 3300025908 | Bacteria | 990 |
| 343 | Ga0207705_10013838 | 3300025909 | Bacteria | 5818 |
| 344 | Ga0207705_10027414 | 3300025909 | Bacteria | 4063 |
| 345 | Ga0207654_10435836 | 3300025911 | Bacteria | 917 |
| 346 | Ga0207707_10006640 | 3300025912 | Bacteria | 10096 |
| 347 | Ga0207707_10042472 | 3300025912 | Bacteria | 3967 |
| 348 | Ga0207707_10191135 | 3300025912 | Bacteria | 1786 |
| 349 | Ga0207695_10016948 | 3300025913 | Bacteria | 8501 |
| 350 | Ga0207695_10086032 | 3300025913 | Bacteria | 3171 |
| 351 | Ga0207671_10033696 | 3300025914 | Bacteria | 3808 |
| 352 | Ga0207671_10100781 | 3300025914 | Bacteria | 2187 |
| 353 | Ga0207671_10573534 | 3300025914 | Bacteria | 900 |
| 354 | Ga0207693_10003776 | 3300025915 | Bacteria | 12901 |
| 355 | Ga0207693_10005429 | 3300025915 | Bacteria | 10632 |
| 356 | Ga0207693_10026494 | 3300025915 | Bacteria | 4589 |
| 357 | Ga0207693_10172684 | 3300025915 | Bacteria | 1702 |
| 358 | Ga0207663_10024658 | 3300025916 | Bacteria | 3466 |
| 359 | Ga0207663_10027118 | 3300025916 | Bacteria | 3334 |
| 360 | Ga0207663_10043010 | 3300025916 | Bacteria | 2763 |
| 361 | Ga0207663_10122300 | 3300025916 | Bacteria | 1784 |
| 362 | Ga0207663_10159991 | 3300025916 | Bacteria | 1589 |
| 363 | Ga0207660_10066430 | 3300025917 | Bacteria | 2609 |
| 364 | Ga0207662_10142139 | 3300025918 | Bacteria | 1521 |
| 365 | Ga0207657_10008699 | 3300025919 | Bacteria | 10276 |
| 366 | Ga0207657_10010785 | 3300025919 | Bacteria | 9099 |
| 367 | Ga0207657_10041090 | 3300025919 | Bacteria | 4091 |
| 368 | Ga0207657_10041625 | 3300025919 | Bacteria | 4061 |
| 369 | Ga0207652_10003326 | 3300025921 | Bacteria | 13311 |
| 370 | Ga0207652_10087129 | 3300025921 | Bacteria | 2738 |
| 371 | Ga0207652_10163155 | 3300025921 | Bacteria | 1998 |
| 372 | Ga0207652_10297693 | 3300025921 | Bacteria | 1456 |
| 373 | Ga0207652_10512315 | 3300025921 | Bacteria | 1080 |
| 374 | Ga0207652_10567119 | 3300025921 | Bacteria | 1019 |
| 375 | Ga0207694_10031822 | 3300025924 | Bacteria | 4032 |
| 376 | Ga0207694_10097251 | 3300025924 | Bacteria | 2329 |
| 377 | Ga0207659_10821627 | 3300025926 | Bacteria | 799 |
| 378 | Ga0207687_10017701 | 3300025927 | Bacteria | 4696 |
| 379 | Ga0207687_10022609 | 3300025927 | Bacteria | 4186 |
| 380 | Ga0207687_10047667 | 3300025927 | Bacteria | 2971 |
| 381 | Ga0207687_10067045 | 3300025927 | Bacteria | 2552 |
| 382 | Ga0207700_10013246 | 3300025928 | Bacteria | 5357 |
| 383 | Ga0207700_10061784 | 3300025928 | Bacteria | 2842 |
| 384 | Ga0207700_10299251 | 3300025928 | Bacteria | 1389 |
| 385 | Ga0207664_10001985 | 3300025929 | Bacteria | 13470 |
| 386 | Ga0207664_10051585 | 3300025929 | Bacteria | 3249 |
| 387 | Ga0207664_10197554 | 3300025929 | Bacteria | 1735 |
| 388 | Ga0207664_10202980 | 3300025929 | Bacteria | 1712 |
| 389 | Ga0207664_10345857 | 3300025929 | Bacteria | 1315 |
| 390 | Ga0207664_10717582 | 3300025929 | Bacteria | 899 |
| 391 | Ga0207664_10810120 | 3300025929 | Bacteria | 842 |
| 392 | Ga0207644_10198206 | 3300025931 | Bacteria | 1583 |
| 393 | Ga0207690_10010476 | 3300025932 | Bacteria | 5512 |
| 394 | Ga0207690_10108565 | 3300025932 | Bacteria | 1995 |
| 395 | Ga0207690_10119030 | 3300025932 | Bacteria | 1915 |
| 396 | Ga0207706_10096563 | 3300025933 | Bacteria | 2599 |
| 397 | Ga0207706_10199289 | 3300025933 | Bacteria | 1756 |
| 398 | Ga0207686_10072983 | 3300025934 | Bacteria | 2213 |
| 399 | Ga0207686_10730765 | 3300025934 | Bacteria | 789 |
| 400 | Ga0207709_10639753 | 3300025935 | Bacteria | 846 |
| 401 | Ga0207669_10303958 | 3300025937 | Bacteria | 1214 |
| 402 | Ga0207669_10429659 | 3300025937 | Bacteria | 1042 |
| 403 | Ga0207704_10115182 | 3300025938 | Bacteria | 1826 |
| 404 | Ga0207704_10205514 | 3300025938 | Bacteria | 1445 |
| 405 | Ga0207704_10235920 | 3300025938 | Bacteria | 1363 |
| 406 | Ga0207704_10317841 | 3300025938 | Bacteria | 1200 |
| 407 | Ga0207665_10000195 | 3300025939 | Bacteria | 40705 |
| 408 | Ga0207665_10000601 | 3300025939 | Bacteria | 24179 |
| 409 | Ga0207665_10006663 | 3300025939 | Bacteria | 7663 |
| 410 | Ga0207665_10075692 | 3300025939 | Bacteria | 2306 |
| 411 | Ga0207665_10141432 | 3300025939 | Bacteria | 1716 |
| 412 | Ga0207665_10741370 | 3300025939 | Bacteria | 774 |
| 413 | Ga0207691_10256887 | 3300025940 | Bacteria | 1507 |
| 414 | Ga0207711_10107641 | 3300025941 | Bacteria | 2475 |
| 415 | Ga0207711_10743703 | 3300025941 | Bacteria | 914 |
| 416 | Ga0207689_10150182 | 3300025942 | Bacteria | 1920 |
| 417 | Ga0207661_10004881 | 3300025944 | Bacteria | 9399 |
| 418 | Ga0207661_10018064 | 3300025944 | Bacteria | 5235 |
| 419 | Ga0207661_10078497 | 3300025944 | Bacteria | 2718 |
| 420 | Ga0207661_10131215 | 3300025944 | Bacteria | 2146 |
| 421 | Ga0207661_10414096 | 3300025944 | Bacteria | 1223 |
| 422 | Ga0207661_10572798 | 3300025944 | Bacteria | 1035 |
| 423 | Ga0207661_10740606 | 3300025944 | Bacteria | 904 |
| 424 | Ga0207679_10033818 | 3300025945 | Bacteria | 3601 |
| 425 | Ga0207679_10073438 | 3300025945 | Bacteria | 2588 |
| 426 | Ga0207679_10080268 | 3300025945 | Bacteria | 2490 |
| 427 | Ga0207667_10038972 | 3300025949 | Bacteria | 5067 |
| 428 | Ga0207667_10186461 | 3300025949 | Bacteria | 2129 |
| 429 | Ga0207651_10162611 | 3300025960 | Bacteria | 1752 |
| 430 | Ga0207712_10038177 | 3300025961 | Bacteria | 3283 |
| 431 | Ga0207712_10492181 | 3300025961 | Bacteria | 1047 |
| 432 | Ga0207668_10158996 | 3300025972 | Bacteria | 1758 |
| 433 | Ga0207640_10022492 | 3300025981 | Bacteria | 3774 |
| 434 | Ga0207640_10747772 | 3300025981 | Bacteria | 843 |
| 435 | Ga0207658_10096596 | 3300025986 | Bacteria | 2305 |
| 436 | Ga0207677_10177629 | 3300026023 | Bacteria | 1672 |
| 437 | Ga0207677_10255939 | 3300026023 | Bacteria | 1424 |
| 438 | Ga0207677_10331833 | 3300026023 | Bacteria | 1268 |
| 439 | Ga0207703_10039187 | 3300026035 | Bacteria | 3786 |
| 440 | Ga0207703_10361769 | 3300026035 | Bacteria | 1338 |
| 441 | Ga0207703_10426431 | 3300026035 | Bacteria | 1235 |
| 442 | Ga0207639_10032180 | 3300026041 | Bacteria | 3859 |
| 443 | Ga0207639_10107751 | 3300026041 | Bacteria | 2264 |
| 444 | Ga0207639_10217847 | 3300026041 | Bacteria | 1647 |
| 445 | Ga0207678_10041636 | 3300026067 | Bacteria | 3982 |
| 446 | Ga0207678_10058655 | 3300026067 | Bacteria | 3312 |
| 447 | Ga0207678_10392052 | 3300026067 | Bacteria | 1201 |
| 448 | Ga0207678_10473383 | 3300026067 | Bacteria | 1090 |
| 449 | Ga0207708_10010964 | 3300026075 | Bacteria | 6743 |
| 450 | Ga0207708_10049128 | 3300026075 | Bacteria | 3212 |
| 451 | Ga0207708_10155372 | 3300026075 | Bacteria | 1804 |
| 452 | Ga0207708_10258905 | 3300026075 | Bacteria | 1404 |
| 453 | Ga0207702_10080103 | 3300026078 | Bacteria | 2833 |
| 454 | Ga0207702_10123558 | 3300026078 | Bacteria | 2320 |
| 455 | Ga0207702_10425791 | 3300026078 | Bacteria | 1284 |
| 456 | Ga0207702_10717445 | 3300026078 | Bacteria | 986 |
| 457 | Ga0207641_10235639 | 3300026088 | Bacteria | 1703 |
| 458 | Ga0207648_10016526 | 3300026089 | Bacteria | 6739 |
| 459 | Ga0207648_10032621 | 3300026089 | Bacteria | 4596 |
| 460 | Ga0207676_10097948 | 3300026095 | Bacteria | 2424 |
| 461 | Ga0207676_10166602 | 3300026095 | Bacteria | 1915 |
| 462 | Ga0207674_10001054 | 3300026116 | Bacteria | 35890 |
| 463 | Ga0207674_10016986 | 3300026116 | Bacteria | 7946 |
| 464 | Ga0207674_10044896 | 3300026116 | Bacteria | 4550 |
| 465 | Ga0207674_10196363 | 3300026116 | Bacteria | 1967 |
| 466 | Ga0207674_10326149 | 3300026116 | Bacteria | 1485 |
| 467 | Ga0207675_100201450 | 3300026118 | Bacteria | 1912 |
| 468 | Ga0207675_100394787 | 3300026118 | Bacteria | 1362 |
| 469 | Ga0207683_10000833 | 3300026121 | Bacteria | 28215 |
| 470 | Ga0207683_10003692 | 3300026121 | Bacteria | 13301 |
| 471 | Ga0207683_10035215 | 3300026121 | Bacteria | 4354 |
| 472 | Ga0207698_10005457 | 3300026142 | Bacteria | 7863 |
| 473 | Ga0207698_10043814 | 3300026142 | Bacteria | 3356 |
| 474 | Ga0207698_10504537 | 3300026142 | Bacteria | 1178 |
| 475 | Ga0207428_10028092 | 3300027907 | Bacteria | 4677 |
| 476 | Ga0207428_10053368 | 3300027907 | Bacteria | 3224 |
| 477 | Ga0207428_10088595 | 3300027907 | Bacteria | 2407 |
| 478 | Ga0207428_10267106 | 3300027907 | Bacteria | 1273 |
| 479 | Ga0268266_10263857 | 3300028379 | Bacteria | 1597 |
| 480 | Ga0268264_10201930 | 3300028381 | Bacteria | 1819 |
| 481 | Ga0268264_10481552 | 3300028381 | Bacteria | 1207 |
| 482 | Ga0265318_10024441 | 3300028577 | Bacteria | 2396 |
| 483 | Ga0265318_10166566 | 3300028577 | Bacteria | 808 |
| 484 | Ga0307515_10010678 | 3300028794 | Bacteria | 17557 |
| 485 | Ga0265338_10018646 | 3300028800 | Bacteria | 7415 |
| 486 | Ga0265338_10131534 | 3300028800 | Bacteria | 1974 |
| 487 | Ga0307512_10006078 | 3300030522 | Bacteria | 12358 |
| 488 | Ga0265320_10012357 | 3300031240 | Bacteria | 4977 |
| 489 | Ga0265320_10033125 | 3300031240 | Bacteria | 2640 |
| 490 | Ga0265327_10001876 | 3300031251 | Bacteria | 24313 |
| 491 | Ga0265316_10351470 | 3300031344 | Bacteria | 1067 |
| 492 | Ga0307513_10072345 | 3300031456 | Bacteria | 3594 |
| 493 | Ga0307513_10073910 | 3300031456 | Bacteria | 3547 |
| 494 | Ga0307408_100072435 | 3300031548 | Bacteria | 2551 |
| 495 | Ga0265313_10015362 | 3300031595 | Bacteria | 4464 |
| 496 | Ga0307508_10018211 | 3300031616 | Bacteria | 6383 |
| 497 | Ga0307516_10066166 | 3300031730 | Bacteria | 3487 |
| 498 | Ga0307405_10001670 | 3300031731 | Bacteria | 9457 |
| 499 | Ga0307405_10176069 | 3300031731 | Bacteria | 1531 |
