F488203

General Info

Members Datasets Scaffolds Average Seq Length
1013 364 2026 226

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0008540|Ga0501047_0008540_4551_5456
Length 264
Sequence MLFMGERPYTLLSCGMSIDGYLDGATDERLLLSNDADFDRVDAVRAECDAILVGAETVRQDNPRLLVRSKARRDDRVARGLRPSPVKVTVTQRGRLDPCARFFVTGESDKLVYCASRTIDDARRRLGPVATVVDAGDPVNLRRVTEDLYARGIARLMVEGGGTVHTQFLTADLADELHLVVAPFFVGDSRARRFVDDGRFPWHPGRRATLAEVRQIGDVVLLRYALSERFGSGRFDSPGQRPRRAAVPDGPDPLRIGPASLGAG

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
356 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
357 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
363 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
364 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.09
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 16.78
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0008540 3300049581 Bacteria 9662
2 JGI24737J22298_10106451 3300001990 Bacteria 830
3 Ga0070658_10012228 3300005327 Bacteria 6890
4 Ga0070676_10378054 3300005328 Bacteria 980
5 Ga0070683_100009018 3300005329 Bacteria 8509
6 Ga0070683_100016184 3300005329 Bacteria 6569
7 Ga0070683_100044245 3300005329 Bacteria 4106
8 Ga0070683_100080515 3300005329 Bacteria 3049
9 Ga0070683_100143935 3300005329 Bacteria 2258
10 Ga0070683_100174470 3300005329 Bacteria 2041
11 Ga0070683_100482419 3300005329 Bacteria 1184
12 Ga0070690_100108110 3300005330 Bacteria 1852
13 Ga0070670_100146353 3300005331 Bacteria 2044
14 Ga0068869_100094719 3300005334 Bacteria 2252
15 Ga0068869_100384366 3300005334 Bacteria 1151
16 Ga0070666_10110019 3300005335 Bacteria 1905
17 Ga0070680_100053920 3300005336 Bacteria 3282
18 Ga0070680_100328131 3300005336 Bacteria 1300
19 Ga0070680_100408909 3300005336 Bacteria 1157
20 Ga0070680_100690582 3300005336 Bacteria 878
21 Ga0070682_100082916 3300005337 Bacteria 2079
22 Ga0070682_100201688 3300005337 Bacteria 1404
23 Ga0070682_100201997 3300005337 Bacteria 1403
24 Ga0070682_100423449 3300005337 Bacteria 1012
25 Ga0068868_100182206 3300005338 Bacteria 1743
26 Ga0068868_100264178 3300005338 Bacteria 1452
27 Ga0068868_100339716 3300005338 Bacteria 1284
28 Ga0068868_100372062 3300005338 Bacteria 1228
29 Ga0070660_100001285 3300005339 Bacteria 17109
30 Ga0070660_100005389 3300005339 Bacteria 8854
31 Ga0070660_100065198 3300005339 Bacteria 2835
32 Ga0070660_100126528 3300005339 Bacteria 2042
33 Ga0070660_100586805 3300005339 Bacteria 931
34 Ga0070689_100125086 3300005340 Bacteria 2057
35 Ga0070689_100183860 3300005340 Bacteria 1699
36 Ga0070691_10062517 3300005341 Bacteria 1793
37 Ga0070691_10112908 3300005341 Bacteria 1361
38 Ga0070691_10151530 3300005341 Bacteria 1189
39 Ga0070687_100106867 3300005343 Bacteria 1577
40 Ga0070687_100224790 3300005343 Bacteria 1152
41 Ga0070661_100149213 3300005344 Bacteria 1767
42 Ga0070692_10054177 3300005345 Bacteria 2093
43 Ga0070692_10103983 3300005345 Bacteria 1561
44 Ga0070692_10253420 3300005345 Bacteria 1055
45 Ga0070668_100007547 3300005347 Bacteria 8075
46 Ga0070671_100012587 3300005355 Bacteria 6814
47 Ga0070671_100432482 3300005355 Bacteria 1128
48 Ga0070674_100159742 3300005356 Bacteria 1709
49 Ga0070674_100212603 3300005356 Bacteria 1500
50 Ga0070674_100486923 3300005356 Bacteria 1025
51 Ga0070673_100224025 3300005364 Bacteria 1629
52 Ga0070659_100002112 3300005366 Bacteria 14160
53 Ga0070659_100035528 3300005366 Bacteria 3881
54 Ga0070659_100138576 3300005366 Bacteria 1980
55 Ga0070659_100180359 3300005366 Bacteria 1733
56 Ga0070659_100265179 3300005366 Bacteria 1426
57 Ga0070659_100317224 3300005366 Bacteria 1302
58 Ga0070667_100041998 3300005367 Bacteria 3835
59 Ga0070703_10006246 3300005406 Bacteria 3338
60 Ga0070709_10023197 3300005434 Bacteria 3641
61 Ga0070709_10118497 3300005434 Bacteria 1790
62 Ga0070709_10145309 3300005434 Bacteria 1633
63 Ga0070709_10537536 3300005434 Bacteria 893
64 Ga0070714_100000894 3300005435 Bacteria 21143
65 Ga0070714_100040769 3300005435 Bacteria 3915
66 Ga0070714_100203415 3300005435 Bacteria 1812
67 Ga0070714_100258495 3300005435 Bacteria 1612
68 Ga0070714_100305226 3300005435 Bacteria 1485
69 Ga0070714_100879266 3300005435 Bacteria 870
70 Ga0070713_100027607 3300005436 Bacteria 4470
71 Ga0070713_100065337 3300005436 Bacteria 3056
72 Ga0070713_100101830 3300005436 Bacteria 2489
73 Ga0070713_100130668 3300005436 Bacteria 2214
74 Ga0070713_100853264 3300005436 Bacteria 874
75 Ga0070710_10017218 3300005437 Bacteria 3694
76 Ga0070710_10035441 3300005437 Bacteria 2720
77 Ga0070710_10267480 3300005437 Bacteria 1104
78 Ga0070711_100011836 3300005439 Bacteria 5429
79 Ga0070711_100140480 3300005439 Bacteria 1810
80 Ga0070711_100173013 3300005439 Bacteria 1647
81 Ga0070711_100231475 3300005439 Bacteria 1441
82 Ga0070711_100240861 3300005439 Bacteria 1414
83 Ga0070711_100252691 3300005439 Bacteria 1383
84 Ga0070705_100015867 3300005440 Bacteria 3902
85 Ga0070700_100100786 3300005441 Bacteria 1902
86 Ga0070700_100136824 3300005441 Bacteria 1660
87 Ga0070700_100463669 3300005441 Bacteria 967
88 Ga0070694_100111554 3300005444 Bacteria 1949
89 Ga0070694_100352407 3300005444 Bacteria 1141
90 Ga0070694_100561933 3300005444 Bacteria 915
91 Ga0070708_100706627 3300005445 Bacteria 949
92 Ga0070663_100043131 3300005455 Bacteria 3173
93 Ga0070663_100211538 3300005455 Bacteria 1518
94 Ga0070663_100626514 3300005455 Bacteria 907
95 Ga0070678_100029931 3300005456 Bacteria 3735
96 Ga0070678_100077314 3300005456 Bacteria 2510
97 Ga0070662_100116546 3300005457 Bacteria 2042
98 Ga0070662_100143536 3300005457 Bacteria 1852
99 Ga0070662_100621682 3300005457 Bacteria 910
100 Ga0070681_10064650 3300005458 Bacteria 3628
101 Ga0070681_10302911 3300005458 Bacteria 1508
102 Ga0068867_100181007 3300005459 Bacteria 1676
103 Ga0070685_10259144 3300005466 Bacteria 1156
104 Ga0070707_100455379 3300005468 Bacteria 1240
105 Ga0070679_100016072 3300005530 Bacteria 7209
106 Ga0070679_100036601 3300005530 Bacteria 4871
107 Ga0070679_100457522 3300005530 Bacteria 1221
108 Ga0070679_100572839 3300005530 Bacteria 1073
109 Ga0070684_100003769 3300005535 Bacteria 11448
110 Ga0070684_100032430 3300005535 Bacteria 4452
111 Ga0070684_100033498 3300005535 Bacteria 4386
112 Ga0070684_100036808 3300005535 Bacteria 4194
113 Ga0070684_100056138 3300005535 Bacteria 3435
114 Ga0070684_100056369 3300005535 Bacteria 3429
115 Ga0070684_100141597 3300005535 Bacteria 2175
116 Ga0070684_100197372 3300005535 Bacteria 1832
117 Ga0070684_100700963 3300005535 Bacteria 944
118 Ga0068853_100110199 3300005539 Bacteria 2445
119 Ga0068853_100380756 3300005539 Bacteria 1317
120 Ga0070686_100037841 3300005544 Bacteria 2995
121 Ga0070686_100042074 3300005544 Bacteria 2860
122 Ga0070686_100138609 3300005544 Bacteria 1691
123 Ga0070686_100256874 3300005544 Bacteria 1279
124 Ga0070695_100424844 3300005545 Bacteria 1013
125 Ga0070696_100010038 3300005546 Bacteria 6334
126 Ga0070696_100022542 3300005546 Bacteria 4279
127 Ga0070696_100078536 3300005546 Bacteria 2334
128 Ga0070696_100138758 3300005546 Bacteria 1775
129 Ga0070696_100144071 3300005546 Bacteria 1744
130 Ga0070693_100007320 3300005547 Bacteria 5390
131 Ga0070693_100042559 3300005547 Bacteria 2559
132 Ga0070665_100341887 3300005548 Bacteria 1501
133 Ga0070665_100362696 3300005548 Bacteria 1455
134 Ga0070665_100377053 3300005548 Bacteria 1426
135 Ga0070704_100013449 3300005549 Bacteria 5080
136 Ga0070704_100068922 3300005549 Bacteria 2561
137 Ga0068855_100012401 3300005563 Bacteria 10293
138 Ga0068855_100023543 3300005563 Bacteria 7374
139 Ga0068855_100321570 3300005563 Bacteria 1710
140 Ga0068855_100486488 3300005563 Bacteria 1343
141 Ga0070664_100195323 3300005564 Bacteria 1804
142 Ga0070664_100206575 3300005564 Bacteria 1754
143 Ga0070664_100367883 3300005564 Bacteria 1310
144 Ga0070664_100581342 3300005564 Bacteria 1038
145 Ga0068857_100001692 3300005577 Bacteria 17733
146 Ga0068857_100014191 3300005577 Bacteria 6938
147 Ga0068857_100722924 3300005577 Bacteria 947
148 Ga0068854_100056597 3300005578 Bacteria 2827
149 Ga0068854_100195568 3300005578 Bacteria 1587
150 Ga0068856_100013828 3300005614 Bacteria 7802
151 Ga0068856_100024559 3300005614 Bacteria 5868
152 Ga0068856_100088553 3300005614 Bacteria 3078
153 Ga0068856_100376453 3300005614 Bacteria 1439
154 Ga0068856_100601052 3300005614 Bacteria 1121
155 Ga0070702_100067949 3300005615 Bacteria 2096
156 Ga0068852_100009339 3300005616 Bacteria 7280
157 Ga0068852_100593127 3300005616 Bacteria 1112
158 Ga0068859_100013627 3300005617 Bacteria 8151
159 Ga0068859_100271115 3300005617 Bacteria 1789
160 Ga0068859_100403685 3300005617 Bacteria 1463
161 Ga0068859_100432310 3300005617 Bacteria 1413
162 Ga0068864_100064564 3300005618 Bacteria 3175
163 Ga0068861_100150032 3300005719 Bacteria 1912
164 Ga0068870_10134947 3300005840 Bacteria 1438
165 Ga0068870_10255196 3300005840 Bacteria 1089
166 Ga0068870_10321776 3300005840 Bacteria 983
167 Ga0068863_100083410 3300005841 Bacteria 3029
168 Ga0068858_100077971 3300005842 Bacteria 3078
169 Ga0068860_100084965 3300005843 Bacteria 3010
170 Ga0068862_100707180 3300005844 Bacteria 977
171 Ga0081455_10024797 3300005937 Bacteria 5545
172 Ga0081455_10025518 3300005937 Bacteria 5453
173 Ga0081455_10170847 3300005937 Bacteria 1656
174 Ga0081538_10021579 3300005981 Bacteria 4691
175 Ga0081540_1003230 3300005983 Bacteria 12988
176 Ga0081540_1004696 3300005983 Bacteria 10338
