F488190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 345 | 2026 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100078239|Ga0070707_1000782391 |
| Length | 87 |
| Sequence | MLVLDLKSGQEVCWMLTPRDQLLASHEEFQKLAQEHTQYAQRLDSLTQKRYLTEDEKLEEVRLKKLKLRLKDQMESIERQYRQHQVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 138 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 139 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 140 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 214 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 215 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 236 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 237 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 238 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 2.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.94 |
| Rhizosphere | 94.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100078239 | 3300005468 | Unclassified | 3190 |
| 2 | JGI24741J21665_1033816 | 3300001915 | Bacteria | 760 |
| 3 | JGI24752J21851_1006609 | 3300001976 | Bacteria | 1516 |
| 4 | JGI24743J22301_10012057 | 3300001991 | Bacteria | 1567 |
| 5 | JGI24748J21848_1025698 | 3300002074 | Bacteria | 718 |
| 6 | JGI24749J21850_1056880 | 3300002076 | Bacteria | 590 |
| 7 | JGI24033J26618_1067013 | 3300002155 | Bacteria | 535 |
| 8 | JGI24034J26672_10002729 | 3300002239 | Unclassified | 2435 |
| 9 | JGI24751J29686_10003895 | 3300002459 | Bacteria | 3015 |
| 10 | Ga0058861_12068115 | 3300004800 | Unclassified | 545 |
| 11 | Ga0065704_10033639 | 3300005289 | Bacteria | 849 |
| 12 | Ga0065712_10338493 | 3300005290 | Bacteria | 804 |
| 13 | Ga0065715_10113296 | 3300005293 | Bacteria | 2496 |
| 14 | Ga0065715_10667531 | 3300005293 | Unclassified | 665 |
| 15 | Ga0065715_11082109 | 3300005293 | Unclassified | 524 |
| 16 | Ga0070658_10600736 | 3300005327 | Bacteria | 954 |
| 17 | Ga0070658_11979186 | 3300005327 | Unclassified | 503 |
| 18 | Ga0070676_10003275 | 3300005328 | Bacteria | 8412 |
| 19 | Ga0070676_10081298 | 3300005328 | Bacteria | 1966 |
| 20 | Ga0070683_100004621 | 3300005329 | Bacteria | 11370 |
| 21 | Ga0070683_100176771 | 3300005329 | Bacteria | 2026 |
| 22 | Ga0070683_100569260 | 3300005329 | Bacteria | 1084 |
| 23 | Ga0070690_100037269 | 3300005330 | Bacteria | 3063 |
| 24 | Ga0070690_100103389 | 3300005330 | Bacteria | 1891 |
| 25 | Ga0070670_100038118 | 3300005331 | Bacteria | 4133 |
| 26 | Ga0070670_100167510 | 3300005331 | Bacteria | 1905 |
| 27 | Ga0070677_10100228 | 3300005333 | Bacteria | 1276 |
| 28 | Ga0070677_10182451 | 3300005333 | Unclassified | 1000 |
| 29 | Ga0068869_100041154 | 3300005334 | Bacteria | 3307 |
| 30 | Ga0068869_100044577 | 3300005334 | Unclassified | 3190 |
| 31 | Ga0068869_100164441 | 3300005334 | Bacteria | 1729 |
| 32 | Ga0070666_10017323 | 3300005335 | Bacteria | 4618 |
| 33 | Ga0070666_10114327 | 3300005335 | Bacteria | 1868 |
| 34 | Ga0070680_100148076 | 3300005336 | Bacteria | 1970 |
| 35 | Ga0070680_100963660 | 3300005336 | Bacteria | 736 |
| 36 | Ga0070680_101799629 | 3300005336 | Unclassified | 531 |
| 37 | Ga0070682_100010844 | 3300005337 | Bacteria | 5185 |
| 38 | Ga0070682_100017628 | 3300005337 | Bacteria | 4165 |
| 39 | Ga0068868_100006913 | 3300005338 | Bacteria | 8060 |
| 40 | Ga0068868_100296432 | 3300005338 | Unclassified | 1372 |
| 41 | Ga0068868_100448747 | 3300005338 | Unclassified | 1121 |
| 42 | Ga0068868_100604449 | 3300005338 | Bacteria | 972 |
| 43 | Ga0070660_100035833 | 3300005339 | Bacteria | 3756 |
| 44 | Ga0070660_100118597 | 3300005339 | Bacteria | 2110 |
| 45 | Ga0070689_100144463 | 3300005340 | Bacteria | 1915 |
| 46 | Ga0070691_10052150 | 3300005341 | Bacteria | 1956 |
| 47 | Ga0070687_100037353 | 3300005343 | Bacteria | 2427 |
| 48 | Ga0070687_100656714 | 3300005343 | Bacteria | 727 |
| 49 | Ga0070661_100010243 | 3300005344 | Bacteria | 6512 |
| 50 | Ga0070661_100261636 | 3300005344 | Bacteria | 1338 |
| 51 | Ga0070692_10145328 | 3300005345 | Bacteria | 1346 |
| 52 | Ga0070692_11372437 | 3300005345 | Bacteria | 509 |
| 53 | Ga0070668_100027931 | 3300005347 | Bacteria | 4282 |
| 54 | Ga0070668_100048610 | 3300005347 | Bacteria | 3262 |
| 55 | Ga0070669_100037937 | 3300005353 | Bacteria | 3497 |
| 56 | Ga0070669_101792330 | 3300005353 | Unclassified | 535 |
| 57 | Ga0070675_100151397 | 3300005354 | Bacteria | 1989 |
| 58 | Ga0070675_100187426 | 3300005354 | Bacteria | 1791 |
| 59 | Ga0070671_100245420 | 3300005355 | Bacteria | 1520 |
| 60 | Ga0070674_100277089 | 3300005356 | Unclassified | 1328 |
| 61 | Ga0070673_100079283 | 3300005364 | Bacteria | 2658 |
| 62 | Ga0070688_100030984 | 3300005365 | Bacteria | 3214 |
| 63 | Ga0070688_100147906 | 3300005365 | Unclassified | 1603 |
| 64 | Ga0070659_100011900 | 3300005366 | Bacteria | 6441 |
| 65 | Ga0070659_100013235 | 3300005366 | Bacteria | 6135 |
| 66 | Ga0070667_100017595 | 3300005367 | Bacteria | 5922 |
| 67 | Ga0070667_100828119 | 3300005367 | Bacteria | 860 |
| 68 | Ga0070709_10000752 | 3300005434 | Bacteria | 18313 |
| 69 | Ga0070709_10026405 | 3300005434 | Bacteria | 3442 |
| 70 | Ga0070709_10059583 | 3300005434 | Bacteria | 2424 |
| 71 | Ga0070709_10084428 | 3300005434 | Bacteria | 2080 |
| 72 | Ga0070709_10109402 | 3300005434 | Bacteria | 1855 |
| 73 | Ga0070709_10167635 | 3300005434 | Bacteria | 1532 |
| 74 | Ga0070709_10240943 | 3300005434 | Bacteria | 1299 |
| 75 | Ga0070709_10259177 | 3300005434 | Unclassified | 1256 |
| 76 | Ga0070709_10279919 | 3300005434 | Bacteria | 1212 |
| 77 | Ga0070709_10280634 | 3300005434 | Bacteria | 1210 |
| 78 | Ga0070709_10409430 | 3300005434 | Bacteria | 1014 |
| 79 | Ga0070709_10830342 | 3300005434 | Unclassified | 727 |
| 80 | Ga0070709_11187308 | 3300005434 | Unclassified | 613 |
| 81 | Ga0070709_11520788 | 3300005434 | Unclassified | 544 |
| 82 | Ga0070714_100000128 | 3300005435 | Bacteria | 59542 |
| 83 | Ga0070714_100003652 | 3300005435 | Bacteria | 11519 |
| 84 | Ga0070714_100100702 | 3300005435 | Bacteria | 2545 |
| 85 | Ga0070714_100271249 | 3300005435 | Bacteria | 1573 |
| 86 | Ga0070714_100549631 | 3300005435 | Unclassified | 1105 |
| 87 | Ga0070714_100573582 | 3300005435 | Unclassified | 1082 |
| 88 | Ga0070714_100604937 | 3300005435 | Bacteria | 1053 |
| 89 | Ga0070714_100728296 | 3300005435 | Bacteria | 958 |
| 90 | Ga0070714_100740984 | 3300005435 | Unclassified | 949 |
| 91 | Ga0070714_100943352 | 3300005435 | Unclassified | 838 |
| 92 | Ga0070714_101027327 | 3300005435 | Unclassified | 802 |
| 93 | Ga0070714_101947373 | 3300005435 | Bacteria | 573 |
| 94 | Ga0070714_102219061 | 3300005435 | Unclassified | 534 |
| 95 | Ga0070713_100000078 | 3300005436 | Bacteria | 60357 |
| 96 | Ga0070713_100000133 | 3300005436 | Bacteria | 48970 |
| 97 | Ga0070713_100078181 | 3300005436 | Unclassified | 2815 |
| 98 | Ga0070713_100080496 | 3300005436 | Bacteria | 2778 |
| 99 | Ga0070713_100101772 | 3300005436 | Bacteria | 2489 |
| 100 | Ga0070713_100127801 | 3300005436 | Bacteria | 2238 |
| 101 | Ga0070713_100145619 | 3300005436 | Bacteria | 2102 |
| 102 | Ga0070713_100147085 | 3300005436 | Unclassified | 2092 |
| 103 | Ga0070713_100314194 | 3300005436 | Unclassified | 1445 |
| 104 | Ga0070713_100392236 | 3300005436 | Bacteria | 1295 |
| 105 | Ga0070713_100585957 | 3300005436 | Bacteria | 1058 |
| 106 | Ga0070710_10004339 | 3300005437 | Bacteria | 6719 |
| 107 | Ga0070710_10008612 | 3300005437 | Bacteria | 4968 |
| 108 | Ga0070710_10018846 | 3300005437 | Unclassified | 3557 |
| 109 | Ga0070710_10036605 | 3300005437 | Bacteria | 2684 |
| 110 | Ga0070710_10063073 | 3300005437 | Unclassified | 2116 |
| 111 | Ga0070710_10177556 | 3300005437 | Bacteria | 1331 |
| 112 | Ga0070710_10449011 | 3300005437 | Bacteria | 874 |
| 113 | Ga0070710_10562122 | 3300005437 | Unclassified | 789 |
| 114 | Ga0070710_10746320 | 3300005437 | Bacteria | 695 |
| 115 | Ga0070710_11352799 | 3300005437 | Unclassified | 531 |
| 116 | Ga0070711_100000189 | 3300005439 | Bacteria | 32578 |
| 117 | Ga0070711_100000517 | 3300005439 | Bacteria | 20051 |
| 118 | Ga0070711_100021434 | 3300005439 | Bacteria | 4179 |
| 119 | Ga0070711_100027778 | 3300005439 | Bacteria | 3717 |
| 120 | Ga0070711_100028299 | 3300005439 | Bacteria | 3687 |
| 121 | Ga0070711_100070816 | 3300005439 | Bacteria | 2456 |
| 122 | Ga0070711_100101824 | 3300005439 | Bacteria | 2091 |
| 123 | Ga0070711_100192634 | 3300005439 | Archaea | 1568 |
| 124 | Ga0070711_100329372 | 3300005439 | Bacteria | 1222 |
| 125 | Ga0070711_100707041 | 3300005439 | Unclassified | 849 |
| 126 | Ga0070711_101120001 | 3300005439 | Unclassified | 679 |
| 127 | Ga0070711_101505264 | 3300005439 | Unclassified | 587 |
| 128 | Ga0070711_101848589 | 3300005439 | Unclassified | 530 |
| 129 | Ga0070705_100139729 | 3300005440 | Bacteria | 1592 |
| 130 | Ga0070705_100537550 | 3300005440 | Bacteria | 894 |
| 131 | Ga0070705_101464647 | 3300005440 | Unclassified | 571 |
| 132 | Ga0070700_101289745 | 3300005441 | Unclassified | 613 |
| 133 | Ga0070700_102002774 | 3300005441 | Unclassified | 502 |
| 134 | Ga0070694_100715056 | 3300005444 | Bacteria | 815 |
| 135 | Ga0070708_100015770 | 3300005445 | Bacteria | 6246 |
| 136 | Ga0070708_100047367 | 3300005445 | Bacteria | 3797 |
| 137 | Ga0070708_100063530 | 3300005445 | Bacteria | 3305 |
| 138 | Ga0070708_100149015 | 3300005445 | Bacteria | 2175 |
| 139 | Ga0070708_100153456 | 3300005445 | Unclassified | 2143 |
| 140 | Ga0070708_100181480 | 3300005445 | Bacteria | 1967 |
| 141 | Ga0070708_101268910 | 3300005445 | Unclassified | 688 |
| 142 | Ga0070708_101869785 | 3300005445 | Unclassified | 557 |
| 143 | Ga0070663_100088468 | 3300005455 | Bacteria | 2290 |
| 144 | Ga0070663_100110977 | 3300005455 | Bacteria | 2060 |
| 145 | Ga0070663_101881138 | 3300005455 | Unclassified | 537 |
| 146 | Ga0070678_100123198 | 3300005456 | Bacteria | 2048 |
| 147 | Ga0070678_100473910 | 3300005456 | Unclassified | 1100 |
| 148 | Ga0070662_100003450 | 3300005457 | Bacteria | 9856 |
| 149 | Ga0070662_100125237 | 3300005457 | Bacteria | 1974 |
| 150 | Ga0070681_10031904 | 3300005458 | Bacteria | 5289 |
| 151 | Ga0070681_10069256 | 3300005458 | Bacteria | 3495 |
| 152 | Ga0070681_10224598 | 3300005458 | Bacteria | 1793 |
| 153 | Ga0070681_10678026 | 3300005458 | Unclassified | 946 |
| 154 | Ga0070681_10945325 | 3300005458 | Bacteria | 781 |
| 155 | Ga0068867_100054635 | 3300005459 | Unclassified | 2950 |
| 156 | Ga0070685_10068999 | 3300005466 | Bacteria | 2089 |
| 157 | Ga0070685_10198125 | 3300005466 | Bacteria | 1304 |
| 158 | Ga0070706_100001770 | 3300005467 | Bacteria | 22364 |
| 159 | Ga0070706_100002201 | 3300005467 | Bacteria | 19839 |
| 160 | Ga0070706_100016311 | 3300005467 | Bacteria | 6863 |
| 161 | Ga0070706_100052308 | 3300005467 | Bacteria | 3770 |
| 162 | Ga0070706_100064806 | 3300005467 | Bacteria | 3378 |
| 163 | Ga0070706_101416023 | 3300005467 | Bacteria | 636 |
| 164 | Ga0070707_100000091 | 3300005468 | Bacteria | 81794 |
| 165 | Ga0070707_100011671 | 3300005468 | Bacteria | 8196 |
| 166 | Ga0070707_100026901 | 3300005468 | Bacteria | 5467 |
| 167 | Ga0070707_100083496 | 3300005468 | Bacteria | 3086 |
| 168 | Ga0070707_100258880 | 3300005468 | Bacteria | 1693 |
| 169 | Ga0070707_100320872 | 3300005468 | Bacteria | 1505 |
| 170 | Ga0070707_100460490 | 3300005468 | Bacteria | 1232 |
| 171 | Ga0070707_100699198 | 3300005468 | Bacteria | 977 |
| 172 | Ga0070707_100771738 | 3300005468 | Unclassified | 925 |
| 173 | Ga0070707_100924642 | 3300005468 | Bacteria | 837 |
| 174 | Ga0070707_101391438 | 3300005468 | Bacteria | 668 |
| 175 | Ga0070707_101563240 | 3300005468 | Bacteria | 626 |
| 176 | Ga0070698_100000027 | 3300005471 | Bacteria | 98052 |
| 177 | Ga0070698_100000226 | 3300005471 | Bacteria | 55431 |
| 178 | Ga0070698_100112749 | 3300005471 | Bacteria | 2684 |
| 179 | Ga0070698_100678324 | 3300005471 | Bacteria | 972 |
| 180 | Ga0070699_100000032 | 3300005518 | Bacteria | 136937 |
| 181 | Ga0070699_100002069 | 3300005518 | Bacteria | 18149 |
| 182 | Ga0070699_100003662 | 3300005518 | Bacteria | 13612 |
| 183 | Ga0070699_100006912 | 3300005518 | Bacteria | 9865 |
| 184 | Ga0070699_100247343 | 3300005518 | Bacteria | 1593 |
| 185 | Ga0070699_100442637 | 3300005518 | Unclassified | 1178 |
| 186 | Ga0070699_100847951 | 3300005518 | Unclassified | 836 |
| 187 | Ga0070699_101213218 | 3300005518 | Unclassified | 692 |