| 500 | Ga0307405_10229809 | 3300031731 | Bacteria | 1367 |
| 501 | Ga0307413_10001335 | 3300031824 | Bacteria | 9219 |
| 502 | Ga0307413_10030442 | 3300031824 | Bacteria | 3032 |
| 503 | Ga0307410_10033497 | 3300031852 | Bacteria | 3317 |
| 504 | Ga0307410_10119763 | 3300031852 | Bacteria | 1918 |
| 505 | Ga0307410_10210731 | 3300031852 | Bacteria | 1489 |
| 506 | Ga0307410_10279861 | 3300031852 | Bacteria | 1309 |
| 507 | Ga0307406_10067089 | 3300031901 | Bacteria | 2338 |
| 508 | Ga0307407_10019549 | 3300031903 | Bacteria | 3452 |
| 509 | Ga0307409_100104057 | 3300031995 | Bacteria | 2363 |
| 510 | Ga0307409_100242413 | 3300031995 | Bacteria | 1642 |
| 511 | Ga0307409_100589653 | 3300031995 | Bacteria | 1097 |
| 512 | Ga0307416_100014965 | 3300032002 | Bacteria | 5339 |
| 513 | Ga0307416_100138320 | 3300032002 | Bacteria | 2208 |
| 514 | Ga0307411_10178438 | 3300032005 | Bacteria | 1609 |
| 515 | Ga0307415_100000090 | 3300032126 | Bacteria | 38246 |
| 516 | Ga0307415_100206395 | 3300032126 | Bacteria | 1563 |
| 517 | Ga0373948_0030669 | 3300034817 | Bacteria | 1082 |
| 518 | Ga0373958_0021883 | 3300034819 | Bacteria | 1190 |
| 519 | Ga0373959_0010660 | 3300034820 | Bacteria | 1610 |
| 520 | Ga0373959_0034892 | 3300034820 | Bacteria | 1032 |
| 521 | Ga0373928_0010968 | 3300035084 | Bacteria | 1787 |
| 522 | Ga0373928_0023029 | 3300035084 | Bacteria | 1326 |
| 523 | Ga0373923_0062371 | 3300035111 | Bacteria | 1586 |
| 524 | Ga0373932_0023557 | 3300035112 | Bacteria | 1648 |
| 525 | Ga0373936_0041637 | 3300035113 | Bacteria | 1843 |
| 526 | Ga0373936_0065566 | 3300035113 | Bacteria | 1490 |
| 527 | Ga0373939_0038090 | 3300035114 | Bacteria | 1432 |
| 528 | Ga0373953_0261233 | 3300035117 | Bacteria | 753 |
| 529 | Ga0373954_0088301 | 3300035118 | Bacteria | 1487 |
| 530 | Ga0373957_0054283 | 3300035120 | Bacteria | 1539 |
| 531 | Ga0373960_0021452 | 3300035121 | Bacteria | 1718 |
| 532 | Ga0373960_0080218 | 3300035121 | Bacteria | 1026 |
| 533 | Ga0373943_0028930 | 3300035170 | Bacteria | 2615 |
| 534 | Ga0373943_0039026 | 3300035170 | Bacteria | 2285 |
| 535 | Ga0373946_0023468 | 3300035171 | Bacteria | 2410 |
| 536 | Ga0373946_0072254 | 3300035171 | Bacteria | 1493 |
| 537 | Ga0373942_0004970 | 3300035207 | Bacteria | 3083 |
| 538 | Ga0373962_0006797 | 3300035242 | Bacteria | 2781 |
| 539 | Ga0373924_0110797 | 3300035410 | Bacteria | 1186 |
| 540 | Ga0373931_0050166 | 3300035691 | Bacteria | 2219 |
| 541 | Ga0373931_0209846 | 3300035691 | Bacteria | 1167 |
| 542 | Ga0373931_0301493 | 3300035691 | Bacteria | 990 |
| 543 | Ga0373935_0025226 | 3300035692 | Bacteria | 3663 |
| 544 | Ga0373935_0052604 | 3300035692 | Bacteria | 2589 |
| 545 | Ga0373935_0071196 | 3300035692 | Bacteria | 2243 |
| 546 | Ga0373935_0098951 | 3300035692 | Bacteria | 1920 |
| 547 | Ga0373935_0535900 | 3300035692 | Bacteria | 852 |
| 548 | Ga0373927_0023041 | 3300035695 | Bacteria | 4079 |
| 549 | Ga0373927_0024339 | 3300035695 | Bacteria | 3962 |
| 550 | Ga0373927_0399154 | 3300035695 | Bacteria | 907 |
| 551 | Ga0373933_0117703 | 3300035724 | Bacteria | 1662 |
| 552 | Ga0373933_0360613 | 3300035724 | Bacteria | 945 |
| 553 | Ga0373947_0004740 | 3300035725 | Bacteria | 7975 |
| 554 | Ga0373947_0021147 | 3300035725 | Bacteria | 3764 |
| 555 | Ga0373947_0252702 | 3300035725 | Bacteria | 1166 |
| 556 | Ga0373937_0263144 | 3300036401 | Bacteria | 1627 |
| 557 | Ga0373925_0003728 | 3300037068 | Bacteria | 11701 |
| 558 | Ga0373925_0008902 | 3300037068 | Bacteria | 7313 |
| 559 | Ga0373925_0334898 | 3300037068 | Bacteria | 1227 |
| 560 | Ga0395899_0013453 | 3300037312 | Bacteria | 6259 |
| 561 | Ga0395899_0085995 | 3300037312 | Bacteria | 2284 |
| 562 | Ga0395900_0002476 | 3300037418 | Bacteria | 20305 |
| 563 | Ga0395900_0005661 | 3300037418 | Bacteria | 13065 |
| 564 | Ga0395900_0335705 | 3300037418 | Bacteria | 1488 |
| 565 | Ga0395900_0965102 | 3300037418 | Bacteria | 773 |
| 566 | Ga0395898_0000647 | 3300037466 | Bacteria | 63277 |
| 567 | Ga0395898_0022090 | 3300037466 | Bacteria | 6446 |
| 568 | Ga0395898_0082928 | 3300037466 | Bacteria | 3090 |
| 569 | Ga0395898_0102264 | 3300037466 | Bacteria | 2751 |
| 570 | Ga0395898_0112047 | 3300037466 | Bacteria | 2615 |
| 571 | Ga0395898_0187817 | 3300037466 | Bacteria | 1975 |
| 572 | Ga0395905_0142028 | 3300037471 | Bacteria | 2258 |
| 573 | Ga0395901_0064172 | 3300038443 | Bacteria | 3823 |
| 574 | Ga0395901_0119196 | 3300038443 | Bacteria | 2773 |
| 575 | Ga0395901_0144437 | 3300038443 | Bacteria | 2501 |
| 576 | Ga0395901_0233642 | 3300038443 | Bacteria | 1919 |
| 577 | Ga0436365_1372001 | 3300039437 | Bacteria | 3824 |
| 578 | Ga0451791_0598011 | 3300041451 | Bacteria | 1401 |
| 579 | Ga0439448_0009987 | 3300042005 | Bacteria | 2805 |
| 580 | Ga0439459_0043442 | 3300042438 | Bacteria | 963 |
| 581 | Ga0466969_0041782 | 3300044656 | Bacteria | 2292 |
| 582 | Ga0466969_0066191 | 3300044656 | Bacteria | 1745 |
| 583 | Ga0466972_0070351 | 3300044658 | Bacteria | 1670 |
| 584 | Ga0466965_0040962 | 3300044683 | Bacteria | 2281 |
| 585 | Ga0466966_0067815 | 3300044684 | Bacteria | 2240 |
| 586 | Ga0466966_0307159 | 3300044684 | Bacteria | 953 |
| 587 | Ga0466966_0510930 | 3300044684 | Bacteria | 723 |
| 588 | Ga0466961_0001879 | 3300044693 | Bacteria | 13055 |
| 589 | Ga0466961_0023121 | 3300044693 | Bacteria | 3997 |
| 590 | Ga0466961_0148178 | 3300044693 | Bacteria | 1466 |
| 591 | Ga0466961_0361659 | 3300044693 | Bacteria | 883 |
| 592 | Ga0466963_0005079 | 3300044694 | Bacteria | 7695 |
| 593 | Ga0466963_0007154 | 3300044694 | Bacteria | 6650 |
| 594 | Ga0466963_0044231 | 3300044694 | Bacteria | 2931 |
| 595 | Ga0466963_0046606 | 3300044694 | Bacteria | 2859 |
| 596 | Ga0466963_0061384 | 3300044694 | Bacteria | 2513 |
| 597 | Ga0466963_0092197 | 3300044694 | Bacteria | 2064 |
| 598 | Ga0466963_0304400 | 3300044694 | Bacteria | 1121 |
| 599 | Ga0466964_0085699 | 3300044706 | Bacteria | 1361 |
| 600 | Ga0466964_0122863 | 3300044706 | Bacteria | 1173 |
| 601 | Ga0466964_0156447 | 3300044706 | Bacteria | 1061 |
| 602 | Ga0466971_0079697 | 3300044719 | Bacteria | 1492 |
| 603 | Ga0466968_0008725 | 3300044735 | Bacteria | 3887 |
| 604 | Ga0466968_0134188 | 3300044735 | Bacteria | 1128 |
| 605 | Ga0466970_0032328 | 3300044765 | Bacteria | 2764 |
| 606 | Ga0466970_0035361 | 3300044765 | Bacteria | 2646 |
| 607 | Ga0466970_0362818 | 3300044765 | Bacteria | 823 |
| 608 | Ga0466957_0000876 | 3300044842 | Bacteria | 15440 |
| 609 | Ga0466957_0286904 | 3300044842 | Bacteria | 1103 |
| 610 | Ga0466960_0004383 | 3300044901 | Bacteria | 5515 |
| 611 | Ga0466960_0055099 | 3300044901 | Bacteria | 1933 |
| 612 | Ga0466960_0090782 | 3300044901 | Bacteria | 1557 |
| 613 | Ga0466960_0233001 | 3300044901 | Bacteria | 1017 |
| 614 | Ga0466959_0012748 | 3300045049 | Bacteria | 6081 |
| 615 | Ga0466959_0016877 | 3300045049 | Bacteria | 5343 |
| 616 | Ga0466959_0031929 | 3300045049 | Bacteria | 3898 |
| 617 | Ga0466959_0207526 | 3300045049 | Bacteria | 1362 |
| 618 | Ga0466959_0239606 | 3300045049 | Bacteria | 1253 |
| 619 | Ga0451576_0110387 | 3300045051 | Bacteria | 2862 |
| 620 | Ga0451576_0116084 | 3300045051 | Bacteria | 2787 |
| 621 | Ga0466958_0011527 | 3300045836 | Bacteria | 4978 |
| 622 | Ga0466958_0030106 | 3300045836 | Bacteria | 3222 |
| 623 | Ga0466958_0052022 | 3300045836 | Bacteria | 2481 |
| 624 | Ga0466958_0066652 | 3300045836 | Bacteria | 2199 |
| 625 | Ga0466958_0115573 | 3300045836 | Bacteria | 1677 |
| 626 | Ga0466958_0369866 | 3300045836 | Bacteria | 924 |
| 627 | Ga0466958_0463717 | 3300045836 | Bacteria | 821 |
| 628 | Ga0466967_0001987 | 3300045976 | Bacteria | 12423 |
| 629 | Ga0466967_0003861 | 3300045976 | Bacteria | 9930 |
| 630 | Ga0466967_0005102 | 3300045976 | Bacteria | 9019 |
| 631 | Ga0466967_0006933 | 3300045976 | Bacteria | 8102 |
| 632 | Ga0466967_0024880 | 3300045976 | Bacteria | 4930 |
| 633 | Ga0466967_0039095 | 3300045976 | Bacteria | 4075 |
| 634 | Ga0466967_0087730 | 3300045976 | Bacteria | 2821 |
| 635 | Ga0466967_0102962 | 3300045976 | Bacteria | 2612 |
| 636 | Ga0466967_0146200 | 3300045976 | Bacteria | 2205 |
| 637 | Ga0466967_0159682 | 3300045976 | Bacteria | 2115 |
| 638 | Ga0466967_0238007 | 3300045976 | Bacteria | 1735 |
| 639 | Ga0466967_0273909 | 3300045976 | Bacteria | 1618 |
| 640 | Ga0466967_0363831 | 3300045976 | Bacteria | 1402 |
| 641 | Ga0466967_0392009 | 3300045976 | Bacteria | 1350 |
| 642 | Ga0466967_0503194 | 3300045976 | Bacteria | 1189 |
| 643 | Ga0466967_0663337 | 3300045976 | Bacteria | 1032 |
| 644 | Ga0466967_0953031 | 3300045976 | Bacteria | 854 |
| 645 | Ga0495603_0018446 | 3300046455 | Bacteria | 4221 |
| 646 | Ga0495603_0084455 | 3300046455 | Bacteria | 1859 |
| 647 | Ga0495629_0003104 | 3300046459 | Bacteria | 12595 |
| 648 | Ga0495629_0013284 | 3300046459 | Bacteria | 5943 |
| 649 | Ga0495629_0073788 | 3300046459 | Bacteria | 2382 |
| 650 | Ga0495629_0107509 | 3300046459 | Bacteria | 1946 |
| 651 | Ga0495629_0236033 | 3300046459 | Bacteria | 1260 |
| 652 | Ga0495629_0303359 | 3300046459 | Bacteria | 1093 |
| 653 | Ga0495641_0006434 | 3300046461 | Bacteria | 7610 |
| 654 | Ga0495641_0011685 | 3300046461 | Bacteria | 4974 |
| 655 | Ga0495641_0043419 | 3300046461 | Bacteria | 2079 |
| 656 | Ga0495641_0046828 | 3300046461 | Bacteria | 1987 |
| 657 | Ga0495641_0102710 | 3300046461 | Bacteria | 1275 |
| 658 | Ga0495653_0010191 | 3300046463 | Bacteria | 7691 |
| 659 | Ga0495653_0047400 | 3300046463 | Bacteria | 3323 |
| 660 | Ga0495653_0260084 | 3300046463 | Bacteria | 1148 |