177 Ga0081540_1014407 3300005983 Bacteria 5064
178 Ga0081539_10001518 3300005985 Bacteria 38975
179 Ga0081539_10006277 3300005985 Bacteria 11490
180 Ga0081539_10059860 3300005985 Bacteria 2094
181 Ga0070717_10001730 3300006028 Bacteria 15232
182 Ga0070717_10039495 3300006028 Bacteria 3840
183 Ga0070717_10040314 3300006028 Bacteria 3803
184 Ga0070717_10246009 3300006028 Bacteria 1579
185 Ga0070717_10370869 3300006028 Bacteria 1282
186 Ga0075432_10019292 3300006058 Bacteria 2329
187 Ga0070716_100016508 3300006173 Bacteria 3812
188 Ga0070716_100166307 3300006173 Bacteria 1434
189 Ga0070716_100347385 3300006173 Bacteria 1049
190 Ga0070712_100022962 3300006175 Bacteria 4113
191 Ga0070712_100384053 3300006175 Bacteria 1157
192 Ga0070712_100645992 3300006175 Bacteria 899
193 Ga0097621_100053228 3300006237 Bacteria 3299
194 Ga0097621_100113335 3300006237 Bacteria 2294
195 Ga0097621_100378741 3300006237 Bacteria 1263
196 Ga0068871_100065208 3300006358 Bacteria 2982
197 Ga0075428_100023749 3300006844 Bacteria 6785
198 Ga0075430_100043862 3300006846 Bacteria 3782
199 Ga0075431_100068089 3300006847 Bacteria 3674
200 Ga0075433_10284126 3300006852 Bacteria 1466
201 Ga0075434_100000357 3300006871 Bacteria 33121
202 Ga0075434_100022375 3300006871 Bacteria 6156
203 Ga0075434_100043392 3300006871 Bacteria 4461
204 Ga0075434_100047366 3300006871 Bacteria 4266
205 Ga0068865_100093452 3300006881 Bacteria 2187
206 Ga0068865_100121384 3300006881 Bacteria 1944
207 Ga0068865_100334097 3300006881 Bacteria 1223
208 Ga0075436_100010725 3300006914 Bacteria 6285
209 Ga0075436_100021002 3300006914 Bacteria 4479
210 Ga0075436_100168380 3300006914 Bacteria 1547
211 Ga0097620_100013627 3300006931 Bacteria 8151
212 Ga0097620_100271117 3300006931 Bacteria 1789
213 Ga0097620_100403685 3300006931 Bacteria 1463
214 Ga0097620_100432341 3300006931 Bacteria 1413
215 Ga0075435_100002080 3300007076 Bacteria 13133
216 Ga0075435_100060922 3300007076 Bacteria 3060
217 Ga0075435_100153173 3300007076 Bacteria 1939
218 Ga0075435_100291479 3300007076 Bacteria 1394
219 Ga0105240_10012384 3300009093 Bacteria 11778
220 Ga0105240_10058663 3300009093 Bacteria 4805
221 Ga0105240_10124671 3300009093 Bacteria 3097
222 Ga0111539_10010762 3300009094 Bacteria 11514
223 Ga0111539_10018092 3300009094 Bacteria 8730
224 Ga0111539_10057998 3300009094 Bacteria 4595
225 Ga0111539_10290047 3300009094 Bacteria 1904
226 Ga0111539_10389091 3300009094 Bacteria 1624
227 Ga0111539_10500846 3300009094 Bacteria 1415
228 Ga0111539_10616445 3300009094 Bacteria 1264
229 Ga0111539_11381875 3300009094 Bacteria 817
230 Ga0105245_10014744 3300009098 Bacteria 6807
231 Ga0105245_10024857 3300009098 Bacteria 5264
232 Ga0105245_10055645 3300009098 Bacteria 3554
233 Ga0105245_10077160 3300009098 Bacteria 3037
234 Ga0105245_10172545 3300009098 Bacteria 2060
235 Ga0105245_10288170 3300009098 Bacteria 1607
236 Ga0105247_10006155 3300009101 Bacteria 7453
237 Ga0105247_10060638 3300009101 Bacteria 2345
238 Ga0105247_10148665 3300009101 Bacteria 1542
239 Ga0114129_10000964 3300009147 Bacteria 37590
240 Ga0114129_10160851 3300009147 Bacteria 3067
241 Ga0114129_10240886 3300009147 Bacteria 2431
242 Ga0114129_10384152 3300009147 Bacteria 1854
243 Ga0114129_10816256 3300009147 Bacteria 1189
244 Ga0105243_10007690 3300009148 Bacteria 8282
245 Ga0105243_10467465 3300009148 Bacteria 1187
246 Ga0105241_10007849 3300009174 Bacteria 7849
247 Ga0105241_10063163 3300009174 Bacteria 2856
248 Ga0105242_10169251 3300009176 Bacteria 1919
249 Ga0105242_10322018 3300009176 Bacteria 1418
250 Ga0105242_10382403 3300009176 Bacteria 1309
251 Ga0105242_10954151 3300009176 Bacteria 862
252 Ga0105248_10084082 3300009177 Bacteria 3580
253 Ga0105248_10467329 3300009177 Bacteria 1422
254 Ga0105237_10019190 3300009545 Bacteria 7064
255 Ga0105237_10077168 3300009545 Bacteria 3322
256 Ga0105237_10117776 3300009545 Bacteria 2650
257 Ga0105237_10632288 3300009545 Bacteria 1077
258 Ga0105237_10851122 3300009545 Bacteria 919
259 Ga0105238_10011067 3300009551 Bacteria 9066
260 Ga0105238_10056023 3300009551 Bacteria 3955
261 Ga0105238_10314471 3300009551 Bacteria 1551
262 Ga0105249_10003207 3300009553 Bacteria 14156
263 Ga0105249_10214729 3300009553 Bacteria 1890
264 Ga0105239_10015168 3300010375 Bacteria 8540
265 Ga0105239_10218383 3300010375 Bacteria 2138
266 Ga0105239_10237974 3300010375 Bacteria 2043
267 Ga0105239_10347378 3300010375 Bacteria 1675
268 Ga0105239_10581810 3300010375 Bacteria 1276
269 Ga0105239_10589137 3300010375 Bacteria 1268
270 Ga0105246_10004642 3300011119 Bacteria 8361
271 Ga0105246_10054641 3300011119 Bacteria 2753
272 Ga0105246_10147892 3300011119 Bacteria 1775
273 Ga0105246_10442329 3300011119 Bacteria 1090
274 Ga0157373_10093518 3300013100 Bacteria 2117
275 Ga0157373_10256934 3300013100 Bacteria 1236
276 Ga0157370_10070259 3300013104 Bacteria 3305
277 Ga0157370_10210702 3300013104 Bacteria 1801
278 Ga0157370_10519018 3300013104 Bacteria 1093
279 Ga0157369_10004927 3300013105 Bacteria 15642
280 Ga0157369_10024850 3300013105 Bacteria 6656
281 Ga0157369_10034367 3300013105 Bacteria 5564
282 Ga0157369_10131855 3300013105 Bacteria 2648
283 Ga0157369_10261093 3300013105 Bacteria 1806
284 Ga0157369_10460022 3300013105 Bacteria 1317
285 Ga0157369_11024190 3300013105 Bacteria 845
286 Ga0157374_10032740 3300013296 Bacteria 4736
287 Ga0157374_10076470 3300013296 Bacteria 3166
288 Ga0157374_11001503 3300013296 Bacteria 855
289 Ga0157378_10304914 3300013297 Bacteria 1542
290 Ga0157378_10602955 3300013297 Bacteria 1110
291 Ga0163162_10042103 3300013306 Bacteria 4570
292 Ga0163162_10071429 3300013306 Bacteria 3524
293 Ga0163162_10135036 3300013306 Bacteria 2578
294 Ga0163162_10409778 3300013306 Bacteria 1488
295 Ga0157372_10034956 3300013307 Bacteria 5530
296 Ga0157372_10179199 3300013307 Bacteria 2453
297 Ga0157372_10228743 3300013307 Bacteria 2156
298 Ga0157372_10284266 3300013307 Bacteria 1924
299 Ga0157372_10975662 3300013307 Bacteria 982
300 Ga0157375_10583298 3300013308 Bacteria 1278
301 Ga0157375_10600903 3300013308 Bacteria 1259
302 Ga0157375_10614609 3300013308 Bacteria 1245
303 Ga0157375_10666074 3300013308 Bacteria 1196
304 Ga0163163_10096785 3300014325 Bacteria 2972
305 Ga0157380_10813770 3300014326 Bacteria 952
306 Ga0157380_11109977 3300014326 Bacteria 830
307 Ga0182008_10042296 3300014497 Bacteria 2270
308 Ga0157377_10018950 3300014745 Bacteria 3588
309 Ga0157377_10045124 3300014745 Bacteria 2461
310 Ga0157377_10404210 3300014745 Bacteria 931
311 Ga0157379_10073420 3300014968 Bacteria 3062
312 Ga0157379_10100042 3300014968 Bacteria 2603
313 Ga0157376_10242432 3300014969 Bacteria 1680
314 Ga0163161_10010967 3300017792 Bacteria 6279
315 Ga0197907_11206444 3300020069 Bacteria 1054
316 Ga0206349_1873883 3300020075 Bacteria 1268
317 Ga0206352_11153564 3300020078 Bacteria 1428
318 Ga0206350_11033092 3300020080 Bacteria 2101
319 Ga0206354_10061286 3300020081 Bacteria 960
320 Ga0206354_10185715 3300020081 Bacteria 832
321 Ga0206353_10429344 3300020082 Bacteria 2195
322 Ga0206353_10573116 3300020082 Bacteria 3211
323 Ga0206353_11625264 3300020082 Bacteria 3426
324 Ga0206353_11644797 3300020082 Bacteria 5711
325 Ga0213876_10174384 3300021384 Bacteria 1144
326 Ga0224712_10009451 3300022467 Bacteria 2939
327 Ga0207653_10010934 3300025885 Bacteria 2833
328 Ga0207692_10020153 3300025898 Bacteria 3027
329 Ga0207642_10042375 3300025899 Bacteria 2000
330 Ga0207642_10267953 3300025899 Bacteria 977
331 Ga0207710_10005704 3300025900 Bacteria 5346
332 Ga0207688_10003011 3300025901 Bacteria 9179
333 Ga0207688_10137833 3300025901 Bacteria 1434
334 Ga0207688_10401540 3300025901 Bacteria 850
335 Ga0207680_10211107 3300025903 Bacteria 1327
336 Ga0207699_10131636 3300025906 Bacteria 1632
337 Ga0207699_10143776 3300025906 Bacteria 1570
338 Ga0207699_10298930 3300025906 Bacteria 1123
339 Ga0207699_10449417 3300025906 Bacteria 924
340 Ga0207643_10093787 3300025908 Bacteria 1753
341 Ga0207643_10212103 3300025908 Bacteria 1182
342 Ga0207643_10305642 3300025908 Bacteria 990
343 Ga0207705_10013838 3300025909 Bacteria 5818
344 Ga0207705_10027414 3300025909 Bacteria 4063
345 Ga0207654_10435836 3300025911 Bacteria 917
346 Ga0207707_10006640 3300025912 Bacteria 10096
347 Ga0207707_10042472 3300025912 Bacteria 3967
348 Ga0207707_10191135 3300025912 Bacteria 1786
349 Ga0207695_10016948 3300025913 Bacteria 8501
350 Ga0207695_10086032 3300025913 Bacteria 3171
351 Ga0207671_10033696 3300025914 Bacteria 3808
352 Ga0207671_10100781 3300025914 Bacteria 2187
353 Ga0207671_10573534 3300025914 Bacteria 900
354 Ga0207693_10003776 3300025915 Bacteria 12901
355 Ga0207693_10005429 3300025915 Bacteria 10632
356 Ga0207693_10026494 3300025915 Bacteria 4589
357 Ga0207693_10172684 3300025915 Bacteria 1702
358 Ga0207663_10024658 3300025916 Bacteria 3466
359 Ga0207663_10027118 3300025916 Bacteria 3334
360 Ga0207663_10043010 3300025916 Bacteria 2763
361 Ga0207663_10122300 3300025916 Bacteria 1784
362 Ga0207663_10159991 3300025916 Bacteria 1589
363 Ga0207660_10066430 3300025917 Bacteria 2609
364 Ga0207662_10142139 3300025918 Bacteria 1521
365 Ga0207657_10008699 3300025919 Bacteria 10276
366 Ga0207657_10010785 3300025919 Bacteria 9099
367 Ga0207657_10041090 3300025919 Bacteria 4091
368 Ga0207657_10041625 3300025919 Bacteria 4061
369 Ga0207652_10003326 3300025921 Bacteria 13311
370 Ga0207652_10087129 3300025921 Bacteria 2738
371 Ga0207652_10163155 3300025921 Bacteria 1998