| 188 | Ga0070679_100044249 | 3300005530 | Bacteria | 4435 |
| 189 | Ga0070679_100109442 | 3300005530 | Bacteria | 2749 |
| 190 | Ga0070679_100905130 | 3300005530 | Unclassified | 826 |
| 191 | Ga0070679_101177647 | 3300005530 | Unclassified | 711 |
| 192 | Ga0070679_101178838 | 3300005530 | Bacteria | 711 |
| 193 | Ga0070684_100039308 | 3300005535 | Bacteria | 4068 |
| 194 | Ga0070684_100066892 | 3300005535 | Bacteria | 3155 |
| 195 | Ga0070684_100854368 | 3300005535 | Unclassified | 852 |
| 196 | Ga0070697_100000166 | 3300005536 | Bacteria | 53539 |
| 197 | Ga0070697_100000902 | 3300005536 | Bacteria | 22350 |
| 198 | Ga0070697_100002343 | 3300005536 | Bacteria | 14568 |
| 199 | Ga0070697_100048678 | 3300005536 | Unclassified | 3437 |
| 200 | Ga0070697_100235277 | 3300005536 | Bacteria | 1563 |
| 201 | Ga0070697_100321207 | 3300005536 | Unclassified | 1333 |
| 202 | Ga0070697_100342055 | 3300005536 | Bacteria | 1291 |
| 203 | Ga0070697_100366232 | 3300005536 | Unclassified | 1246 |
| 204 | Ga0068853_100012730 | 3300005539 | Bacteria | 6849 |
| 205 | Ga0068853_100182064 | 3300005539 | Bacteria | 1906 |
| 206 | Ga0070672_100338745 | 3300005543 | Bacteria | 1280 |
| 207 | Ga0070686_100017238 | 3300005544 | Bacteria | 4217 |
| 208 | Ga0070686_100030478 | 3300005544 | Bacteria | 3291 |
| 209 | Ga0070686_100085327 | 3300005544 | Unclassified | 2100 |
| 210 | Ga0070695_100100752 | 3300005545 | Unclassified | 1945 |
| 211 | Ga0070695_100210766 | 3300005545 | Bacteria | 1394 |
| 212 | Ga0070696_100104103 | 3300005546 | Bacteria | 2037 |
| 213 | Ga0070696_100542363 | 3300005546 | Unclassified | 931 |
| 214 | Ga0070696_100732162 | 3300005546 | Bacteria | 809 |
| 215 | Ga0070693_100107977 | 3300005547 | Bacteria | 1707 |
| 216 | Ga0070693_100110100 | 3300005547 | Bacteria | 1693 |
| 217 | Ga0070665_100013996 | 3300005548 | Bacteria | 8068 |
| 218 | Ga0070665_102382087 | 3300005548 | Unclassified | 532 |
| 219 | Ga0070704_100402147 | 3300005549 | Bacteria | 1169 |
| 220 | Ga0068855_100029749 | 3300005563 | Bacteria | 6530 |
| 221 | Ga0068855_100063210 | 3300005563 | Bacteria | 4320 |
| 222 | Ga0070664_100088635 | 3300005564 | Bacteria | 2675 |
| 223 | Ga0070664_100650380 | 3300005564 | Bacteria | 980 |
| 224 | Ga0070664_100765937 | 3300005564 | Bacteria | 901 |
| 225 | Ga0068857_100029312 | 3300005577 | Bacteria | 4856 |
| 226 | Ga0068857_100068768 | 3300005577 | Bacteria | 3152 |
| 227 | Ga0068857_101840300 | 3300005577 | Unclassified | 593 |
| 228 | Ga0068854_100011566 | 3300005578 | Bacteria | 5753 |
| 229 | Ga0068854_100057319 | 3300005578 | Bacteria | 2810 |
| 230 | Ga0068854_100895755 | 3300005578 | Bacteria | 779 |
| 231 | Ga0068854_101139569 | 3300005578 | Unclassified | 696 |
| 232 | Ga0068856_100028207 | 3300005614 | Bacteria | 5480 |
| 233 | Ga0068856_100051815 | 3300005614 | Bacteria | 4046 |
| 234 | Ga0068856_100150978 | 3300005614 | Bacteria | 2332 |
| 235 | Ga0068856_100211765 | 3300005614 | Bacteria | 1953 |
| 236 | Ga0070702_100086640 | 3300005615 | Bacteria | 1890 |
| 237 | Ga0068852_100004955 | 3300005616 | Bacteria | 9460 |
| 238 | Ga0068852_100054381 | 3300005616 | Bacteria | 3450 |
| 239 | Ga0068852_102719078 | 3300005616 | Unclassified | 514 |
| 240 | Ga0068859_100017990 | 3300005617 | Bacteria | 7102 |
| 241 | Ga0068859_100207857 | 3300005617 | Bacteria | 2043 |
| 242 | Ga0068859_102239659 | 3300005617 | Unclassified | 603 |
| 243 | Ga0068864_100109218 | 3300005618 | Bacteria | 2462 |
| 244 | Ga0068864_100195502 | 3300005618 | Bacteria | 1856 |
| 245 | Ga0068864_101977081 | 3300005618 | Unclassified | 589 |
| 246 | Ga0068866_10067230 | 3300005718 | Unclassified | 1880 |
| 247 | Ga0068866_10082174 | 3300005718 | Unclassified | 1732 |
| 248 | Ga0068861_100059708 | 3300005719 | Bacteria | 2921 |
| 249 | Ga0068861_100333469 | 3300005719 | Bacteria | 1325 |
| 250 | Ga0068851_10008145 | 3300005834 | Bacteria | 4839 |
| 251 | Ga0068851_10012378 | 3300005834 | Bacteria | 4020 |
| 252 | Ga0068870_10019594 | 3300005840 | Bacteria | 3283 |
| 253 | Ga0068863_100121543 | 3300005841 | Bacteria | 2491 |
| 254 | Ga0068863_100451812 | 3300005841 | Bacteria | 1261 |
| 255 | Ga0068863_100908603 | 3300005841 | Bacteria | 881 |
| 256 | Ga0068863_101505225 | 3300005841 | Bacteria | 681 |
| 257 | Ga0068858_100092904 | 3300005842 | Bacteria | 2808 |
| 258 | Ga0068858_100150484 | 3300005842 | Bacteria | 2188 |
| 259 | Ga0068858_101240465 | 3300005842 | Unclassified | 733 |
| 260 | Ga0068860_100014669 | 3300005843 | Bacteria | 7667 |
| 261 | Ga0068860_100229000 | 3300005843 | Unclassified | 1806 |
| 262 | Ga0068860_100844126 | 3300005843 | Bacteria | 930 |
| 263 | Ga0068862_100029977 | 3300005844 | Bacteria | 4584 |
| 264 | Ga0068862_100183452 | 3300005844 | Bacteria | 1879 |
| 265 | Ga0068862_101613508 | 3300005844 | Unclassified | 656 |
| 266 | Ga0081540_1084424 | 3300005983 | Bacteria | 1417 |
| 267 | Ga0081540_1091210 | 3300005983 | Bacteria | 1340 |
| 268 | Ga0081540_1156292 | 3300005983 | Bacteria | 892 |
| 269 | Ga0070717_10005218 | 3300006028 | Bacteria | 9466 |
| 270 | Ga0070717_10010950 | 3300006028 | Bacteria | 6868 |
| 271 | Ga0070717_10026950 | 3300006028 | Bacteria | 4590 |
| 272 | Ga0070717_10071635 | 3300006028 | Bacteria | 2892 |
| 273 | Ga0070717_10086417 | 3300006028 | Unclassified | 2640 |
| 274 | Ga0070717_10095308 | 3300006028 | Unclassified | 2519 |
| 275 | Ga0070717_10110467 | 3300006028 | Bacteria | 2345 |
| 276 | Ga0070717_10130139 | 3300006028 | Unclassified | 2164 |
| 277 | Ga0070717_10238559 | 3300006028 | Bacteria | 1602 |
| 278 | Ga0070717_10370925 | 3300006028 | Bacteria | 1282 |
| 279 | Ga0070717_10395501 | 3300006028 | Archaea | 1241 |
| 280 | Ga0070717_10497236 | 3300006028 | Bacteria | 1102 |
| 281 | Ga0070717_10511264 | 3300006028 | Bacteria | 1086 |
| 282 | Ga0070717_10702149 | 3300006028 | Bacteria | 919 |
| 283 | Ga0070717_11273395 | 3300006028 | Bacteria | 669 |
| 284 | Ga0070717_11579976 | 3300006028 | Unclassified | 595 |
| 285 | Ga0070715_10006750 | 3300006163 | Bacteria | 3918 |
| 286 | Ga0070715_10013201 | 3300006163 | Bacteria | 3028 |
| 287 | Ga0070715_10020846 | 3300006163 | Bacteria | 2533 |
| 288 | Ga0070715_10084048 | 3300006163 | Bacteria | 1451 |
| 289 | Ga0070715_10311557 | 3300006163 | Unclassified | 846 |
| 290 | Ga0070715_10423818 | 3300006163 | Unclassified | 745 |
| 291 | Ga0070715_10584465 | 3300006163 | Bacteria | 652 |
| 292 | Ga0070715_10834544 | 3300006163 | Unclassified | 562 |
| 293 | Ga0070716_100000881 | 3300006173 | Bacteria | 12956 |
| 294 | Ga0070716_100006268 | 3300006173 | Bacteria | 5806 |
| 295 | Ga0070716_100011280 | 3300006173 | Unclassified | 4500 |
| 296 | Ga0070716_100084619 | 3300006173 | Unclassified | 1903 |
| 297 | Ga0070716_100145850 | 3300006173 | Bacteria | 1516 |
| 298 | Ga0070716_100188448 | 3300006173 | Bacteria | 1361 |
| 299 | Ga0070716_100188496 | 3300006173 | Unclassified | 1361 |
| 300 | Ga0070716_100268442 | 3300006173 | Bacteria | 1171 |
| 301 | Ga0070716_100304032 | 3300006173 | Bacteria | 1111 |
| 302 | Ga0070716_100308818 | 3300006173 | Bacteria | 1103 |
| 303 | Ga0070716_100596644 | 3300006173 | Bacteria | 830 |
| 304 | Ga0070716_101014513 | 3300006173 | Unclassified | 657 |
| 305 | Ga0070716_101084443 | 3300006173 | Unclassified | 638 |
| 306 | Ga0070712_100000047 | 3300006175 | Bacteria | 65314 |
| 307 | Ga0070712_100000156 | 3300006175 | Bacteria | 36864 |
| 308 | Ga0070712_100000649 | 3300006175 | Bacteria | 20433 |
| 309 | Ga0070712_100001728 | 3300006175 | Bacteria | 13362 |
| 310 | Ga0070712_100046295 | 3300006175 | Unclassified | 3007 |
| 311 | Ga0070712_100328358 | 3300006175 | Bacteria | 1246 |
| 312 | Ga0070712_100359344 | 3300006175 | Bacteria | 1194 |
| 313 | Ga0070712_100390079 | 3300006175 | Unclassified | 1148 |
| 314 | Ga0070712_100506173 | 3300006175 | Bacteria | 1013 |
| 315 | Ga0070712_100534253 | 3300006175 | Bacteria | 986 |
| 316 | Ga0070712_101065742 | 3300006175 | Unclassified | 701 |
| 317 | Ga0097621_100012031 | 3300006237 | Bacteria | 6402 |
| 318 | Ga0097621_100060568 | 3300006237 | Unclassified | 3103 |
| 319 | Ga0097621_100137826 | 3300006237 | Bacteria | 2083 |
| 320 | Ga0097621_100209749 | 3300006237 | Bacteria | 1694 |
| 321 | Ga0097621_100367318 | 3300006237 | Unclassified | 1283 |
| 322 | Ga0097621_100805015 | 3300006237 | Bacteria | 871 |
| 323 | Ga0097621_101002169 | 3300006237 | Unclassified | 781 |
| 324 | Ga0068871_100015762 | 3300006358 | Bacteria | 5670 |
| 325 | Ga0068871_100170472 | 3300006358 | Bacteria | 1865 |
| 326 | Ga0068871_100245901 | 3300006358 | Bacteria | 1557 |
| 327 | Ga0068871_101749361 | 3300006358 | Unclassified | 590 |
| 328 | Ga0075433_10000203 | 3300006852 | Bacteria | 33282 |
| 329 | Ga0075433_10174181 | 3300006852 | Bacteria | 1914 |
| 330 | Ga0075434_100000016 | 3300006871 | Bacteria | 75294 |
| 331 | Ga0075434_100001747 | 3300006871 | Bacteria | 18672 |
| 332 | Ga0075434_100775620 | 3300006871 | Unclassified | 975 |
| 333 | Ga0075434_100923064 | 3300006871 | Bacteria | 888 |
| 334 | Ga0075434_102176069 | 3300006871 | Bacteria | 559 |
| 335 | Ga0068865_100048226 | 3300006881 | Bacteria | 2930 |
| 336 | Ga0075436_100002204 | 3300006914 | Bacteria | 13447 |
| 337 | Ga0075436_100101665 | 3300006914 | Unclassified | 2002 |
| 338 | Ga0075436_100710867 | 3300006914 | Bacteria | 745 |
| 339 | Ga0097620_100017990 | 3300006931 | Bacteria | 7102 |
| 340 | Ga0097620_100207853 | 3300006931 | Bacteria | 2043 |
| 341 | Ga0097620_102239811 | 3300006931 | Unclassified | 603 |
| 342 | Ga0075435_100000173 | 3300007076 | Bacteria | 37964 |
| 343 | Ga0075435_100035103 | 3300007076 | Bacteria | 3978 |
| 344 | Ga0075435_100111091 | 3300007076 | Bacteria | 2280 |
| 345 | Ga0075435_100217729 | 3300007076 | Bacteria | 1621 |
| 346 | Ga0075435_101220917 | 3300007076 | Unclassified | 658 |
| 347 | Ga0099794_10093523 | 3300007265 | Bacteria | 1494 |
| 348 | Ga0099794_10235581 | 3300007265 | Unclassified | 942 |
| 349 | Ga0099794_10269852 | 3300007265 | Bacteria | 879 |
| 350 | Ga0099794_10620459 | 3300007265 | Unclassified | 573 |
| 351 | Ga0099795_10006741 | 3300007788 | Bacteria | 3152 |
| 352 | Ga0099795_10180885 | 3300007788 | Unclassified | 880 |
| 353 | Ga0105250_10071717 | 3300009092 | Bacteria | 1399 |
| 354 | Ga0105250_10307856 | 3300009092 | Bacteria | 686 |
| 355 | Ga0105240_10037841 | 3300009093 | Bacteria | 6196 |
| 356 | Ga0105240_10071887 | 3300009093 | Bacteria | 4277 |
| 357 | Ga0105240_10146767 | 3300009093 | Bacteria | 2814 |
| 358 | Ga0105240_10151677 | 3300009093 | Bacteria | 2760 |
| 359 | Ga0105240_12634126 | 3300009093 | Unclassified | 519 |
| 360 | Ga0111539_11457666 | 3300009094 | Unclassified | 794 |
| 361 | Ga0105245_10023080 | 3300009098 | Bacteria | 5460 |
| 362 | Ga0105245_10030677 | 3300009098 | Bacteria | 4755 |
| 363 | Ga0105245_10149993 | 3300009098 | Bacteria | 2204 |
| 364 | Ga0105245_10417509 | 3300009098 | Bacteria | 1344 |
| 365 | Ga0105247_10017833 | 3300009101 | Bacteria | 4257 |
| 366 | Ga0105247_10104225 | 3300009101 | Bacteria | 1817 |
| 367 | Ga0105247_10404589 | 3300009101 | Bacteria | 973 |
| 368 | Ga0105247_10547382 | 3300009101 | Unclassified | 850 |
| 369 | Ga0105247_10932564 | 3300009101 | Bacteria | 673 |
| 370 | Ga0114129_10286706 | 3300009147 | Bacteria | 2198 |
| 371 | Ga0114129_13438347 | 3300009147 | Unclassified | 508 |
| 372 | Ga0105243_10008143 | 3300009148 | Bacteria | 8049 |
| 373 | Ga0105241_10063812 | 3300009174 | Bacteria | 2843 |
| 374 | Ga0105241_10138828 | 3300009174 | Bacteria | 1977 |
| 375 | Ga0105241_10152210 | 3300009174 | Bacteria | 1893 |
| 376 | Ga0105241_10319013 | 3300009174 | Unclassified | 1339 |
| 377 | Ga0105241_11536629 | 3300009174 | Unclassified | 642 |
| 378 | Ga0105242_10009635 | 3300009176 | Bacteria | 7402 |
| 379 | Ga0105242_11269840 | 3300009176 | Unclassified | 759 |
| 380 | Ga0105242_13103109 | 3300009176 | Unclassified | 515 |
| 381 | Ga0105248_10004294 | 3300009177 | Bacteria | 15771 |
| 382 | Ga0105248_10117024 | 3300009177 | Unclassified | 3006 |
| 383 | Ga0105248_10129281 | 3300009177 | Bacteria | 2849 |
| 384 | Ga0105248_10339967 | 3300009177 | Bacteria | 1690 |
| 385 | Ga0105237_10029573 | 3300009545 | Bacteria | 5567 |
| 386 | Ga0105237_10101265 | 3300009545 | Bacteria | 2873 |
| 387 | Ga0105237_10144905 | 3300009545 | Unclassified | 2370 |
| 388 | Ga0105237_10188217 | 3300009545 | Bacteria | 2064 |