| 661 | Ga0495580_0133747 | 3300046472 | Bacteria | 1719 |
| 662 | Ga0495580_0470771 | 3300046472 | Bacteria | 841 |
| 663 | Ga0495582_0000556 | 3300046473 | Bacteria | 20608 |
| 664 | Ga0495582_0094319 | 3300046473 | Bacteria | 1671 |
| 665 | Ga0495605_0036349 | 3300046474 | Bacteria | 2484 |
| 666 | Ga0495639_0000322 | 3300046475 | Bacteria | 23204 |
| 667 | Ga0495639_0000484 | 3300046475 | Bacteria | 18956 |
| 668 | Ga0495662_0005856 | 3300046476 | Bacteria | 6145 |
| 669 | Ga0495662_0010467 | 3300046476 | Bacteria | 4541 |
| 670 | Ga0495662_0058954 | 3300046476 | Bacteria | 1854 |
| 671 | Ga0495662_0068334 | 3300046476 | Bacteria | 1720 |
| 672 | Ga0495664_0004712 | 3300046477 | Bacteria | 7459 |
| 673 | Ga0495664_0134037 | 3300046477 | Bacteria | 1501 |
| 674 | Ga0495584_0286115 | 3300046491 | Bacteria | 837 |
| 675 | Ga0495594_0007889 | 3300046499 | Bacteria | 5473 |
| 676 | Ga0495594_0216596 | 3300046499 | Bacteria | 1092 |
| 677 | Ga0495607_0195851 | 3300046501 | Bacteria | 1003 |
| 678 | Ga0495606_0002983 | 3300046507 | Bacteria | 18608 |
| 679 | Ga0495608_0014283 | 3300046511 | Bacteria | 5510 |
| 680 | Ga0495608_0111010 | 3300046511 | Bacteria | 1763 |
| 681 | Ga0495608_0337565 | 3300046511 | Bacteria | 929 |
| 682 | Ga0495608_0453886 | 3300046511 | Bacteria | 780 |
| 683 | Ga0495616_0063656 | 3300046513 | Bacteria | 1802 |
| 684 | Ga0495618_0007980 | 3300046514 | Bacteria | 6405 |
| 685 | Ga0495618_0040561 | 3300046514 | Bacteria | 2930 |
| 686 | Ga0495620_0084431 | 3300046515 | Bacteria | 1281 |
| 687 | Ga0495630_0007718 | 3300046517 | Bacteria | 7696 |
| 688 | Ga0495630_0080750 | 3300046517 | Bacteria | 2453 |
| 689 | Ga0495630_0316227 | 3300046517 | Bacteria | 1193 |
| 690 | Ga0495632_0245801 | 3300046519 | Bacteria | 804 |
| 691 | Ga0495663_0008906 | 3300046525 | Bacteria | 2783 |
| 692 | Ga0495666_0000381 | 3300046526 | Bacteria | 19428 |
| 693 | Ga0495666_0025977 | 3300046526 | Bacteria | 2890 |
| 694 | Ga0495652_0018726 | 3300046529 | Bacteria | 6171 |
| 695 | Ga0495665_0001289 | 3300046531 | Bacteria | 13380 |
| 696 | Ga0495665_0004560 | 3300046531 | Bacteria | 7478 |
| 697 | Ga0495665_0005611 | 3300046531 | Bacteria | 6761 |
| 698 | Ga0495665_0175949 | 3300046531 | Bacteria | 1113 |
| 699 | Ga0495640_0019654 | 3300046533 | Bacteria | 4982 |
| 700 | Ga0495640_0095027 | 3300046533 | Bacteria | 1962 |
| 701 | Ga0495640_0152143 | 3300046533 | Bacteria | 1486 |
| 702 | Ga0495640_0174723 | 3300046533 | Bacteria | 1371 |
| 703 | Ga0495586_0009299 | 3300046535 | Bacteria | 5227 |
| 704 | Ga0495587_0064209 | 3300046536 | Bacteria | 2145 |
| 705 | Ga0495587_0366642 | 3300046536 | Bacteria | 802 |
| 706 | Ga0495609_0142992 | 3300046538 | Bacteria | 1020 |
| 707 | Ga0495621_0017646 | 3300046539 | Bacteria | 2310 |
| 708 | Ga0495645_0302806 | 3300046543 | Bacteria | 1044 |
| 709 | Ga0495645_0441092 | 3300046543 | Bacteria | 823 |
| 710 | Ga0495667_0022322 | 3300046559 | Bacteria | 4264 |
| 711 | Ga0495667_0112754 | 3300046559 | Bacteria | 1757 |
| 712 | Ga0495667_0445422 | 3300046559 | Bacteria | 814 |
| 713 | Ga0495668_0002487 | 3300046616 | Bacteria | 15099 |
| 714 | Ga0495634_0011846 | 3300046642 | Bacteria | 6339 |
| 715 | Ga0495611_0092206 | 3300046648 | Bacteria | 1401 |
| 716 | Ga0495625_0004304 | 3300046660 | Bacteria | 13532 |
| 717 | Ga0495635_0002868 | 3300046663 | Bacteria | 11845 |
| 718 | Ga0495635_0005770 | 3300046663 | Bacteria | 8627 |
| 719 | Ga0495635_0032400 | 3300046663 | Bacteria | 3626 |
| 720 | Ga0495635_0214706 | 3300046663 | Bacteria | 1302 |
| 721 | Ga0495635_0252106 | 3300046663 | Bacteria | 1190 |
| 722 | Ga0495659_0021617 | 3300046664 | Bacteria | 2170 |
| 723 | Ga0495588_0004661 | 3300046674 | Bacteria | 6055 |
| 724 | Ga0495588_0179206 | 3300046674 | Bacteria | 1120 |
| 725 | Ga0495657_0011425 | 3300046675 | Bacteria | 6637 |
| 726 | Ga0495623_0135923 | 3300046679 | Bacteria | 1467 |
| 727 | Ga0495646_0097986 | 3300046680 | Bacteria | 1684 |
| 728 | Ga0495646_0134576 | 3300046680 | Bacteria | 1388 |
| 729 | Ga0495647_0000125 | 3300046681 | Bacteria | 19619 |
| 730 | Ga0495647_0012406 | 3300046681 | Bacteria | 2933 |
| 731 | Ga0495647_0092653 | 3300046681 | Bacteria | 1241 |
| 732 | Ga0495658_0009157 | 3300046683 | Bacteria | 4922 |
| 733 | Ga0495658_0010814 | 3300046683 | Bacteria | 4571 |
| 734 | Ga0495658_0020440 | 3300046683 | Bacteria | 3474 |
| 735 | Ga0495658_0395814 | 3300046683 | Bacteria | 880 |
| 736 | Ga0495658_0459177 | 3300046683 | Bacteria | 814 |
| 737 | Ga0495669_0034445 | 3300046684 | Bacteria | 2233 |
| 738 | Ga0495613_0015338 | 3300046689 | Bacteria | 5696 |
| 739 | Ga0495613_0018490 | 3300046689 | Bacteria | 5195 |
| 740 | Ga0495613_0049767 | 3300046689 | Bacteria | 3091 |
| 741 | Ga0495624_0003568 | 3300046690 | Bacteria | 11523 |
| 742 | Ga0495624_0012260 | 3300046690 | Bacteria | 5868 |
| 743 | Ga0495670_0216085 | 3300046691 | Bacteria | 1018 |
| 744 | Ga0495670_0231718 | 3300046691 | Bacteria | 982 |
| 745 | Ga0495670_0239659 | 3300046691 | Bacteria | 965 |
| 746 | Ga0495600_0002021 | 3300046809 | Bacteria | 11409 |
| 747 | Ga0495600_0250855 | 3300046809 | Bacteria | 1126 |
| 748 | Ga0495600_0275767 | 3300046809 | Bacteria | 1065 |
| 749 | Ga0495581_0014414 | 3300047315 | Bacteria | 4584 |
| 750 | Ga0495581_0024013 | 3300047315 | Bacteria | 3532 |
| 751 | Ga0495604_0190611 | 3300047317 | Bacteria | 1429 |
| 752 | Ga0495674_0023283 | 3300047319 | Bacteria | 5710 |
| 753 | Ga0495674_0037655 | 3300047319 | Bacteria | 4346 |
| 754 | Ga0495674_0058125 | 3300047319 | Bacteria | 3382 |
| 755 | Ga0495674_0164679 | 3300047319 | Bacteria | 1854 |
| 756 | Ga0495674_0208773 | 3300047319 | Bacteria | 1618 |
| 757 | Ga0495674_0375387 | 3300047319 | Bacteria | 1151 |
| 758 | Ga0495674_0387615 | 3300047319 | Bacteria | 1130 |
| 759 | Ga0495674_0701987 | 3300047319 | Bacteria | 794 |
| 760 | Ga0495676_0004037 | 3300047321 | Bacteria | 13362 |
| 761 | Ga0495676_0007501 | 3300047321 | Bacteria | 10005 |
| 762 | Ga0495676_0027898 | 3300047321 | Bacteria | 4835 |
| 763 | Ga0495680_0059675 | 3300047322 | Bacteria | 2943 |
| 764 | Ga0495680_0132194 | 3300047322 | Bacteria | 1833 |
| 765 | Ga0495680_0192253 | 3300047322 | Bacteria | 1468 |
| 766 | Ga0495680_0226473 | 3300047322 | Bacteria | 1333 |
| 767 | Ga0495675_0026638 | 3300047444 | Bacteria | 3687 |
| 768 | Ga0495675_0225238 | 3300047444 | Bacteria | 1133 |
| 769 | Ga0495684_0009841 | 3300047471 | Bacteria | 7376 |
| 770 | Ga0495684_0099851 | 3300047471 | Bacteria | 2194 |
| 771 | Ga0495684_0216457 | 3300047471 | Bacteria | 1406 |
| 772 | Ga0495593_0001712 | 3300047673 | Bacteria | 12980 |
| 773 | Ga0495593_0013286 | 3300047673 | Bacteria | 4699 |
| 774 | Ga0495593_0389500 | 3300047673 | Unclassified | 697 |
| 775 | Ga0495602_0047169 | 3300048088 | Bacteria | 3884 |
| 776 | Ga0495602_0420012 | 3300048088 | Bacteria | 950 |
| 777 | Ga0495614_0022259 | 3300048089 | Bacteria | 2735 |
| 778 | Ga0495614_0119046 | 3300048089 | Bacteria | 1163 |
| 779 | Ga0495626_0001210 | 3300048091 | Bacteria | 21305 |
| 780 | Ga0496100_0036946 | 3300048903 | Bacteria | 3084 |
| 781 | Ga0496100_0043571 | 3300048903 | Bacteria | 2871 |
| 782 | Ga0496100_0068408 | 3300048903 | Bacteria | 2362 |
| 783 | Ga0496100_0068643 | 3300048903 | Bacteria | 2358 |
| 784 | Ga0496100_0068952 | 3300048903 | Bacteria | 2353 |
| 785 | Ga0496100_0130895 | 3300048903 | Bacteria | 1767 |
| 786 | Ga0496100_0132266 | 3300048903 | Bacteria | 1759 |
| 787 | Ga0496100_0190027 | 3300048903 | Bacteria | 1490 |
| 788 | Ga0496100_0229499 | 3300048903 | Bacteria | 1365 |
| 789 | Ga0496100_0249262 | 3300048903 | Bacteria | 1313 |
| 790 | Ga0496100_0544164 | 3300048903 | Bacteria | 898 |
| 791 | Ga0496101_0019803 | 3300048904 | Bacteria | 4600 |
| 792 | Ga0496101_0028280 | 3300048904 | Bacteria | 3913 |
| 793 | Ga0496101_0054862 | 3300048904 | Bacteria | 2877 |
| 794 | Ga0496101_0061488 | 3300048904 | Bacteria | 2728 |
| 795 | Ga0496101_0073391 | 3300048904 | Bacteria | 2513 |
| 796 | Ga0496101_0151121 | 3300048904 | Bacteria | 1776 |
| 797 | Ga0496101_0221889 | 3300048904 | Bacteria | 1467 |
| 798 | Ga0496101_0312608 | 3300048904 | Bacteria | 1232 |
| 799 | Ga0496102_0000044 | 3300048905 | Bacteria | 187834 |
| 800 | Ga0496102_0000669 | 3300048905 | Bacteria | 34288 |
| 801 | Ga0496102_0013968 | 3300048905 | Bacteria | 6971 |
| 802 | Ga0496102_0018252 | 3300048905 | Bacteria | 6162 |
| 803 | Ga0496102_0039907 | 3300048905 | Bacteria | 4244 |
| 804 | Ga0496102_0043100 | 3300048905 | Bacteria | 4090 |
| 805 | Ga0496102_0046725 | 3300048905 | Bacteria | 3932 |
| 806 | Ga0496102_0106076 | 3300048905 | Bacteria | 2615 |
| 807 | Ga0496102_0110761 | 3300048905 | Bacteria | 2559 |
| 808 | Ga0496102_0136062 | 3300048905 | Bacteria | 2302 |
| 809 | Ga0496102_0209082 | 3300048905 | Bacteria | 1840 |
| 810 | Ga0496102_0239905 | 3300048905 | Bacteria | 1709 |
| 811 | Ga0496102_0478728 | 3300048905 | Bacteria | 1166 |
| 812 | Ga0496102_0485859 | 3300048905 | Bacteria | 1156 |
| 813 | Ga0496103_0000123 | 3300048906 | Bacteria | 83794 |
| 814 | Ga0496103_0006778 | 3300048906 | Bacteria | 6834 |
| 815 | Ga0496103_0024711 | 3300048906 | Bacteria | 3626 |
| 816 | Ga0496103_0043628 | 3300048906 | Bacteria | 2761 |
| 817 | Ga0496103_0050205 | 3300048906 | Bacteria | 2580 |
| 818 | Ga0496103_0138677 | 3300048906 | Bacteria | 1554 |
| 819 | Ga0496103_0159149 | 3300048906 | Bacteria | 1448 |
| 820 | Ga0496103_0417328 | 3300048906 | Bacteria | 861 |