372 Ga0207652_10297693 3300025921 Bacteria 1456
373 Ga0207652_10512315 3300025921 Bacteria 1080
374 Ga0207652_10567119 3300025921 Bacteria 1019
375 Ga0207694_10031822 3300025924 Bacteria 4032
376 Ga0207694_10097251 3300025924 Bacteria 2329
377 Ga0207659_10821627 3300025926 Bacteria 799
378 Ga0207687_10017701 3300025927 Bacteria 4696
379 Ga0207687_10022609 3300025927 Bacteria 4186
380 Ga0207687_10047667 3300025927 Bacteria 2971
381 Ga0207687_10067045 3300025927 Bacteria 2552
382 Ga0207700_10013246 3300025928 Bacteria 5357
383 Ga0207700_10061784 3300025928 Bacteria 2842
384 Ga0207700_10299251 3300025928 Bacteria 1389
385 Ga0207664_10001985 3300025929 Bacteria 13470
386 Ga0207664_10051585 3300025929 Bacteria 3249
387 Ga0207664_10197554 3300025929 Bacteria 1735
388 Ga0207664_10202980 3300025929 Bacteria 1712
389 Ga0207664_10345857 3300025929 Bacteria 1315
390 Ga0207664_10717582 3300025929 Bacteria 899
391 Ga0207664_10810120 3300025929 Bacteria 842
392 Ga0207644_10198206 3300025931 Bacteria 1583
393 Ga0207690_10010476 3300025932 Bacteria 5512
394 Ga0207690_10108565 3300025932 Bacteria 1995
395 Ga0207690_10119030 3300025932 Bacteria 1915
396 Ga0207706_10096563 3300025933 Bacteria 2599
397 Ga0207706_10199289 3300025933 Bacteria 1756
398 Ga0207686_10072983 3300025934 Bacteria 2213
399 Ga0207686_10730765 3300025934 Bacteria 789
400 Ga0207709_10639753 3300025935 Bacteria 846
401 Ga0207669_10303958 3300025937 Bacteria 1214
402 Ga0207669_10429659 3300025937 Bacteria 1042
403 Ga0207704_10115182 3300025938 Bacteria 1826
404 Ga0207704_10205514 3300025938 Bacteria 1445
405 Ga0207704_10235920 3300025938 Bacteria 1363
406 Ga0207704_10317841 3300025938 Bacteria 1200
407 Ga0207665_10000195 3300025939 Bacteria 40705
408 Ga0207665_10000601 3300025939 Bacteria 24179
409 Ga0207665_10006663 3300025939 Bacteria 7663
410 Ga0207665_10075692 3300025939 Bacteria 2306
411 Ga0207665_10141432 3300025939 Bacteria 1716
412 Ga0207665_10741370 3300025939 Bacteria 774
413 Ga0207691_10256887 3300025940 Bacteria 1507
414 Ga0207711_10107641 3300025941 Bacteria 2475
415 Ga0207711_10743703 3300025941 Bacteria 914
416 Ga0207689_10150182 3300025942 Bacteria 1920
417 Ga0207661_10004881 3300025944 Bacteria 9399
418 Ga0207661_10018064 3300025944 Bacteria 5235
419 Ga0207661_10078497 3300025944 Bacteria 2718
420 Ga0207661_10131215 3300025944 Bacteria 2146
421 Ga0207661_10414096 3300025944 Bacteria 1223
422 Ga0207661_10572798 3300025944 Bacteria 1035
423 Ga0207661_10740606 3300025944 Bacteria 904
424 Ga0207679_10033818 3300025945 Bacteria 3601
425 Ga0207679_10073438 3300025945 Bacteria 2588
426 Ga0207679_10080268 3300025945 Bacteria 2490
427 Ga0207667_10038972 3300025949 Bacteria 5067
428 Ga0207667_10186461 3300025949 Bacteria 2129
429 Ga0207651_10162611 3300025960 Bacteria 1752
430 Ga0207712_10038177 3300025961 Bacteria 3283
431 Ga0207712_10492181 3300025961 Bacteria 1047
432 Ga0207668_10158996 3300025972 Bacteria 1758
433 Ga0207640_10022492 3300025981 Bacteria 3774
434 Ga0207640_10747772 3300025981 Bacteria 843
435 Ga0207658_10096596 3300025986 Bacteria 2305
436 Ga0207677_10177629 3300026023 Bacteria 1672
437 Ga0207677_10255939 3300026023 Bacteria 1424
438 Ga0207677_10331833 3300026023 Bacteria 1268
439 Ga0207703_10039187 3300026035 Bacteria 3786
440 Ga0207703_10361769 3300026035 Bacteria 1338
441 Ga0207703_10426431 3300026035 Bacteria 1235
442 Ga0207639_10032180 3300026041 Bacteria 3859
443 Ga0207639_10107751 3300026041 Bacteria 2264
444 Ga0207639_10217847 3300026041 Bacteria 1647
445 Ga0207678_10041636 3300026067 Bacteria 3982
446 Ga0207678_10058655 3300026067 Bacteria 3312
447 Ga0207678_10392052 3300026067 Bacteria 1201
448 Ga0207678_10473383 3300026067 Bacteria 1090
449 Ga0207708_10010964 3300026075 Bacteria 6743
450 Ga0207708_10049128 3300026075 Bacteria 3212
451 Ga0207708_10155372 3300026075 Bacteria 1804
452 Ga0207708_10258905 3300026075 Bacteria 1404
453 Ga0207702_10080103 3300026078 Bacteria 2833
454 Ga0207702_10123558 3300026078 Bacteria 2320
455 Ga0207702_10425791 3300026078 Bacteria 1284
456 Ga0207702_10717445 3300026078 Bacteria 986
457 Ga0207641_10235639 3300026088 Bacteria 1703
458 Ga0207648_10016526 3300026089 Bacteria 6739
459 Ga0207648_10032621 3300026089 Bacteria 4596
460 Ga0207676_10097948 3300026095 Bacteria 2424
461 Ga0207676_10166602 3300026095 Bacteria 1915
462 Ga0207674_10001054 3300026116 Bacteria 35890
463 Ga0207674_10016986 3300026116 Bacteria 7946
464 Ga0207674_10044896 3300026116 Bacteria 4550
465 Ga0207674_10196363 3300026116 Bacteria 1967
466 Ga0207674_10326149 3300026116 Bacteria 1485
467 Ga0207675_100201450 3300026118 Bacteria 1912
468 Ga0207675_100394787 3300026118 Bacteria 1362
469 Ga0207683_10000833 3300026121 Bacteria 28215
470 Ga0207683_10003692 3300026121 Bacteria 13301
471 Ga0207683_10035215 3300026121 Bacteria 4354
472 Ga0207698_10005457 3300026142 Bacteria 7863
473 Ga0207698_10043814 3300026142 Bacteria 3356
474 Ga0207698_10504537 3300026142 Bacteria 1178
475 Ga0207428_10028092 3300027907 Bacteria 4677
476 Ga0207428_10053368 3300027907 Bacteria 3224
477 Ga0207428_10088595 3300027907 Bacteria 2407
478 Ga0207428_10267106 3300027907 Bacteria 1273
479 Ga0268266_10263857 3300028379 Bacteria 1597
480 Ga0268264_10201930 3300028381 Bacteria 1819
481 Ga0268264_10481552 3300028381 Bacteria 1207
482 Ga0265318_10024441 3300028577 Bacteria 2396
483 Ga0265318_10166566 3300028577 Bacteria 808
484 Ga0307515_10010678 3300028794 Bacteria 17557
485 Ga0265338_10018646 3300028800 Bacteria 7415
486 Ga0265338_10131534 3300028800 Bacteria 1974
487 Ga0307512_10006078 3300030522 Bacteria 12358
488 Ga0265320_10012357 3300031240 Bacteria 4977
489 Ga0265320_10033125 3300031240 Bacteria 2640
490 Ga0265327_10001876 3300031251 Bacteria 24313
491 Ga0265316_10351470 3300031344 Bacteria 1067
492 Ga0307513_10072345 3300031456 Bacteria 3594
493 Ga0307513_10073910 3300031456 Bacteria 3547
494 Ga0307408_100072435 3300031548 Bacteria 2551
495 Ga0265313_10015362 3300031595 Bacteria 4464
496 Ga0307508_10018211 3300031616 Bacteria 6383
497 Ga0307516_10066166 3300031730 Bacteria 3487
498 Ga0307405_10001670 3300031731 Bacteria 9457
499 Ga0307405_10176069 3300031731 Bacteria 1531
500 Ga0307405_10229809 3300031731 Bacteria 1367
501 Ga0307413_10001335 3300031824 Bacteria 9219
502 Ga0307413_10030442 3300031824 Bacteria 3032
503 Ga0307410_10033497 3300031852 Bacteria 3317
504 Ga0307410_10119763 3300031852 Bacteria 1918
505 Ga0307410_10210731 3300031852 Bacteria 1489
506 Ga0307410_10279861 3300031852 Bacteria 1309
507 Ga0307406_10067089 3300031901 Bacteria 2338
508 Ga0307407_10019549 3300031903 Bacteria 3452
509 Ga0307409_100104057 3300031995 Bacteria 2363
510 Ga0307409_100242413 3300031995 Bacteria 1642
511 Ga0307409_100589653 3300031995 Bacteria 1097
512 Ga0307416_100014965 3300032002 Bacteria 5339
513 Ga0307416_100138320 3300032002 Bacteria 2208
514 Ga0307411_10178438 3300032005 Bacteria 1609
515 Ga0307415_100000090 3300032126 Bacteria 38246
516 Ga0307415_100206395 3300032126 Bacteria 1563
517 Ga0373948_0030669 3300034817 Bacteria 1082
518 Ga0373958_0021883 3300034819 Bacteria 1190
519 Ga0373959_0010660 3300034820 Bacteria 1610
520 Ga0373959_0034892 3300034820 Bacteria 1032
521 Ga0373928_0010968 3300035084 Bacteria 1787
522 Ga0373928_0023029 3300035084 Bacteria 1326
523 Ga0373923_0062371 3300035111 Bacteria 1586
524 Ga0373932_0023557 3300035112 Bacteria 1648
525 Ga0373936_0041637 3300035113 Bacteria 1843
526 Ga0373936_0065566 3300035113 Bacteria 1490
527 Ga0373939_0038090 3300035114 Bacteria 1432
528 Ga0373953_0261233 3300035117 Bacteria 753
529 Ga0373954_0088301 3300035118 Bacteria 1487
530 Ga0373957_0054283 3300035120 Bacteria 1539
531 Ga0373960_0021452 3300035121 Bacteria 1718
532 Ga0373960_0080218 3300035121 Bacteria 1026
533 Ga0373943_0028930 3300035170 Bacteria 2615
534 Ga0373943_0039026 3300035170 Bacteria 2285
535 Ga0373946_0023468 3300035171 Bacteria 2410
536 Ga0373946_0072254 3300035171 Bacteria 1493
537 Ga0373942_0004970 3300035207 Bacteria 3083
538 Ga0373962_0006797 3300035242 Bacteria 2781
539 Ga0373924_0110797 3300035410 Bacteria 1186
540 Ga0373931_0050166 3300035691 Bacteria 2219
541 Ga0373931_0209846 3300035691 Bacteria 1167
542 Ga0373931_0301493 3300035691 Bacteria 990
543 Ga0373935_0025226 3300035692 Bacteria 3663
544 Ga0373935_0052604 3300035692 Bacteria 2589
545 Ga0373935_0071196 3300035692 Bacteria 2243
546 Ga0373935_0098951 3300035692 Bacteria 1920
547 Ga0373935_0535900 3300035692 Bacteria 852
548 Ga0373927_0023041 3300035695 Bacteria 4079
549 Ga0373927_0024339 3300035695 Bacteria 3962
550 Ga0373927_0399154 3300035695 Bacteria 907
551 Ga0373933_0117703 3300035724 Bacteria 1662
552 Ga0373933_0360613 3300035724 Bacteria 945
553 Ga0373947_0004740 3300035725 Bacteria 7975
554 Ga0373947_0021147 3300035725 Bacteria 3764
555 Ga0373947_0252702 3300035725 Bacteria 1166
556 Ga0373937_0263144 3300036401 Bacteria 1627
557 Ga0373925_0003728 3300037068 Bacteria 11701
558 Ga0373925_0008902 3300037068 Bacteria 7313
559 Ga0373925_0334898 3300037068 Bacteria 1227
560 Ga0395899_0013453 3300037312 Bacteria 6259
561 Ga0395899_0085995 3300037312 Bacteria 2284
562 Ga0395900_0002476 3300037418 Bacteria 20305
563 Ga0395900_0005661 3300037418 Bacteria 13065
564 Ga0395900_0335705 3300037418 Bacteria 1488
565 Ga0395900_0965102 3300037418 Bacteria 773
566 Ga0395898_0000647 3300037466 Bacteria 63277