| 389 | Ga0105237_10461130 | 3300009545 | Bacteria | 1277 |
| 390 | Ga0105237_12360198 | 3300009545 | Unclassified | 542 |
| 391 | Ga0105237_12532673 | 3300009545 | Unclassified | 523 |
| 392 | Ga0105238_10052183 | 3300009551 | Bacteria | 4111 |
| 393 | Ga0105238_10235410 | 3300009551 | Bacteria | 1808 |
| 394 | Ga0105238_11116841 | 3300009551 | Unclassified | 811 |
| 395 | Ga0105249_10090658 | 3300009553 | Bacteria | 2858 |
| 396 | Ga0105249_10107384 | 3300009553 | Bacteria | 2634 |
| 397 | Ga0105249_10147805 | 3300009553 | Unclassified | 2259 |
| 398 | Ga0099796_10020949 | 3300010159 | Bacteria | 2006 |
| 399 | Ga0099796_10079919 | 3300010159 | Bacteria | 1197 |
| 400 | Ga0099796_10084822 | 3300010159 | Bacteria | 1168 |
| 401 | Ga0099796_10344619 | 3300010159 | Unclassified | 641 |
| 402 | Ga0105239_10014054 | 3300010375 | Bacteria | 8887 |
| 403 | Ga0105239_12021631 | 3300010375 | Unclassified | 669 |
| 404 | Ga0105246_10006433 | 3300011119 | Bacteria | 7178 |
| 405 | Ga0105246_10072271 | 3300011119 | Unclassified | 2432 |
| 406 | Ga0105246_10460634 | 3300011119 | Unclassified | 1071 |
| 407 | Ga0157325_1023642 | 3300012485 | Unclassified | 568 |
| 408 | Ga0157373_10001333 | 3300013100 | Bacteria | 18897 |
| 409 | Ga0157373_11535892 | 3300013100 | Unclassified | 509 |
| 410 | Ga0157371_10007438 | 3300013102 | Bacteria | 8868 |
| 411 | Ga0157371_10022254 | 3300013102 | Bacteria | 4648 |
| 412 | Ga0157370_10150403 | 3300013104 | Unclassified | 2166 |
| 413 | Ga0157370_10373164 | 3300013104 | Unclassified | 1314 |
| 414 | Ga0157369_10048322 | 3300013105 | Bacteria | 4617 |
| 415 | Ga0157369_10221669 | 3300013105 | Bacteria | 1980 |
| 416 | Ga0157374_10002103 | 3300013296 | Bacteria | 16740 |
| 417 | Ga0157374_10014783 | 3300013296 | Bacteria | 6835 |
| 418 | Ga0157374_10369244 | 3300013296 | Bacteria | 1428 |
| 419 | Ga0157374_12848252 | 3300013296 | Unclassified | 511 |
| 420 | Ga0157378_10119785 | 3300013297 | Unclassified | 2424 |
| 421 | Ga0157378_10244259 | 3300013297 | Unclassified | 1716 |
| 422 | Ga0157378_10298489 | 3300013297 | Unclassified | 1558 |
| 423 | Ga0157378_11795408 | 3300013297 | Unclassified | 661 |
| 424 | Ga0157378_12046670 | 3300013297 | Unclassified | 623 |
| 425 | Ga0157378_12351309 | 3300013297 | Bacteria | 585 |
| 426 | Ga0163162_10013430 | 3300013306 | Bacteria | 7994 |
| 427 | Ga0163162_10057046 | 3300013306 | Unclassified | 3933 |
| 428 | Ga0163162_10067390 | 3300013306 | Bacteria | 3630 |
| 429 | Ga0163162_10412528 | 3300013306 | Bacteria | 1483 |
| 430 | Ga0157372_10013384 | 3300013307 | Bacteria | 8758 |
| 431 | Ga0157372_10014532 | 3300013307 | Bacteria | 8425 |
| 432 | Ga0157372_10020193 | 3300013307 | Bacteria | 7183 |
| 433 | Ga0157372_10431276 | 3300013307 | Bacteria | 1536 |
| 434 | Ga0157372_11680122 | 3300013307 | Unclassified | 731 |
| 435 | Ga0157375_10069523 | 3300013308 | Bacteria | 3528 |
| 436 | Ga0157375_10827844 | 3300013308 | Bacteria | 1073 |
| 437 | Ga0163163_10012687 | 3300014325 | Bacteria | 7686 |
| 438 | Ga0163163_10028596 | 3300014325 | Bacteria | 5356 |
| 439 | Ga0163163_10398171 | 3300014325 | Bacteria | 1435 |
| 440 | Ga0163163_10875057 | 3300014325 | Bacteria | 962 |
| 441 | Ga0157380_10117385 | 3300014326 | Bacteria | 2247 |
| 442 | Ga0182008_10029883 | 3300014497 | Bacteria | 2750 |
| 443 | Ga0157377_10010559 | 3300014745 | Bacteria | 4571 |
| 444 | Ga0157379_10003230 | 3300014968 | Bacteria | 13811 |
| 445 | Ga0157379_10042368 | 3300014968 | Bacteria | 4064 |
| 446 | Ga0157379_10057309 | 3300014968 | Bacteria | 3482 |
| 447 | Ga0157379_10331916 | 3300014968 | Unclassified | 1390 |
| 448 | Ga0157376_10019022 | 3300014969 | Bacteria | 5283 |
| 449 | Ga0157376_10033236 | 3300014969 | Bacteria | 4150 |
| 450 | Ga0157376_10699902 | 3300014969 | Unclassified | 1018 |
| 451 | Ga0157376_12502725 | 3300014969 | Bacteria | 556 |
| 452 | Ga0182006_1047945 | 3300015261 | Bacteria | 1654 |
| 453 | Ga0182007_10132730 | 3300015262 | Unclassified | 838 |
| 454 | Ga0182005_1084277 | 3300015265 | Unclassified | 880 |
| 455 | Ga0163161_10003472 | 3300017792 | Bacteria | 11047 |
| 456 | Ga0213873_10014330 | 3300021358 | Bacteria | 1755 |
| 457 | Ga0224569_104280 | 3300022732 | Bacteria | 1086 |
| 458 | Ga0224571_101031 | 3300022734 | Bacteria | 1692 |
| 459 | Ga0224572_1012871 | 3300024225 | Bacteria | 1594 |
| 460 | Ga0224572_1050267 | 3300024225 | Unclassified | 777 |
| 461 | Ga0228598_1002428 | 3300024227 | Bacteria | 4069 |
| 462 | Ga0228598_1014444 | 3300024227 | Bacteria | 1562 |
| 463 | Ga0228598_1033115 | 3300024227 | Bacteria | 1018 |
| 464 | Ga0207697_10005682 | 3300025315 | Bacteria | 5755 |
| 465 | Ga0207656_10001681 | 3300025321 | Bacteria | 7348 |
| 466 | Ga0207656_10032949 | 3300025321 | Bacteria | 2155 |
| 467 | Ga0207696_1112319 | 3300025711 | Bacteria | 738 |
| 468 | Ga0207696_1183839 | 3300025711 | Unclassified | 552 |
| 469 | Ga0207682_10091582 | 3300025893 | Unclassified | 1319 |
| 470 | Ga0207692_10008567 | 3300025898 | Bacteria | 4238 |
| 471 | Ga0207692_10013176 | 3300025898 | Unclassified | 3580 |
| 472 | Ga0207692_10083891 | 3300025898 | Bacteria | 1711 |
| 473 | Ga0207692_10092337 | 3300025898 | Bacteria | 1644 |
| 474 | Ga0207692_10516941 | 3300025898 | Bacteria | 759 |
| 475 | Ga0207692_10517462 | 3300025898 | Unclassified | 759 |
| 476 | Ga0207692_10561048 | 3300025898 | Bacteria | 731 |
| 477 | Ga0207642_10014209 | 3300025899 | Bacteria | 2931 |
| 478 | Ga0207642_10018561 | 3300025899 | Bacteria | 2673 |
| 479 | Ga0207642_10915337 | 3300025899 | Unclassified | 562 |
| 480 | Ga0207710_10030416 | 3300025900 | Unclassified | 2356 |
| 481 | Ga0207710_10046728 | 3300025900 | Bacteria | 1933 |
| 482 | Ga0207710_10148325 | 3300025900 | Bacteria | 1136 |
| 483 | Ga0207710_10383881 | 3300025900 | Unclassified | 719 |
| 484 | Ga0207688_10026648 | 3300025901 | Unclassified | 3180 |
| 485 | Ga0207680_10011553 | 3300025903 | Bacteria | 4466 |
| 486 | Ga0207680_10063583 | 3300025903 | Unclassified | 2259 |
| 487 | Ga0207647_10037541 | 3300025904 | Bacteria | 3071 |
| 488 | Ga0207647_10093744 | 3300025904 | Bacteria | 1789 |
| 489 | Ga0207685_10011500 | 3300025905 | Bacteria | 2662 |
| 490 | Ga0207685_10021033 | 3300025905 | Bacteria | 2179 |
| 491 | Ga0207685_10036902 | 3300025905 | Bacteria | 1795 |
| 492 | Ga0207685_10145109 | 3300025905 | Unclassified | 1068 |
| 493 | Ga0207685_10316401 | 3300025905 | Unclassified | 777 |
| 494 | Ga0207699_10019860 | 3300025906 | Bacteria | 3592 |
| 495 | Ga0207699_10142458 | 3300025906 | Bacteria | 1577 |
| 496 | Ga0207699_10165923 | 3300025906 | Bacteria | 1474 |
| 497 | Ga0207699_10216972 | 3300025906 | Bacteria | 1304 |
| 498 | Ga0207699_10273896 | 3300025906 | Bacteria | 1171 |
| 499 | Ga0207699_10311664 | 3300025906 | Unclassified | 1101 |
| 500 | Ga0207699_10320229 | 3300025906 | Bacteria | 1087 |
| 501 | Ga0207699_10449664 | 3300025906 | Unclassified | 924 |
| 502 | Ga0207699_10454268 | 3300025906 | Unclassified | 919 |
| 503 | Ga0207699_10557740 | 3300025906 | Bacteria | 831 |
| 504 | Ga0207699_10597405 | 3300025906 | Bacteria | 803 |
| 505 | Ga0207699_10696845 | 3300025906 | Unclassified | 743 |
| 506 | Ga0207699_11065101 | 3300025906 | Bacteria | 598 |
| 507 | Ga0207699_11122367 | 3300025906 | Unclassified | 582 |
| 508 | Ga0207699_11178849 | 3300025906 | Unclassified | 567 |
| 509 | Ga0207645_10000021 | 3300025907 | Bacteria | 104186 |
| 510 | Ga0207645_10004345 | 3300025907 | Bacteria | 10499 |
| 511 | Ga0207643_10007444 | 3300025908 | Bacteria | 5874 |
| 512 | Ga0207643_10436204 | 3300025908 | Unclassified | 832 |
| 513 | Ga0207705_10594852 | 3300025909 | Bacteria | 860 |
| 514 | Ga0207684_10000238 | 3300025910 | Bacteria | 83165 |
| 515 | Ga0207684_10001028 | 3300025910 | Bacteria | 31287 |
| 516 | Ga0207684_10002047 | 3300025910 | Bacteria | 20752 |
| 517 | Ga0207684_10057239 | 3300025910 | Bacteria | 3307 |
| 518 | Ga0207684_10244115 | 3300025910 | Bacteria | 1549 |
| 519 | Ga0207684_10247668 | 3300025910 | Bacteria | 1537 |
| 520 | Ga0207654_10042939 | 3300025911 | Bacteria | 2561 |
| 521 | Ga0207654_10179570 | 3300025911 | Bacteria | 1380 |
| 522 | Ga0207654_10722339 | 3300025911 | Bacteria | 716 |
| 523 | Ga0207654_11054510 | 3300025911 | Unclassified | 592 |
| 524 | Ga0207707_10016277 | 3300025912 | Bacteria | 6487 |
| 525 | Ga0207707_10055851 | 3300025912 | Bacteria | 3435 |
| 526 | Ga0207707_10447399 | 3300025912 | Bacteria | 1106 |
| 527 | Ga0207707_10754267 | 3300025912 | Unclassified | 814 |
| 528 | Ga0207695_10007368 | 3300025913 | Bacteria | 14040 |
| 529 | Ga0207695_10016928 | 3300025913 | Bacteria | 8506 |
| 530 | Ga0207695_10318637 | 3300025913 | Bacteria | 1444 |
| 531 | Ga0207695_10389091 | 3300025913 | Unclassified | 1279 |
| 532 | Ga0207695_10470820 | 3300025913 | Unclassified | 1139 |
| 533 | Ga0207695_10749349 | 3300025913 | Bacteria | 857 |
| 534 | Ga0207695_10881542 | 3300025913 | Bacteria | 774 |
| 535 | Ga0207671_10064944 | 3300025914 | Bacteria | 2714 |
| 536 | Ga0207671_10938039 | 3300025914 | Unclassified | 683 |
| 537 | Ga0207671_11169156 | 3300025914 | Unclassified | 603 |
| 538 | Ga0207671_11264466 | 3300025914 | Bacteria | 576 |
| 539 | Ga0207693_10000044 | 3300025915 | Bacteria | 103362 |
| 540 | Ga0207693_10000097 | 3300025915 | Bacteria | 77565 |
| 541 | Ga0207693_10000546 | 3300025915 | Bacteria | 34039 |
| 542 | Ga0207693_10006025 | 3300025915 | Bacteria | 10050 |
| 543 | Ga0207693_10066246 | 3300025915 | Bacteria | 2828 |
| 544 | Ga0207693_10113772 | 3300025915 | Bacteria | 2123 |
| 545 | Ga0207693_10116175 | 3300025915 | Bacteria | 2101 |
| 546 | Ga0207693_10137353 | 3300025915 | Bacteria | 1922 |
| 547 | Ga0207693_10366040 | 3300025915 | Bacteria | 1128 |
| 548 | Ga0207693_10539978 | 3300025915 | Bacteria | 909 |
| 549 | Ga0207693_10869690 | 3300025915 | Bacteria | 692 |
| 550 | Ga0207663_10000276 | 3300025916 | Bacteria | 22338 |
| 551 | Ga0207663_10001127 | 3300025916 | Bacteria | 12306 |
| 552 | Ga0207663_10030227 | 3300025916 | Bacteria | 3193 |
| 553 | Ga0207663_10096029 | 3300025916 | Bacteria | 1979 |
| 554 | Ga0207663_10123387 | 3300025916 | Bacteria | 1777 |
| 555 | Ga0207663_10132697 | 3300025916 | Bacteria | 1723 |
| 556 | Ga0207663_10234390 | 3300025916 | Bacteria | 1343 |
| 557 | Ga0207663_10386717 | 3300025916 | Archaea | 1067 |
| 558 | Ga0207663_10389470 | 3300025916 | Unclassified | 1063 |
| 559 | Ga0207663_10688931 | 3300025916 | Bacteria | 808 |
| 560 | Ga0207663_10740562 | 3300025916 | Bacteria | 780 |
| 561 | Ga0207663_11058094 | 3300025916 | Bacteria | 652 |
| 562 | Ga0207663_11422740 | 3300025916 | Unclassified | 558 |
| 563 | Ga0207663_11600215 | 3300025916 | Unclassified | 524 |
| 564 | Ga0207660_10362344 | 3300025917 | Bacteria | 1163 |
| 565 | Ga0207660_10819818 | 3300025917 | Unclassified | 759 |
| 566 | Ga0207662_10015324 | 3300025918 | Bacteria | 4314 |
| 567 | Ga0207657_10001918 | 3300025919 | Bacteria | 22449 |
| 568 | Ga0207657_10004787 | 3300025919 | Bacteria | 14280 |
| 569 | Ga0207649_10000836 | 3300025920 | Bacteria | 19838 |
| 570 | Ga0207649_10132580 | 3300025920 | Bacteria | 1695 |
| 571 | Ga0207652_10024152 | 3300025921 | Bacteria | 5042 |
| 572 | Ga0207652_10146421 | 3300025921 | Bacteria | 2114 |
| 573 | Ga0207646_10000073 | 3300025922 | Bacteria | 140267 |
| 574 | Ga0207646_10001530 | 3300025922 | Bacteria | 28310 |
| 575 | Ga0207646_10096540 | 3300025922 | Bacteria | 2648 |
| 576 | Ga0207646_10182814 | 3300025922 | Unclassified | 1894 |
| 577 | Ga0207646_10513541 | 3300025922 | Bacteria | 1079 |
| 578 | Ga0207646_11188135 | 3300025922 | Unclassified | 669 |
| 579 | Ga0207646_11292698 | 3300025922 | Bacteria | 637 |
| 580 | Ga0207646_11449621 | 3300025922 | Bacteria | 596 |
| 581 | Ga0207646_11506863 | 3300025922 | Unclassified | 582 |
| 582 | Ga0207681_10035914 | 3300025923 | Bacteria | 3267 |
| 583 | Ga0207681_10774621 | 3300025923 | Bacteria | 800 |
| 584 | Ga0207694_10162801 | 3300025924 | Bacteria | 1803 |
| 585 | Ga0207694_10239595 | 3300025924 | Bacteria | 1482 |
| 586 | Ga0207694_10643205 | 3300025924 | Unclassified | 893 |
| 587 | Ga0207650_10000097 | 3300025925 | Bacteria | 115583 |
| 588 | Ga0207650_10216033 | 3300025925 | Unclassified | 1541 |
| 589 | Ga0207650_11646433 | 3300025925 | Unclassified | 544 |
| 590 | Ga0207659_10555648 | 3300025926 | Bacteria | 976 |
| 591 | Ga0207659_11668407 | 3300025926 | Bacteria | 543 |