| 821 | Ga0496103_0420387 | 3300048906 | Bacteria | 858 |
| 822 | Ga0496103_0457849 | 3300048906 | Bacteria | 818 |
| 823 | Ga0496104_0011466 | 3300048907 | Bacteria | 7941 |
| 824 | Ga0496104_0013602 | 3300048907 | Bacteria | 7336 |
| 825 | Ga0496104_0014409 | 3300048907 | Bacteria | 7145 |
| 826 | Ga0496104_0027699 | 3300048907 | Bacteria | 5246 |
| 827 | Ga0496104_0034169 | 3300048907 | Bacteria | 4739 |
| 828 | Ga0496104_0044810 | 3300048907 | Bacteria | 4157 |
| 829 | Ga0496104_0058061 | 3300048907 | Bacteria | 3662 |
| 830 | Ga0496104_0103028 | 3300048907 | Bacteria | 2734 |
| 831 | Ga0496104_0115270 | 3300048907 | Bacteria | 2578 |
| 832 | Ga0496104_0117783 | 3300048907 | Bacteria | 2549 |
| 833 | Ga0496104_0123377 | 3300048907 | Bacteria | 2487 |
| 834 | Ga0496104_0139560 | 3300048907 | Bacteria | 2329 |
| 835 | Ga0496104_0218858 | 3300048907 | Bacteria | 1816 |
| 836 | Ga0496104_0221224 | 3300048907 | Bacteria | 1805 |
| 837 | Ga0496104_0221848 | 3300048907 | Bacteria | 1803 |
| 838 | Ga0496104_0533917 | 3300048907 | Bacteria | 1084 |
| 839 | Ga0496105_0004276 | 3300048908 | Bacteria | 10744 |
| 840 | Ga0496105_0005275 | 3300048908 | Bacteria | 9797 |
| 841 | Ga0496105_0018647 | 3300048908 | Bacteria | 5585 |
| 842 | Ga0496105_0045351 | 3300048908 | Bacteria | 3627 |
| 843 | Ga0496105_0080135 | 3300048908 | Bacteria | 2696 |
| 844 | Ga0496105_0104604 | 3300048908 | Bacteria | 2337 |
| 845 | Ga0496105_0148559 | 3300048908 | Bacteria | 1927 |
| 846 | Ga0496105_0153966 | 3300048908 | Bacteria | 1889 |
| 847 | Ga0496105_0194434 | 3300048908 | Bacteria | 1658 |
| 848 | Ga0496105_0388577 | 3300048908 | Bacteria | 1110 |
| 849 | Ga0496105_0504297 | 3300048908 | Bacteria | 950 |
| 850 | Ga0496106_0007647 | 3300048909 | Bacteria | 7993 |
| 851 | Ga0496106_0011800 | 3300048909 | Bacteria | 6450 |
| 852 | Ga0496106_0016676 | 3300048909 | Bacteria | 5434 |
| 853 | Ga0496106_0018577 | 3300048909 | Bacteria | 5144 |
| 854 | Ga0496106_0055255 | 3300048909 | Bacteria | 3000 |
| 855 | Ga0496106_0097150 | 3300048909 | Bacteria | 2280 |
| 856 | Ga0496106_0108617 | 3300048909 | Bacteria | 2158 |
| 857 | Ga0496106_0126810 | 3300048909 | Bacteria | 1999 |
| 858 | Ga0496106_0155778 | 3300048909 | Bacteria | 1804 |
| 859 | Ga0496107_0028222 | 3300048910 | Bacteria | 3988 |
| 860 | Ga0496107_0032253 | 3300048910 | Bacteria | 3743 |
| 861 | Ga0496107_0036363 | 3300048910 | Bacteria | 3532 |
| 862 | Ga0496107_0045591 | 3300048910 | Bacteria | 3154 |
| 863 | Ga0496107_0081206 | 3300048910 | Bacteria | 2364 |
| 864 | Ga0496107_0098938 | 3300048910 | Bacteria | 2137 |
| 865 | Ga0496107_0303185 | 3300048910 | Bacteria | 1189 |
| 866 | Ga0496107_0516595 | 3300048910 | Bacteria | 885 |
| 867 | Ga0496108_0009178 | 3300048911 | Bacteria | 8004 |
| 868 | Ga0496108_0014293 | 3300048911 | Bacteria | 6478 |
| 869 | Ga0496108_0021143 | 3300048911 | Bacteria | 5347 |
| 870 | Ga0496108_0022524 | 3300048911 | Bacteria | 5180 |
| 871 | Ga0496108_0038584 | 3300048911 | Bacteria | 3980 |
| 872 | Ga0496108_0104013 | 3300048911 | Bacteria | 2423 |
| 873 | Ga0496108_0136804 | 3300048911 | Bacteria | 2108 |
| 874 | Ga0496108_0277156 | 3300048911 | Bacteria | 1460 |
| 875 | Ga0496108_0309335 | 3300048911 | Bacteria | 1377 |
| 876 | Ga0496108_0462371 | 3300048911 | Bacteria | 1108 |
| 877 | Ga0496108_0643625 | 3300048911 | Bacteria | 922 |
| 878 | Ga0496109_0001181 | 3300048912 | Bacteria | 21688 |
| 879 | Ga0496109_0001497 | 3300048912 | Bacteria | 19409 |
| 880 | Ga0496109_0002763 | 3300048912 | Bacteria | 14695 |
| 881 | Ga0496109_0010768 | 3300048912 | Bacteria | 7828 |
| 882 | Ga0496109_0024527 | 3300048912 | Bacteria | 5363 |
| 883 | Ga0496109_0027766 | 3300048912 | Bacteria | 5057 |
| 884 | Ga0496109_0028637 | 3300048912 | Bacteria | 4984 |
| 885 | Ga0496109_0057894 | 3300048912 | Bacteria | 3539 |
| 886 | Ga0496109_0065716 | 3300048912 | Bacteria | 3320 |
| 887 | Ga0496109_0101415 | 3300048912 | Bacteria | 2671 |
| 888 | Ga0496109_0122100 | 3300048912 | Bacteria | 2427 |
| 889 | Ga0496109_0255789 | 3300048912 | Bacteria | 1649 |
| 890 | Ga0496110_0002894 | 3300048913 | Bacteria | 12990 |
| 891 | Ga0496110_0003955 | 3300048913 | Bacteria | 11398 |
| 892 | Ga0496110_0005402 | 3300048913 | Bacteria | 10019 |
| 893 | Ga0496110_0012717 | 3300048913 | Bacteria | 6927 |
| 894 | Ga0496110_0021225 | 3300048913 | Bacteria | 5494 |
| 895 | Ga0496110_0069223 | 3300048913 | Bacteria | 3125 |
| 896 | Ga0496110_0106372 | 3300048913 | Bacteria | 2517 |
| 897 | Ga0496110_0151032 | 3300048913 | Bacteria | 2103 |
| 898 | Ga0496110_0164684 | 3300048913 | Bacteria | 2010 |
| 899 | Ga0496110_0381672 | 3300048913 | Bacteria | 1284 |
| 900 | Ga0496110_0574639 | 3300048913 | Bacteria | 1024 |
| 901 | Ga0496110_0582985 | 3300048913 | Bacteria | 1015 |
| 902 | Ga0496111_0000950 | 3300048914 | Bacteria | 15848 |
| 903 | Ga0496111_0001566 | 3300048914 | Bacteria | 13202 |
| 904 | Ga0496111_0029301 | 3300048914 | Bacteria | 3909 |
| 905 | Ga0496111_0034973 | 3300048914 | Bacteria | 3588 |
| 906 | Ga0496111_0069256 | 3300048914 | Bacteria | 2565 |
| 907 | Ga0496111_0070133 | 3300048914 | Bacteria | 2549 |
| 908 | Ga0496111_0166069 | 3300048914 | Bacteria | 1639 |
| 909 | Ga0496111_0175800 | 3300048914 | Bacteria | 1591 |
| 910 | Ga0496111_0250810 | 3300048914 | Bacteria | 1314 |
| 911 | Ga0496112_0007917 | 3300048915 | Bacteria | 9468 |
| 912 | Ga0496112_0008096 | 3300048915 | Bacteria | 9385 |
| 913 | Ga0496112_0023292 | 3300048915 | Bacteria | 5914 |
| 914 | Ga0496112_0051518 | 3300048915 | Bacteria | 4038 |
| 915 | Ga0496112_0089434 | 3300048915 | Bacteria | 3047 |
| 916 | Ga0496112_0105046 | 3300048915 | Bacteria | 2794 |
| 917 | Ga0496112_0180960 | 3300048915 | Bacteria | 2072 |
| 918 | Ga0496112_0222874 | 3300048915 | Bacteria | 1841 |
| 919 | Ga0496112_0271807 | 3300048915 | Bacteria | 1643 |
| 920 | Ga0496112_0340820 | 3300048915 | Bacteria | 1442 |
| 921 | Ga0496113_0002548 | 3300048916 | Bacteria | 10633 |
| 922 | Ga0496113_0020491 | 3300048916 | Bacteria | 4649 |
| 923 | Ga0496113_0027747 | 3300048916 | Bacteria | 4062 |
| 924 | Ga0496113_0050403 | 3300048916 | Bacteria | 3104 |
| 925 | Ga0496113_0109010 | 3300048916 | Bacteria | 2153 |
| 926 | Ga0496113_0122777 | 3300048916 | Bacteria | 2032 |
| 927 | Ga0496113_0203794 | 3300048916 | Bacteria | 1573 |
| 928 | Ga0496113_0423410 | 3300048916 | Bacteria | 1069 |
| 929 | Ga0496114_0010141 | 3300048917 | Bacteria | 7495 |
| 930 | Ga0496114_0047435 | 3300048917 | Bacteria | 3573 |
| 931 | Ga0496114_0051346 | 3300048917 | Bacteria | 3433 |
| 932 | Ga0496114_0062504 | 3300048917 | Bacteria | 3116 |
| 933 | Ga0496114_0066554 | 3300048917 | Bacteria | 3021 |
| 934 | Ga0496114_0077580 | 3300048917 | Bacteria | 2801 |
| 935 | Ga0496114_0110497 | 3300048917 | Bacteria | 2355 |
| 936 | Ga0496114_0112716 | 3300048917 | Bacteria | 2331 |
| 937 | Ga0496114_0167902 | 3300048917 | Bacteria | 1911 |
| 938 | Ga0496114_0432914 | 3300048917 | Bacteria | 1165 |
| 939 | Ga0496114_0439378 | 3300048917 | Bacteria | 1155 |
| 940 | Ga0496114_0558122 | 3300048917 | Bacteria | 1011 |
| 941 | Ga0496115_0002678 | 3300048918 | Bacteria | 12774 |
| 942 | Ga0496115_0068553 | 3300048918 | Bacteria | 2872 |
| 943 | Ga0496115_0088415 | 3300048918 | Bacteria | 2530 |
| 944 | Ga0496115_0101210 | 3300048918 | Bacteria | 2362 |
| 945 | Ga0496115_0189887 | 3300048918 | Bacteria | 1697 |
| 946 | Ga0496115_0209007 | 3300048918 | Bacteria | 1612 |
| 947 | Ga0496115_0223249 | 3300048918 | Bacteria | 1555 |
| 948 | Ga0496115_0323657 | 3300048918 | Bacteria | 1260 |
| 949 | Ga0496118_0042197 | 3300048921 | Bacteria | 3601 |
| 950 | Ga0496119_0000333 | 3300048922 | Bacteria | 65888 |
| 951 | Ga0496119_0015393 | 3300048922 | Bacteria | 5893 |
| 952 | Ga0496120_0015310 | 3300048923 | Bacteria | 5065 |
| 953 | Ga0496120_0068025 | 3300048923 | Bacteria | 1966 |
| 954 | Ga0501032_0219753 | 3300049569 | Bacteria | 1237 |
| 955 | Ga0501036_0157878 | 3300049572 | Bacteria | 1913 |
| 956 | Ga0501037_0028486 | 3300049573 | Bacteria | 4126 |
| 957 | Ga0501038_0225409 | 3300049574 | Bacteria | 1494 |
| 958 | Ga0501039_0022065 | 3300049575 | Bacteria | 4886 |
| 959 | Ga0501046_0012417 | 3300049580 | Bacteria | 7252 |
| 960 | Ga0501047_0333934 | 3300049581 | Bacteria | 1354 |
| 961 | Ga0501067_0002055 | 3300049583 | Bacteria | 11100 |
| 962 | Ga0501067_0019838 | 3300049583 | Bacteria | 3722 |
| 963 | Ga0501068_0052215 | 3300049584 | Bacteria | 2473 |
| 964 | Ga0501069_0025754 | 3300049585 | Bacteria | 3216 |
| 965 | Ga0501069_0065922 | 3300049585 | Bacteria | 2025 |
| 966 | Ga0501069_0150127 | 3300049585 | Bacteria | 1339 |
| 967 | Ga0501070_0129570 | 3300049586 | Bacteria | 2084 |
| 968 | Ga0501074_0061956 | 3300049590 | Bacteria | 2695 |
| 969 | Ga0501080_0198527 | 3300049742 | Bacteria | 1842 |
| 970 | Ga0501080_0965520 | 3300049742 | Bacteria | 740 |
| 971 | Ga0501035_0174366 | 3300049822 | Bacteria | 1856 |
| 972 | Ga0501044_0456446 | 3300049823 | Bacteria | 1184 |
| 973 | Ga0501044_0676668 | 3300049823 | Bacteria | 919 |
| 974 | Ga0501044_1026951 | 3300049823 | Bacteria | 695 |
| 975 | nmdc:mga05p37_218242_c1 | 3300050507 | Bacteria | 2303 |
| 976 | nmdc:mga05p37_8428_c1 | 3300050507 | Bacteria | 12190 |
| 977 | nmdc:mga0qj67_132852_c1 | 3300050509 | Bacteria | 2016 |
| 978 | nmdc:mga08y16_326067_c1 | 3300050511 | Bacteria | 1580 |
| 979 | nmdc:mga08y16_36663_c1 | 3300050511 | Bacteria | 5150 |
| 980 | nmdc:mga0n895_108231_c1 | 3300050512 | Bacteria | 2794 |