567 Ga0395898_0022090 3300037466 Bacteria 6446
568 Ga0395898_0082928 3300037466 Bacteria 3090
569 Ga0395898_0102264 3300037466 Bacteria 2751
570 Ga0395898_0112047 3300037466 Bacteria 2615
571 Ga0395898_0187817 3300037466 Bacteria 1975
572 Ga0395905_0142028 3300037471 Bacteria 2258
573 Ga0395901_0064172 3300038443 Bacteria 3823
574 Ga0395901_0119196 3300038443 Bacteria 2773
575 Ga0395901_0144437 3300038443 Bacteria 2501
576 Ga0395901_0233642 3300038443 Bacteria 1919
577 Ga0436365_1372001 3300039437 Bacteria 3824
578 Ga0451791_0598011 3300041451 Bacteria 1401
579 Ga0439448_0009987 3300042005 Bacteria 2805
580 Ga0439459_0043442 3300042438 Bacteria 963
581 Ga0466969_0041782 3300044656 Bacteria 2292
582 Ga0466969_0066191 3300044656 Bacteria 1745
583 Ga0466972_0070351 3300044658 Bacteria 1670
584 Ga0466965_0040962 3300044683 Bacteria 2281
585 Ga0466966_0067815 3300044684 Bacteria 2240
586 Ga0466966_0307159 3300044684 Bacteria 953
587 Ga0466966_0510930 3300044684 Bacteria 723
588 Ga0466961_0001879 3300044693 Bacteria 13055
589 Ga0466961_0023121 3300044693 Bacteria 3997
590 Ga0466961_0148178 3300044693 Bacteria 1466
591 Ga0466961_0361659 3300044693 Bacteria 883
592 Ga0466963_0005079 3300044694 Bacteria 7695
593 Ga0466963_0007154 3300044694 Bacteria 6650
594 Ga0466963_0044231 3300044694 Bacteria 2931
595 Ga0466963_0046606 3300044694 Bacteria 2859
596 Ga0466963_0061384 3300044694 Bacteria 2513
597 Ga0466963_0092197 3300044694 Bacteria 2064
598 Ga0466963_0304400 3300044694 Bacteria 1121
599 Ga0466964_0085699 3300044706 Bacteria 1361
600 Ga0466964_0122863 3300044706 Bacteria 1173
601 Ga0466964_0156447 3300044706 Bacteria 1061
602 Ga0466971_0079697 3300044719 Bacteria 1492
603 Ga0466968_0008725 3300044735 Bacteria 3887
604 Ga0466968_0134188 3300044735 Bacteria 1128
605 Ga0466970_0032328 3300044765 Bacteria 2764
606 Ga0466970_0035361 3300044765 Bacteria 2646
607 Ga0466970_0362818 3300044765 Bacteria 823
608 Ga0466957_0000876 3300044842 Bacteria 15440
609 Ga0466957_0286904 3300044842 Bacteria 1103
610 Ga0466960_0004383 3300044901 Bacteria 5515
611 Ga0466960_0055099 3300044901 Bacteria 1933
612 Ga0466960_0090782 3300044901 Bacteria 1557
613 Ga0466960_0233001 3300044901 Bacteria 1017
614 Ga0466959_0012748 3300045049 Bacteria 6081
615 Ga0466959_0016877 3300045049 Bacteria 5343
616 Ga0466959_0031929 3300045049 Bacteria 3898
617 Ga0466959_0207526 3300045049 Bacteria 1362
618 Ga0466959_0239606 3300045049 Bacteria 1253
619 Ga0451576_0110387 3300045051 Bacteria 2862
620 Ga0451576_0116084 3300045051 Bacteria 2787
621 Ga0466958_0011527 3300045836 Bacteria 4978
622 Ga0466958_0030106 3300045836 Bacteria 3222
623 Ga0466958_0052022 3300045836 Bacteria 2481
624 Ga0466958_0066652 3300045836 Bacteria 2199
625 Ga0466958_0115573 3300045836 Bacteria 1677
626 Ga0466958_0369866 3300045836 Bacteria 924
627 Ga0466958_0463717 3300045836 Bacteria 821
628 Ga0466967_0001987 3300045976 Bacteria 12423
629 Ga0466967_0003861 3300045976 Bacteria 9930
630 Ga0466967_0005102 3300045976 Bacteria 9019
631 Ga0466967_0006933 3300045976 Bacteria 8102
632 Ga0466967_0024880 3300045976 Bacteria 4930
633 Ga0466967_0039095 3300045976 Bacteria 4075
634 Ga0466967_0087730 3300045976 Bacteria 2821
635 Ga0466967_0102962 3300045976 Bacteria 2612
636 Ga0466967_0146200 3300045976 Bacteria 2205
637 Ga0466967_0159682 3300045976 Bacteria 2115
638 Ga0466967_0238007 3300045976 Bacteria 1735
639 Ga0466967_0273909 3300045976 Bacteria 1618
640 Ga0466967_0363831 3300045976 Bacteria 1402
641 Ga0466967_0392009 3300045976 Bacteria 1350
642 Ga0466967_0503194 3300045976 Bacteria 1189
643 Ga0466967_0663337 3300045976 Bacteria 1032
644 Ga0466967_0953031 3300045976 Bacteria 854
645 Ga0495603_0018446 3300046455 Bacteria 4221
646 Ga0495603_0084455 3300046455 Bacteria 1859
647 Ga0495629_0003104 3300046459 Bacteria 12595
648 Ga0495629_0013284 3300046459 Bacteria 5943
649 Ga0495629_0073788 3300046459 Bacteria 2382
650 Ga0495629_0107509 3300046459 Bacteria 1946
651 Ga0495629_0236033 3300046459 Bacteria 1260
652 Ga0495629_0303359 3300046459 Bacteria 1093
653 Ga0495641_0006434 3300046461 Bacteria 7610
654 Ga0495641_0011685 3300046461 Bacteria 4974
655 Ga0495641_0043419 3300046461 Bacteria 2079
656 Ga0495641_0046828 3300046461 Bacteria 1987
657 Ga0495641_0102710 3300046461 Bacteria 1275
658 Ga0495653_0010191 3300046463 Bacteria 7691
659 Ga0495653_0047400 3300046463 Bacteria 3323
660 Ga0495653_0260084 3300046463 Bacteria 1148
661 Ga0495580_0133747 3300046472 Bacteria 1719
662 Ga0495580_0470771 3300046472 Bacteria 841
663 Ga0495582_0000556 3300046473 Bacteria 20608
664 Ga0495582_0094319 3300046473 Bacteria 1671
665 Ga0495605_0036349 3300046474 Bacteria 2484
666 Ga0495639_0000322 3300046475 Bacteria 23204
667 Ga0495639_0000484 3300046475 Bacteria 18956
668 Ga0495662_0005856 3300046476 Bacteria 6145
669 Ga0495662_0010467 3300046476 Bacteria 4541
670 Ga0495662_0058954 3300046476 Bacteria 1854
671 Ga0495662_0068334 3300046476 Bacteria 1720
672 Ga0495664_0004712 3300046477 Bacteria 7459
673 Ga0495664_0134037 3300046477 Bacteria 1501
674 Ga0495584_0286115 3300046491 Bacteria 837
675 Ga0495594_0007889 3300046499 Bacteria 5473
676 Ga0495594_0216596 3300046499 Bacteria 1092
677 Ga0495607_0195851 3300046501 Bacteria 1003
678 Ga0495606_0002983 3300046507 Bacteria 18608
679 Ga0495608_0014283 3300046511 Bacteria 5510
680 Ga0495608_0111010 3300046511 Bacteria 1763
681 Ga0495608_0337565 3300046511 Bacteria 929
682 Ga0495608_0453886 3300046511 Bacteria 780
683 Ga0495616_0063656 3300046513 Bacteria 1802
684 Ga0495618_0007980 3300046514 Bacteria 6405
685 Ga0495618_0040561 3300046514 Bacteria 2930
686 Ga0495620_0084431 3300046515 Bacteria 1281
687 Ga0495630_0007718 3300046517 Bacteria 7696
688 Ga0495630_0080750 3300046517 Bacteria 2453
689 Ga0495630_0316227 3300046517 Bacteria 1193
690 Ga0495632_0245801 3300046519 Bacteria 804
691 Ga0495663_0008906 3300046525 Bacteria 2783
692 Ga0495666_0000381 3300046526 Bacteria 19428
693 Ga0495666_0025977 3300046526 Bacteria 2890
694 Ga0495652_0018726 3300046529 Bacteria 6171
695 Ga0495665_0001289 3300046531 Bacteria 13380
696 Ga0495665_0004560 3300046531 Bacteria 7478
697 Ga0495665_0005611 3300046531 Bacteria 6761
698 Ga0495665_0175949 3300046531 Bacteria 1113
699 Ga0495640_0019654 3300046533 Bacteria 4982
700 Ga0495640_0095027 3300046533 Bacteria 1962
701 Ga0495640_0152143 3300046533 Bacteria 1486
702 Ga0495640_0174723 3300046533 Bacteria 1371
703 Ga0495586_0009299 3300046535 Bacteria 5227
704 Ga0495587_0064209 3300046536 Bacteria 2145
705 Ga0495587_0366642 3300046536 Bacteria 802
706 Ga0495609_0142992 3300046538 Bacteria 1020
707 Ga0495621_0017646 3300046539 Bacteria 2310
708 Ga0495645_0302806 3300046543 Bacteria 1044
709 Ga0495645_0441092 3300046543 Bacteria 823
710 Ga0495667_0022322 3300046559 Bacteria 4264
711 Ga0495667_0112754 3300046559 Bacteria 1757
712 Ga0495667_0445422 3300046559 Bacteria 814
713 Ga0495668_0002487 3300046616 Bacteria 15099
714 Ga0495634_0011846 3300046642 Bacteria 6339
715 Ga0495611_0092206 3300046648 Bacteria 1401
716 Ga0495625_0004304 3300046660 Bacteria 13532
717 Ga0495635_0002868 3300046663 Bacteria 11845
718 Ga0495635_0005770 3300046663 Bacteria 8627
719 Ga0495635_0032400 3300046663 Bacteria 3626
720 Ga0495635_0214706 3300046663 Bacteria 1302
721 Ga0495635_0252106 3300046663 Bacteria 1190
722 Ga0495659_0021617 3300046664 Bacteria 2170
723 Ga0495588_0004661 3300046674 Bacteria 6055
724 Ga0495588_0179206 3300046674 Bacteria 1120
725 Ga0495657_0011425 3300046675 Bacteria 6637
726 Ga0495623_0135923 3300046679 Bacteria 1467
727 Ga0495646_0097986 3300046680 Bacteria 1684
728 Ga0495646_0134576 3300046680 Bacteria 1388
729 Ga0495647_0000125 3300046681 Bacteria 19619
730 Ga0495647_0012406 3300046681 Bacteria 2933
731 Ga0495647_0092653 3300046681 Bacteria 1241
732 Ga0495658_0009157 3300046683 Bacteria 4922
733 Ga0495658_0010814 3300046683 Bacteria 4571
734 Ga0495658_0020440 3300046683 Bacteria 3474
735 Ga0495658_0395814 3300046683 Bacteria 880
736 Ga0495658_0459177 3300046683 Bacteria 814
737 Ga0495669_0034445 3300046684 Bacteria 2233
738 Ga0495613_0015338 3300046689 Bacteria 5696
739 Ga0495613_0018490 3300046689 Bacteria 5195
740 Ga0495613_0049767 3300046689 Bacteria 3091
741 Ga0495624_0003568 3300046690 Bacteria 11523
742 Ga0495624_0012260 3300046690 Bacteria 5868
743 Ga0495670_0216085 3300046691 Bacteria 1018
744 Ga0495670_0231718 3300046691 Bacteria 982
745 Ga0495670_0239659 3300046691 Bacteria 965
746 Ga0495600_0002021 3300046809 Bacteria 11409
747 Ga0495600_0250855 3300046809 Bacteria 1126
748 Ga0495600_0275767 3300046809 Bacteria 1065
749 Ga0495581_0014414 3300047315 Bacteria 4584
750 Ga0495581_0024013 3300047315 Bacteria 3532
751 Ga0495604_0190611 3300047317 Bacteria 1429
752 Ga0495674_0023283 3300047319 Bacteria 5710
753 Ga0495674_0037655 3300047319 Bacteria 4346
754 Ga0495674_0058125 3300047319 Bacteria 3382
755 Ga0495674_0164679 3300047319 Bacteria 1854
756 Ga0495674_0208773 3300047319 Bacteria 1618
757 Ga0495674_0375387 3300047319 Bacteria 1151
758 Ga0495674_0387615 3300047319 Bacteria 1130
759 Ga0495674_0701987 3300047319 Bacteria 794
760 Ga0495676_0004037 3300047321 Bacteria 13362
761 Ga0495676_0007501 3300047321 Bacteria 10005
762 Ga0495676_0027898 3300047321 Bacteria 4835
763 Ga0495680_0059675 3300047322 Bacteria 2943
764 Ga0495680_0132194 3300047322 Bacteria 1833
765 Ga0495680_0192253 3300047322 Bacteria 1468