| 592 | Ga0207687_10018851 | 3300025927 | Unclassified | 4562 |
| 593 | Ga0207687_10075610 | 3300025927 | Bacteria | 2418 |
| 594 | Ga0207687_10163917 | 3300025927 | Unclassified | 1708 |
| 595 | Ga0207687_11213842 | 3300025927 | Bacteria | 648 |
| 596 | Ga0207700_10000227 | 3300025928 | Bacteria | 33670 |
| 597 | Ga0207700_10002357 | 3300025928 | Bacteria | 10847 |
| 598 | Ga0207700_10033743 | 3300025928 | Bacteria | 3665 |
| 599 | Ga0207700_10044086 | 3300025928 | Bacteria | 3281 |
| 600 | Ga0207700_10148298 | 3300025928 | Bacteria | 1936 |
| 601 | Ga0207700_10155263 | 3300025928 | Bacteria | 1896 |
| 602 | Ga0207700_10270357 | 3300025928 | Bacteria | 1459 |
| 603 | Ga0207700_10295320 | 3300025928 | Bacteria | 1398 |
| 604 | Ga0207700_10401378 | 3300025928 | Bacteria | 1201 |
| 605 | Ga0207700_10406850 | 3300025928 | Bacteria | 1193 |
| 606 | Ga0207700_10444398 | 3300025928 | Bacteria | 1142 |
| 607 | Ga0207700_10706066 | 3300025928 | Bacteria | 900 |
| 608 | Ga0207700_10866673 | 3300025928 | Bacteria | 808 |
| 609 | Ga0207700_11449954 | 3300025928 | Unclassified | 610 |
| 610 | Ga0207700_11521598 | 3300025928 | Unclassified | 593 |
| 611 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 612 | Ga0207664_10008409 | 3300025929 | Bacteria | 7196 |
| 613 | Ga0207664_10027738 | 3300025929 | Bacteria | 4298 |
| 614 | Ga0207664_10064432 | 3300025929 | Bacteria | 2931 |
| 615 | Ga0207664_10138671 | 3300025929 | Bacteria | 2055 |
| 616 | Ga0207664_10319773 | 3300025929 | Bacteria | 1369 |
| 617 | Ga0207664_10485846 | 3300025929 | Unclassified | 1105 |
| 618 | Ga0207664_10642628 | 3300025929 | Bacteria | 953 |
| 619 | Ga0207664_10684730 | 3300025929 | Unclassified | 922 |
| 620 | Ga0207664_10819453 | 3300025929 | Unclassified | 837 |
| 621 | Ga0207664_11031224 | 3300025929 | Bacteria | 737 |
| 622 | Ga0207664_11069052 | 3300025929 | Unclassified | 722 |
| 623 | Ga0207664_11408966 | 3300025929 | Unclassified | 618 |
| 624 | Ga0207664_11443092 | 3300025929 | Unclassified | 609 |
| 625 | Ga0207644_10091967 | 3300025931 | Bacteria | 2262 |
| 626 | Ga0207690_10059602 | 3300025932 | Bacteria | 2587 |
| 627 | Ga0207706_10000048 | 3300025933 | Bacteria | 117454 |
| 628 | Ga0207706_10004287 | 3300025933 | Bacteria | 13405 |
| 629 | Ga0207686_10200339 | 3300025934 | Bacteria | 1429 |
| 630 | Ga0207709_10014364 | 3300025935 | Bacteria | 4371 |
| 631 | Ga0207670_10372013 | 3300025936 | Bacteria | 1136 |
| 632 | Ga0207669_10277933 | 3300025937 | Unclassified | 1261 |
| 633 | Ga0207669_11016033 | 3300025937 | Bacteria | 697 |
| 634 | Ga0207704_10009462 | 3300025938 | Bacteria | 4703 |
| 635 | Ga0207704_10040610 | 3300025938 | Bacteria | 2721 |
| 636 | Ga0207665_10000326 | 3300025939 | Bacteria | 32993 |
| 637 | Ga0207665_10001590 | 3300025939 | Bacteria | 15301 |
| 638 | Ga0207665_10007003 | 3300025939 | Bacteria | 7464 |
| 639 | Ga0207665_10042800 | 3300025939 | Bacteria | 3027 |
| 640 | Ga0207665_10048543 | 3300025939 | Bacteria | 2850 |
| 641 | Ga0207665_10057230 | 3300025939 | Bacteria | 2633 |
| 642 | Ga0207665_10122612 | 3300025939 | Bacteria | 1837 |
| 643 | Ga0207665_10126324 | 3300025939 | Unclassified | 1811 |
| 644 | Ga0207665_10232142 | 3300025939 | Bacteria | 1356 |
| 645 | Ga0207665_10392708 | 3300025939 | Bacteria | 1055 |
| 646 | Ga0207665_10537036 | 3300025939 | Unclassified | 907 |
| 647 | Ga0207665_10554499 | 3300025939 | Unclassified | 893 |
| 648 | Ga0207665_10626121 | 3300025939 | Unclassified | 842 |
| 649 | Ga0207665_10655792 | 3300025939 | Unclassified | 823 |
| 650 | Ga0207665_11527637 | 3300025939 | Unclassified | 530 |
| 651 | Ga0207665_11568423 | 3300025939 | Unclassified | 522 |
| 652 | Ga0207691_10000721 | 3300025940 | Bacteria | 32643 |
| 653 | Ga0207711_10002079 | 3300025941 | Bacteria | 18085 |
| 654 | Ga0207711_10058222 | 3300025941 | Bacteria | 3324 |
| 655 | Ga0207711_11551166 | 3300025941 | Unclassified | 605 |
| 656 | Ga0207689_10010374 | 3300025942 | Bacteria | 8028 |
| 657 | Ga0207689_10041384 | 3300025942 | Bacteria | 3812 |
| 658 | Ga0207689_10078781 | 3300025942 | Unclassified | 2708 |
| 659 | Ga0207689_11135203 | 3300025942 | Bacteria | 658 |
| 660 | Ga0207661_10001148 | 3300025944 | Bacteria | 17682 |
| 661 | Ga0207661_10063706 | 3300025944 | Bacteria | 2987 |
| 662 | Ga0207661_11914218 | 3300025944 | Unclassified | 539 |
| 663 | Ga0207679_10003643 | 3300025945 | Bacteria | 9546 |
| 664 | Ga0207679_10202739 | 3300025945 | Bacteria | 1658 |
| 665 | Ga0207679_11096265 | 3300025945 | Unclassified | 730 |
| 666 | Ga0207667_10004050 | 3300025949 | Bacteria | 18001 |
| 667 | Ga0207667_10135994 | 3300025949 | Bacteria | 2531 |
| 668 | Ga0207651_10065812 | 3300025960 | Bacteria | 2543 |
| 669 | Ga0207712_10007284 | 3300025961 | Bacteria | 6977 |
| 670 | Ga0207712_10036002 | 3300025961 | Unclassified | 3368 |
| 671 | Ga0207712_10823536 | 3300025961 | Unclassified | 817 |
| 672 | Ga0207668_10052806 | 3300025972 | Bacteria | 2813 |
| 673 | Ga0207668_11328446 | 3300025972 | Unclassified | 647 |
| 674 | Ga0207640_10002588 | 3300025981 | Bacteria | 9689 |
| 675 | Ga0207640_10511208 | 3300025981 | Unclassified | 1002 |
| 676 | Ga0207640_10728350 | 3300025981 | Bacteria | 853 |
| 677 | Ga0207658_10065657 | 3300025986 | Bacteria | 2726 |
| 678 | Ga0207658_10080617 | 3300025986 | Bacteria | 2493 |
| 679 | Ga0207677_10234952 | 3300026023 | Bacteria | 1479 |
| 680 | Ga0207677_10288090 | 3300026023 | Bacteria | 1351 |
| 681 | Ga0207677_10467629 | 3300026023 | Bacteria | 1084 |
| 682 | Ga0207703_10093417 | 3300026035 | Bacteria | 2533 |
| 683 | Ga0207703_11029506 | 3300026035 | Bacteria | 790 |
| 684 | Ga0207703_11163802 | 3300026035 | Unclassified | 741 |
| 685 | Ga0207639_10063533 | 3300026041 | Bacteria | 2859 |
| 686 | Ga0207639_10251123 | 3300026041 | Unclassified | 1542 |
| 687 | Ga0207678_10000388 | 3300026067 | Bacteria | 40020 |
| 688 | Ga0207678_10002928 | 3300026067 | Bacteria | 15472 |
| 689 | Ga0207678_10306755 | 3300026067 | Unclassified | 1364 |
| 690 | Ga0207708_10233545 | 3300026075 | Bacteria | 1477 |
| 691 | Ga0207702_10026929 | 3300026078 | Bacteria | 4774 |
| 692 | Ga0207702_10098919 | 3300026078 | Bacteria | 2570 |
| 693 | Ga0207702_10338684 | 3300026078 | Bacteria | 1436 |
| 694 | Ga0207702_11033687 | 3300026078 | Bacteria | 815 |
| 695 | Ga0207641_10000183 | 3300026088 | Bacteria | 87085 |
| 696 | Ga0207641_10065899 | 3300026088 | Bacteria | 3099 |
| 697 | Ga0207641_10076011 | 3300026088 | Bacteria | 2902 |
| 698 | Ga0207641_10980716 | 3300026088 | Bacteria | 841 |
| 699 | Ga0207648_10000063 | 3300026089 | Bacteria | 99270 |
| 700 | Ga0207648_10099896 | 3300026089 | Bacteria | 2541 |
| 701 | Ga0207676_10000536 | 3300026095 | Bacteria | 31866 |
| 702 | Ga0207676_10772830 | 3300026095 | Bacteria | 935 |
| 703 | Ga0207674_10001582 | 3300026116 | Bacteria | 29319 |
| 704 | Ga0207674_10249442 | 3300026116 | Bacteria | 1722 |
| 705 | Ga0207675_100013698 | 3300026118 | Bacteria | 7569 |
| 706 | Ga0207675_100147440 | 3300026118 | Bacteria | 2238 |
| 707 | Ga0207683_10003861 | 3300026121 | Bacteria | 13007 |
| 708 | Ga0207683_10119691 | 3300026121 | Unclassified | 2363 |
| 709 | Ga0207698_10039524 | 3300026142 | Bacteria | 3496 |
| 710 | Ga0207698_10572119 | 3300026142 | Bacteria | 1110 |
| 711 | Ga0209179_1032941 | 3300027512 | Bacteria | 1069 |
| 712 | Ga0209588_1058833 | 3300027671 | Bacteria | 1242 |
| 713 | Ga0209974_10352875 | 3300027876 | Unclassified | 571 |
| 714 | Ga0265354_1012680 | 3300028016 | Unclassified | 799 |
| 715 | Ga0265354_1017113 | 3300028016 | Unclassified | 687 |
| 716 | Ga0265356_1000009 | 3300028017 | Bacteria | 31596 |
| 717 | Ga0265356_1003264 | 3300028017 | Bacteria | 2064 |
| 718 | Ga0265356_1006394 | 3300028017 | Unclassified | 1378 |
| 719 | Ga0265355_1001124 | 3300028036 | Bacteria | 1659 |
| 720 | Ga0265355_1009222 | 3300028036 | Unclassified | 797 |
| 721 | Ga0268266_10008112 | 3300028379 | Bacteria | 9376 |
| 722 | Ga0268266_10078715 | 3300028379 | Bacteria | 2869 |
| 723 | Ga0268266_10553817 | 3300028379 | Unclassified | 1102 |
| 724 | Ga0268266_12051644 | 3300028379 | Unclassified | 545 |
| 725 | Ga0268265_10012882 | 3300028380 | Bacteria | 5675 |
| 726 | Ga0268265_10130047 | 3300028380 | Bacteria | 2090 |
| 727 | Ga0268264_10039167 | 3300028381 | Bacteria | 3916 |
| 728 | Ga0268264_10060775 | 3300028381 | Bacteria | 3167 |
| 729 | Ga0268264_10706010 | 3300028381 | Unclassified | 1002 |
| 730 | Ga0265336_10130114 | 3300028666 | Unclassified | 749 |
| 731 | Ga0265338_10002910 | 3300028800 | Bacteria | 24891 |
| 732 | Ga0265338_10091787 | 3300028800 | Unclassified | 2507 |
| 733 | Ga0265338_10160047 | 3300028800 | Unclassified | 1740 |
| 734 | Ga0265338_10263307 | 3300028800 | Unclassified | 1266 |
| 735 | Ga0265338_11038433 | 3300028800 | Bacteria | 554 |
| 736 | Ga0265762_1003153 | 3300030760 | Bacteria | 2945 |
| 737 | Ga0265762_1003335 | 3300030760 | Bacteria | 2870 |
| 738 | Ga0265762_1050535 | 3300030760 | Bacteria | 834 |
| 739 | Ga0265762_1082697 | 3300030760 | Unclassified | 690 |
| 740 | Ga0265762_1181968 | 3300030760 | Unclassified | 518 |
| 741 | Ga0265763_1049870 | 3300030763 | Bacteria | 525 |
| 742 | Ga0265770_1047779 | 3300030878 | Bacteria | 766 |
| 743 | Ga0265770_1099058 | 3300030878 | Unclassified | 591 |
| 744 | Ga0265765_1000774 | 3300030879 | Bacteria | 2733 |
| 745 | Ga0265765_1037590 | 3300030879 | Unclassified | 635 |
| 746 | Ga0265769_122017 | 3300030888 | Bacteria | 511 |
| 747 | Ga0265771_1000422 | 3300031010 | Unclassified | 1527 |
| 748 | Ga0265773_1009065 | 3300031018 | Unclassified | 812 |
| 749 | Ga0265773_1011646 | 3300031018 | Bacteria | 759 |
| 750 | Ga0265760_10000974 | 3300031090 | Bacteria | 8273 |
| 751 | Ga0265760_10001465 | 3300031090 | Bacteria | 6948 |
| 752 | Ga0265760_10022711 | 3300031090 | Bacteria | 1819 |
| 753 | Ga0265760_10045646 | 3300031090 | Bacteria | 1313 |
| 754 | Ga0265760_10064779 | 3300031090 | Bacteria | 1115 |
| 755 | Ga0265760_10154806 | 3300031090 | Unclassified | 753 |
| 756 | Ga0265760_10310012 | 3300031090 | Unclassified | 560 |
| 757 | Ga0265325_10015165 | 3300031241 | Bacteria | 4340 |
| 758 | Ga0265325_10058038 | 3300031241 | Bacteria | 1972 |
| 759 | Ga0265325_10109702 | 3300031241 | Unclassified | 1342 |
| 760 | Ga0265325_10468160 | 3300031241 | Unclassified | 548 |
| 761 | Ga0265340_10015612 | 3300031247 | Bacteria | 3945 |
| 762 | Ga0265340_10192784 | 3300031247 | Bacteria | 918 |
| 763 | Ga0265339_10072160 | 3300031249 | Bacteria | 1837 |
| 764 | Ga0307408_100688626 | 3300031548 | Bacteria | 918 |
| 765 | Ga0307508_10783486 | 3300031616 | Unclassified | 569 |
| 766 | Ga0265342_10114337 | 3300031712 | Bacteria | 1525 |
| 767 | Ga0316212_1005341 | 3300033547 | Bacteria | 1867 |
| 768 | Ga0373948_0146517 | 3300034817 | Bacteria | 587 |
| 769 | Ga0373958_0170857 | 3300034819 | Unclassified | 555 |
| 770 | Ga0373959_0065550 | 3300034820 | Bacteria | 812 |
| 771 | Ga0373938_0008616 | 3300034957 | Bacteria | 1827 |
| 772 | Ga0373926_0036187 | 3300035083 | Bacteria | 1753 |
| 773 | Ga0373926_0460245 | 3300035083 | Unclassified | 505 |
| 774 | Ga0373929_0037319 | 3300035085 | Bacteria | 1065 |
| 775 | Ga0373934_0108590 | 3300035086 | Bacteria | 1124 |
| 776 | Ga0373940_0047243 | 3300035088 | Bacteria | 1200 |
| 777 | Ga0373940_0113526 | 3300035088 | Bacteria | 834 |
| 778 | Ga0373949_0021801 | 3300035090 | Bacteria | 1473 |
| 779 | Ga0373952_0146949 | 3300035092 | Unclassified | 659 |
| 780 | Ga0373923_0002660 | 3300035111 | Bacteria | 5552 |
| 781 | Ga0373923_0153437 | 3300035111 | Bacteria | 1047 |
| 782 | Ga0373923_0201757 | 3300035111 | Bacteria | 920 |
| 783 | Ga0373923_0379353 | 3300035111 | Unclassified | 678 |
| 784 | Ga0373923_0582411 | 3300035111 | Unclassified | 550 |
| 785 | Ga0373932_0026611 | 3300035112 | Bacteria | 1575 |
| 786 | Ga0373932_0277330 | 3300035112 | Bacteria | 619 |
| 787 | Ga0373936_0006971 | 3300035113 | Bacteria | 4253 |
| 788 | Ga0373936_0040082 | 3300035113 | Bacteria | 1875 |
| 789 | Ga0373936_0530870 | 3300035113 | Unclassified | 549 |
| 790 | Ga0373945_0016630 | 3300035116 | Bacteria | 2483 |
| 791 | Ga0373945_0492695 | 3300035116 | Unclassified | 545 |
| 792 | Ga0373953_0245631 | 3300035117 | Bacteria | 777 |
| 793 | Ga0373954_0016939 | 3300035118 | Bacteria | 3269 |
| 794 | Ga0373954_0484467 | 3300035118 | Unclassified | 613 |