| 981 | nmdc:mga0n895_14986_c1 | 3300050512 | Bacteria | 7061 |
| 982 | nmdc:mga0n895_42194_c1 | 3300050512 | Bacteria | 4438 |
| 983 | nmdc:mga0rr50_566486_c1 | 3300050513 | Bacteria | 968 |
| 984 | nmdc:mga0rr50_6021_c1 | 3300050513 | Bacteria | 7323 |
| 985 | nmdc:mga0rr50_84884_c1 | 3300050513 | Bacteria | 2452 |
| 986 | nmdc:mga08x19_22363_c1 | 3300050514 | Bacteria | 3916 |
| 987 | nmdc:mga08x19_64249_c1 | 3300050514 | Bacteria | 2382 |
| 988 | nmdc:mga08x19_68069_c1 | 3300050514 | Bacteria | 2317 |
| 989 | nmdc:mga0a205_115318_c1 | 3300050515 | Bacteria | 2585 |
| 990 | nmdc:mga0a205_902062_c1 | 3300050515 | Bacteria | 731 |
| 991 | Ga0495601_0005606 | 3300053077 | Bacteria | 7319 |
| 992 | Ga0495601_0039984 | 3300053077 | Bacteria | 2937 |
| 993 | Ga0495601_0082212 | 3300053077 | Bacteria | 2067 |
| 994 | Ga0495601_0268923 | 3300053077 | Bacteria | 1112 |
| 995 | Ga0495612_0001055 | 3300053078 | Bacteria | 11274 |
| 996 | Ga0495612_0037938 | 3300053078 | Bacteria | 1957 |
| 997 | Ga0495655_0087718 | 3300053083 | Bacteria | 901 |
| 998 | Ga0495595_0082259 | 3300053084 | Bacteria | 1535 |
| 999 | Ga0495619_0011287 | 3300053085 | Bacteria | 5621 |
| 1000 | Ga0495619_0335389 | 3300053085 | Bacteria | 1047 |
| 1001 | Ga0495619_0344742 | 3300053085 | Bacteria | 1031 |
| 1002 | Ga0500583_0184189 | 3300053092 | Bacteria | 1040 |
| 1003 | Ga0500566_0024371 | 3300053094 | Bacteria | 3552 |
| 1004 | Ga0500556_0000417 | 3300053104 | Bacteria | 30638 |
| 1005 | Ga0500568_0123165 | 3300053139 | Bacteria | 966 |
| 1006 | Ga0500600_0011756 | 3300053149 | Bacteria | 5315 |
| 1007 | Ga0466962_0009921 | 3300061719 | Bacteria | 4569 |
| 1008 | Ga0466962_0082473 | 3300061719 | Bacteria | 1538 |
| 1009 | Ga0466962_0091526 | 3300061719 | Bacteria | 1457 |
| 1010 | Ga0530510_0271324 | 3300061734 | Bacteria | 1266 |
| 1011 | 2819425918 | 2818991318 | Bacteria | 5266538 |
| 1012 | 2819665006 | 2818991458 | Bacteria | 4794049 |
| 1013 | 2887480959 | 2887478801 | Bacteria | 8972725 |
| 1014 | Ga0501047_0008540 | |||
| 1015 | JGI24737J22298_10106451 | |||
| 1016 | Ga0070658_10012228 | |||
| 1017 | Ga0070676_10378054 | |||
| 1018 | Ga0070683_100009018 | |||
| 1019 | Ga0070683_100016184 | |||
| 1020 | Ga0070683_100044245 | |||
| 1021 | Ga0070683_100080515 | |||
| 1022 | Ga0070683_100143935 | |||
| 1023 | Ga0070683_100174470 | |||
| 1024 | Ga0070683_100482419 | |||
| 1025 | Ga0070690_100108110 | |||
| 1026 | Ga0070670_100146353 | |||
| 1027 | Ga0068869_100094719 | |||
| 1028 | Ga0068869_100384366 | |||
| 1029 | Ga0070666_10110019 | |||
| 1030 | Ga0070680_100053920 | |||
| 1031 | Ga0070680_100328131 | |||
| 1032 | Ga0070680_100408909 | |||
| 1033 | Ga0070680_100690582 | |||
| 1034 | Ga0070682_100082916 | |||
| 1035 | Ga0070682_100201688 | |||
| 1036 | Ga0070682_100201997 | |||
| 1037 | Ga0070682_100423449 | |||
| 1038 | Ga0068868_100182206 | |||
| 1039 | Ga0068868_100264178 | |||
| 1040 | Ga0068868_100339716 | |||
| 1041 | Ga0068868_100372062 | |||
| 1042 | Ga0070660_100001285 | |||
| 1043 | Ga0070660_100005389 | |||
| 1044 | Ga0070660_100065198 | |||
| 1045 | Ga0070660_100126528 | |||
| 1046 | Ga0070660_100586805 | |||
| 1047 | Ga0070689_100125086 | |||
| 1048 | Ga0070689_100183860 | |||
| 1049 | Ga0070691_10062517 | |||
| 1050 | Ga0070691_10112908 | |||
| 1051 | Ga0070691_10151530 | |||
| 1052 | Ga0070687_100106867 | |||
| 1053 | Ga0070687_100224790 | |||
| 1054 | Ga0070661_100149213 | |||
| 1055 | Ga0070692_10054177 | |||
| 1056 | Ga0070692_10103983 | |||
| 1057 | Ga0070692_10253420 | |||
| 1058 | Ga0070668_100007547 | |||
| 1059 | Ga0070671_100012587 | |||
| 1060 | Ga0070671_100432482 | |||
| 1061 | Ga0070674_100159742 | |||
| 1062 | Ga0070674_100212603 | |||
| 1063 | Ga0070674_100486923 | |||
| 1064 | Ga0070673_100224025 | |||
| 1065 | Ga0070659_100002112 | |||
| 1066 | Ga0070659_100035528 | |||
| 1067 | Ga0070659_100138576 | |||
| 1068 | Ga0070659_100180359 | |||
| 1069 | Ga0070659_100265179 | |||
| 1070 | Ga0070659_100317224 | |||
| 1071 | Ga0070667_100041998 | |||
| 1072 | Ga0070703_10006246 | |||
| 1073 | Ga0070709_10023197 | |||
| 1074 | Ga0070709_10118497 | |||
| 1075 | Ga0070709_10145309 | |||
| 1076 | Ga0070709_10537536 | |||
| 1077 | Ga0070714_100000894 | |||
| 1078 | Ga0070714_100040769 | |||
| 1079 | Ga0070714_100203415 | |||
| 1080 | Ga0070714_100258495 | |||
| 1081 | Ga0070714_100305226 | |||
| 1082 | Ga0070714_100879266 | |||
| 1083 | Ga0070713_100027607 | |||
| 1084 | Ga0070713_100065337 | |||
| 1085 | Ga0070713_100101830 | |||
| 1086 | Ga0070713_100130668 | |||
| 1087 | Ga0070713_100853264 | |||
| 1088 | Ga0070710_10017218 | |||
| 1089 | Ga0070710_10035441 | |||
| 1090 | Ga0070710_10267480 | |||
| 1091 | Ga0070711_100011836 | |||
| 1092 | Ga0070711_100140480 | |||
| 1093 | Ga0070711_100173013 | |||
| 1094 | Ga0070711_100231475 | |||
| 1095 | Ga0070711_100240861 | |||
| 1096 | Ga0070711_100252691 | |||
| 1097 | Ga0070705_100015867 | |||
| 1098 | Ga0070700_100100786 | |||
| 1099 | Ga0070700_100136824 | |||
| 1100 | Ga0070700_100463669 | |||
| 1101 | Ga0070694_100111554 | |||
| 1102 | Ga0070694_100352407 | |||
| 1103 | Ga0070694_100561933 | |||
| 1104 | Ga0070708_100706627 | |||
| 1105 | Ga0070663_100043131 | |||
| 1106 | Ga0070663_100211538 | |||
| 1107 | Ga0070663_100626514 | |||
| 1108 | Ga0070678_100029931 | |||
| 1109 | Ga0070678_100077314 | |||
| 1110 | Ga0070662_100116546 | |||
| 1111 | Ga0070662_100143536 | |||
| 1112 | Ga0070662_100621682 | |||
| 1113 | Ga0070681_10064650 | |||
| 1114 | Ga0070681_10302911 | |||
| 1115 | Ga0068867_100181007 | |||
| 1116 | Ga0070685_10259144 | |||
| 1117 | Ga0070707_100455379 | |||
| 1118 | Ga0070679_100016072 | |||
| 1119 | Ga0070679_100036601 | |||
| 1120 | Ga0070679_100457522 | |||
| 1121 | Ga0070679_100572839 | |||
| 1122 | Ga0070684_100003769 | |||
| 1123 | Ga0070684_100032430 | |||
| 1124 | Ga0070684_100033498 | |||
| 1125 | Ga0070684_100036808 | |||
| 1126 | Ga0070684_100056138 | |||
| 1127 | Ga0070684_100056369 | |||
| 1128 | Ga0070684_100141597 | |||
| 1129 | Ga0070684_100197372 | |||
| 1130 | Ga0070684_100700963 | |||
| 1131 | Ga0068853_100110199 | |||
| 1132 | Ga0068853_100380756 | |||
| 1133 | Ga0070686_100037841 | |||
| 1134 | Ga0070686_100042074 | |||
| 1135 | Ga0070686_100138609 | |||
| 1136 | Ga0070686_100256874 | |||
| 1137 | Ga0070695_100424844 | |||
| 1138 | Ga0070696_100010038 | |||
| 1139 | Ga0070696_100022542 | |||
| 1140 | Ga0070696_100078536 | |||
| 1141 | Ga0070696_100138758 | |||
| 1142 | Ga0070696_100144071 | |||
| 1143 | Ga0070693_100007320 | |||
| 1144 | Ga0070693_100042559 | |||
| 1145 | Ga0070665_100341887 | |||
| 1146 | Ga0070665_100362696 | |||
| 1147 | Ga0070665_100377053 | |||
| 1148 | Ga0070704_100013449 | |||
| 1149 | Ga0070704_100068922 | |||
| 1150 | Ga0068855_100012401 | |||
| 1151 | Ga0068855_100023543 | |||
| 1152 | Ga0068855_100321570 | |||
| 1153 | Ga0068855_100486488 | |||
| 1154 | Ga0070664_100195323 | |||
| 1155 | Ga0070664_100206575 | |||
| 1156 | Ga0070664_100367883 | |||
| 1157 | Ga0070664_100581342 | |||
| 1158 | Ga0068857_100001692 | |||
| 1159 | Ga0068857_100014191 | |||
| 1160 | Ga0068857_100722924 | |||
| 1161 | Ga0068854_100056597 | |||
| 1162 | Ga0068854_100195568 | |||
| 1163 | Ga0068856_100013828 | |||
| 1164 | Ga0068856_100024559 | |||
| 1165 | Ga0068856_100088553 | |||
| 1166 | Ga0068856_100376453 | |||
| 1167 | Ga0068856_100601052 | |||
| 1168 | Ga0070702_100067949 | |||
| 1169 | Ga0068852_100009339 | |||
| 1170 | Ga0068852_100593127 | |||
| 1171 | Ga0068859_100013627 | |||
| 1172 | Ga0068859_100271115 | |||
| 1173 | Ga0068859_100403685 | |||
| 1174 | Ga0068859_100432310 | |||
| 1175 | Ga0068864_100064564 | |||
| 1176 | Ga0068861_100150032 | |||
| 1177 | Ga0068870_10134947 | |||
| 1178 | Ga0068870_10255196 | |||
| 1179 | Ga0068870_10321776 | |||
| 1180 | Ga0068863_100083410 | |||
| 1181 | Ga0068858_100077971 | |||
| 1182 | Ga0068860_100084965 | |||
| 1183 | Ga0068862_100707180 | |||
| 1184 | Ga0081455_10024797 | |||
| 1185 | Ga0081455_10025518 | |||
| 1186 | Ga0081455_10170847 | |||
| 1187 | Ga0081538_10021579 | |||
| 1188 | Ga0081540_1003230 | |||
| 1189 | Ga0081540_1004696 | |||
| 1190 | Ga0081540_1014407 | |||
| 1191 | Ga0081539_10001518 | |||
| 1192 | Ga0081539_10006277 | |||
| 1193 | Ga0081539_10059860 | |||
| 1194 | Ga0070717_10001730 | |||
| 1195 | Ga0070717_10039495 | |||
| 1196 | Ga0070717_10040314 | |||
| 1197 | Ga0070717_10246009 | |||
| 1198 | Ga0070717_10370869 | |||
| 1199 | Ga0075432_10019292 | |||
| 1200 | Ga0070716_100016508 | |||
| 1201 | Ga0070716_100166307 | |||
| 1202 | Ga0070716_100347385 | |||
| 1203 | Ga0070712_100022962 | |||
| 1204 | Ga0070712_100384053 | |||
| 1205 | Ga0070712_100645992 | |||
| 1206 | Ga0097621_100053228 | |||
| 1207 | Ga0097621_100113335 | |||
| 1208 | Ga0097621_100378741 | |||
| 1209 | Ga0068871_100065208 | |||
| 1210 | Ga0075428_100023749 | |||
| 1211 | Ga0075430_100043862 | |||
| 1212 | Ga0075431_100068089 | |||
| 1213 | Ga0075433_10284126 | |||
| 1214 | Ga0075434_100000357 | |||
| 1215 | Ga0075434_100022375 | |||
| 1216 | Ga0075434_100043392 | |||
| 1217 | Ga0075434_100047366 | |||
| 1218 | Ga0068865_100093452 | |||
| 1219 | Ga0068865_100121384 | |||
| 1220 | Ga0068865_100334097 | |||
| 1221 | Ga0075436_100010725 | |||
| 1222 | Ga0075436_100021002 | |||
| 1223 | Ga0075436_100168380 | |||
| 1224 | Ga0097620_100013627 | |||
| 1225 | Ga0097620_100271117 | |||
| 1226 | Ga0097620_100403685 | |||
| 1227 | Ga0097620_100432341 | |||
| 1228 | Ga0075435_100002080 | |||