766 Ga0495680_0226473 3300047322 Bacteria 1333
767 Ga0495675_0026638 3300047444 Bacteria 3687
768 Ga0495675_0225238 3300047444 Bacteria 1133
769 Ga0495684_0009841 3300047471 Bacteria 7376
770 Ga0495684_0099851 3300047471 Bacteria 2194
771 Ga0495684_0216457 3300047471 Bacteria 1406
772 Ga0495593_0001712 3300047673 Bacteria 12980
773 Ga0495593_0013286 3300047673 Bacteria 4699
774 Ga0495593_0389500 3300047673 Unclassified 697
775 Ga0495602_0047169 3300048088 Bacteria 3884
776 Ga0495602_0420012 3300048088 Bacteria 950
777 Ga0495614_0022259 3300048089 Bacteria 2735
778 Ga0495614_0119046 3300048089 Bacteria 1163
779 Ga0495626_0001210 3300048091 Bacteria 21305
780 Ga0496100_0036946 3300048903 Bacteria 3084
781 Ga0496100_0043571 3300048903 Bacteria 2871
782 Ga0496100_0068408 3300048903 Bacteria 2362
783 Ga0496100_0068643 3300048903 Bacteria 2358
784 Ga0496100_0068952 3300048903 Bacteria 2353
785 Ga0496100_0130895 3300048903 Bacteria 1767
786 Ga0496100_0132266 3300048903 Bacteria 1759
787 Ga0496100_0190027 3300048903 Bacteria 1490
788 Ga0496100_0229499 3300048903 Bacteria 1365
789 Ga0496100_0249262 3300048903 Bacteria 1313
790 Ga0496100_0544164 3300048903 Bacteria 898
791 Ga0496101_0019803 3300048904 Bacteria 4600
792 Ga0496101_0028280 3300048904 Bacteria 3913
793 Ga0496101_0054862 3300048904 Bacteria 2877
794 Ga0496101_0061488 3300048904 Bacteria 2728
795 Ga0496101_0073391 3300048904 Bacteria 2513
796 Ga0496101_0151121 3300048904 Bacteria 1776
797 Ga0496101_0221889 3300048904 Bacteria 1467
798 Ga0496101_0312608 3300048904 Bacteria 1232
799 Ga0496102_0000044 3300048905 Bacteria 187834
800 Ga0496102_0000669 3300048905 Bacteria 34288
801 Ga0496102_0013968 3300048905 Bacteria 6971
802 Ga0496102_0018252 3300048905 Bacteria 6162
803 Ga0496102_0039907 3300048905 Bacteria 4244
804 Ga0496102_0043100 3300048905 Bacteria 4090
805 Ga0496102_0046725 3300048905 Bacteria 3932
806 Ga0496102_0106076 3300048905 Bacteria 2615
807 Ga0496102_0110761 3300048905 Bacteria 2559
808 Ga0496102_0136062 3300048905 Bacteria 2302
809 Ga0496102_0209082 3300048905 Bacteria 1840
810 Ga0496102_0239905 3300048905 Bacteria 1709
811 Ga0496102_0478728 3300048905 Bacteria 1166
812 Ga0496102_0485859 3300048905 Bacteria 1156
813 Ga0496103_0000123 3300048906 Bacteria 83794
814 Ga0496103_0006778 3300048906 Bacteria 6834
815 Ga0496103_0024711 3300048906 Bacteria 3626
816 Ga0496103_0043628 3300048906 Bacteria 2761
817 Ga0496103_0050205 3300048906 Bacteria 2580
818 Ga0496103_0138677 3300048906 Bacteria 1554
819 Ga0496103_0159149 3300048906 Bacteria 1448
820 Ga0496103_0417328 3300048906 Bacteria 861
821 Ga0496103_0420387 3300048906 Bacteria 858
822 Ga0496103_0457849 3300048906 Bacteria 818
823 Ga0496104_0011466 3300048907 Bacteria 7941
824 Ga0496104_0013602 3300048907 Bacteria 7336
825 Ga0496104_0014409 3300048907 Bacteria 7145
826 Ga0496104_0027699 3300048907 Bacteria 5246
827 Ga0496104_0034169 3300048907 Bacteria 4739
828 Ga0496104_0044810 3300048907 Bacteria 4157
829 Ga0496104_0058061 3300048907 Bacteria 3662
830 Ga0496104_0103028 3300048907 Bacteria 2734
831 Ga0496104_0115270 3300048907 Bacteria 2578
832 Ga0496104_0117783 3300048907 Bacteria 2549
833 Ga0496104_0123377 3300048907 Bacteria 2487
834 Ga0496104_0139560 3300048907 Bacteria 2329
835 Ga0496104_0218858 3300048907 Bacteria 1816
836 Ga0496104_0221224 3300048907 Bacteria 1805
837 Ga0496104_0221848 3300048907 Bacteria 1803
838 Ga0496104_0533917 3300048907 Bacteria 1084
839 Ga0496105_0004276 3300048908 Bacteria 10744
840 Ga0496105_0005275 3300048908 Bacteria 9797
841 Ga0496105_0018647 3300048908 Bacteria 5585
842 Ga0496105_0045351 3300048908 Bacteria 3627
843 Ga0496105_0080135 3300048908 Bacteria 2696
844 Ga0496105_0104604 3300048908 Bacteria 2337
845 Ga0496105_0148559 3300048908 Bacteria 1927
846 Ga0496105_0153966 3300048908 Bacteria 1889
847 Ga0496105_0194434 3300048908 Bacteria 1658
848 Ga0496105_0388577 3300048908 Bacteria 1110
849 Ga0496105_0504297 3300048908 Bacteria 950
850 Ga0496106_0007647 3300048909 Bacteria 7993
851 Ga0496106_0011800 3300048909 Bacteria 6450
852 Ga0496106_0016676 3300048909 Bacteria 5434
853 Ga0496106_0018577 3300048909 Bacteria 5144
854 Ga0496106_0055255 3300048909 Bacteria 3000
855 Ga0496106_0097150 3300048909 Bacteria 2280
856 Ga0496106_0108617 3300048909 Bacteria 2158
857 Ga0496106_0126810 3300048909 Bacteria 1999
858 Ga0496106_0155778 3300048909 Bacteria 1804
859 Ga0496107_0028222 3300048910 Bacteria 3988
860 Ga0496107_0032253 3300048910 Bacteria 3743
861 Ga0496107_0036363 3300048910 Bacteria 3532
862 Ga0496107_0045591 3300048910 Bacteria 3154
863 Ga0496107_0081206 3300048910 Bacteria 2364
864 Ga0496107_0098938 3300048910 Bacteria 2137
865 Ga0496107_0303185 3300048910 Bacteria 1189
866 Ga0496107_0516595 3300048910 Bacteria 885
867 Ga0496108_0009178 3300048911 Bacteria 8004
868 Ga0496108_0014293 3300048911 Bacteria 6478
869 Ga0496108_0021143 3300048911 Bacteria 5347
870 Ga0496108_0022524 3300048911 Bacteria 5180
871 Ga0496108_0038584 3300048911 Bacteria 3980
872 Ga0496108_0104013 3300048911 Bacteria 2423
873 Ga0496108_0136804 3300048911 Bacteria 2108
874 Ga0496108_0277156 3300048911 Bacteria 1460
875 Ga0496108_0309335 3300048911 Bacteria 1377
876 Ga0496108_0462371 3300048911 Bacteria 1108
877 Ga0496108_0643625 3300048911 Bacteria 922
878 Ga0496109_0001181 3300048912 Bacteria 21688
879 Ga0496109_0001497 3300048912 Bacteria 19409
880 Ga0496109_0002763 3300048912 Bacteria 14695
881 Ga0496109_0010768 3300048912 Bacteria 7828
882 Ga0496109_0024527 3300048912 Bacteria 5363
883 Ga0496109_0027766 3300048912 Bacteria 5057
884 Ga0496109_0028637 3300048912 Bacteria 4984
885 Ga0496109_0057894 3300048912 Bacteria 3539
886 Ga0496109_0065716 3300048912 Bacteria 3320
887 Ga0496109_0101415 3300048912 Bacteria 2671
888 Ga0496109_0122100 3300048912 Bacteria 2427
889 Ga0496109_0255789 3300048912 Bacteria 1649
890 Ga0496110_0002894 3300048913 Bacteria 12990
891 Ga0496110_0003955 3300048913 Bacteria 11398
892 Ga0496110_0005402 3300048913 Bacteria 10019
893 Ga0496110_0012717 3300048913 Bacteria 6927
894 Ga0496110_0021225 3300048913 Bacteria 5494
895 Ga0496110_0069223 3300048913 Bacteria 3125
896 Ga0496110_0106372 3300048913 Bacteria 2517
897 Ga0496110_0151032 3300048913 Bacteria 2103
898 Ga0496110_0164684 3300048913 Bacteria 2010
899 Ga0496110_0381672 3300048913 Bacteria 1284
900 Ga0496110_0574639 3300048913 Bacteria 1024
901 Ga0496110_0582985 3300048913 Bacteria 1015
902 Ga0496111_0000950 3300048914 Bacteria 15848
903 Ga0496111_0001566 3300048914 Bacteria 13202
904 Ga0496111_0029301 3300048914 Bacteria 3909
905 Ga0496111_0034973 3300048914 Bacteria 3588
906 Ga0496111_0069256 3300048914 Bacteria 2565
907 Ga0496111_0070133 3300048914 Bacteria 2549
908 Ga0496111_0166069 3300048914 Bacteria 1639
909 Ga0496111_0175800 3300048914 Bacteria 1591
910 Ga0496111_0250810 3300048914 Bacteria 1314
911 Ga0496112_0007917 3300048915 Bacteria 9468
912 Ga0496112_0008096 3300048915 Bacteria 9385
913 Ga0496112_0023292 3300048915 Bacteria 5914
914 Ga0496112_0051518 3300048915 Bacteria 4038
915 Ga0496112_0089434 3300048915 Bacteria 3047
916 Ga0496112_0105046 3300048915 Bacteria 2794
917 Ga0496112_0180960 3300048915 Bacteria 2072
918 Ga0496112_0222874 3300048915 Bacteria 1841
919 Ga0496112_0271807 3300048915 Bacteria 1643
920 Ga0496112_0340820 3300048915 Bacteria 1442
921 Ga0496113_0002548 3300048916 Bacteria 10633
922 Ga0496113_0020491 3300048916 Bacteria 4649
923 Ga0496113_0027747 3300048916 Bacteria 4062
924 Ga0496113_0050403 3300048916 Bacteria 3104
925 Ga0496113_0109010 3300048916 Bacteria 2153
926 Ga0496113_0122777 3300048916 Bacteria 2032
927 Ga0496113_0203794 3300048916 Bacteria 1573
928 Ga0496113_0423410 3300048916 Bacteria 1069
929 Ga0496114_0010141 3300048917 Bacteria 7495
930 Ga0496114_0047435 3300048917 Bacteria 3573
931 Ga0496114_0051346 3300048917 Bacteria 3433
932 Ga0496114_0062504 3300048917 Bacteria 3116
933 Ga0496114_0066554 3300048917 Bacteria 3021
934 Ga0496114_0077580 3300048917 Bacteria 2801
935 Ga0496114_0110497 3300048917 Bacteria 2355
936 Ga0496114_0112716 3300048917 Bacteria 2331
937 Ga0496114_0167902 3300048917 Bacteria 1911
938 Ga0496114_0432914 3300048917 Bacteria 1165
939 Ga0496114_0439378 3300048917 Bacteria 1155
940 Ga0496114_0558122 3300048917 Bacteria 1011
941 Ga0496115_0002678 3300048918 Bacteria 12774
942 Ga0496115_0068553 3300048918 Bacteria 2872
943 Ga0496115_0088415 3300048918 Bacteria 2530
944 Ga0496115_0101210 3300048918 Bacteria 2362
945 Ga0496115_0189887 3300048918 Bacteria 1697
946 Ga0496115_0209007 3300048918 Bacteria 1612
947 Ga0496115_0223249 3300048918 Bacteria 1555
948 Ga0496115_0323657 3300048918 Bacteria 1260
949 Ga0496118_0042197 3300048921 Bacteria 3601
950 Ga0496119_0000333 3300048922 Bacteria 65888
951 Ga0496119_0015393 3300048922 Bacteria 5893
952 Ga0496120_0015310 3300048923 Bacteria 5065
953 Ga0496120_0068025 3300048923 Bacteria 1966
954 Ga0501032_0219753 3300049569 Bacteria 1237
955 Ga0501036_0157878 3300049572 Bacteria 1913
956 Ga0501037_0028486 3300049573 Bacteria 4126
957 Ga0501038_0225409 3300049574 Bacteria 1494
958 Ga0501039_0022065 3300049575 Bacteria 4886
959 Ga0501046_0012417 3300049580 Bacteria 7252
960 Ga0501047_0333934 3300049581 Bacteria 1354
961 Ga0501067_0002055 3300049583 Bacteria 11100
962 Ga0501067_0019838 3300049583 Bacteria 3722
963 Ga0501068_0052215 3300049584 Bacteria 2473
964 Ga0501069_0025754 3300049585 Bacteria 3216