| 795 | Ga0373957_0010409 | 3300035120 | Bacteria | 3075 |
| 796 | Ga0373957_0171387 | 3300035120 | Bacteria | 897 |
| 797 | Ga0373960_0187294 | 3300035121 | Unclassified | 725 |
| 798 | Ga0373943_0000271 | 3300035170 | Bacteria | 21388 |
| 799 | Ga0373943_0061016 | 3300035170 | Unclassified | 1884 |
| 800 | Ga0373943_0681143 | 3300035170 | Unclassified | 609 |
| 801 | Ga0373946_0007194 | 3300035171 | Bacteria | 4064 |
| 802 | Ga0373946_0643407 | 3300035171 | Unclassified | 552 |
| 803 | Ga0373955_0044395 | 3300035172 | Bacteria | 2394 |
| 804 | Ga0373955_0186295 | 3300035172 | Bacteria | 1233 |
| 805 | Ga0373955_0367341 | 3300035172 | Bacteria | 872 |
| 806 | Ga0373955_0390853 | 3300035172 | Unclassified | 845 |
| 807 | Ga0373942_0201860 | 3300035207 | Bacteria | 660 |
| 808 | Ga0373961_0026579 | 3300035241 | Bacteria | 1583 |
| 809 | Ga0373962_0391269 | 3300035242 | Unclassified | 510 |
| 810 | Ga0373924_0010668 | 3300035410 | Bacteria | 3397 |
| 811 | Ga0373924_0109748 | 3300035410 | Bacteria | 1192 |
| 812 | Ga0373924_0567196 | 3300035410 | Unclassified | 511 |
| 813 | Ga0373931_0018942 | 3300035691 | Bacteria | 3429 |
| 814 | Ga0373935_0042083 | 3300035692 | Bacteria | 2871 |
| 815 | Ga0373935_0062176 | 3300035692 | Unclassified | 2391 |
| 816 | Ga0373935_0062581 | 3300035692 | Unclassified | 2384 |
| 817 | Ga0373935_0369325 | 3300035692 | Bacteria | 1026 |
| 818 | Ga0373935_0621461 | 3300035692 | Unclassified | 791 |
| 819 | Ga0373935_0794054 | 3300035692 | Bacteria | 699 |
| 820 | Ga0373935_1001166 | 3300035692 | Unclassified | 621 |
| 821 | Ga0373935_1177768 | 3300035692 | Unclassified | 571 |
| 822 | Ga0373935_1219064 | 3300035692 | Unclassified | 561 |
| 823 | Ga0373927_0000123 | 3300035695 | Bacteria | 58803 |
| 824 | Ga0373927_0079107 | 3300035695 | Bacteria | 2130 |
| 825 | Ga0373927_0204889 | 3300035695 | Unclassified | 1295 |
| 826 | Ga0373927_0461421 | 3300035695 | Unclassified | 839 |
| 827 | Ga0373927_0577607 | 3300035695 | Unclassified | 743 |
| 828 | Ga0373927_0611731 | 3300035695 | Unclassified | 720 |
| 829 | Ga0373927_0728678 | 3300035695 | Unclassified | 655 |
| 830 | Ga0373927_0861255 | 3300035695 | Unclassified | 598 |
| 831 | Ga0373933_0342245 | 3300035724 | Unclassified | 971 |
| 832 | Ga0373933_0422705 | 3300035724 | Unclassified | 870 |
| 833 | Ga0373933_0434460 | 3300035724 | Bacteria | 858 |
| 834 | Ga0373933_0505313 | 3300035724 | Bacteria | 792 |
| 835 | Ga0373933_0575532 | 3300035724 | Unclassified | 739 |
| 836 | Ga0373933_0990092 | 3300035724 | Unclassified | 554 |
| 837 | Ga0373933_1011507 | 3300035724 | Unclassified | 547 |
| 838 | Ga0373947_0000757 | 3300035725 | Bacteria | 19372 |
| 839 | Ga0373947_0086316 | 3300035725 | Bacteria | 1950 |
| 840 | Ga0373947_0102449 | 3300035725 | Bacteria | 1800 |
| 841 | Ga0373947_0166554 | 3300035725 | Bacteria | 1428 |
| 842 | Ga0373947_0326586 | 3300035725 | Bacteria | 1027 |
| 843 | Ga0373937_0086094 | 3300036401 | Bacteria | 2908 |
| 844 | Ga0373937_0305068 | 3300036401 | Unclassified | 1505 |
| 845 | Ga0373937_0344397 | 3300036401 | Bacteria | 1411 |
| 846 | Ga0373937_0455024 | 3300036401 | Unclassified | 1216 |
| 847 | Ga0373937_0668956 | 3300036401 | Unclassified | 984 |
| 848 | Ga0373937_1049736 | 3300036401 | Unclassified | 764 |
| 849 | Ga0373937_1186039 | 3300036401 | Unclassified | 712 |
| 850 | Ga0373925_0000589 | 3300037068 | Bacteria | 35013 |
| 851 | Ga0373925_0006557 | 3300037068 | Bacteria | 8556 |
| 852 | Ga0373925_0023231 | 3300037068 | Bacteria | 4525 |
| 853 | Ga0373925_0035914 | 3300037068 | Bacteria | 3658 |
| 854 | Ga0373925_0345084 | 3300037068 | Bacteria | 1208 |
| 855 | Ga0373925_0487777 | 3300037068 | Bacteria | 1011 |
| 856 | Ga0373925_1166428 | 3300037068 | Unclassified | 633 |
| 857 | Ga0373925_1222548 | 3300037068 | Unclassified | 617 |
| 858 | Ga0395905_0818467 | 3300037471 | Unclassified | 834 |
| 859 | Ga0436365_0213101 | 3300039437 | Bacteria | 2661 |
| 860 | Ga0436360_0116685 | 3300039438 | Unclassified | 758 |
| 861 | Ga0436360_0643861 | 3300039438 | Bacteria | 1357 |
| 862 | Ga0436361_1024562 | 3300039447 | Unclassified | 618 |
| 863 | Ga0436363_1306274 | 3300039450 | Bacteria | 1084 |
| 864 | Ga0436363_1601056 | 3300039450 | Unclassified | 766 |
| 865 | Ga0436362_0088740 | 3300039453 | Bacteria | 10371 |
| 866 | Ga0436362_0743766 | 3300039453 | Bacteria | 659 |
| 867 | Ga0451577_0041323 | 3300042876 | Bacteria | 4139 |
| 868 | Ga0453683_0066458 | 3300044673 | Bacteria | 2254 |
| 869 | Ga0453683_0119261 | 3300044673 | Bacteria | 1660 |
| 870 | Ga0453684_0564639 | 3300044712 | Bacteria | 1252 |
| 871 | Ga0466959_1200536 | 3300045049 | Unclassified | 504 |
| 872 | Ga0451576_0057431 | 3300045051 | Bacteria | 4068 |
| 873 | Ga0451576_0203839 | 3300045051 | Bacteria | 2066 |
| 874 | Ga0451576_0508087 | 3300045051 | Unclassified | 1266 |
| 875 | Ga0466958_0691657 | 3300045836 | Unclassified | 664 |
| 876 | Ga0466967_0331126 | 3300045976 | Bacteria | 1471 |
| 877 | Ga0495592_0372076 | 3300046454 | Bacteria | 911 |
| 878 | Ga0495603_0224756 | 3300046455 | Bacteria | 1083 |
| 879 | Ga0495590_0035373 | 3300046457 | Unclassified | 1744 |
| 880 | Ga0495629_0009854 | 3300046459 | Bacteria | 6972 |
| 881 | Ga0495651_0184121 | 3300046462 | Bacteria | 1476 |
| 882 | Ga0495651_0659480 | 3300046462 | Unclassified | 655 |
| 883 | Ga0495653_0734525 | 3300046463 | Bacteria | 597 |
| 884 | Ga0495580_0000609 | 3300046472 | Bacteria | 30239 |
| 885 | Ga0495580_0001590 | 3300046472 | Bacteria | 19932 |
| 886 | Ga0495580_0003591 | 3300046472 | Bacteria | 13156 |
| 887 | Ga0495580_0006112 | 3300046472 | Bacteria | 9847 |
| 888 | Ga0495580_0022020 | 3300046472 | Bacteria | 4696 |
| 889 | Ga0495580_0026006 | 3300046472 | Bacteria | 4271 |
| 890 | Ga0495580_0039583 | 3300046472 | Bacteria | 3373 |
| 891 | Ga0495580_0121243 | 3300046472 | Unclassified | 1815 |
| 892 | Ga0495580_0840009 | 3300046472 | Unclassified | 593 |
| 893 | Ga0495582_0016523 | 3300046473 | Bacteria | 4042 |
| 894 | Ga0495582_0803187 | 3300046473 | Unclassified | 544 |
| 895 | Ga0495639_0108256 | 3300046475 | Bacteria | 1317 |
| 896 | Ga0495664_0081591 | 3300046477 | Bacteria | 1939 |
| 897 | Ga0495664_0682675 | 3300046477 | Unclassified | 607 |
| 898 | Ga0495594_0776007 | 3300046499 | Unclassified | 541 |
| 899 | Ga0495618_0604965 | 3300046514 | Unclassified | 652 |
| 900 | Ga0495628_0440303 | 3300046516 | Unclassified | 948 |
| 901 | Ga0495630_0045503 | 3300046517 | Unclassified | 3280 |
| 902 | Ga0495630_0459745 | 3300046517 | Unclassified | 975 |
| 903 | Ga0495666_0089516 | 3300046526 | Bacteria | 1453 |
| 904 | Ga0495652_0354739 | 3300046529 | Bacteria | 1050 |
| 905 | Ga0495665_0262826 | 3300046531 | Bacteria | 887 |
| 906 | Ga0495640_0804633 | 3300046533 | Unclassified | 560 |
| 907 | Ga0495640_0894317 | 3300046533 | Bacteria | 526 |
| 908 | Ga0495622_0093102 | 3300046557 | Bacteria | 1384 |
| 909 | Ga0495667_0221960 | 3300046559 | Unclassified | 1206 |
| 910 | Ga0495635_0470649 | 3300046663 | Bacteria | 829 |
| 911 | Ga0495635_0547667 | 3300046663 | Unclassified | 759 |
| 912 | Ga0495659_0004901 | 3300046664 | Bacteria | 4215 |
| 913 | Ga0495657_0378144 | 3300046675 | Unclassified | 836 |
| 914 | Ga0495657_0743095 | 3300046675 | Unclassified | 563 |
| 915 | Ga0495599_0391856 | 3300046678 | Unclassified | 828 |
| 916 | Ga0495623_0349843 | 3300046679 | Bacteria | 805 |
| 917 | Ga0495646_0174941 | 3300046680 | Bacteria | 1181 |
| 918 | Ga0495658_0567108 | 3300046683 | Unclassified | 727 |
| 919 | Ga0495658_0658787 | 3300046683 | Bacteria | 671 |
| 920 | Ga0495658_0858505 | 3300046683 | Unclassified | 581 |
| 921 | Ga0495669_0321211 | 3300046684 | Unclassified | 747 |
| 922 | Ga0495669_0589745 | 3300046684 | Bacteria | 541 |
| 923 | Ga0495624_0593954 | 3300046690 | Unclassified | 660 |
| 924 | Ga0495624_0794473 | 3300046690 | Bacteria | 559 |
| 925 | Ga0495581_0423544 | 3300047315 | Unclassified | 776 |
| 926 | Ga0495581_0694354 | 3300047315 | Unclassified | 587 |
| 927 | Ga0495674_0015928 | 3300047319 | Bacteria | 7019 |
| 928 | Ga0495674_0048500 | 3300047319 | Bacteria | 3758 |
| 929 | Ga0495674_0133422 | 3300047319 | Unclassified | 2091 |
| 930 | Ga0495674_0721518 | 3300047319 | Unclassified | 781 |
| 931 | Ga0495675_0797622 | 3300047444 | Unclassified | 523 |
| 932 | Ga0495684_0784390 | 3300047471 | Unclassified | 624 |
| 933 | Ga0495684_1054619 | 3300047471 | Unclassified | 513 |
| 934 | Ga0495593_0536115 | 3300047673 | Bacteria | 587 |
| 935 | Ga0495602_0385403 | 3300048088 | Bacteria | 1003 |
| 936 | Ga0495602_0941697 | 3300048088 | Unclassified | 573 |
| 937 | Ga0495614_0206261 | 3300048089 | Bacteria | 891 |
| 938 | Ga0496100_0280788 | 3300048903 | Bacteria | 1241 |
| 939 | Ga0496100_0597044 | 3300048903 | Bacteria | 857 |
| 940 | Ga0496100_0742905 | 3300048903 | Unclassified | 767 |
| 941 | Ga0496101_0052127 | 3300048904 | Bacteria | 2950 |
| 942 | Ga0496101_0105617 | 3300048904 | Bacteria | 2114 |
| 943 | Ga0496101_0571265 | 3300048904 | Bacteria | 894 |
| 944 | Ga0496101_0624846 | 3300048904 | Unclassified | 851 |
| 945 | Ga0496102_0001608 | 3300048905 | Bacteria | 19914 |
| 946 | Ga0496102_0037848 | 3300048905 | Bacteria | 4352 |
| 947 | Ga0496102_0073308 | 3300048905 | Bacteria | 3147 |
| 948 | Ga0496102_0208403 | 3300048905 | Bacteria | 1843 |
| 949 | Ga0496103_0001131 | 3300048906 | Bacteria | 18549 |
| 950 | Ga0496103_0126374 | 3300048906 | Bacteria | 1631 |
| 951 | Ga0496104_0020814 | 3300048907 | Bacteria | 6015 |
| 952 | Ga0496104_0058780 | 3300048907 | Bacteria | 3640 |
| 953 | Ga0496104_0230524 | 3300048907 | Bacteria | 1764 |
| 954 | Ga0496104_0275215 | 3300048907 | Unclassified | 1596 |
| 955 | Ga0496104_0608573 | 3300048907 | Unclassified | 1003 |
| 956 | Ga0496105_0056250 | 3300048908 | Bacteria | 3247 |
| 957 | Ga0496105_0466397 | 3300048908 | Bacteria | 995 |
| 958 | Ga0496105_0915144 | 3300048908 | Bacteria | 660 |
| 959 | Ga0496105_1230022 | 3300048908 | Unclassified | 550 |
| 960 | Ga0496106_0449594 | 3300048909 | Bacteria | 1035 |
| 961 | Ga0496106_0867368 | 3300048909 | Unclassified | 714 |
| 962 | Ga0496107_0209947 | 3300048910 | Bacteria | 1448 |
| 963 | Ga0496107_0252824 | 3300048910 | Bacteria | 1311 |
| 964 | Ga0496107_0287070 | 3300048910 | Bacteria | 1225 |
| 965 | Ga0496108_0002049 | 3300048911 | Bacteria | 16155 |
| 966 | Ga0496108_0304228 | 3300048911 | Bacteria | 1389 |
| 967 | Ga0496109_0001965 | 3300048912 | Bacteria | 17051 |
| 968 | Ga0496109_0756972 | 3300048912 | Bacteria | 909 |
| 969 | Ga0496110_0000608 | 3300048913 | Bacteria | 24639 |
| 970 | Ga0496110_0083303 | 3300048913 | Bacteria | 2853 |
| 971 | Ga0496111_0003481 | 3300048914 | Bacteria | 9740 |
| 972 | Ga0496111_0880988 | 3300048914 | Bacteria | 645 |
| 973 | Ga0496112_0000225 | 3300048915 | Bacteria | 36816 |
| 974 | Ga0496112_0003304 | 3300048915 | Bacteria | 13311 |
| 975 | Ga0496112_0023777 | 3300048915 | Bacteria | 5861 |
| 976 | Ga0496113_0000151 | 3300048916 | Bacteria | 30342 |
| 977 | Ga0496113_0054633 | 3300048916 | Bacteria | 2990 |
| 978 | Ga0496113_0504699 | 3300048916 | Bacteria | 971 |
| 979 | Ga0496113_0783005 | 3300048916 | Unclassified | 758 |
| 980 | Ga0496113_0936958 | 3300048916 | Unclassified | 684 |
| 981 | Ga0496114_0141394 | 3300048917 | Bacteria | 2084 |
| 982 | Ga0496114_1139542 | 3300048917 | Unclassified | 665 |
| 983 | Ga0496115_0004761 | 3300048918 | Bacteria | 9850 |
| 984 | Ga0496115_0100396 | 3300048918 | Bacteria | 2372 |
| 985 | Ga0496115_0177475 | 3300048918 | Bacteria | 1761 |
| 986 | Ga0496115_0553950 | 3300048918 | Bacteria | 919 |
| 987 | Ga0496115_0804501 | 3300048918 | Bacteria | 731 |
| 988 | Ga0501299_032904 | 3300049522 | Bacteria | 1009 |
| 989 | Ga0501069_0789096 | 3300049585 | Unclassified | 575 |
| 990 | Ga0501236_124659 | 3300049670 | Unclassified | 526 |
| 991 | nmdc:mga05p37_346514_c1 | 3300050507 | Bacteria | 1750 |
| 992 | nmdc:mga08y16_1472035_c1 | 3300050511 | Unclassified | 642 |
| 993 | nmdc:mga0n895_1211_c1 | 3300050512 | Bacteria | 19031 |
| 994 | nmdc:mga0n895_1230_c1 | 3300050512 | Bacteria | 18879 |
| 995 | nmdc:mga0n895_717532_c1 | 3300050512 | Bacteria | 995 |
| 996 | nmdc:mga0rr50_1238948_c1 | 3300050513 | Unclassified | 633 |
| 997 | nmdc:mga0rr50_1398859_c1 | 3300050513 | Unclassified | 592 |
| 998 | nmdc:mga0rr50_1847_c2 | 3300050513 | Bacteria | 7575 |
| 999 | nmdc:mga0rr50_21376_c1 | 3300050513 | Bacteria | 4416 |