| 1229 | Ga0075435_100060922 | |||
| 1230 | Ga0075435_100153173 | |||
| 1231 | Ga0075435_100291479 | |||
| 1232 | Ga0105240_10012384 | |||
| 1233 | Ga0105240_10058663 | |||
| 1234 | Ga0105240_10124671 | |||
| 1235 | Ga0111539_10010762 | |||
| 1236 | Ga0111539_10018092 | |||
| 1237 | Ga0111539_10057998 | |||
| 1238 | Ga0111539_10290047 | |||
| 1239 | Ga0111539_10389091 | |||
| 1240 | Ga0111539_10500846 | |||
| 1241 | Ga0111539_10616445 | |||
| 1242 | Ga0111539_11381875 | |||
| 1243 | Ga0105245_10014744 | |||
| 1244 | Ga0105245_10024857 | |||
| 1245 | Ga0105245_10055645 | |||
| 1246 | Ga0105245_10077160 | |||
| 1247 | Ga0105245_10172545 | |||
| 1248 | Ga0105245_10288170 | |||
| 1249 | Ga0105247_10006155 | |||
| 1250 | Ga0105247_10060638 | |||
| 1251 | Ga0105247_10148665 | |||
| 1252 | Ga0114129_10000964 | |||
| 1253 | Ga0114129_10160851 | |||
| 1254 | Ga0114129_10240886 | |||
| 1255 | Ga0114129_10384152 | |||
| 1256 | Ga0114129_10816256 | |||
| 1257 | Ga0105243_10007690 | |||
| 1258 | Ga0105243_10467465 | |||
| 1259 | Ga0105241_10007849 | |||
| 1260 | Ga0105241_10063163 | |||
| 1261 | Ga0105242_10169251 | |||
| 1262 | Ga0105242_10322018 | |||
| 1263 | Ga0105242_10382403 | |||
| 1264 | Ga0105242_10954151 | |||
| 1265 | Ga0105248_10084082 | |||
| 1266 | Ga0105248_10467329 | |||
| 1267 | Ga0105237_10019190 | |||
| 1268 | Ga0105237_10077168 | |||
| 1269 | Ga0105237_10117776 | |||
| 1270 | Ga0105237_10632288 | |||
| 1271 | Ga0105237_10851122 | |||
| 1272 | Ga0105238_10011067 | |||
| 1273 | Ga0105238_10056023 | |||
| 1274 | Ga0105238_10314471 | |||
| 1275 | Ga0105249_10003207 | |||
| 1276 | Ga0105249_10214729 | |||
| 1277 | Ga0105239_10015168 | |||
| 1278 | Ga0105239_10218383 | |||
| 1279 | Ga0105239_10237974 | |||
| 1280 | Ga0105239_10347378 | |||
| 1281 | Ga0105239_10581810 | |||
| 1282 | Ga0105239_10589137 | |||
| 1283 | Ga0105246_10004642 | |||
| 1284 | Ga0105246_10054641 | |||
| 1285 | Ga0105246_10147892 | |||
| 1286 | Ga0105246_10442329 | |||
| 1287 | Ga0157373_10093518 | |||
| 1288 | Ga0157373_10256934 | |||
| 1289 | Ga0157370_10070259 | |||
| 1290 | Ga0157370_10210702 | |||
| 1291 | Ga0157370_10519018 | |||
| 1292 | Ga0157369_10004927 | |||
| 1293 | Ga0157369_10024850 | |||
| 1294 | Ga0157369_10034367 | |||
| 1295 | Ga0157369_10131855 | |||
| 1296 | Ga0157369_10261093 | |||
| 1297 | Ga0157369_10460022 | |||
| 1298 | Ga0157369_11024190 | |||
| 1299 | Ga0157374_10032740 | |||
| 1300 | Ga0157374_10076470 | |||
| 1301 | Ga0157374_11001503 | |||
| 1302 | Ga0157378_10304914 | |||
| 1303 | Ga0157378_10602955 | |||
| 1304 | Ga0163162_10042103 | |||
| 1305 | Ga0163162_10071429 | |||
| 1306 | Ga0163162_10135036 | |||
| 1307 | Ga0163162_10409778 | |||
| 1308 | Ga0157372_10034956 | |||
| 1309 | Ga0157372_10179199 | |||
| 1310 | Ga0157372_10228743 | |||
| 1311 | Ga0157372_10284266 | |||
| 1312 | Ga0157372_10975662 | |||
| 1313 | Ga0157375_10583298 | |||
| 1314 | Ga0157375_10600903 | |||
| 1315 | Ga0157375_10614609 | |||
| 1316 | Ga0157375_10666074 | |||
| 1317 | Ga0163163_10096785 | |||
| 1318 | Ga0157380_10813770 | |||
| 1319 | Ga0157380_11109977 | |||
| 1320 | Ga0182008_10042296 | |||
| 1321 | Ga0157377_10018950 | |||
| 1322 | Ga0157377_10045124 | |||
| 1323 | Ga0157377_10404210 | |||
| 1324 | Ga0157379_10073420 | |||
| 1325 | Ga0157379_10100042 | |||
| 1326 | Ga0157376_10242432 | |||
| 1327 | Ga0163161_10010967 | |||
| 1328 | Ga0197907_11206444 | |||
| 1329 | Ga0206349_1873883 | |||
| 1330 | Ga0206352_11153564 | |||
| 1331 | Ga0206350_11033092 | |||
| 1332 | Ga0206354_10061286 | |||
| 1333 | Ga0206354_10185715 | |||
| 1334 | Ga0206353_10429344 | |||
| 1335 | Ga0206353_10573116 | |||
| 1336 | Ga0206353_11625264 | |||
| 1337 | Ga0206353_11644797 | |||
| 1338 | Ga0213876_10174384 | |||
| 1339 | Ga0224712_10009451 | |||
| 1340 | Ga0207653_10010934 | |||
| 1341 | Ga0207692_10020153 | |||
| 1342 | Ga0207642_10042375 | |||
| 1343 | Ga0207642_10267953 | |||
| 1344 | Ga0207710_10005704 | |||
| 1345 | Ga0207688_10003011 | |||
| 1346 | Ga0207688_10137833 | |||
| 1347 | Ga0207688_10401540 | |||
| 1348 | Ga0207680_10211107 | |||
| 1349 | Ga0207699_10131636 | |||
| 1350 | Ga0207699_10143776 | |||
| 1351 | Ga0207699_10298930 | |||
| 1352 | Ga0207699_10449417 | |||
| 1353 | Ga0207643_10093787 | |||
| 1354 | Ga0207643_10212103 | |||
| 1355 | Ga0207643_10305642 | |||
| 1356 | Ga0207705_10013838 | |||
| 1357 | Ga0207705_10027414 | |||
| 1358 | Ga0207654_10435836 | |||
| 1359 | Ga0207707_10006640 | |||
| 1360 | Ga0207707_10042472 | |||
| 1361 | Ga0207707_10191135 | |||
| 1362 | Ga0207695_10016948 | |||
| 1363 | Ga0207695_10086032 | |||
| 1364 | Ga0207671_10033696 | |||
| 1365 | Ga0207671_10100781 | |||
| 1366 | Ga0207671_10573534 | |||
| 1367 | Ga0207693_10003776 | |||
| 1368 | Ga0207693_10005429 | |||
| 1369 | Ga0207693_10026494 | |||
| 1370 | Ga0207693_10172684 | |||
| 1371 | Ga0207663_10024658 | |||
| 1372 | Ga0207663_10027118 | |||
| 1373 | Ga0207663_10043010 | |||
| 1374 | Ga0207663_10122300 | |||
| 1375 | Ga0207663_10159991 | |||
| 1376 | Ga0207660_10066430 | |||
| 1377 | Ga0207662_10142139 | |||
| 1378 | Ga0207657_10008699 | |||
| 1379 | Ga0207657_10010785 | |||
| 1380 | Ga0207657_10041090 | |||
| 1381 | Ga0207657_10041625 | |||
| 1382 | Ga0207652_10003326 | |||
| 1383 | Ga0207652_10087129 | |||
| 1384 | Ga0207652_10163155 | |||
| 1385 | Ga0207652_10297693 | |||
| 1386 | Ga0207652_10512315 | |||
| 1387 | Ga0207652_10567119 | |||
| 1388 | Ga0207694_10031822 | |||
| 1389 | Ga0207694_10097251 | |||
| 1390 | Ga0207659_10821627 | |||
| 1391 | Ga0207687_10017701 | |||
| 1392 | Ga0207687_10022609 | |||
| 1393 | Ga0207687_10047667 | |||
| 1394 | Ga0207687_10067045 | |||
| 1395 | Ga0207700_10013246 | |||
| 1396 | Ga0207700_10061784 | |||
| 1397 | Ga0207700_10299251 | |||
| 1398 | Ga0207664_10001985 | |||
| 1399 | Ga0207664_10051585 | |||
| 1400 | Ga0207664_10197554 | |||
| 1401 | Ga0207664_10202980 | |||
| 1402 | Ga0207664_10345857 | |||
| 1403 | Ga0207664_10717582 | |||
| 1404 | Ga0207664_10810120 | |||
| 1405 | Ga0207644_10198206 | |||
| 1406 | Ga0207690_10010476 | |||
| 1407 | Ga0207690_10108565 | |||
| 1408 | Ga0207690_10119030 | |||
| 1409 | Ga0207706_10096563 | |||
| 1410 | Ga0207706_10199289 | |||
| 1411 | Ga0207686_10072983 | |||
| 1412 | Ga0207686_10730765 | |||
| 1413 | Ga0207709_10639753 | |||
| 1414 | Ga0207669_10303958 | |||
| 1415 | Ga0207669_10429659 | |||
| 1416 | Ga0207704_10115182 | |||
| 1417 | Ga0207704_10205514 | |||
| 1418 | Ga0207704_10235920 | |||
| 1419 | Ga0207704_10317841 | |||
| 1420 | Ga0207665_10000195 | |||
| 1421 | Ga0207665_10000601 | |||
| 1422 | Ga0207665_10006663 | |||
| 1423 | Ga0207665_10075692 | |||
| 1424 | Ga0207665_10141432 | |||
| 1425 | Ga0207665_10741370 | |||
| 1426 | Ga0207691_10256887 | |||
| 1427 | Ga0207711_10107641 | |||
| 1428 | Ga0207711_10743703 | |||
| 1429 | Ga0207689_10150182 | |||
| 1430 | Ga0207661_10004881 | |||
| 1431 | Ga0207661_10018064 | |||
| 1432 | Ga0207661_10078497 | |||
| 1433 | Ga0207661_10131215 | |||
| 1434 | Ga0207661_10414096 | |||
| 1435 | Ga0207661_10572798 | |||
| 1436 | Ga0207661_10740606 | |||
| 1437 | Ga0207679_10033818 | |||
| 1438 | Ga0207679_10073438 | |||
| 1439 | Ga0207679_10080268 | |||
| 1440 | Ga0207667_10038972 | |||
| 1441 | Ga0207667_10186461 | |||
| 1442 | Ga0207651_10162611 | |||
| 1443 | Ga0207712_10038177 | |||
| 1444 | Ga0207712_10492181 | |||
| 1445 | Ga0207668_10158996 | |||
| 1446 | Ga0207640_10022492 | |||
| 1447 | Ga0207640_10747772 | |||
| 1448 | Ga0207658_10096596 | |||
| 1449 | Ga0207677_10177629 | |||
| 1450 | Ga0207677_10255939 | |||
| 1451 | Ga0207677_10331833 | |||
| 1452 | Ga0207703_10039187 | |||
| 1453 | Ga0207703_10361769 | |||
| 1454 | Ga0207703_10426431 | |||
| 1455 | Ga0207639_10032180 | |||
| 1456 | Ga0207639_10107751 | |||
| 1457 | Ga0207639_10217847 | |||
| 1458 | Ga0207678_10041636 | |||
| 1459 | Ga0207678_10058655 | |||
| 1460 | Ga0207678_10392052 | |||
| 1461 | Ga0207678_10473383 | |||
| 1462 | Ga0207708_10010964 | |||
| 1463 | Ga0207708_10049128 | |||
| 1464 | Ga0207708_10155372 | |||
| 1465 | Ga0207708_10258905 | |||
| 1466 | Ga0207702_10080103 | |||
| 1467 | Ga0207702_10123558 | |||
| 1468 | Ga0207702_10425791 | |||
| 1469 | Ga0207702_10717445 | |||
| 1470 | Ga0207641_10235639 | |||
| 1471 | Ga0207648_10016526 | |||
| 1472 | Ga0207648_10032621 | |||
| 1473 | Ga0207676_10097948 | |||
| 1474 | Ga0207676_10166602 | |||
| 1475 | Ga0207674_10001054 | |||
| 1476 | Ga0207674_10016986 | |||
| 1477 | Ga0207674_10044896 | |||
| 1478 | Ga0207674_10196363 | |||
| 1479 | Ga0207674_10326149 | |||
| 1480 | Ga0207675_100201450 | |||
| 1481 | Ga0207675_100394787 | |||
| 1482 | Ga0207683_10000833 | |||
| 1483 | Ga0207683_10003692 | |||
| 1484 | Ga0207683_10035215 | |||
| 1485 | Ga0207698_10005457 | |||
| 1486 | Ga0207698_10043814 | |||
| 1487 | Ga0207698_10504537 | |||
| 1488 | Ga0207428_10028092 | |||
| 1489 | Ga0207428_10053368 | |||
| 1490 | Ga0207428_10088595 | |||
| 1491 | Ga0207428_10267106 | |||
| 1492 | Ga0268266_10263857 | |||
| 1493 | Ga0268264_10201930 | |||
| 1494 | Ga0268264_10481552 | |||
| 1495 | Ga0265318_10024441 | |||
| 1496 | Ga0265318_10166566 | |||
| 1497 | Ga0307515_10010678 | |||
| 1498 | Ga0265338_10018646 | |||
| 1499 | Ga0265338_10131534 | |||
| 1500 | Ga0307512_10006078 | |||
| 1501 | Ga0265320_10012357 | |||
| 1502 | Ga0265320_10033125 | |||
| 1503 | Ga0265327_10001876 | |||
| 1504 | Ga0265316_10351470 | |||
| 1505 | Ga0307513_10072345 | |||
| 1506 | Ga0307513_10073910 | |||