965 Ga0501069_0065922 3300049585 Bacteria 2025
966 Ga0501069_0150127 3300049585 Bacteria 1339
967 Ga0501070_0129570 3300049586 Bacteria 2084
968 Ga0501074_0061956 3300049590 Bacteria 2695
969 Ga0501080_0198527 3300049742 Bacteria 1842
970 Ga0501080_0965520 3300049742 Bacteria 740
971 Ga0501035_0174366 3300049822 Bacteria 1856
972 Ga0501044_0456446 3300049823 Bacteria 1184
973 Ga0501044_0676668 3300049823 Bacteria 919
974 Ga0501044_1026951 3300049823 Bacteria 695
975 nmdc:mga05p37_218242_c1 3300050507 Bacteria 2303
976 nmdc:mga05p37_8428_c1 3300050507 Bacteria 12190
977 nmdc:mga0qj67_132852_c1 3300050509 Bacteria 2016
978 nmdc:mga08y16_326067_c1 3300050511 Bacteria 1580
979 nmdc:mga08y16_36663_c1 3300050511 Bacteria 5150
980 nmdc:mga0n895_108231_c1 3300050512 Bacteria 2794
981 nmdc:mga0n895_14986_c1 3300050512 Bacteria 7061
982 nmdc:mga0n895_42194_c1 3300050512 Bacteria 4438
983 nmdc:mga0rr50_566486_c1 3300050513 Bacteria 968
984 nmdc:mga0rr50_6021_c1 3300050513 Bacteria 7323
985 nmdc:mga0rr50_84884_c1 3300050513 Bacteria 2452
986 nmdc:mga08x19_22363_c1 3300050514 Bacteria 3916
987 nmdc:mga08x19_64249_c1 3300050514 Bacteria 2382
988 nmdc:mga08x19_68069_c1 3300050514 Bacteria 2317
989 nmdc:mga0a205_115318_c1 3300050515 Bacteria 2585
990 nmdc:mga0a205_902062_c1 3300050515 Bacteria 731
991 Ga0495601_0005606 3300053077 Bacteria 7319
992 Ga0495601_0039984 3300053077 Bacteria 2937
993 Ga0495601_0082212 3300053077 Bacteria 2067
994 Ga0495601_0268923 3300053077 Bacteria 1112
995 Ga0495612_0001055 3300053078 Bacteria 11274
996 Ga0495612_0037938 3300053078 Bacteria 1957
997 Ga0495655_0087718 3300053083 Bacteria 901
998 Ga0495595_0082259 3300053084 Bacteria 1535
999 Ga0495619_0011287 3300053085 Bacteria 5621
1000 Ga0495619_0335389 3300053085 Bacteria 1047
1001 Ga0495619_0344742 3300053085 Bacteria 1031
1002 Ga0500583_0184189 3300053092 Bacteria 1040
1003 Ga0500566_0024371 3300053094 Bacteria 3552
1004 Ga0500556_0000417 3300053104 Bacteria 30638
1005 Ga0500568_0123165 3300053139 Bacteria 966
1006 Ga0500600_0011756 3300053149 Bacteria 5315
1007 Ga0466962_0009921 3300061719 Bacteria 4569
1008 Ga0466962_0082473 3300061719 Bacteria 1538
1009 Ga0466962_0091526 3300061719 Bacteria 1457
1010 Ga0530510_0271324 3300061734 Bacteria 1266
1011 2819425918 2818991318 Bacteria 5266538
1012 2819665006 2818991458 Bacteria 4794049
1013 2887480959 2887478801 Bacteria 8972725
1014 Ga0501047_0008540
1015 JGI24737J22298_10106451
1016 Ga0070658_10012228
1017 Ga0070676_10378054
1018 Ga0070683_100009018
1019 Ga0070683_100016184
1020 Ga0070683_100044245
1021 Ga0070683_100080515
1022 Ga0070683_100143935
1023 Ga0070683_100174470
1024 Ga0070683_100482419
1025 Ga0070690_100108110
1026 Ga0070670_100146353
1027 Ga0068869_100094719
1028 Ga0068869_100384366
1029 Ga0070666_10110019
1030 Ga0070680_100053920
1031 Ga0070680_100328131
1032 Ga0070680_100408909
1033 Ga0070680_100690582
1034 Ga0070682_100082916
1035 Ga0070682_100201688
1036 Ga0070682_100201997
1037 Ga0070682_100423449
1038 Ga0068868_100182206
1039 Ga0068868_100264178
1040 Ga0068868_100339716
1041 Ga0068868_100372062
1042 Ga0070660_100001285
1043 Ga0070660_100005389
1044 Ga0070660_100065198
1045 Ga0070660_100126528
1046 Ga0070660_100586805
1047 Ga0070689_100125086
1048 Ga0070689_100183860
1049 Ga0070691_10062517
1050 Ga0070691_10112908
1051 Ga0070691_10151530
1052 Ga0070687_100106867
1053 Ga0070687_100224790
1054 Ga0070661_100149213
1055 Ga0070692_10054177
1056 Ga0070692_10103983
1057 Ga0070692_10253420
1058 Ga0070668_100007547
1059 Ga0070671_100012587
1060 Ga0070671_100432482
1061 Ga0070674_100159742
1062 Ga0070674_100212603
1063 Ga0070674_100486923
1064 Ga0070673_100224025
1065 Ga0070659_100002112
1066 Ga0070659_100035528
1067 Ga0070659_100138576
1068 Ga0070659_100180359
1069 Ga0070659_100265179
1070 Ga0070659_100317224
1071 Ga0070667_100041998
1072 Ga0070703_10006246
1073 Ga0070709_10023197
1074 Ga0070709_10118497
1075 Ga0070709_10145309
1076 Ga0070709_10537536
1077 Ga0070714_100000894
1078 Ga0070714_100040769
1079 Ga0070714_100203415
1080 Ga0070714_100258495
1081 Ga0070714_100305226
1082 Ga0070714_100879266
1083 Ga0070713_100027607
1084 Ga0070713_100065337
1085 Ga0070713_100101830
1086 Ga0070713_100130668
1087 Ga0070713_100853264
1088 Ga0070710_10017218
1089 Ga0070710_10035441
1090 Ga0070710_10267480
1091 Ga0070711_100011836
1092 Ga0070711_100140480
1093 Ga0070711_100173013
1094 Ga0070711_100231475
1095 Ga0070711_100240861
1096 Ga0070711_100252691
1097 Ga0070705_100015867
1098 Ga0070700_100100786
1099 Ga0070700_100136824
1100 Ga0070700_100463669
1101 Ga0070694_100111554
1102 Ga0070694_100352407
1103 Ga0070694_100561933
1104 Ga0070708_100706627
1105 Ga0070663_100043131
1106 Ga0070663_100211538
1107 Ga0070663_100626514
1108 Ga0070678_100029931
1109 Ga0070678_100077314
1110 Ga0070662_100116546
1111 Ga0070662_100143536
1112 Ga0070662_100621682
1113 Ga0070681_10064650
1114 Ga0070681_10302911
1115 Ga0068867_100181007
1116 Ga0070685_10259144
1117 Ga0070707_100455379
1118 Ga0070679_100016072
1119 Ga0070679_100036601
1120 Ga0070679_100457522
1121 Ga0070679_100572839
1122 Ga0070684_100003769
1123 Ga0070684_100032430
1124 Ga0070684_100033498
1125 Ga0070684_100036808
1126 Ga0070684_100056138
1127 Ga0070684_100056369
1128 Ga0070684_100141597
1129 Ga0070684_100197372
1130 Ga0070684_100700963
1131 Ga0068853_100110199
1132 Ga0068853_100380756
1133 Ga0070686_100037841
1134 Ga0070686_100042074
1135 Ga0070686_100138609
1136 Ga0070686_100256874
1137 Ga0070695_100424844
1138 Ga0070696_100010038
1139 Ga0070696_100022542
1140 Ga0070696_100078536
1141 Ga0070696_100138758
1142 Ga0070696_100144071
1143 Ga0070693_100007320
1144 Ga0070693_100042559
1145 Ga0070665_100341887
1146 Ga0070665_100362696
1147 Ga0070665_100377053
1148 Ga0070704_100013449
1149 Ga0070704_100068922
1150 Ga0068855_100012401
1151 Ga0068855_100023543
1152 Ga0068855_100321570
1153 Ga0068855_100486488
1154 Ga0070664_100195323
1155 Ga0070664_100206575
1156 Ga0070664_100367883
1157 Ga0070664_100581342
1158 Ga0068857_100001692
1159 Ga0068857_100014191
1160 Ga0068857_100722924
1161 Ga0068854_100056597
1162 Ga0068854_100195568
1163 Ga0068856_100013828
1164 Ga0068856_100024559
1165 Ga0068856_100088553
1166 Ga0068856_100376453
1167 Ga0068856_100601052
1168 Ga0070702_100067949
1169 Ga0068852_100009339
1170 Ga0068852_100593127
1171 Ga0068859_100013627
1172 Ga0068859_100271115
1173 Ga0068859_100403685
1174 Ga0068859_100432310
1175 Ga0068864_100064564
1176 Ga0068861_100150032
1177 Ga0068870_10134947
1178 Ga0068870_10255196
1179 Ga0068870_10321776
1180 Ga0068863_100083410
1181 Ga0068858_100077971
1182 Ga0068860_100084965
1183 Ga0068862_100707180
1184 Ga0081455_10024797
1185 Ga0081455_10025518
1186 Ga0081455_10170847
1187 Ga0081538_10021579
1188 Ga0081540_1003230
1189 Ga0081540_1004696
1190 Ga0081540_1014407
1191 Ga0081539_10001518
1192 Ga0081539_10006277
1193 Ga0081539_10059860
1194 Ga0070717_10001730
1195 Ga0070717_10039495
1196 Ga0070717_10040314
1197 Ga0070717_10246009
1198 Ga0070717_10370869
1199 Ga0075432_10019292
1200 Ga0070716_100016508
1201 Ga0070716_100166307
1202 Ga0070716_100347385
1203 Ga0070712_100022962
1204 Ga0070712_100384053
1205 Ga0070712_100645992
1206 Ga0097621_100053228
1207 Ga0097621_100113335
1208 Ga0097621_100378741
1209 Ga0068871_100065208
1210 Ga0075428_100023749
1211 Ga0075430_100043862
1212 Ga0075431_100068089
1213 Ga0075433_10284126
1214 Ga0075434_100000357
1215 Ga0075434_100022375
1216 Ga0075434_100043392
1217 Ga0075434_100047366
1218 Ga0068865_100093452
1219 Ga0068865_100121384
1220 Ga0068865_100334097
1221 Ga0075436_100010725
1222 Ga0075436_100021002
1223 Ga0075436_100168380
1224 Ga0097620_100013627
1225 Ga0097620_100271117
1226 Ga0097620_100403685
1227 Ga0097620_100432341
1228 Ga0075435_100002080
1229 Ga0075435_100060922
1230 Ga0075435_100153173
1231 Ga0075435_100291479
1232 Ga0105240_10012384
1233 Ga0105240_10058663
1234 Ga0105240_10124671
1235 Ga0111539_10010762
1236 Ga0111539_10018092
1237 Ga0111539_10057998
1238 Ga0111539_10290047
1239 Ga0111539_10389091
1240 Ga0111539_10500846
1241 Ga0111539_10616445
1242 Ga0111539_11381875
1243 Ga0105245_10014744
1244 Ga0105245_10024857
1245 Ga0105245_10055645
1246 Ga0105245_10077160
1247 Ga0105245_10172545
1248 Ga0105245_10288170
1249 Ga0105247_10006155
1250 Ga0105247_10060638
1251 Ga0105247_10148665
1252 Ga0114129_10000964
1253 Ga0114129_10160851
1254 Ga0114129_10240886
1255 Ga0114129_10384152
1256 Ga0114129_10816256
1257 Ga0105243_10007690
1258 Ga0105243_10467465
1259 Ga0105241_10007849
1260 Ga0105241_10063163
1261 Ga0105242_10169251
1262 Ga0105242_10322018
1263 Ga0105242_10382403
1264 Ga0105242_10954151
1265 Ga0105248_10084082
1266 Ga0105248_10467329
1267 Ga0105237_10019190
1268 Ga0105237_10077168
1269 Ga0105237_10117776
1270 Ga0105237_10632288
1271 Ga0105237_10851122
1272 Ga0105238_10011067
1273 Ga0105238_10056023
1274 Ga0105238_10314471
1275 Ga0105249_10003207
1276 Ga0105249_10214729
1277 Ga0105239_10015168
1278 Ga0105239_10218383
1279 Ga0105239_10237974
1280 Ga0105239_10347378
1281 Ga0105239_10581810
1282 Ga0105239_10589137
1283 Ga0105246_10004642
1284 Ga0105246_10054641
1285 Ga0105246_10147892
1286 Ga0105246_10442329
1287 Ga0157373_10093518
1288 Ga0157373_10256934
1289 Ga0157370_10070259
1290 Ga0157370_10210702
1291 Ga0157370_10519018
1292 Ga0157369_10004927
1293 Ga0157369_10024850
1294 Ga0157369_10034367
1295 Ga0157369_10131855