| 1000 | nmdc:mga0rr50_466232_c1 | 3300050513 | Unclassified | 1072 |
| 1001 | nmdc:mga0rr50_550098_c1 | 3300050513 | Unclassified | 983 |
| 1002 | nmdc:mga0rr50_560108_c1 | 3300050513 | Bacteria | 973 |
| 1003 | nmdc:mga08x19_12995_c1 | 3300050514 | Bacteria | 5026 |
| 1004 | nmdc:mga08x19_166456_c1 | 3300050514 | Bacteria | 1499 |
| 1005 | nmdc:mga08x19_5938_c1 | 3300050514 | Bacteria | 7225 |
| 1006 | nmdc:mga0a205_225_c1 | 3300050515 | Bacteria | 39886 |
| 1007 | nmdc:mga0a205_88236_c1 | 3300050515 | Bacteria | 2997 |
| 1008 | Ga0495601_0387682 | 3300053077 | Unclassified | 906 |
| 1009 | Ga0495601_0719154 | 3300053077 | Bacteria | 636 |
| 1010 | Ga0495612_0060571 | 3300053078 | Bacteria | 1567 |
| 1011 | Ga0495612_0481524 | 3300053078 | Unclassified | 568 |
| 1012 | Ga0495655_0259050 | 3300053083 | Unclassified | 587 |
| 1013 | Ga0587062_141171 | 3300059639 | Bacteria | 503 |
| 1014 | Ga0070707_100078239 | |||
| 1015 | JGI24741J21665_1033816 | |||
| 1016 | JGI24752J21851_1006609 | |||
| 1017 | JGI24743J22301_10012057 | |||
| 1018 | JGI24748J21848_1025698 | |||
| 1019 | JGI24749J21850_1056880 | |||
| 1020 | JGI24033J26618_1067013 | |||
| 1021 | JGI24034J26672_10002729 | |||
| 1022 | JGI24751J29686_10003895 | |||
| 1023 | Ga0058861_12068115 | |||
| 1024 | Ga0065704_10033639 | |||
| 1025 | Ga0065712_10338493 | |||
| 1026 | Ga0065715_10113296 | |||
| 1027 | Ga0065715_10667531 | |||
| 1028 | Ga0065715_11082109 | |||
| 1029 | Ga0070658_10600736 | |||
| 1030 | Ga0070658_11979186 | |||
| 1031 | Ga0070676_10003275 | |||
| 1032 | Ga0070676_10081298 | |||
| 1033 | Ga0070683_100004621 | |||
| 1034 | Ga0070683_100176771 | |||
| 1035 | Ga0070683_100569260 | |||
| 1036 | Ga0070690_100037269 | |||
| 1037 | Ga0070690_100103389 | |||
| 1038 | Ga0070670_100038118 | |||
| 1039 | Ga0070670_100167510 | |||
| 1040 | Ga0070677_10100228 | |||
| 1041 | Ga0070677_10182451 | |||
| 1042 | Ga0068869_100041154 | |||
| 1043 | Ga0068869_100044577 | |||
| 1044 | Ga0068869_100164441 | |||
| 1045 | Ga0070666_10017323 | |||
| 1046 | Ga0070666_10114327 | |||
| 1047 | Ga0070680_100148076 | |||
| 1048 | Ga0070680_100963660 | |||
| 1049 | Ga0070680_101799629 | |||
| 1050 | Ga0070682_100010844 | |||
| 1051 | Ga0070682_100017628 | |||
| 1052 | Ga0068868_100006913 | |||
| 1053 | Ga0068868_100296432 | |||
| 1054 | Ga0068868_100448747 | |||
| 1055 | Ga0068868_100604449 | |||
| 1056 | Ga0070660_100035833 | |||
| 1057 | Ga0070660_100118597 | |||
| 1058 | Ga0070689_100144463 | |||
| 1059 | Ga0070691_10052150 | |||
| 1060 | Ga0070687_100037353 | |||
| 1061 | Ga0070687_100656714 | |||
| 1062 | Ga0070661_100010243 | |||
| 1063 | Ga0070661_100261636 | |||
| 1064 | Ga0070692_10145328 | |||
| 1065 | Ga0070692_11372437 | |||
| 1066 | Ga0070668_100027931 | |||
| 1067 | Ga0070668_100048610 | |||
| 1068 | Ga0070669_100037937 | |||
| 1069 | Ga0070669_101792330 | |||
| 1070 | Ga0070675_100151397 | |||
| 1071 | Ga0070675_100187426 | |||
| 1072 | Ga0070671_100245420 | |||
| 1073 | Ga0070674_100277089 | |||
| 1074 | Ga0070673_100079283 | |||
| 1075 | Ga0070688_100030984 | |||
| 1076 | Ga0070688_100147906 | |||
| 1077 | Ga0070659_100011900 | |||
| 1078 | Ga0070659_100013235 | |||
| 1079 | Ga0070667_100017595 | |||
| 1080 | Ga0070667_100828119 | |||
| 1081 | Ga0070709_10000752 | |||
| 1082 | Ga0070709_10026405 | |||
| 1083 | Ga0070709_10059583 | |||
| 1084 | Ga0070709_10084428 | |||
| 1085 | Ga0070709_10109402 | |||
| 1086 | Ga0070709_10167635 | |||
| 1087 | Ga0070709_10240943 | |||
| 1088 | Ga0070709_10259177 | |||
| 1089 | Ga0070709_10279919 | |||
| 1090 | Ga0070709_10280634 | |||
| 1091 | Ga0070709_10409430 | |||
| 1092 | Ga0070709_10830342 | |||
| 1093 | Ga0070709_11187308 | |||
| 1094 | Ga0070709_11520788 | |||
| 1095 | Ga0070714_100000128 | |||
| 1096 | Ga0070714_100003652 | |||
| 1097 | Ga0070714_100100702 | |||
| 1098 | Ga0070714_100271249 | |||
| 1099 | Ga0070714_100549631 | |||
| 1100 | Ga0070714_100573582 | |||
| 1101 | Ga0070714_100604937 | |||
| 1102 | Ga0070714_100728296 | |||
| 1103 | Ga0070714_100740984 | |||
| 1104 | Ga0070714_100943352 | |||
| 1105 | Ga0070714_101027327 | |||
| 1106 | Ga0070714_101947373 | |||
| 1107 | Ga0070714_102219061 | |||
| 1108 | Ga0070713_100000078 | |||
| 1109 | Ga0070713_100000133 | |||
| 1110 | Ga0070713_100078181 | |||
| 1111 | Ga0070713_100080496 | |||
| 1112 | Ga0070713_100101772 | |||
| 1113 | Ga0070713_100127801 | |||
| 1114 | Ga0070713_100145619 | |||
| 1115 | Ga0070713_100147085 | |||
| 1116 | Ga0070713_100314194 | |||
| 1117 | Ga0070713_100392236 | |||
| 1118 | Ga0070713_100585957 | |||
| 1119 | Ga0070710_10004339 | |||
| 1120 | Ga0070710_10008612 | |||
| 1121 | Ga0070710_10018846 | |||
| 1122 | Ga0070710_10036605 | |||
| 1123 | Ga0070710_10063073 | |||
| 1124 | Ga0070710_10177556 | |||
| 1125 | Ga0070710_10449011 | |||
| 1126 | Ga0070710_10562122 | |||
| 1127 | Ga0070710_10746320 | |||
| 1128 | Ga0070710_11352799 | |||
| 1129 | Ga0070711_100000189 | |||
| 1130 | Ga0070711_100000517 | |||
| 1131 | Ga0070711_100021434 | |||
| 1132 | Ga0070711_100027778 | |||
| 1133 | Ga0070711_100028299 | |||
| 1134 | Ga0070711_100070816 | |||
| 1135 | Ga0070711_100101824 | |||
| 1136 | Ga0070711_100192634 | |||
| 1137 | Ga0070711_100329372 | |||
| 1138 | Ga0070711_100707041 | |||
| 1139 | Ga0070711_101120001 | |||
| 1140 | Ga0070711_101505264 | |||
| 1141 | Ga0070711_101848589 | |||
| 1142 | Ga0070705_100139729 | |||
| 1143 | Ga0070705_100537550 | |||
| 1144 | Ga0070705_101464647 | |||
| 1145 | Ga0070700_101289745 | |||
| 1146 | Ga0070700_102002774 | |||
| 1147 | Ga0070694_100715056 | |||
| 1148 | Ga0070708_100015770 | |||
| 1149 | Ga0070708_100047367 | |||
| 1150 | Ga0070708_100063530 | |||
| 1151 | Ga0070708_100149015 | |||
| 1152 | Ga0070708_100153456 | |||
| 1153 | Ga0070708_100181480 | |||
| 1154 | Ga0070708_101268910 | |||
| 1155 | Ga0070708_101869785 | |||
| 1156 | Ga0070663_100088468 | |||
| 1157 | Ga0070663_100110977 | |||
| 1158 | Ga0070663_101881138 | |||
| 1159 | Ga0070678_100123198 | |||
| 1160 | Ga0070678_100473910 | |||
| 1161 | Ga0070662_100003450 | |||
| 1162 | Ga0070662_100125237 | |||
| 1163 | Ga0070681_10031904 | |||
| 1164 | Ga0070681_10069256 | |||
| 1165 | Ga0070681_10224598 | |||
| 1166 | Ga0070681_10678026 | |||
| 1167 | Ga0070681_10945325 | |||
| 1168 | Ga0068867_100054635 | |||
| 1169 | Ga0070685_10068999 | |||
| 1170 | Ga0070685_10198125 | |||
| 1171 | Ga0070706_100001770 | |||
| 1172 | Ga0070706_100002201 | |||
| 1173 | Ga0070706_100016311 | |||
| 1174 | Ga0070706_100052308 | |||
| 1175 | Ga0070706_100064806 | |||
| 1176 | Ga0070706_101416023 | |||
| 1177 | Ga0070707_100000091 | |||
| 1178 | Ga0070707_100011671 | |||
| 1179 | Ga0070707_100026901 | |||
| 1180 | Ga0070707_100083496 | |||
| 1181 | Ga0070707_100258880 | |||
| 1182 | Ga0070707_100320872 | |||
| 1183 | Ga0070707_100460490 | |||
| 1184 | Ga0070707_100699198 | |||
| 1185 | Ga0070707_100771738 | |||
| 1186 | Ga0070707_100924642 | |||
| 1187 | Ga0070707_101391438 | |||
| 1188 | Ga0070707_101563240 | |||
| 1189 | Ga0070698_100000027 | |||
| 1190 | Ga0070698_100000226 | |||
| 1191 | Ga0070698_100112749 | |||
| 1192 | Ga0070698_100678324 | |||
| 1193 | Ga0070699_100000032 | |||
| 1194 | Ga0070699_100002069 | |||
| 1195 | Ga0070699_100003662 | |||
| 1196 | Ga0070699_100006912 | |||
| 1197 | Ga0070699_100247343 | |||
| 1198 | Ga0070699_100442637 | |||
| 1199 | Ga0070699_100847951 | |||
| 1200 | Ga0070699_101213218 | |||
| 1201 | Ga0070679_100044249 | |||
| 1202 | Ga0070679_100109442 | |||
| 1203 | Ga0070679_100905130 | |||
| 1204 | Ga0070679_101177647 | |||
| 1205 | Ga0070679_101178838 | |||
| 1206 | Ga0070684_100039308 | |||
| 1207 | Ga0070684_100066892 | |||
| 1208 | Ga0070684_100854368 | |||
| 1209 | Ga0070697_100000166 | |||
| 1210 | Ga0070697_100000902 | |||
| 1211 | Ga0070697_100002343 | |||
| 1212 | Ga0070697_100048678 | |||
| 1213 | Ga0070697_100235277 | |||
| 1214 | Ga0070697_100321207 | |||
| 1215 | Ga0070697_100342055 | |||
| 1216 | Ga0070697_100366232 | |||
| 1217 | Ga0068853_100012730 | |||
| 1218 | Ga0068853_100182064 | |||
| 1219 | Ga0070672_100338745 | |||
| 1220 | Ga0070686_100017238 | |||
| 1221 | Ga0070686_100030478 | |||
| 1222 | Ga0070686_100085327 | |||
| 1223 | Ga0070695_100100752 | |||
| 1224 | Ga0070695_100210766 | |||
| 1225 | Ga0070696_100104103 | |||
| 1226 | Ga0070696_100542363 | |||
| 1227 | Ga0070696_100732162 | |||
| 1228 | Ga0070693_100107977 | |||
| 1229 | Ga0070693_100110100 | |||
| 1230 | Ga0070665_100013996 | |||
| 1231 | Ga0070665_102382087 | |||
| 1232 | Ga0070704_100402147 | |||
| 1233 | Ga0068855_100029749 | |||
| 1234 | Ga0068855_100063210 | |||
| 1235 | Ga0070664_100088635 | |||
| 1236 | Ga0070664_100650380 | |||
| 1237 | Ga0070664_100765937 | |||
| 1238 | Ga0068857_100029312 | |||
| 1239 | Ga0068857_100068768 | |||
| 1240 | Ga0068857_101840300 | |||
| 1241 | Ga0068854_100011566 | |||
| 1242 | Ga0068854_100057319 | |||
| 1243 | Ga0068854_100895755 | |||
| 1244 | Ga0068854_101139569 | |||
| 1245 | Ga0068856_100028207 | |||
| 1246 | Ga0068856_100051815 | |||
| 1247 | Ga0068856_100150978 | |||
| 1248 | Ga0068856_100211765 | |||
| 1249 | Ga0070702_100086640 | |||
| 1250 | Ga0068852_100004955 | |||
| 1251 | Ga0068852_100054381 | |||
| 1252 | Ga0068852_102719078 | |||
| 1253 | Ga0068859_100017990 | |||
| 1254 | Ga0068859_100207857 | |||
| 1255 | Ga0068859_102239659 | |||
| 1256 | Ga0068864_100109218 | |||
| 1257 | Ga0068864_100195502 | |||
| 1258 | Ga0068864_101977081 | |||
| 1259 | Ga0068866_10067230 | |||
| 1260 | Ga0068866_10082174 | |||
| 1261 | Ga0068861_100059708 | |||
| 1262 | Ga0068861_100333469 | |||
| 1263 | Ga0068851_10008145 | |||
| 1264 | Ga0068851_10012378 | |||
| 1265 | Ga0068870_10019594 | |||
| 1266 | Ga0068863_100121543 | |||
| 1267 | Ga0068863_100451812 | |||
| 1268 | Ga0068863_100908603 | |||
| 1269 | Ga0068863_101505225 | |||
| 1270 | Ga0068858_100092904 | |||
| 1271 | Ga0068858_100150484 | |||
| 1272 | Ga0068858_101240465 | |||
| 1273 | Ga0068860_100014669 | |||
| 1274 | Ga0068860_100229000 | |||
| 1275 | Ga0068860_100844126 | |||
| 1276 | Ga0068862_100029977 | |||
| 1277 | Ga0068862_100183452 | |||
| 1278 | Ga0068862_101613508 | |||
| 1279 | Ga0081540_1084424 | |||
| 1280 | Ga0081540_1091210 | |||
| 1281 | Ga0081540_1156292 | |||
| 1282 | Ga0070717_10005218 | |||
| 1283 | Ga0070717_10010950 | |||
| 1284 | Ga0070717_10026950 | |||
| 1285 | Ga0070717_10071635 | |||
| 1286 | Ga0070717_10086417 | |||
| 1287 | Ga0070717_10095308 | |||
| 1288 | Ga0070717_10110467 | |||
| 1289 | Ga0070717_10130139 | |||
| 1290 | Ga0070717_10238559 | |||
| 1291 | Ga0070717_10370925 | |||
| 1292 | Ga0070717_10395501 | |||
| 1293 | Ga0070717_10497236 | |||
| 1294 | Ga0070717_10511264 | |||
| 1295 | Ga0070717_10702149 | |||
| 1296 | Ga0070717_11273395 | |||
| 1297 | Ga0070717_11579976 | |||
| 1298 | Ga0070715_10006750 | |||
| 1299 | Ga0070715_10013201 | |||
| 1300 | Ga0070715_10020846 | |||
| 1301 | Ga0070715_10084048 | |||
| 1302 | Ga0070715_10311557 | |||
| 1303 | Ga0070715_10423818 | |||
| 1304 | Ga0070715_10584465 | |||
| 1305 | Ga0070715_10834544 | |||
| 1306 | Ga0070716_100000881 | |||
| 1307 | Ga0070716_100006268 | |||
| 1308 | Ga0070716_100011280 | |||
| 1309 | Ga0070716_100084619 | |||
| 1310 | Ga0070716_100145850 | |||
| 1311 | Ga0070716_100188448 | |||
| 1312 | Ga0070716_100188496 | |||
| 1313 | Ga0070716_100268442 | |||
| 1314 | Ga0070716_100304032 | |||
| 1315 | Ga0070716_100308818 | |||
| 1316 | Ga0070716_100596644 | |||
| 1317 | Ga0070716_101014513 | |||
| 1318 | Ga0070716_101084443 | |||
| 1319 | Ga0070712_100000047 | |||
| 1320 | Ga0070712_100000156 | |||
| 1321 | Ga0070712_100000649 | |||
| 1322 | Ga0070712_100001728 | |||
| 1323 | Ga0070712_100046295 | |||
| 1324 | Ga0070712_100328358 | |||
| 1325 | Ga0070712_100359344 | |||
| 1326 | Ga0070712_100390079 | |||
| 1327 | Ga0070712_100506173 | |||
| 1328 | Ga0070712_100534253 | |||
| 1329 | Ga0070712_101065742 | |||
| 1330 | Ga0097621_100012031 | |||
| 1331 | Ga0097621_100060568 | |||
| 1332 | Ga0097621_100137826 | |||
| 1333 | Ga0097621_100209749 | |||
| 1334 | Ga0097621_100367318 | |||
| 1335 | Ga0097621_100805015 | |||
| 1336 | Ga0097621_101002169 | |||
| 1337 | Ga0068871_100015762 | |||
| 1338 | Ga0068871_100170472 | |||
| 1339 | Ga0068871_100245901 | |||
| 1340 | Ga0068871_101749361 | |||
| 1341 | Ga0075433_10000203 | |||
| 1342 | Ga0075433_10174181 | |||