| 1507 | Ga0307408_100072435 | |||
| 1508 | Ga0265313_10015362 | |||
| 1509 | Ga0307508_10018211 | |||
| 1510 | Ga0307516_10066166 | |||
| 1511 | Ga0307405_10001670 | |||
| 1512 | Ga0307405_10176069 | |||
| 1513 | Ga0307405_10229809 | |||
| 1514 | Ga0307413_10001335 | |||
| 1515 | Ga0307413_10030442 | |||
| 1516 | Ga0307410_10033497 | |||
| 1517 | Ga0307410_10119763 | |||
| 1518 | Ga0307410_10210731 | |||
| 1519 | Ga0307410_10279861 | |||
| 1520 | Ga0307406_10067089 | |||
| 1521 | Ga0307407_10019549 | |||
| 1522 | Ga0307409_100104057 | |||
| 1523 | Ga0307409_100242413 | |||
| 1524 | Ga0307409_100589653 | |||
| 1525 | Ga0307416_100014965 | |||
| 1526 | Ga0307416_100138320 | |||
| 1527 | Ga0307411_10178438 | |||
| 1528 | Ga0307415_100000090 | |||
| 1529 | Ga0307415_100206395 | |||
| 1530 | Ga0373948_0030669 | |||
| 1531 | Ga0373958_0021883 | |||
| 1532 | Ga0373959_0010660 | |||
| 1533 | Ga0373959_0034892 | |||
| 1534 | Ga0373928_0010968 | |||
| 1535 | Ga0373928_0023029 | |||
| 1536 | Ga0373923_0062371 | |||
| 1537 | Ga0373932_0023557 | |||
| 1538 | Ga0373936_0041637 | |||
| 1539 | Ga0373936_0065566 | |||
| 1540 | Ga0373939_0038090 | |||
| 1541 | Ga0373953_0261233 | |||
| 1542 | Ga0373954_0088301 | |||
| 1543 | Ga0373957_0054283 | |||
| 1544 | Ga0373960_0021452 | |||
| 1545 | Ga0373960_0080218 | |||
| 1546 | Ga0373943_0028930 | |||
| 1547 | Ga0373943_0039026 | |||
| 1548 | Ga0373946_0023468 | |||
| 1549 | Ga0373946_0072254 | |||
| 1550 | Ga0373942_0004970 | |||
| 1551 | Ga0373962_0006797 | |||
| 1552 | Ga0373924_0110797 | |||
| 1553 | Ga0373931_0050166 | |||
| 1554 | Ga0373931_0209846 | |||
| 1555 | Ga0373931_0301493 | |||
| 1556 | Ga0373935_0025226 | |||
| 1557 | Ga0373935_0052604 | |||
| 1558 | Ga0373935_0071196 | |||
| 1559 | Ga0373935_0098951 | |||
| 1560 | Ga0373935_0535900 | |||
| 1561 | Ga0373927_0023041 | |||
| 1562 | Ga0373927_0024339 | |||
| 1563 | Ga0373927_0399154 | |||
| 1564 | Ga0373933_0117703 | |||
| 1565 | Ga0373933_0360613 | |||
| 1566 | Ga0373947_0004740 | |||
| 1567 | Ga0373947_0021147 | |||
| 1568 | Ga0373947_0252702 | |||
| 1569 | Ga0373937_0263144 | |||
| 1570 | Ga0373925_0003728 | |||
| 1571 | Ga0373925_0008902 | |||
| 1572 | Ga0373925_0334898 | |||
| 1573 | Ga0395899_0013453 | |||
| 1574 | Ga0395899_0085995 | |||
| 1575 | Ga0395900_0002476 | |||
| 1576 | Ga0395900_0005661 | |||
| 1577 | Ga0395900_0335705 | |||
| 1578 | Ga0395900_0965102 | |||
| 1579 | Ga0395898_0000647 | |||
| 1580 | Ga0395898_0022090 | |||
| 1581 | Ga0395898_0082928 | |||
| 1582 | Ga0395898_0102264 | |||
| 1583 | Ga0395898_0112047 | |||
| 1584 | Ga0395898_0187817 | |||
| 1585 | Ga0395905_0142028 | |||
| 1586 | Ga0395901_0064172 | |||
| 1587 | Ga0395901_0119196 | |||
| 1588 | Ga0395901_0144437 | |||
| 1589 | Ga0395901_0233642 | |||
| 1590 | Ga0436365_1372001 | |||
| 1591 | Ga0451791_0598011 | |||
| 1592 | Ga0439448_0009987 | |||
| 1593 | Ga0439459_0043442 | |||
| 1594 | Ga0466969_0041782 | |||
| 1595 | Ga0466969_0066191 | |||
| 1596 | Ga0466972_0070351 | |||
| 1597 | Ga0466965_0040962 | |||
| 1598 | Ga0466966_0067815 | |||
| 1599 | Ga0466966_0307159 | |||
| 1600 | Ga0466966_0510930 | |||
| 1601 | Ga0466961_0001879 | |||
| 1602 | Ga0466961_0023121 | |||
| 1603 | Ga0466961_0148178 | |||
| 1604 | Ga0466961_0361659 | |||
| 1605 | Ga0466963_0005079 | |||
| 1606 | Ga0466963_0007154 | |||
| 1607 | Ga0466963_0044231 | |||
| 1608 | Ga0466963_0046606 | |||
| 1609 | Ga0466963_0061384 | |||
| 1610 | Ga0466963_0092197 | |||
| 1611 | Ga0466963_0304400 | |||
| 1612 | Ga0466964_0085699 | |||
| 1613 | Ga0466964_0122863 | |||
| 1614 | Ga0466964_0156447 | |||
| 1615 | Ga0466971_0079697 | |||
| 1616 | Ga0466968_0008725 | |||
| 1617 | Ga0466968_0134188 | |||
| 1618 | Ga0466970_0032328 | |||
| 1619 | Ga0466970_0035361 | |||
| 1620 | Ga0466970_0362818 | |||
| 1621 | Ga0466957_0000876 | |||
| 1622 | Ga0466957_0286904 | |||
| 1623 | Ga0466960_0004383 | |||
| 1624 | Ga0466960_0055099 | |||
| 1625 | Ga0466960_0090782 | |||
| 1626 | Ga0466960_0233001 | |||
| 1627 | Ga0466959_0012748 | |||
| 1628 | Ga0466959_0016877 | |||
| 1629 | Ga0466959_0031929 | |||
| 1630 | Ga0466959_0207526 | |||
| 1631 | Ga0466959_0239606 | |||
| 1632 | Ga0451576_0110387 | |||
| 1633 | Ga0451576_0116084 | |||
| 1634 | Ga0466958_0011527 | |||
| 1635 | Ga0466958_0030106 | |||
| 1636 | Ga0466958_0052022 | |||
| 1637 | Ga0466958_0066652 | |||
| 1638 | Ga0466958_0115573 | |||
| 1639 | Ga0466958_0369866 | |||
| 1640 | Ga0466958_0463717 | |||
| 1641 | Ga0466967_0001987 | |||
| 1642 | Ga0466967_0003861 | |||
| 1643 | Ga0466967_0005102 | |||
| 1644 | Ga0466967_0006933 | |||
| 1645 | Ga0466967_0024880 | |||
| 1646 | Ga0466967_0039095 | |||
| 1647 | Ga0466967_0087730 | |||
| 1648 | Ga0466967_0102962 | |||
| 1649 | Ga0466967_0146200 | |||
| 1650 | Ga0466967_0159682 | |||
| 1651 | Ga0466967_0238007 | |||
| 1652 | Ga0466967_0273909 | |||
| 1653 | Ga0466967_0363831 | |||
| 1654 | Ga0466967_0392009 | |||
| 1655 | Ga0466967_0503194 | |||
| 1656 | Ga0466967_0663337 | |||
| 1657 | Ga0466967_0953031 | |||
| 1658 | Ga0495603_0018446 | |||
| 1659 | Ga0495603_0084455 | |||
| 1660 | Ga0495629_0003104 | |||
| 1661 | Ga0495629_0013284 | |||
| 1662 | Ga0495629_0073788 | |||
| 1663 | Ga0495629_0107509 | |||
| 1664 | Ga0495629_0236033 | |||
| 1665 | Ga0495629_0303359 | |||
| 1666 | Ga0495641_0006434 | |||
| 1667 | Ga0495641_0011685 | |||
| 1668 | Ga0495641_0043419 | |||
| 1669 | Ga0495641_0046828 | |||
| 1670 | Ga0495641_0102710 | |||
| 1671 | Ga0495653_0010191 | |||
| 1672 | Ga0495653_0047400 | |||
| 1673 | Ga0495653_0260084 | |||
| 1674 | Ga0495580_0133747 | |||
| 1675 | Ga0495580_0470771 | |||
| 1676 | Ga0495582_0000556 | |||
| 1677 | Ga0495582_0094319 | |||
| 1678 | Ga0495605_0036349 | |||
| 1679 | Ga0495639_0000322 | |||
| 1680 | Ga0495639_0000484 | |||
| 1681 | Ga0495662_0005856 | |||
| 1682 | Ga0495662_0010467 | |||
| 1683 | Ga0495662_0058954 | |||
| 1684 | Ga0495662_0068334 | |||
| 1685 | Ga0495664_0004712 | |||
| 1686 | Ga0495664_0134037 | |||
| 1687 | Ga0495584_0286115 | |||
| 1688 | Ga0495594_0007889 | |||
| 1689 | Ga0495594_0216596 | |||
| 1690 | Ga0495607_0195851 | |||
| 1691 | Ga0495606_0002983 | |||
| 1692 | Ga0495608_0014283 | |||
| 1693 | Ga0495608_0111010 | |||
| 1694 | Ga0495608_0337565 | |||
| 1695 | Ga0495608_0453886 | |||
| 1696 | Ga0495616_0063656 | |||
| 1697 | Ga0495618_0007980 | |||
| 1698 | Ga0495618_0040561 | |||
| 1699 | Ga0495620_0084431 | |||
| 1700 | Ga0495630_0007718 | |||
| 1701 | Ga0495630_0080750 | |||
| 1702 | Ga0495630_0316227 | |||
| 1703 | Ga0495632_0245801 | |||
| 1704 | Ga0495663_0008906 | |||
| 1705 | Ga0495666_0000381 | |||
| 1706 | Ga0495666_0025977 | |||
| 1707 | Ga0495652_0018726 | |||
| 1708 | Ga0495665_0001289 | |||
| 1709 | Ga0495665_0004560 | |||
| 1710 | Ga0495665_0005611 | |||
| 1711 | Ga0495665_0175949 | |||
| 1712 | Ga0495640_0019654 | |||
| 1713 | Ga0495640_0095027 | |||
| 1714 | Ga0495640_0152143 | |||
| 1715 | Ga0495640_0174723 | |||
| 1716 | Ga0495586_0009299 | |||
| 1717 | Ga0495587_0064209 | |||
| 1718 | Ga0495587_0366642 | |||
| 1719 | Ga0495609_0142992 | |||
| 1720 | Ga0495621_0017646 | |||
| 1721 | Ga0495645_0302806 | |||
| 1722 | Ga0495645_0441092 | |||
| 1723 | Ga0495667_0022322 | |||
| 1724 | Ga0495667_0112754 | |||
| 1725 | Ga0495667_0445422 | |||
| 1726 | Ga0495668_0002487 | |||
| 1727 | Ga0495634_0011846 | |||
| 1728 | Ga0495611_0092206 | |||
| 1729 | Ga0495625_0004304 | |||
| 1730 | Ga0495635_0002868 | |||
| 1731 | Ga0495635_0005770 | |||
| 1732 | Ga0495635_0032400 | |||
| 1733 | Ga0495635_0214706 | |||
| 1734 | Ga0495635_0252106 | |||
| 1735 | Ga0495659_0021617 | |||
| 1736 | Ga0495588_0004661 | |||
| 1737 | Ga0495588_0179206 | |||
| 1738 | Ga0495657_0011425 | |||
| 1739 | Ga0495623_0135923 | |||
| 1740 | Ga0495646_0097986 | |||
| 1741 | Ga0495646_0134576 | |||
| 1742 | Ga0495647_0000125 | |||
| 1743 | Ga0495647_0012406 | |||
| 1744 | Ga0495647_0092653 | |||
| 1745 | Ga0495658_0009157 | |||
| 1746 | Ga0495658_0010814 | |||
| 1747 | Ga0495658_0020440 | |||
| 1748 | Ga0495658_0395814 | |||
| 1749 | Ga0495658_0459177 | |||
| 1750 | Ga0495669_0034445 | |||
| 1751 | Ga0495613_0015338 | |||
| 1752 | Ga0495613_0018490 | |||
| 1753 | Ga0495613_0049767 | |||
| 1754 | Ga0495624_0003568 | |||
| 1755 | Ga0495624_0012260 | |||
| 1756 | Ga0495670_0216085 | |||
| 1757 | Ga0495670_0231718 | |||
| 1758 | Ga0495670_0239659 | |||
| 1759 | Ga0495600_0002021 | |||
| 1760 | Ga0495600_0250855 | |||
| 1761 | Ga0495600_0275767 | |||
| 1762 | Ga0495581_0014414 | |||
| 1763 | Ga0495581_0024013 | |||
| 1764 | Ga0495604_0190611 | |||
| 1765 | Ga0495674_0023283 | |||
| 1766 | Ga0495674_0037655 | |||
| 1767 | Ga0495674_0058125 | |||
| 1768 | Ga0495674_0164679 | |||
| 1769 | Ga0495674_0208773 | |||
| 1770 | Ga0495674_0375387 | |||
| 1771 | Ga0495674_0387615 | |||
| 1772 | Ga0495674_0701987 | |||
| 1773 | Ga0495676_0004037 | |||
| 1774 | Ga0495676_0007501 | |||
| 1775 | Ga0495676_0027898 | |||
| 1776 | Ga0495680_0059675 | |||
| 1777 | Ga0495680_0132194 | |||
| 1778 | Ga0495680_0192253 | |||
| 1779 | Ga0495680_0226473 | |||
| 1780 | Ga0495675_0026638 | |||
| 1781 | Ga0495675_0225238 | |||
| 1782 | Ga0495684_0009841 | |||
| 1783 | Ga0495684_0099851 | |||
| 1784 | Ga0495684_0216457 | |||
| 1785 | Ga0495593_0001712 | |||
| 1786 | Ga0495593_0013286 | |||
| 1787 | Ga0495593_0389500 | |||
| 1788 | Ga0495602_0047169 | |||
| 1789 | Ga0495602_0420012 | |||
| 1790 | Ga0495614_0022259 | |||
| 1791 | Ga0495614_0119046 | |||
| 1792 | Ga0495626_0001210 | |||