1296 Ga0157369_10261093
1297 Ga0157369_10460022
1298 Ga0157369_11024190
1299 Ga0157374_10032740
1300 Ga0157374_10076470
1301 Ga0157374_11001503
1302 Ga0157378_10304914
1303 Ga0157378_10602955
1304 Ga0163162_10042103
1305 Ga0163162_10071429
1306 Ga0163162_10135036
1307 Ga0163162_10409778
1308 Ga0157372_10034956
1309 Ga0157372_10179199
1310 Ga0157372_10228743
1311 Ga0157372_10284266
1312 Ga0157372_10975662
1313 Ga0157375_10583298
1314 Ga0157375_10600903
1315 Ga0157375_10614609
1316 Ga0157375_10666074
1317 Ga0163163_10096785
1318 Ga0157380_10813770
1319 Ga0157380_11109977
1320 Ga0182008_10042296
1321 Ga0157377_10018950
1322 Ga0157377_10045124
1323 Ga0157377_10404210
1324 Ga0157379_10073420
1325 Ga0157379_10100042
1326 Ga0157376_10242432
1327 Ga0163161_10010967
1328 Ga0197907_11206444
1329 Ga0206349_1873883
1330 Ga0206352_11153564
1331 Ga0206350_11033092
1332 Ga0206354_10061286
1333 Ga0206354_10185715
1334 Ga0206353_10429344
1335 Ga0206353_10573116
1336 Ga0206353_11625264
1337 Ga0206353_11644797
1338 Ga0213876_10174384
1339 Ga0224712_10009451
1340 Ga0207653_10010934
1341 Ga0207692_10020153
1342 Ga0207642_10042375
1343 Ga0207642_10267953
1344 Ga0207710_10005704
1345 Ga0207688_10003011
1346 Ga0207688_10137833
1347 Ga0207688_10401540
1348 Ga0207680_10211107
1349 Ga0207699_10131636
1350 Ga0207699_10143776
1351 Ga0207699_10298930
1352 Ga0207699_10449417
1353 Ga0207643_10093787
1354 Ga0207643_10212103
1355 Ga0207643_10305642
1356 Ga0207705_10013838
1357 Ga0207705_10027414
1358 Ga0207654_10435836
1359 Ga0207707_10006640
1360 Ga0207707_10042472
1361 Ga0207707_10191135
1362 Ga0207695_10016948
1363 Ga0207695_10086032
1364 Ga0207671_10033696
1365 Ga0207671_10100781
1366 Ga0207671_10573534
1367 Ga0207693_10003776
1368 Ga0207693_10005429
1369 Ga0207693_10026494
1370 Ga0207693_10172684
1371 Ga0207663_10024658
1372 Ga0207663_10027118
1373 Ga0207663_10043010
1374 Ga0207663_10122300
1375 Ga0207663_10159991
1376 Ga0207660_10066430
1377 Ga0207662_10142139
1378 Ga0207657_10008699
1379 Ga0207657_10010785
1380 Ga0207657_10041090
1381 Ga0207657_10041625
1382 Ga0207652_10003326
1383 Ga0207652_10087129
1384 Ga0207652_10163155
1385 Ga0207652_10297693
1386 Ga0207652_10512315
1387 Ga0207652_10567119
1388 Ga0207694_10031822
1389 Ga0207694_10097251
1390 Ga0207659_10821627
1391 Ga0207687_10017701
1392 Ga0207687_10022609
1393 Ga0207687_10047667
1394 Ga0207687_10067045
1395 Ga0207700_10013246
1396 Ga0207700_10061784
1397 Ga0207700_10299251
1398 Ga0207664_10001985
1399 Ga0207664_10051585
1400 Ga0207664_10197554
1401 Ga0207664_10202980
1402 Ga0207664_10345857
1403 Ga0207664_10717582
1404 Ga0207664_10810120
1405 Ga0207644_10198206
1406 Ga0207690_10010476
1407 Ga0207690_10108565
1408 Ga0207690_10119030
1409 Ga0207706_10096563
1410 Ga0207706_10199289
1411 Ga0207686_10072983
1412 Ga0207686_10730765
1413 Ga0207709_10639753
1414 Ga0207669_10303958
1415 Ga0207669_10429659
1416 Ga0207704_10115182
1417 Ga0207704_10205514
1418 Ga0207704_10235920
1419 Ga0207704_10317841
1420 Ga0207665_10000195
1421 Ga0207665_10000601
1422 Ga0207665_10006663
1423 Ga0207665_10075692
1424 Ga0207665_10141432
1425 Ga0207665_10741370
1426 Ga0207691_10256887
1427 Ga0207711_10107641
1428 Ga0207711_10743703
1429 Ga0207689_10150182
1430 Ga0207661_10004881
1431 Ga0207661_10018064
1432 Ga0207661_10078497
1433 Ga0207661_10131215
1434 Ga0207661_10414096
1435 Ga0207661_10572798
1436 Ga0207661_10740606
1437 Ga0207679_10033818
1438 Ga0207679_10073438
1439 Ga0207679_10080268
1440 Ga0207667_10038972
1441 Ga0207667_10186461
1442 Ga0207651_10162611
1443 Ga0207712_10038177
1444 Ga0207712_10492181
1445 Ga0207668_10158996
1446 Ga0207640_10022492
1447 Ga0207640_10747772
1448 Ga0207658_10096596
1449 Ga0207677_10177629
1450 Ga0207677_10255939
1451 Ga0207677_10331833
1452 Ga0207703_10039187
1453 Ga0207703_10361769
1454 Ga0207703_10426431
1455 Ga0207639_10032180
1456 Ga0207639_10107751
1457 Ga0207639_10217847
1458 Ga0207678_10041636
1459 Ga0207678_10058655
1460 Ga0207678_10392052
1461 Ga0207678_10473383
1462 Ga0207708_10010964
1463 Ga0207708_10049128
1464 Ga0207708_10155372
1465 Ga0207708_10258905
1466 Ga0207702_10080103
1467 Ga0207702_10123558
1468 Ga0207702_10425791
1469 Ga0207702_10717445
1470 Ga0207641_10235639
1471 Ga0207648_10016526
1472 Ga0207648_10032621
1473 Ga0207676_10097948
1474 Ga0207676_10166602
1475 Ga0207674_10001054
1476 Ga0207674_10016986
1477 Ga0207674_10044896
1478 Ga0207674_10196363
1479 Ga0207674_10326149
1480 Ga0207675_100201450
1481 Ga0207675_100394787
1482 Ga0207683_10000833
1483 Ga0207683_10003692
1484 Ga0207683_10035215
1485 Ga0207698_10005457
1486 Ga0207698_10043814
1487 Ga0207698_10504537
1488 Ga0207428_10028092
1489 Ga0207428_10053368
1490 Ga0207428_10088595
1491 Ga0207428_10267106
1492 Ga0268266_10263857
1493 Ga0268264_10201930
1494 Ga0268264_10481552
1495 Ga0265318_10024441
1496 Ga0265318_10166566
1497 Ga0307515_10010678
1498 Ga0265338_10018646
1499 Ga0265338_10131534
1500 Ga0307512_10006078
1501 Ga0265320_10012357
1502 Ga0265320_10033125
1503 Ga0265327_10001876
1504 Ga0265316_10351470
1505 Ga0307513_10072345
1506 Ga0307513_10073910
1507 Ga0307408_100072435
1508 Ga0265313_10015362
1509 Ga0307508_10018211
1510 Ga0307516_10066166
1511 Ga0307405_10001670
1512 Ga0307405_10176069
1513 Ga0307405_10229809
1514 Ga0307413_10001335
1515 Ga0307413_10030442
1516 Ga0307410_10033497
1517 Ga0307410_10119763
1518 Ga0307410_10210731
1519 Ga0307410_10279861
1520 Ga0307406_10067089
1521 Ga0307407_10019549
1522 Ga0307409_100104057
1523 Ga0307409_100242413
1524 Ga0307409_100589653
1525 Ga0307416_100014965
1526 Ga0307416_100138320
1527 Ga0307411_10178438
1528 Ga0307415_100000090
1529 Ga0307415_100206395
1530 Ga0373948_0030669
1531 Ga0373958_0021883
1532 Ga0373959_0010660
1533 Ga0373959_0034892
1534 Ga0373928_0010968
1535 Ga0373928_0023029
1536 Ga0373923_0062371
1537 Ga0373932_0023557
1538 Ga0373936_0041637
1539 Ga0373936_0065566
1540 Ga0373939_0038090
1541 Ga0373953_0261233
1542 Ga0373954_0088301
1543 Ga0373957_0054283
1544 Ga0373960_0021452
1545 Ga0373960_0080218
1546 Ga0373943_0028930
1547 Ga0373943_0039026
1548 Ga0373946_0023468
1549 Ga0373946_0072254
1550 Ga0373942_0004970
1551 Ga0373962_0006797
1552 Ga0373924_0110797
1553 Ga0373931_0050166
1554 Ga0373931_0209846
1555 Ga0373931_0301493
1556 Ga0373935_0025226
1557 Ga0373935_0052604
1558 Ga0373935_0071196
1559 Ga0373935_0098951
1560 Ga0373935_0535900
1561 Ga0373927_0023041
1562 Ga0373927_0024339
1563 Ga0373927_0399154
1564 Ga0373933_0117703
1565 Ga0373933_0360613
1566 Ga0373947_0004740
1567 Ga0373947_0021147
1568 Ga0373947_0252702
1569 Ga0373937_0263144
1570 Ga0373925_0003728
1571 Ga0373925_0008902
1572 Ga0373925_0334898
1573 Ga0395899_0013453
1574 Ga0395899_0085995
1575 Ga0395900_0002476
1576 Ga0395900_0005661
1577 Ga0395900_0335705
1578 Ga0395900_0965102
1579 Ga0395898_0000647
1580 Ga0395898_0022090
1581 Ga0395898_0082928
1582 Ga0395898_0102264
1583 Ga0395898_0112047
1584 Ga0395898_0187817
1585 Ga0395905_0142028
1586 Ga0395901_0064172
1587 Ga0395901_0119196
1588 Ga0395901_0144437
1589 Ga0395901_0233642
1590 Ga0436365_1372001
1591 Ga0451791_0598011
1592 Ga0439448_0009987
1593 Ga0439459_0043442
1594 Ga0466969_0041782
1595 Ga0466969_0066191
1596 Ga0466972_0070351
1597 Ga0466965_0040962
1598 Ga0466966_0067815
1599 Ga0466966_0307159
1600 Ga0466966_0510930
1601 Ga0466961_0001879
1602 Ga0466961_0023121
1603 Ga0466961_0148178
1604 Ga0466961_0361659
1605 Ga0466963_0005079
1606 Ga0466963_0007154
1607 Ga0466963_0044231
1608 Ga0466963_0046606
1609 Ga0466963_0061384
1610 Ga0466963_0092197
1611 Ga0466963_0304400
1612 Ga0466964_0085699
1613 Ga0466964_0122863
1614 Ga0466964_0156447
1615 Ga0466971_0079697
1616 Ga0466968_0008725
1617 Ga0466968_0134188
1618 Ga0466970_0032328
1619 Ga0466970_0035361
1620 Ga0466970_0362818
1621 Ga0466957_0000876
1622 Ga0466957_0286904
1623 Ga0466960_0004383
1624 Ga0466960_0055099
1625 Ga0466960_0090782
1626 Ga0466960_0233001
1627 Ga0466959_0012748
1628 Ga0466959_0016877
1629 Ga0466959_0031929
1630 Ga0466959_0207526
1631 Ga0466959_0239606
1632 Ga0451576_0110387
1633 Ga0451576_0116084
1634 Ga0466958_0011527
1635 Ga0466958_0030106
1636 Ga0466958_0052022
1637 Ga0466958_0066652
1638 Ga0466958_0115573
1639 Ga0466958_0369866
1640 Ga0466958_0463717
1641 Ga0466967_0001987
1642 Ga0466967_0003861
1643 Ga0466967_0005102
1644 Ga0466967_0006933
1645 Ga0466967_0024880
1646 Ga0466967_0039095
1647 Ga0466967_0087730
1648 Ga0466967_0102962
1649 Ga0466967_0146200
1650 Ga0466967_0159682
1651 Ga0466967_0238007
1652 Ga0466967_0273909
1653 Ga0466967_0363831
1654 Ga0466967_0392009
1655 Ga0466967_0503194
1656 Ga0466967_0663337
1657 Ga0466967_0953031
1658 Ga0495603_0018446
1659 Ga0495603_0084455
1660 Ga0495629_0003104
1661 Ga0495629_0013284
1662 Ga0495629_0073788
1663 Ga0495629_0107509
1664 Ga0495629_0236033
1665 Ga0495629_0303359
1666 Ga0495641_0006434
1667 Ga0495641_0011685
1668 Ga0495641_0043419
1669 Ga0495641_0046828
1670 Ga0495641_0102710
1671 Ga0495653_0010191
1672 Ga0495653_0047400
1673 Ga0495653_0260084
1674 Ga0495580_0133747
1675 Ga0495580_0470771
1676 Ga0495582_0000556
1677 Ga0495582_0094319
1678 Ga0495605_0036349
1679 Ga0495639_0000322
1680 Ga0495639_0000484
1681 Ga0495662_0005856
1682 Ga0495662_0010467
1683 Ga0495662_0058954
1684 Ga0495662_0068334
1685 Ga0495664_0004712
1686 Ga0495664_0134037
1687 Ga0495584_0286115
1688 Ga0495594_0007889
1689 Ga0495594_0216596
1690 Ga0495607_0195851
1691 Ga0495606_0002983