| 1343 | Ga0075434_100000016 | |||
| 1344 | Ga0075434_100001747 | |||
| 1345 | Ga0075434_100775620 | |||
| 1346 | Ga0075434_100923064 | |||
| 1347 | Ga0075434_102176069 | |||
| 1348 | Ga0068865_100048226 | |||
| 1349 | Ga0075436_100002204 | |||
| 1350 | Ga0075436_100101665 | |||
| 1351 | Ga0075436_100710867 | |||
| 1352 | Ga0097620_100017990 | |||
| 1353 | Ga0097620_100207853 | |||
| 1354 | Ga0097620_102239811 | |||
| 1355 | Ga0075435_100000173 | |||
| 1356 | Ga0075435_100035103 | |||
| 1357 | Ga0075435_100111091 | |||
| 1358 | Ga0075435_100217729 | |||
| 1359 | Ga0075435_101220917 | |||
| 1360 | Ga0099794_10093523 | |||
| 1361 | Ga0099794_10235581 | |||
| 1362 | Ga0099794_10269852 | |||
| 1363 | Ga0099794_10620459 | |||
| 1364 | Ga0099795_10006741 | |||
| 1365 | Ga0099795_10180885 | |||
| 1366 | Ga0105250_10071717 | |||
| 1367 | Ga0105250_10307856 | |||
| 1368 | Ga0105240_10037841 | |||
| 1369 | Ga0105240_10071887 | |||
| 1370 | Ga0105240_10146767 | |||
| 1371 | Ga0105240_10151677 | |||
| 1372 | Ga0105240_12634126 | |||
| 1373 | Ga0111539_11457666 | |||
| 1374 | Ga0105245_10023080 | |||
| 1375 | Ga0105245_10030677 | |||
| 1376 | Ga0105245_10149993 | |||
| 1377 | Ga0105245_10417509 | |||
| 1378 | Ga0105247_10017833 | |||
| 1379 | Ga0105247_10104225 | |||
| 1380 | Ga0105247_10404589 | |||
| 1381 | Ga0105247_10547382 | |||
| 1382 | Ga0105247_10932564 | |||
| 1383 | Ga0114129_10286706 | |||
| 1384 | Ga0114129_13438347 | |||
| 1385 | Ga0105243_10008143 | |||
| 1386 | Ga0105241_10063812 | |||
| 1387 | Ga0105241_10138828 | |||
| 1388 | Ga0105241_10152210 | |||
| 1389 | Ga0105241_10319013 | |||
| 1390 | Ga0105241_11536629 | |||
| 1391 | Ga0105242_10009635 | |||
| 1392 | Ga0105242_11269840 | |||
| 1393 | Ga0105242_13103109 | |||
| 1394 | Ga0105248_10004294 | |||
| 1395 | Ga0105248_10117024 | |||
| 1396 | Ga0105248_10129281 | |||
| 1397 | Ga0105248_10339967 | |||
| 1398 | Ga0105237_10029573 | |||
| 1399 | Ga0105237_10101265 | |||
| 1400 | Ga0105237_10144905 | |||
| 1401 | Ga0105237_10188217 | |||
| 1402 | Ga0105237_10461130 | |||
| 1403 | Ga0105237_12360198 | |||
| 1404 | Ga0105237_12532673 | |||
| 1405 | Ga0105238_10052183 | |||
| 1406 | Ga0105238_10235410 | |||
| 1407 | Ga0105238_11116841 | |||
| 1408 | Ga0105249_10090658 | |||
| 1409 | Ga0105249_10107384 | |||
| 1410 | Ga0105249_10147805 | |||
| 1411 | Ga0099796_10020949 | |||
| 1412 | Ga0099796_10079919 | |||
| 1413 | Ga0099796_10084822 | |||
| 1414 | Ga0099796_10344619 | |||
| 1415 | Ga0105239_10014054 | |||
| 1416 | Ga0105239_12021631 | |||
| 1417 | Ga0105246_10006433 | |||
| 1418 | Ga0105246_10072271 | |||
| 1419 | Ga0105246_10460634 | |||
| 1420 | Ga0157325_1023642 | |||
| 1421 | Ga0157373_10001333 | |||
| 1422 | Ga0157373_11535892 | |||
| 1423 | Ga0157371_10007438 | |||
| 1424 | Ga0157371_10022254 | |||
| 1425 | Ga0157370_10150403 | |||
| 1426 | Ga0157370_10373164 | |||
| 1427 | Ga0157369_10048322 | |||
| 1428 | Ga0157369_10221669 | |||
| 1429 | Ga0157374_10002103 | |||
| 1430 | Ga0157374_10014783 | |||
| 1431 | Ga0157374_10369244 | |||
| 1432 | Ga0157374_12848252 | |||
| 1433 | Ga0157378_10119785 | |||
| 1434 | Ga0157378_10244259 | |||
| 1435 | Ga0157378_10298489 | |||
| 1436 | Ga0157378_11795408 | |||
| 1437 | Ga0157378_12046670 | |||
| 1438 | Ga0157378_12351309 | |||
| 1439 | Ga0163162_10013430 | |||
| 1440 | Ga0163162_10057046 | |||
| 1441 | Ga0163162_10067390 | |||
| 1442 | Ga0163162_10412528 | |||
| 1443 | Ga0157372_10013384 | |||
| 1444 | Ga0157372_10014532 | |||
| 1445 | Ga0157372_10020193 | |||
| 1446 | Ga0157372_10431276 | |||
| 1447 | Ga0157372_11680122 | |||
| 1448 | Ga0157375_10069523 | |||
| 1449 | Ga0157375_10827844 | |||
| 1450 | Ga0163163_10012687 | |||
| 1451 | Ga0163163_10028596 | |||
| 1452 | Ga0163163_10398171 | |||
| 1453 | Ga0163163_10875057 | |||
| 1454 | Ga0157380_10117385 | |||
| 1455 | Ga0182008_10029883 | |||
| 1456 | Ga0157377_10010559 | |||
| 1457 | Ga0157379_10003230 | |||
| 1458 | Ga0157379_10042368 | |||
| 1459 | Ga0157379_10057309 | |||
| 1460 | Ga0157379_10331916 | |||
| 1461 | Ga0157376_10019022 | |||
| 1462 | Ga0157376_10033236 | |||
| 1463 | Ga0157376_10699902 | |||
| 1464 | Ga0157376_12502725 | |||
| 1465 | Ga0182006_1047945 | |||
| 1466 | Ga0182007_10132730 | |||
| 1467 | Ga0182005_1084277 | |||
| 1468 | Ga0163161_10003472 | |||
| 1469 | Ga0213873_10014330 | |||
| 1470 | Ga0224569_104280 | |||
| 1471 | Ga0224571_101031 | |||
| 1472 | Ga0224572_1012871 | |||
| 1473 | Ga0224572_1050267 | |||
| 1474 | Ga0228598_1002428 | |||
| 1475 | Ga0228598_1014444 | |||
| 1476 | Ga0228598_1033115 | |||
| 1477 | Ga0207697_10005682 | |||
| 1478 | Ga0207656_10001681 | |||
| 1479 | Ga0207656_10032949 | |||
| 1480 | Ga0207696_1112319 | |||
| 1481 | Ga0207696_1183839 | |||
| 1482 | Ga0207682_10091582 | |||
| 1483 | Ga0207692_10008567 | |||
| 1484 | Ga0207692_10013176 | |||
| 1485 | Ga0207692_10083891 | |||
| 1486 | Ga0207692_10092337 | |||
| 1487 | Ga0207692_10516941 | |||
| 1488 | Ga0207692_10517462 | |||
| 1489 | Ga0207692_10561048 | |||
| 1490 | Ga0207642_10014209 | |||
| 1491 | Ga0207642_10018561 | |||
| 1492 | Ga0207642_10915337 | |||
| 1493 | Ga0207710_10030416 | |||
| 1494 | Ga0207710_10046728 | |||
| 1495 | Ga0207710_10148325 | |||
| 1496 | Ga0207710_10383881 | |||
| 1497 | Ga0207688_10026648 | |||
| 1498 | Ga0207680_10011553 | |||
| 1499 | Ga0207680_10063583 | |||
| 1500 | Ga0207647_10037541 | |||
| 1501 | Ga0207647_10093744 | |||
| 1502 | Ga0207685_10011500 | |||
| 1503 | Ga0207685_10021033 | |||
| 1504 | Ga0207685_10036902 | |||
| 1505 | Ga0207685_10145109 | |||
| 1506 | Ga0207685_10316401 | |||
| 1507 | Ga0207699_10019860 | |||
| 1508 | Ga0207699_10142458 | |||
| 1509 | Ga0207699_10165923 | |||
| 1510 | Ga0207699_10216972 | |||
| 1511 | Ga0207699_10273896 | |||
| 1512 | Ga0207699_10311664 | |||
| 1513 | Ga0207699_10320229 | |||
| 1514 | Ga0207699_10449664 | |||
| 1515 | Ga0207699_10454268 | |||
| 1516 | Ga0207699_10557740 | |||
| 1517 | Ga0207699_10597405 | |||
| 1518 | Ga0207699_10696845 | |||
| 1519 | Ga0207699_11065101 | |||
| 1520 | Ga0207699_11122367 | |||
| 1521 | Ga0207699_11178849 | |||
| 1522 | Ga0207645_10000021 | |||
| 1523 | Ga0207645_10004345 | |||
| 1524 | Ga0207643_10007444 | |||
| 1525 | Ga0207643_10436204 | |||
| 1526 | Ga0207705_10594852 | |||
| 1527 | Ga0207684_10000238 | |||
| 1528 | Ga0207684_10001028 | |||
| 1529 | Ga0207684_10002047 | |||
| 1530 | Ga0207684_10057239 | |||
| 1531 | Ga0207684_10244115 | |||
| 1532 | Ga0207684_10247668 | |||
| 1533 | Ga0207654_10042939 | |||
| 1534 | Ga0207654_10179570 | |||
| 1535 | Ga0207654_10722339 | |||
| 1536 | Ga0207654_11054510 | |||
| 1537 | Ga0207707_10016277 | |||
| 1538 | Ga0207707_10055851 | |||
| 1539 | Ga0207707_10447399 | |||
| 1540 | Ga0207707_10754267 | |||
| 1541 | Ga0207695_10007368 | |||
| 1542 | Ga0207695_10016928 | |||
| 1543 | Ga0207695_10318637 | |||
| 1544 | Ga0207695_10389091 | |||
| 1545 | Ga0207695_10470820 | |||
| 1546 | Ga0207695_10749349 | |||
| 1547 | Ga0207695_10881542 | |||
| 1548 | Ga0207671_10064944 | |||
| 1549 | Ga0207671_10938039 | |||
| 1550 | Ga0207671_11169156 | |||
| 1551 | Ga0207671_11264466 | |||
| 1552 | Ga0207693_10000044 | |||
| 1553 | Ga0207693_10000097 | |||
| 1554 | Ga0207693_10000546 | |||
| 1555 | Ga0207693_10006025 | |||
| 1556 | Ga0207693_10066246 | |||
| 1557 | Ga0207693_10113772 | |||
| 1558 | Ga0207693_10116175 | |||
| 1559 | Ga0207693_10137353 | |||
| 1560 | Ga0207693_10366040 | |||
| 1561 | Ga0207693_10539978 | |||
| 1562 | Ga0207693_10869690 | |||
| 1563 | Ga0207663_10000276 | |||
| 1564 | Ga0207663_10001127 | |||
| 1565 | Ga0207663_10030227 | |||
| 1566 | Ga0207663_10096029 | |||
| 1567 | Ga0207663_10123387 | |||
| 1568 | Ga0207663_10132697 | |||
| 1569 | Ga0207663_10234390 | |||
| 1570 | Ga0207663_10386717 | |||
| 1571 | Ga0207663_10389470 | |||
| 1572 | Ga0207663_10688931 | |||
| 1573 | Ga0207663_10740562 | |||
| 1574 | Ga0207663_11058094 | |||
| 1575 | Ga0207663_11422740 | |||
| 1576 | Ga0207663_11600215 | |||
| 1577 | Ga0207660_10362344 | |||
| 1578 | Ga0207660_10819818 | |||
| 1579 | Ga0207662_10015324 | |||
| 1580 | Ga0207657_10001918 | |||
| 1581 | Ga0207657_10004787 | |||
| 1582 | Ga0207649_10000836 | |||
| 1583 | Ga0207649_10132580 | |||
| 1584 | Ga0207652_10024152 | |||
| 1585 | Ga0207652_10146421 | |||
| 1586 | Ga0207646_10000073 | |||
| 1587 | Ga0207646_10001530 | |||
| 1588 | Ga0207646_10096540 | |||
| 1589 | Ga0207646_10182814 | |||
| 1590 | Ga0207646_10513541 | |||
| 1591 | Ga0207646_11188135 | |||
| 1592 | Ga0207646_11292698 | |||
| 1593 | Ga0207646_11449621 | |||
| 1594 | Ga0207646_11506863 | |||
| 1595 | Ga0207681_10035914 | |||
| 1596 | Ga0207681_10774621 | |||
| 1597 | Ga0207694_10162801 | |||
| 1598 | Ga0207694_10239595 | |||
| 1599 | Ga0207694_10643205 | |||
| 1600 | Ga0207650_10000097 | |||
| 1601 | Ga0207650_10216033 | |||
| 1602 | Ga0207650_11646433 | |||
| 1603 | Ga0207659_10555648 | |||
| 1604 | Ga0207659_11668407 | |||
| 1605 | Ga0207687_10018851 | |||
| 1606 | Ga0207687_10075610 | |||
| 1607 | Ga0207687_10163917 | |||
| 1608 | Ga0207687_11213842 | |||
| 1609 | Ga0207700_10000227 | |||
| 1610 | Ga0207700_10002357 | |||
| 1611 | Ga0207700_10033743 | |||
| 1612 | Ga0207700_10044086 | |||
| 1613 | Ga0207700_10148298 | |||
| 1614 | Ga0207700_10155263 | |||
| 1615 | Ga0207700_10270357 | |||
| 1616 | Ga0207700_10295320 | |||
| 1617 | Ga0207700_10401378 | |||
| 1618 | Ga0207700_10406850 | |||
| 1619 | Ga0207700_10444398 | |||
| 1620 | Ga0207700_10706066 | |||
| 1621 | Ga0207700_10866673 | |||
| 1622 | Ga0207700_11449954 | |||
| 1623 | Ga0207700_11521598 | |||
| 1624 | Ga0207664_10000033 | |||
| 1625 | Ga0207664_10008409 | |||
| 1626 | Ga0207664_10027738 | |||
| 1627 | Ga0207664_10064432 | |||
| 1628 | Ga0207664_10138671 | |||
| 1629 | Ga0207664_10319773 | |||
| 1630 | Ga0207664_10485846 | |||
| 1631 | Ga0207664_10642628 | |||
| 1632 | Ga0207664_10684730 | |||
| 1633 | Ga0207664_10819453 | |||
| 1634 | Ga0207664_11031224 | |||
| 1635 | Ga0207664_11069052 | |||
| 1636 | Ga0207664_11408966 | |||
| 1637 | Ga0207664_11443092 | |||
| 1638 | Ga0207644_10091967 | |||
| 1639 | Ga0207690_10059602 | |||
| 1640 | Ga0207706_10000048 | |||
| 1641 | Ga0207706_10004287 | |||
| 1642 | Ga0207686_10200339 | |||
| 1643 | Ga0207709_10014364 | |||
| 1644 | Ga0207670_10372013 | |||
| 1645 | Ga0207669_10277933 | |||
| 1646 | Ga0207669_11016033 | |||
| 1647 | Ga0207704_10009462 | |||
| 1648 | Ga0207704_10040610 | |||
| 1649 | Ga0207665_10000326 | |||
| 1650 | Ga0207665_10001590 | |||
| 1651 | Ga0207665_10007003 | |||
| 1652 | Ga0207665_10042800 | |||
| 1653 | Ga0207665_10048543 | |||
| 1654 | Ga0207665_10057230 | |||
| 1655 | Ga0207665_10122612 | |||
| 1656 | Ga0207665_10126324 | |||
| 1657 | Ga0207665_10232142 | |||
| 1658 | Ga0207665_10392708 | |||
| 1659 | Ga0207665_10537036 | |||
| 1660 | Ga0207665_10554499 | |||
| 1661 | Ga0207665_10626121 | |||
| 1662 | Ga0207665_10655792 | |||
| 1663 | Ga0207665_11527637 | |||
| 1664 | Ga0207665_11568423 | |||
| 1665 | Ga0207691_10000721 | |||
| 1666 | Ga0207711_10002079 | |||
| 1667 | Ga0207711_10058222 | |||
| 1668 | Ga0207711_11551166 | |||
| 1669 | Ga0207689_10010374 | |||
| 1670 | Ga0207689_10041384 | |||
| 1671 | Ga0207689_10078781 | |||
| 1672 | Ga0207689_11135203 | |||
| 1673 | Ga0207661_10001148 | |||
| 1674 | Ga0207661_10063706 | |||
| 1675 | Ga0207661_11914218 | |||
| 1676 | Ga0207679_10003643 | |||
| 1677 | Ga0207679_10202739 | |||
| 1678 | Ga0207679_11096265 | |||
| 1679 | Ga0207667_10004050 | |||
| 1680 | Ga0207667_10135994 | |||
| 1681 | Ga0207651_10065812 | |||
| 1682 | Ga0207712_10007284 | |||
| 1683 | Ga0207712_10036002 | |||
| 1684 | Ga0207712_10823536 | |||
| 1685 | Ga0207668_10052806 | |||
| 1686 | Ga0207668_11328446 | |||
| 1687 | Ga0207640_10002588 | |||
| 1688 | Ga0207640_10511208 | |||
| 1689 | Ga0207640_10728350 | |||
| 1690 | Ga0207658_10065657 | |||
| 1691 | Ga0207658_10080617 | |||
| 1692 | Ga0207677_10234952 | |||
| 1693 | Ga0207677_10288090 | |||
| 1694 | Ga0207677_10467629 | |||
| 1695 | Ga0207703_10093417 | |||
| 1696 | Ga0207703_11029506 | |||
| 1697 | Ga0207703_11163802 | |||
| 1698 | Ga0207639_10063533 | |||
| 1699 | Ga0207639_10251123 | |||
| 1700 | Ga0207678_10000388 | |||
| 1701 | Ga0207678_10002928 | |||
| 1702 | Ga0207678_10306755 | |||
| 1703 | Ga0207708_10233545 | |||
| 1704 | Ga0207702_10026929 | |||
| 1705 | Ga0207702_10098919 | |||