| 1793 | Ga0496100_0036946 | |||
| 1794 | Ga0496100_0043571 | |||
| 1795 | Ga0496100_0068408 | |||
| 1796 | Ga0496100_0068643 | |||
| 1797 | Ga0496100_0068952 | |||
| 1798 | Ga0496100_0130895 | |||
| 1799 | Ga0496100_0132266 | |||
| 1800 | Ga0496100_0190027 | |||
| 1801 | Ga0496100_0229499 | |||
| 1802 | Ga0496100_0249262 | |||
| 1803 | Ga0496100_0544164 | |||
| 1804 | Ga0496101_0019803 | |||
| 1805 | Ga0496101_0028280 | |||
| 1806 | Ga0496101_0054862 | |||
| 1807 | Ga0496101_0061488 | |||
| 1808 | Ga0496101_0073391 | |||
| 1809 | Ga0496101_0151121 | |||
| 1810 | Ga0496101_0221889 | |||
| 1811 | Ga0496101_0312608 | |||
| 1812 | Ga0496102_0000044 | |||
| 1813 | Ga0496102_0000669 | |||
| 1814 | Ga0496102_0013968 | |||
| 1815 | Ga0496102_0018252 | |||
| 1816 | Ga0496102_0039907 | |||
| 1817 | Ga0496102_0043100 | |||
| 1818 | Ga0496102_0046725 | |||
| 1819 | Ga0496102_0106076 | |||
| 1820 | Ga0496102_0110761 | |||
| 1821 | Ga0496102_0136062 | |||
| 1822 | Ga0496102_0209082 | |||
| 1823 | Ga0496102_0239905 | |||
| 1824 | Ga0496102_0478728 | |||
| 1825 | Ga0496102_0485859 | |||
| 1826 | Ga0496103_0000123 | |||
| 1827 | Ga0496103_0006778 | |||
| 1828 | Ga0496103_0024711 | |||
| 1829 | Ga0496103_0043628 | |||
| 1830 | Ga0496103_0050205 | |||
| 1831 | Ga0496103_0138677 | |||
| 1832 | Ga0496103_0159149 | |||
| 1833 | Ga0496103_0417328 | |||
| 1834 | Ga0496103_0420387 | |||
| 1835 | Ga0496103_0457849 | |||
| 1836 | Ga0496104_0011466 | |||
| 1837 | Ga0496104_0013602 | |||
| 1838 | Ga0496104_0014409 | |||
| 1839 | Ga0496104_0027699 | |||
| 1840 | Ga0496104_0034169 | |||
| 1841 | Ga0496104_0044810 | |||
| 1842 | Ga0496104_0058061 | |||
| 1843 | Ga0496104_0103028 | |||
| 1844 | Ga0496104_0115270 | |||
| 1845 | Ga0496104_0117783 | |||
| 1846 | Ga0496104_0123377 | |||
| 1847 | Ga0496104_0139560 | |||
| 1848 | Ga0496104_0218858 | |||
| 1849 | Ga0496104_0221224 | |||
| 1850 | Ga0496104_0221848 | |||
| 1851 | Ga0496104_0533917 | |||
| 1852 | Ga0496105_0004276 | |||
| 1853 | Ga0496105_0005275 | |||
| 1854 | Ga0496105_0018647 | |||
| 1855 | Ga0496105_0045351 | |||
| 1856 | Ga0496105_0080135 | |||
| 1857 | Ga0496105_0104604 | |||
| 1858 | Ga0496105_0148559 | |||
| 1859 | Ga0496105_0153966 | |||
| 1860 | Ga0496105_0194434 | |||
| 1861 | Ga0496105_0388577 | |||
| 1862 | Ga0496105_0504297 | |||
| 1863 | Ga0496106_0007647 | |||
| 1864 | Ga0496106_0011800 | |||
| 1865 | Ga0496106_0016676 | |||
| 1866 | Ga0496106_0018577 | |||
| 1867 | Ga0496106_0055255 | |||
| 1868 | Ga0496106_0097150 | |||
| 1869 | Ga0496106_0108617 | |||
| 1870 | Ga0496106_0126810 | |||
| 1871 | Ga0496106_0155778 | |||
| 1872 | Ga0496107_0028222 | |||
| 1873 | Ga0496107_0032253 | |||
| 1874 | Ga0496107_0036363 | |||
| 1875 | Ga0496107_0045591 | |||
| 1876 | Ga0496107_0081206 | |||
| 1877 | Ga0496107_0098938 | |||
| 1878 | Ga0496107_0303185 | |||
| 1879 | Ga0496107_0516595 | |||
| 1880 | Ga0496108_0009178 | |||
| 1881 | Ga0496108_0014293 | |||
| 1882 | Ga0496108_0021143 | |||
| 1883 | Ga0496108_0022524 | |||
| 1884 | Ga0496108_0038584 | |||
| 1885 | Ga0496108_0104013 | |||
| 1886 | Ga0496108_0136804 | |||
| 1887 | Ga0496108_0277156 | |||
| 1888 | Ga0496108_0309335 | |||
| 1889 | Ga0496108_0462371 | |||
| 1890 | Ga0496108_0643625 | |||
| 1891 | Ga0496109_0001181 | |||
| 1892 | Ga0496109_0001497 | |||
| 1893 | Ga0496109_0002763 | |||
| 1894 | Ga0496109_0010768 | |||
| 1895 | Ga0496109_0024527 | |||
| 1896 | Ga0496109_0027766 | |||
| 1897 | Ga0496109_0028637 | |||
| 1898 | Ga0496109_0057894 | |||
| 1899 | Ga0496109_0065716 | |||
| 1900 | Ga0496109_0101415 | |||
| 1901 | Ga0496109_0122100 | |||
| 1902 | Ga0496109_0255789 | |||
| 1903 | Ga0496110_0002894 | |||
| 1904 | Ga0496110_0003955 | |||
| 1905 | Ga0496110_0005402 | |||
| 1906 | Ga0496110_0012717 | |||
| 1907 | Ga0496110_0021225 | |||
| 1908 | Ga0496110_0069223 | |||
| 1909 | Ga0496110_0106372 | |||
| 1910 | Ga0496110_0151032 | |||
| 1911 | Ga0496110_0164684 | |||
| 1912 | Ga0496110_0381672 | |||
| 1913 | Ga0496110_0574639 | |||
| 1914 | Ga0496110_0582985 | |||
| 1915 | Ga0496111_0000950 | |||
| 1916 | Ga0496111_0001566 | |||
| 1917 | Ga0496111_0029301 | |||
| 1918 | Ga0496111_0034973 | |||
| 1919 | Ga0496111_0069256 | |||
| 1920 | Ga0496111_0070133 | |||
| 1921 | Ga0496111_0166069 | |||
| 1922 | Ga0496111_0175800 | |||
| 1923 | Ga0496111_0250810 | |||
| 1924 | Ga0496112_0007917 | |||
| 1925 | Ga0496112_0008096 | |||
| 1926 | Ga0496112_0023292 | |||
| 1927 | Ga0496112_0051518 | |||
| 1928 | Ga0496112_0089434 | |||
| 1929 | Ga0496112_0105046 | |||
| 1930 | Ga0496112_0180960 | |||
| 1931 | Ga0496112_0222874 | |||
| 1932 | Ga0496112_0271807 | |||
| 1933 | Ga0496112_0340820 | |||
| 1934 | Ga0496113_0002548 | |||
| 1935 | Ga0496113_0020491 | |||
| 1936 | Ga0496113_0027747 | |||
| 1937 | Ga0496113_0050403 | |||
| 1938 | Ga0496113_0109010 | |||
| 1939 | Ga0496113_0122777 | |||
| 1940 | Ga0496113_0203794 | |||
| 1941 | Ga0496113_0423410 | |||
| 1942 | Ga0496114_0010141 | |||
| 1943 | Ga0496114_0047435 | |||
| 1944 | Ga0496114_0051346 | |||
| 1945 | Ga0496114_0062504 | |||
| 1946 | Ga0496114_0066554 | |||
| 1947 | Ga0496114_0077580 | |||
| 1948 | Ga0496114_0110497 | |||
| 1949 | Ga0496114_0112716 | |||
| 1950 | Ga0496114_0167902 | |||
| 1951 | Ga0496114_0432914 | |||
| 1952 | Ga0496114_0439378 | |||
| 1953 | Ga0496114_0558122 | |||
| 1954 | Ga0496115_0002678 | |||
| 1955 | Ga0496115_0068553 | |||
| 1956 | Ga0496115_0088415 | |||
| 1957 | Ga0496115_0101210 | |||
| 1958 | Ga0496115_0189887 | |||
| 1959 | Ga0496115_0209007 | |||
| 1960 | Ga0496115_0223249 | |||
| 1961 | Ga0496115_0323657 | |||
| 1962 | Ga0496118_0042197 | |||
| 1963 | Ga0496119_0000333 | |||
| 1964 | Ga0496119_0015393 | |||
| 1965 | Ga0496120_0015310 | |||
| 1966 | Ga0496120_0068025 | |||
| 1967 | Ga0501032_0219753 | |||
| 1968 | Ga0501036_0157878 | |||
| 1969 | Ga0501037_0028486 | |||
| 1970 | Ga0501038_0225409 | |||
| 1971 | Ga0501039_0022065 | |||
| 1972 | Ga0501046_0012417 | |||
| 1973 | Ga0501047_0333934 | |||
| 1974 | Ga0501067_0002055 | |||
| 1975 | Ga0501067_0019838 | |||
| 1976 | Ga0501068_0052215 | |||
| 1977 | Ga0501069_0025754 | |||
| 1978 | Ga0501069_0065922 | |||
| 1979 | Ga0501069_0150127 | |||
| 1980 | Ga0501070_0129570 | |||
| 1981 | Ga0501074_0061956 | |||
| 1982 | Ga0501080_0198527 | |||
| 1983 | Ga0501080_0965520 | |||
| 1984 | Ga0501035_0174366 | |||
| 1985 | Ga0501044_0456446 | |||
| 1986 | Ga0501044_0676668 | |||
| 1987 | Ga0501044_1026951 | |||
| 1988 | nmdc:mga05p37_218242_c1 | |||
| 1989 | nmdc:mga05p37_8428_c1 | |||
| 1990 | nmdc:mga0qj67_132852_c1 | |||
| 1991 | nmdc:mga08y16_326067_c1 | |||
| 1992 | nmdc:mga08y16_36663_c1 | |||
| 1993 | nmdc:mga0n895_108231_c1 | |||
| 1994 | nmdc:mga0n895_14986_c1 | |||
| 1995 | nmdc:mga0n895_42194_c1 | |||
| 1996 | nmdc:mga0rr50_566486_c1 | |||
| 1997 | nmdc:mga0rr50_6021_c1 | |||
| 1998 | nmdc:mga0rr50_84884_c1 | |||
| 1999 | nmdc:mga08x19_22363_c1 | |||
| 2000 | nmdc:mga08x19_64249_c1 | |||
| 2001 | nmdc:mga08x19_68069_c1 | |||
| 2002 | nmdc:mga0a205_115318_c1 | |||
| 2003 | nmdc:mga0a205_902062_c1 | |||
| 2004 | Ga0495601_0005606 | |||
| 2005 | Ga0495601_0039984 | |||
| 2006 | Ga0495601_0082212 | |||
| 2007 | Ga0495601_0268923 | |||
| 2008 | Ga0495612_0001055 | |||
| 2009 | Ga0495612_0037938 | |||
| 2010 | Ga0495655_0087718 | |||
| 2011 | Ga0495595_0082259 | |||
| 2012 | Ga0495619_0011287 | |||
| 2013 | Ga0495619_0335389 | |||
| 2014 | Ga0495619_0344742 | |||
| 2015 | Ga0500583_0184189 | |||
| 2016 | Ga0500566_0024371 | |||
| 2017 | Ga0500556_0000417 | |||
| 2018 | Ga0500568_0123165 | |||
| 2019 | Ga0500600_0011756 | |||
| 2020 | Ga0466962_0009921 | |||
| 2021 | Ga0466962_0082473 | |||
| 2022 | Ga0466962_0091526 | |||
| 2023 | Ga0530510_0271324 | |||
| 2024 | 2819425918 | |||
| 2025 | 2819665006 | |||
| 2026 | 2887480959 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xv5-assembly1.cif.gz_B | crystal structure of rib7 mutant s88e from methanosarcina mazei | 0.9131 | 20 | 240 |
| 5xux-assembly2.cif.gz_C | crystal structure of rib7 from methanosarcina mazei | 0.9129 | 20 | 240 |
| 5xv0-assembly1.cif.gz_A | crystal structure of rib7 mutant d33n from methanosarcina mazei | 0.9123 | 19 | 240 |
| 5xv0-assembly3.cif.gz_E | crystal structure of rib7 mutant d33n from methanosarcina mazei | 0.9121 | 20 | 240 |
| 5xux-assembly3.cif.gz_F | crystal structure of rib7 from methanosarcina mazei | 0.9115 | 19 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xuxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.93 | 20 | 240 | 3.40.430.10 |
| 5xuxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9141 | 20 | 240 | 3.40.430.10 |
| 3h7kA00 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.8846 | 121 | 147 | 3.75.10.10 |
| 2aznF00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8778 | 21 | 240 | 3.40.430.10 |
| 3zpgA02 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8639 | 21 | 240 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q9QFU6-F1-model_v4 | Deaminase | 0.9799 | 19 | 244 |
GO:0008703
GO:0009231 |
| AF-A0A543DYK6-F1-model_v4 | 5-amino-6-(5-phosphoribosylamino)uracil reductase | 0.9772 | 21 | 239 |
GO:0008703
GO:0009231 |
| AF-A0A7Y9GMP1-F1-model_v4 | 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) | 0.9753 | 19 | 242 |
GO:0008703
GO:0009231 |
| AF-A0A259SMT2-F1-model_v4 | Deaminase | 0.9674 | 65 | 246 |
GO:0008703
GO:0009231 |
| AF-A0A396MDH7-F1-model_v4 | Riboflavin biosynthesis protein RibD (EC 3.5.4.26) | 0.9656 | 23 | 242 |
GO:0008703
GO:0008835 GO:0009231 |