1692 Ga0495608_0014283
1693 Ga0495608_0111010
1694 Ga0495608_0337565
1695 Ga0495608_0453886
1696 Ga0495616_0063656
1697 Ga0495618_0007980
1698 Ga0495618_0040561
1699 Ga0495620_0084431
1700 Ga0495630_0007718
1701 Ga0495630_0080750
1702 Ga0495630_0316227
1703 Ga0495632_0245801
1704 Ga0495663_0008906
1705 Ga0495666_0000381
1706 Ga0495666_0025977
1707 Ga0495652_0018726
1708 Ga0495665_0001289
1709 Ga0495665_0004560
1710 Ga0495665_0005611
1711 Ga0495665_0175949
1712 Ga0495640_0019654
1713 Ga0495640_0095027
1714 Ga0495640_0152143
1715 Ga0495640_0174723
1716 Ga0495586_0009299
1717 Ga0495587_0064209
1718 Ga0495587_0366642
1719 Ga0495609_0142992
1720 Ga0495621_0017646
1721 Ga0495645_0302806
1722 Ga0495645_0441092
1723 Ga0495667_0022322
1724 Ga0495667_0112754
1725 Ga0495667_0445422
1726 Ga0495668_0002487
1727 Ga0495634_0011846
1728 Ga0495611_0092206
1729 Ga0495625_0004304
1730 Ga0495635_0002868
1731 Ga0495635_0005770
1732 Ga0495635_0032400
1733 Ga0495635_0214706
1734 Ga0495635_0252106
1735 Ga0495659_0021617
1736 Ga0495588_0004661
1737 Ga0495588_0179206
1738 Ga0495657_0011425
1739 Ga0495623_0135923
1740 Ga0495646_0097986
1741 Ga0495646_0134576
1742 Ga0495647_0000125
1743 Ga0495647_0012406
1744 Ga0495647_0092653
1745 Ga0495658_0009157
1746 Ga0495658_0010814
1747 Ga0495658_0020440
1748 Ga0495658_0395814
1749 Ga0495658_0459177
1750 Ga0495669_0034445
1751 Ga0495613_0015338
1752 Ga0495613_0018490
1753 Ga0495613_0049767
1754 Ga0495624_0003568
1755 Ga0495624_0012260
1756 Ga0495670_0216085
1757 Ga0495670_0231718
1758 Ga0495670_0239659
1759 Ga0495600_0002021
1760 Ga0495600_0250855
1761 Ga0495600_0275767
1762 Ga0495581_0014414
1763 Ga0495581_0024013
1764 Ga0495604_0190611
1765 Ga0495674_0023283
1766 Ga0495674_0037655
1767 Ga0495674_0058125
1768 Ga0495674_0164679
1769 Ga0495674_0208773
1770 Ga0495674_0375387
1771 Ga0495674_0387615
1772 Ga0495674_0701987
1773 Ga0495676_0004037
1774 Ga0495676_0007501
1775 Ga0495676_0027898
1776 Ga0495680_0059675
1777 Ga0495680_0132194
1778 Ga0495680_0192253
1779 Ga0495680_0226473
1780 Ga0495675_0026638
1781 Ga0495675_0225238
1782 Ga0495684_0009841
1783 Ga0495684_0099851
1784 Ga0495684_0216457
1785 Ga0495593_0001712
1786 Ga0495593_0013286
1787 Ga0495593_0389500
1788 Ga0495602_0047169
1789 Ga0495602_0420012
1790 Ga0495614_0022259
1791 Ga0495614_0119046
1792 Ga0495626_0001210
1793 Ga0496100_0036946
1794 Ga0496100_0043571
1795 Ga0496100_0068408
1796 Ga0496100_0068643
1797 Ga0496100_0068952
1798 Ga0496100_0130895
1799 Ga0496100_0132266
1800 Ga0496100_0190027
1801 Ga0496100_0229499
1802 Ga0496100_0249262
1803 Ga0496100_0544164
1804 Ga0496101_0019803
1805 Ga0496101_0028280
1806 Ga0496101_0054862
1807 Ga0496101_0061488
1808 Ga0496101_0073391
1809 Ga0496101_0151121
1810 Ga0496101_0221889
1811 Ga0496101_0312608
1812 Ga0496102_0000044
1813 Ga0496102_0000669
1814 Ga0496102_0013968
1815 Ga0496102_0018252
1816 Ga0496102_0039907
1817 Ga0496102_0043100
1818 Ga0496102_0046725
1819 Ga0496102_0106076
1820 Ga0496102_0110761
1821 Ga0496102_0136062
1822 Ga0496102_0209082
1823 Ga0496102_0239905
1824 Ga0496102_0478728
1825 Ga0496102_0485859
1826 Ga0496103_0000123
1827 Ga0496103_0006778
1828 Ga0496103_0024711
1829 Ga0496103_0043628
1830 Ga0496103_0050205
1831 Ga0496103_0138677
1832 Ga0496103_0159149
1833 Ga0496103_0417328
1834 Ga0496103_0420387
1835 Ga0496103_0457849
1836 Ga0496104_0011466
1837 Ga0496104_0013602
1838 Ga0496104_0014409
1839 Ga0496104_0027699
1840 Ga0496104_0034169
1841 Ga0496104_0044810
1842 Ga0496104_0058061
1843 Ga0496104_0103028
1844 Ga0496104_0115270
1845 Ga0496104_0117783
1846 Ga0496104_0123377
1847 Ga0496104_0139560
1848 Ga0496104_0218858
1849 Ga0496104_0221224
1850 Ga0496104_0221848
1851 Ga0496104_0533917
1852 Ga0496105_0004276
1853 Ga0496105_0005275
1854 Ga0496105_0018647
1855 Ga0496105_0045351
1856 Ga0496105_0080135
1857 Ga0496105_0104604
1858 Ga0496105_0148559
1859 Ga0496105_0153966
1860 Ga0496105_0194434
1861 Ga0496105_0388577
1862 Ga0496105_0504297
1863 Ga0496106_0007647
1864 Ga0496106_0011800
1865 Ga0496106_0016676
1866 Ga0496106_0018577
1867 Ga0496106_0055255
1868 Ga0496106_0097150
1869 Ga0496106_0108617
1870 Ga0496106_0126810
1871 Ga0496106_0155778
1872 Ga0496107_0028222
1873 Ga0496107_0032253
1874 Ga0496107_0036363
1875 Ga0496107_0045591
1876 Ga0496107_0081206
1877 Ga0496107_0098938
1878 Ga0496107_0303185
1879 Ga0496107_0516595
1880 Ga0496108_0009178
1881 Ga0496108_0014293
1882 Ga0496108_0021143
1883 Ga0496108_0022524
1884 Ga0496108_0038584
1885 Ga0496108_0104013
1886 Ga0496108_0136804
1887 Ga0496108_0277156
1888 Ga0496108_0309335
1889 Ga0496108_0462371
1890 Ga0496108_0643625
1891 Ga0496109_0001181
1892 Ga0496109_0001497
1893 Ga0496109_0002763
1894 Ga0496109_0010768
1895 Ga0496109_0024527
1896 Ga0496109_0027766
1897 Ga0496109_0028637
1898 Ga0496109_0057894
1899 Ga0496109_0065716
1900 Ga0496109_0101415
1901 Ga0496109_0122100
1902 Ga0496109_0255789
1903 Ga0496110_0002894
1904 Ga0496110_0003955
1905 Ga0496110_0005402
1906 Ga0496110_0012717
1907 Ga0496110_0021225
1908 Ga0496110_0069223
1909 Ga0496110_0106372
1910 Ga0496110_0151032
1911 Ga0496110_0164684
1912 Ga0496110_0381672
1913 Ga0496110_0574639
1914 Ga0496110_0582985
1915 Ga0496111_0000950
1916 Ga0496111_0001566
1917 Ga0496111_0029301
1918 Ga0496111_0034973
1919 Ga0496111_0069256
1920 Ga0496111_0070133
1921 Ga0496111_0166069
1922 Ga0496111_0175800
1923 Ga0496111_0250810
1924 Ga0496112_0007917
1925 Ga0496112_0008096
1926 Ga0496112_0023292
1927 Ga0496112_0051518
1928 Ga0496112_0089434
1929 Ga0496112_0105046
1930 Ga0496112_0180960
1931 Ga0496112_0222874
1932 Ga0496112_0271807
1933 Ga0496112_0340820
1934 Ga0496113_0002548
1935 Ga0496113_0020491
1936 Ga0496113_0027747
1937 Ga0496113_0050403
1938 Ga0496113_0109010
1939 Ga0496113_0122777
1940 Ga0496113_0203794
1941 Ga0496113_0423410
1942 Ga0496114_0010141
1943 Ga0496114_0047435
1944 Ga0496114_0051346
1945 Ga0496114_0062504
1946 Ga0496114_0066554
1947 Ga0496114_0077580
1948 Ga0496114_0110497
1949 Ga0496114_0112716
1950 Ga0496114_0167902
1951 Ga0496114_0432914
1952 Ga0496114_0439378
1953 Ga0496114_0558122
1954 Ga0496115_0002678
1955 Ga0496115_0068553
1956 Ga0496115_0088415
1957 Ga0496115_0101210
1958 Ga0496115_0189887
1959 Ga0496115_0209007
1960 Ga0496115_0223249
1961 Ga0496115_0323657
1962 Ga0496118_0042197
1963 Ga0496119_0000333
1964 Ga0496119_0015393
1965 Ga0496120_0015310
1966 Ga0496120_0068025
1967 Ga0501032_0219753
1968 Ga0501036_0157878
1969 Ga0501037_0028486
1970 Ga0501038_0225409
1971 Ga0501039_0022065
1972 Ga0501046_0012417
1973 Ga0501047_0333934
1974 Ga0501067_0002055
1975 Ga0501067_0019838
1976 Ga0501068_0052215
1977 Ga0501069_0025754
1978 Ga0501069_0065922
1979 Ga0501069_0150127
1980 Ga0501070_0129570
1981 Ga0501074_0061956
1982 Ga0501080_0198527
1983 Ga0501080_0965520
1984 Ga0501035_0174366
1985 Ga0501044_0456446
1986 Ga0501044_0676668
1987 Ga0501044_1026951
1988 nmdc:mga05p37_218242_c1
1989 nmdc:mga05p37_8428_c1
1990 nmdc:mga0qj67_132852_c1
1991 nmdc:mga08y16_326067_c1
1992 nmdc:mga08y16_36663_c1
1993 nmdc:mga0n895_108231_c1
1994 nmdc:mga0n895_14986_c1
1995 nmdc:mga0n895_42194_c1
1996 nmdc:mga0rr50_566486_c1
1997 nmdc:mga0rr50_6021_c1
1998 nmdc:mga0rr50_84884_c1
1999 nmdc:mga08x19_22363_c1
2000 nmdc:mga08x19_64249_c1
2001 nmdc:mga08x19_68069_c1
2002 nmdc:mga0a205_115318_c1
2003 nmdc:mga0a205_902062_c1
2004 Ga0495601_0005606
2005 Ga0495601_0039984
2006 Ga0495601_0082212
2007 Ga0495601_0268923
2008 Ga0495612_0001055
2009 Ga0495612_0037938
2010 Ga0495655_0087718
2011 Ga0495595_0082259
2012 Ga0495619_0011287
2013 Ga0495619_0335389
2014 Ga0495619_0344742
2015 Ga0500583_0184189
2016 Ga0500566_0024371
2017 Ga0500556_0000417
2018 Ga0500568_0123165
2019 Ga0500600_0011756
2020 Ga0466962_0009921
2021 Ga0466962_0082473
2022 Ga0466962_0091526
2023 Ga0530510_0271324
2024 2819425918
2025 2819665006
2026 2887480959

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

8

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xv5-assembly1.cif.gz_B crystal structure of rib7 mutant s88e from methanosarcina mazei 0.9131 20 240
5xux-assembly2.cif.gz_C crystal structure of rib7 from methanosarcina mazei 0.9129 20 240
5xv0-assembly1.cif.gz_A crystal structure of rib7 mutant d33n from methanosarcina mazei 0.9123 19 240
5xv0-assembly3.cif.gz_E crystal structure of rib7 mutant d33n from methanosarcina mazei 0.9121 20 240
5xux-assembly3.cif.gz_F crystal structure of rib7 from methanosarcina mazei 0.9115 19 240
ID Description Score Start End Superfamily
5xuxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.93 20 240 3.40.430.10
5xuxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9141 20 240 3.40.430.10
3h7kA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8846 121 147 3.75.10.10
2aznF00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8778 21 240 3.40.430.10
3zpgA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8639 21 240 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A0Q9QFU6-F1-model_v4 Deaminase 0.9799 19 244 GO:0008703
GO:0009231
AF-A0A543DYK6-F1-model_v4 5-amino-6-(5-phosphoribosylamino)uracil reductase 0.9772 21 239 GO:0008703
GO:0009231
AF-A0A7Y9GMP1-F1-model_v4 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) 0.9753 19 242 GO:0008703
GO:0009231
AF-A0A259SMT2-F1-model_v4 Deaminase 0.9674 65 246 GO:0008703
GO:0009231
AF-A0A396MDH7-F1-model_v4 Riboflavin biosynthesis protein RibD (EC 3.5.4.26) 0.9656 23 242 GO:0008703
GO:0008835
GO:0009231

Map