| 1706 | Ga0207702_10338684 | |||
| 1707 | Ga0207702_11033687 | |||
| 1708 | Ga0207641_10000183 | |||
| 1709 | Ga0207641_10065899 | |||
| 1710 | Ga0207641_10076011 | |||
| 1711 | Ga0207641_10980716 | |||
| 1712 | Ga0207648_10000063 | |||
| 1713 | Ga0207648_10099896 | |||
| 1714 | Ga0207676_10000536 | |||
| 1715 | Ga0207676_10772830 | |||
| 1716 | Ga0207674_10001582 | |||
| 1717 | Ga0207674_10249442 | |||
| 1718 | Ga0207675_100013698 | |||
| 1719 | Ga0207675_100147440 | |||
| 1720 | Ga0207683_10003861 | |||
| 1721 | Ga0207683_10119691 | |||
| 1722 | Ga0207698_10039524 | |||
| 1723 | Ga0207698_10572119 | |||
| 1724 | Ga0209179_1032941 | |||
| 1725 | Ga0209588_1058833 | |||
| 1726 | Ga0209974_10352875 | |||
| 1727 | Ga0265354_1012680 | |||
| 1728 | Ga0265354_1017113 | |||
| 1729 | Ga0265356_1000009 | |||
| 1730 | Ga0265356_1003264 | |||
| 1731 | Ga0265356_1006394 | |||
| 1732 | Ga0265355_1001124 | |||
| 1733 | Ga0265355_1009222 | |||
| 1734 | Ga0268266_10008112 | |||
| 1735 | Ga0268266_10078715 | |||
| 1736 | Ga0268266_10553817 | |||
| 1737 | Ga0268266_12051644 | |||
| 1738 | Ga0268265_10012882 | |||
| 1739 | Ga0268265_10130047 | |||
| 1740 | Ga0268264_10039167 | |||
| 1741 | Ga0268264_10060775 | |||
| 1742 | Ga0268264_10706010 | |||
| 1743 | Ga0265336_10130114 | |||
| 1744 | Ga0265338_10002910 | |||
| 1745 | Ga0265338_10091787 | |||
| 1746 | Ga0265338_10160047 | |||
| 1747 | Ga0265338_10263307 | |||
| 1748 | Ga0265338_11038433 | |||
| 1749 | Ga0265762_1003153 | |||
| 1750 | Ga0265762_1003335 | |||
| 1751 | Ga0265762_1050535 | |||
| 1752 | Ga0265762_1082697 | |||
| 1753 | Ga0265762_1181968 | |||
| 1754 | Ga0265763_1049870 | |||
| 1755 | Ga0265770_1047779 | |||
| 1756 | Ga0265770_1099058 | |||
| 1757 | Ga0265765_1000774 | |||
| 1758 | Ga0265765_1037590 | |||
| 1759 | Ga0265769_122017 | |||
| 1760 | Ga0265771_1000422 | |||
| 1761 | Ga0265773_1009065 | |||
| 1762 | Ga0265773_1011646 | |||
| 1763 | Ga0265760_10000974 | |||
| 1764 | Ga0265760_10001465 | |||
| 1765 | Ga0265760_10022711 | |||
| 1766 | Ga0265760_10045646 | |||
| 1767 | Ga0265760_10064779 | |||
| 1768 | Ga0265760_10154806 | |||
| 1769 | Ga0265760_10310012 | |||
| 1770 | Ga0265325_10015165 | |||
| 1771 | Ga0265325_10058038 | |||
| 1772 | Ga0265325_10109702 | |||
| 1773 | Ga0265325_10468160 | |||
| 1774 | Ga0265340_10015612 | |||
| 1775 | Ga0265340_10192784 | |||
| 1776 | Ga0265339_10072160 | |||
| 1777 | Ga0307408_100688626 | |||
| 1778 | Ga0307508_10783486 | |||
| 1779 | Ga0265342_10114337 | |||
| 1780 | Ga0316212_1005341 | |||
| 1781 | Ga0373948_0146517 | |||
| 1782 | Ga0373958_0170857 | |||
| 1783 | Ga0373959_0065550 | |||
| 1784 | Ga0373938_0008616 | |||
| 1785 | Ga0373926_0036187 | |||
| 1786 | Ga0373926_0460245 | |||
| 1787 | Ga0373929_0037319 | |||
| 1788 | Ga0373934_0108590 | |||
| 1789 | Ga0373940_0047243 | |||
| 1790 | Ga0373940_0113526 | |||
| 1791 | Ga0373949_0021801 | |||
| 1792 | Ga0373952_0146949 | |||
| 1793 | Ga0373923_0002660 | |||
| 1794 | Ga0373923_0153437 | |||
| 1795 | Ga0373923_0201757 | |||
| 1796 | Ga0373923_0379353 | |||
| 1797 | Ga0373923_0582411 | |||
| 1798 | Ga0373932_0026611 | |||
| 1799 | Ga0373932_0277330 | |||
| 1800 | Ga0373936_0006971 | |||
| 1801 | Ga0373936_0040082 | |||
| 1802 | Ga0373936_0530870 | |||
| 1803 | Ga0373945_0016630 | |||
| 1804 | Ga0373945_0492695 | |||
| 1805 | Ga0373953_0245631 | |||
| 1806 | Ga0373954_0016939 | |||
| 1807 | Ga0373954_0484467 | |||
| 1808 | Ga0373957_0010409 | |||
| 1809 | Ga0373957_0171387 | |||
| 1810 | Ga0373960_0187294 | |||
| 1811 | Ga0373943_0000271 | |||
| 1812 | Ga0373943_0061016 | |||
| 1813 | Ga0373943_0681143 | |||
| 1814 | Ga0373946_0007194 | |||
| 1815 | Ga0373946_0643407 | |||
| 1816 | Ga0373955_0044395 | |||
| 1817 | Ga0373955_0186295 | |||
| 1818 | Ga0373955_0367341 | |||
| 1819 | Ga0373955_0390853 | |||
| 1820 | Ga0373942_0201860 | |||
| 1821 | Ga0373961_0026579 | |||
| 1822 | Ga0373962_0391269 | |||
| 1823 | Ga0373924_0010668 | |||
| 1824 | Ga0373924_0109748 | |||
| 1825 | Ga0373924_0567196 | |||
| 1826 | Ga0373931_0018942 | |||
| 1827 | Ga0373935_0042083 | |||
| 1828 | Ga0373935_0062176 | |||
| 1829 | Ga0373935_0062581 | |||
| 1830 | Ga0373935_0369325 | |||
| 1831 | Ga0373935_0621461 | |||
| 1832 | Ga0373935_0794054 | |||
| 1833 | Ga0373935_1001166 | |||
| 1834 | Ga0373935_1177768 | |||
| 1835 | Ga0373935_1219064 | |||
| 1836 | Ga0373927_0000123 | |||
| 1837 | Ga0373927_0079107 | |||
| 1838 | Ga0373927_0204889 | |||
| 1839 | Ga0373927_0461421 | |||
| 1840 | Ga0373927_0577607 | |||
| 1841 | Ga0373927_0611731 | |||
| 1842 | Ga0373927_0728678 | |||
| 1843 | Ga0373927_0861255 | |||
| 1844 | Ga0373933_0342245 | |||
| 1845 | Ga0373933_0422705 | |||
| 1846 | Ga0373933_0434460 | |||
| 1847 | Ga0373933_0505313 | |||
| 1848 | Ga0373933_0575532 | |||
| 1849 | Ga0373933_0990092 | |||
| 1850 | Ga0373933_1011507 | |||
| 1851 | Ga0373947_0000757 | |||
| 1852 | Ga0373947_0086316 | |||
| 1853 | Ga0373947_0102449 | |||
| 1854 | Ga0373947_0166554 | |||
| 1855 | Ga0373947_0326586 | |||
| 1856 | Ga0373937_0086094 | |||
| 1857 | Ga0373937_0305068 | |||
| 1858 | Ga0373937_0344397 | |||
| 1859 | Ga0373937_0455024 | |||
| 1860 | Ga0373937_0668956 | |||
| 1861 | Ga0373937_1049736 | |||
| 1862 | Ga0373937_1186039 | |||
| 1863 | Ga0373925_0000589 | |||
| 1864 | Ga0373925_0006557 | |||
| 1865 | Ga0373925_0023231 | |||
| 1866 | Ga0373925_0035914 | |||
| 1867 | Ga0373925_0345084 | |||
| 1868 | Ga0373925_0487777 | |||
| 1869 | Ga0373925_1166428 | |||
| 1870 | Ga0373925_1222548 | |||
| 1871 | Ga0395905_0818467 | |||
| 1872 | Ga0436365_0213101 | |||
| 1873 | Ga0436360_0116685 | |||
| 1874 | Ga0436360_0643861 | |||
| 1875 | Ga0436361_1024562 | |||
| 1876 | Ga0436363_1306274 | |||
| 1877 | Ga0436363_1601056 | |||
| 1878 | Ga0436362_0088740 | |||
| 1879 | Ga0436362_0743766 | |||
| 1880 | Ga0451577_0041323 | |||
| 1881 | Ga0453683_0066458 | |||
| 1882 | Ga0453683_0119261 | |||
| 1883 | Ga0453684_0564639 | |||
| 1884 | Ga0466959_1200536 | |||
| 1885 | Ga0451576_0057431 | |||
| 1886 | Ga0451576_0203839 | |||
| 1887 | Ga0451576_0508087 | |||
| 1888 | Ga0466958_0691657 | |||
| 1889 | Ga0466967_0331126 | |||
| 1890 | Ga0495592_0372076 | |||
| 1891 | Ga0495603_0224756 | |||
| 1892 | Ga0495590_0035373 | |||
| 1893 | Ga0495629_0009854 | |||
| 1894 | Ga0495651_0184121 | |||
| 1895 | Ga0495651_0659480 | |||
| 1896 | Ga0495653_0734525 | |||
| 1897 | Ga0495580_0000609 | |||
| 1898 | Ga0495580_0001590 | |||
| 1899 | Ga0495580_0003591 | |||
| 1900 | Ga0495580_0006112 | |||
| 1901 | Ga0495580_0022020 | |||
| 1902 | Ga0495580_0026006 | |||
| 1903 | Ga0495580_0039583 | |||
| 1904 | Ga0495580_0121243 | |||
| 1905 | Ga0495580_0840009 | |||
| 1906 | Ga0495582_0016523 | |||
| 1907 | Ga0495582_0803187 | |||
| 1908 | Ga0495639_0108256 | |||
| 1909 | Ga0495664_0081591 | |||
| 1910 | Ga0495664_0682675 | |||
| 1911 | Ga0495594_0776007 | |||
| 1912 | Ga0495618_0604965 | |||
| 1913 | Ga0495628_0440303 | |||
| 1914 | Ga0495630_0045503 | |||
| 1915 | Ga0495630_0459745 | |||
| 1916 | Ga0495666_0089516 | |||
| 1917 | Ga0495652_0354739 | |||
| 1918 | Ga0495665_0262826 | |||
| 1919 | Ga0495640_0804633 | |||
| 1920 | Ga0495640_0894317 | |||
| 1921 | Ga0495622_0093102 | |||
| 1922 | Ga0495667_0221960 | |||
| 1923 | Ga0495635_0470649 | |||
| 1924 | Ga0495635_0547667 | |||
| 1925 | Ga0495659_0004901 | |||
| 1926 | Ga0495657_0378144 | |||
| 1927 | Ga0495657_0743095 | |||
| 1928 | Ga0495599_0391856 | |||
| 1929 | Ga0495623_0349843 | |||
| 1930 | Ga0495646_0174941 | |||
| 1931 | Ga0495658_0567108 | |||
| 1932 | Ga0495658_0658787 | |||
| 1933 | Ga0495658_0858505 | |||
| 1934 | Ga0495669_0321211 | |||
| 1935 | Ga0495669_0589745 | |||
| 1936 | Ga0495624_0593954 | |||
| 1937 | Ga0495624_0794473 | |||
| 1938 | Ga0495581_0423544 | |||
| 1939 | Ga0495581_0694354 | |||
| 1940 | Ga0495674_0015928 | |||
| 1941 | Ga0495674_0048500 | |||
| 1942 | Ga0495674_0133422 | |||
| 1943 | Ga0495674_0721518 | |||
| 1944 | Ga0495675_0797622 | |||
| 1945 | Ga0495684_0784390 | |||
| 1946 | Ga0495684_1054619 | |||
| 1947 | Ga0495593_0536115 | |||
| 1948 | Ga0495602_0385403 | |||
| 1949 | Ga0495602_0941697 | |||
| 1950 | Ga0495614_0206261 | |||
| 1951 | Ga0496100_0280788 | |||
| 1952 | Ga0496100_0597044 | |||
| 1953 | Ga0496100_0742905 | |||
| 1954 | Ga0496101_0052127 | |||
| 1955 | Ga0496101_0105617 | |||
| 1956 | Ga0496101_0571265 | |||
| 1957 | Ga0496101_0624846 | |||
| 1958 | Ga0496102_0001608 | |||
| 1959 | Ga0496102_0037848 | |||
| 1960 | Ga0496102_0073308 | |||
| 1961 | Ga0496102_0208403 | |||
| 1962 | Ga0496103_0001131 | |||
| 1963 | Ga0496103_0126374 | |||
| 1964 | Ga0496104_0020814 | |||
| 1965 | Ga0496104_0058780 | |||
| 1966 | Ga0496104_0230524 | |||
| 1967 | Ga0496104_0275215 | |||
| 1968 | Ga0496104_0608573 | |||
| 1969 | Ga0496105_0056250 | |||
| 1970 | Ga0496105_0466397 | |||
| 1971 | Ga0496105_0915144 | |||
| 1972 | Ga0496105_1230022 | |||
| 1973 | Ga0496106_0449594 | |||
| 1974 | Ga0496106_0867368 | |||
| 1975 | Ga0496107_0209947 | |||
| 1976 | Ga0496107_0252824 | |||
| 1977 | Ga0496107_0287070 | |||
| 1978 | Ga0496108_0002049 | |||
| 1979 | Ga0496108_0304228 | |||
| 1980 | Ga0496109_0001965 | |||
| 1981 | Ga0496109_0756972 | |||
| 1982 | Ga0496110_0000608 | |||
| 1983 | Ga0496110_0083303 | |||
| 1984 | Ga0496111_0003481 | |||
| 1985 | Ga0496111_0880988 | |||
| 1986 | Ga0496112_0000225 | |||
| 1987 | Ga0496112_0003304 | |||
| 1988 | Ga0496112_0023777 | |||
| 1989 | Ga0496113_0000151 | |||
| 1990 | Ga0496113_0054633 | |||
| 1991 | Ga0496113_0504699 | |||
| 1992 | Ga0496113_0783005 | |||
| 1993 | Ga0496113_0936958 | |||
| 1994 | Ga0496114_0141394 | |||
| 1995 | Ga0496114_1139542 | |||
| 1996 | Ga0496115_0004761 | |||
| 1997 | Ga0496115_0100396 | |||
| 1998 | Ga0496115_0177475 | |||
| 1999 | Ga0496115_0553950 | |||
| 2000 | Ga0496115_0804501 | |||
| 2001 | Ga0501299_032904 | |||
| 2002 | Ga0501069_0789096 | |||
| 2003 | Ga0501236_124659 | |||
| 2004 | nmdc:mga05p37_346514_c1 | |||
| 2005 | nmdc:mga08y16_1472035_c1 | |||
| 2006 | nmdc:mga0n895_1211_c1 | |||
| 2007 | nmdc:mga0n895_1230_c1 | |||
| 2008 | nmdc:mga0n895_717532_c1 | |||
| 2009 | nmdc:mga0rr50_1238948_c1 | |||
| 2010 | nmdc:mga0rr50_1398859_c1 | |||
| 2011 | nmdc:mga0rr50_1847_c2 | |||
| 2012 | nmdc:mga0rr50_21376_c1 | |||
| 2013 | nmdc:mga0rr50_466232_c1 | |||
| 2014 | nmdc:mga0rr50_550098_c1 | |||
| 2015 | nmdc:mga0rr50_560108_c1 | |||
| 2016 | nmdc:mga08x19_12995_c1 | |||
| 2017 | nmdc:mga08x19_166456_c1 | |||
| 2018 | nmdc:mga08x19_5938_c1 | |||
| 2019 | nmdc:mga0a205_225_c1 | |||
| 2020 | nmdc:mga0a205_88236_c1 | |||
| 2021 | Ga0495601_0387682 | |||
| 2022 | Ga0495601_0719154 | |||
| 2023 | Ga0495612_0060571 | |||
| 2024 | Ga0495612_0481524 | |||
| 2025 | Ga0495655_0259050 | |||
| 2026 | Ga0587062_141171 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4um2-assembly1.cif.gz_A | crystal structure of the tpr domain of smg6 | 0.9586 | 13 | 59 |
| 3k9a-assembly1.cif.gz_A | crystal structure of hiv gp41 with mper | 0.9036 | 13 | 74 |
| 6vli-assembly1.cif.gz_A | crystal structure of transcriptional regulator from bacteriophage 186 | 0.9005 | 12 | 57 |
| 5lmg-assembly2.cif.gz_B | structure of c-terminal domain from s. cerevisiae pat1 decapping activator bound to dcp2 hlm10 peptide (region 954-970) | 0.8953 | 7 | 59 |
| 8iyj-assembly1.cif.gz_k | cryo-em structure of the 48-nm repeat doublet microtubule from mouse sperm | 0.8951 | 14 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9I7K6_253_427_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9723 | 17 | 74 | 1.25.40.10 |
| 2wmmB01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9582 | 11 | 61 | 1.20.5.420 |
| af_Q2FYR1_179_367_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9477 | 14 | 69 | 3.40.630.30 |
| 2wmmA01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9379 | 11 | 61 | 1.20.5.420 |
| 2wmmB01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9208 | 11 | 61 | 1.20.5.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9U374-F1-model_v4 | DUF465 domain-containing protein | 1.006 | 1 | 76 |
|
| AF-A0A321LZQ7-F1-model_v4 | DUF465 domain-containing protein | 1.003 | 2 | 72 |
|
| AF-A0A5C0SAU3-F1-model_v4 | Spo0E like sporulation regulatory protein | 1.003 | 12 | 68 |
|
| AF-A0A497DZ56-F1-model_v4 | DUF465 domain-containing protein | 1.001 | 3 | 70 |
|
| AF-A0A383A896-F1-model_v4 | DUF465 domain-containing protein | 1 | 4 | 70 |
|