F488190

General Info

Members Datasets Scaffolds Average Seq Length
1013 345 2026 76

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100078239|Ga0070707_1000782391
Length 87
Sequence MLVLDLKSGQEVCWMLTPRDQLLASHEEFQKLAQEHTQYAQRLDSLTQKRYLTEDEKLEEVRLKKLKLRLKDQMESIERQYRQHQVA

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
139 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
214 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
215 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
238 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
345 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 2.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.94
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 30.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100078239 3300005468 Unclassified 3190
2 JGI24741J21665_1033816 3300001915 Bacteria 760
3 JGI24752J21851_1006609 3300001976 Bacteria 1516
4 JGI24743J22301_10012057 3300001991 Bacteria 1567
5 JGI24748J21848_1025698 3300002074 Bacteria 718
6 JGI24749J21850_1056880 3300002076 Bacteria 590
7 JGI24033J26618_1067013 3300002155 Bacteria 535
8 JGI24034J26672_10002729 3300002239 Unclassified 2435
9 JGI24751J29686_10003895 3300002459 Bacteria 3015
10 Ga0058861_12068115 3300004800 Unclassified 545
11 Ga0065704_10033639 3300005289 Bacteria 849
12 Ga0065712_10338493 3300005290 Bacteria 804
13 Ga0065715_10113296 3300005293 Bacteria 2496
14 Ga0065715_10667531 3300005293 Unclassified 665
15 Ga0065715_11082109 3300005293 Unclassified 524
16 Ga0070658_10600736 3300005327 Bacteria 954
17 Ga0070658_11979186 3300005327 Unclassified 503
18 Ga0070676_10003275 3300005328 Bacteria 8412
19 Ga0070676_10081298 3300005328 Bacteria 1966
20 Ga0070683_100004621 3300005329 Bacteria 11370
21 Ga0070683_100176771 3300005329 Bacteria 2026
22 Ga0070683_100569260 3300005329 Bacteria 1084
23 Ga0070690_100037269 3300005330 Bacteria 3063
24 Ga0070690_100103389 3300005330 Bacteria 1891
25 Ga0070670_100038118 3300005331 Bacteria 4133
26 Ga0070670_100167510 3300005331 Bacteria 1905
27 Ga0070677_10100228 3300005333 Bacteria 1276
28 Ga0070677_10182451 3300005333 Unclassified 1000
29 Ga0068869_100041154 3300005334 Bacteria 3307
30 Ga0068869_100044577 3300005334 Unclassified 3190
31 Ga0068869_100164441 3300005334 Bacteria 1729
32 Ga0070666_10017323 3300005335 Bacteria 4618
33 Ga0070666_10114327 3300005335 Bacteria 1868
34 Ga0070680_100148076 3300005336 Bacteria 1970
35 Ga0070680_100963660 3300005336 Bacteria 736
36 Ga0070680_101799629 3300005336 Unclassified 531
37 Ga0070682_100010844 3300005337 Bacteria 5185
38 Ga0070682_100017628 3300005337 Bacteria 4165
39 Ga0068868_100006913 3300005338 Bacteria 8060
40 Ga0068868_100296432 3300005338 Unclassified 1372
41 Ga0068868_100448747 3300005338 Unclassified 1121
42 Ga0068868_100604449 3300005338 Bacteria 972
43 Ga0070660_100035833 3300005339 Bacteria 3756
44 Ga0070660_100118597 3300005339 Bacteria 2110
45 Ga0070689_100144463 3300005340 Bacteria 1915
46 Ga0070691_10052150 3300005341 Bacteria 1956
47 Ga0070687_100037353 3300005343 Bacteria 2427
48 Ga0070687_100656714 3300005343 Bacteria 727
49 Ga0070661_100010243 3300005344 Bacteria 6512
50 Ga0070661_100261636 3300005344 Bacteria 1338
51 Ga0070692_10145328 3300005345 Bacteria 1346
52 Ga0070692_11372437 3300005345 Bacteria 509
53 Ga0070668_100027931 3300005347 Bacteria 4282
54 Ga0070668_100048610 3300005347 Bacteria 3262
55 Ga0070669_100037937 3300005353 Bacteria 3497
56 Ga0070669_101792330 3300005353 Unclassified 535
57 Ga0070675_100151397 3300005354 Bacteria 1989
58 Ga0070675_100187426 3300005354 Bacteria 1791
59 Ga0070671_100245420 3300005355 Bacteria 1520
60 Ga0070674_100277089 3300005356 Unclassified 1328
61 Ga0070673_100079283 3300005364 Bacteria 2658
62 Ga0070688_100030984 3300005365 Bacteria 3214
63 Ga0070688_100147906 3300005365 Unclassified 1603
64 Ga0070659_100011900 3300005366 Bacteria 6441
65 Ga0070659_100013235 3300005366 Bacteria 6135
66 Ga0070667_100017595 3300005367 Bacteria 5922
67 Ga0070667_100828119 3300005367 Bacteria 860
68 Ga0070709_10000752 3300005434 Bacteria 18313
69 Ga0070709_10026405 3300005434 Bacteria 3442
70 Ga0070709_10059583 3300005434 Bacteria 2424
71 Ga0070709_10084428 3300005434 Bacteria 2080
72 Ga0070709_10109402 3300005434 Bacteria 1855
73 Ga0070709_10167635 3300005434 Bacteria 1532
74 Ga0070709_10240943 3300005434 Bacteria 1299
75 Ga0070709_10259177 3300005434 Unclassified 1256
76 Ga0070709_10279919 3300005434 Bacteria 1212
77 Ga0070709_10280634 3300005434 Bacteria 1210
78 Ga0070709_10409430 3300005434 Bacteria 1014
79 Ga0070709_10830342 3300005434 Unclassified 727
80 Ga0070709_11187308 3300005434 Unclassified 613
81 Ga0070709_11520788 3300005434 Unclassified 544
82 Ga0070714_100000128 3300005435 Bacteria 59542
83 Ga0070714_100003652 3300005435 Bacteria 11519
84 Ga0070714_100100702 3300005435 Bacteria 2545
85 Ga0070714_100271249 3300005435 Bacteria 1573
86 Ga0070714_100549631 3300005435 Unclassified 1105
87 Ga0070714_100573582 3300005435 Unclassified 1082
88 Ga0070714_100604937 3300005435 Bacteria 1053
89 Ga0070714_100728296 3300005435 Bacteria 958
90 Ga0070714_100740984 3300005435 Unclassified 949
91 Ga0070714_100943352 3300005435 Unclassified 838
92 Ga0070714_101027327 3300005435 Unclassified 802
93 Ga0070714_101947373 3300005435 Bacteria 573
94 Ga0070714_102219061 3300005435 Unclassified 534
95 Ga0070713_100000078 3300005436 Bacteria 60357
96 Ga0070713_100000133 3300005436 Bacteria 48970
97 Ga0070713_100078181 3300005436 Unclassified 2815
98 Ga0070713_100080496 3300005436 Bacteria 2778
99 Ga0070713_100101772 3300005436 Bacteria 2489
100 Ga0070713_100127801 3300005436 Bacteria 2238
101 Ga0070713_100145619 3300005436 Bacteria 2102
102 Ga0070713_100147085 3300005436 Unclassified 2092
103 Ga0070713_100314194 3300005436 Unclassified 1445
104 Ga0070713_100392236 3300005436 Bacteria 1295
105 Ga0070713_100585957 3300005436 Bacteria 1058
106 Ga0070710_10004339 3300005437 Bacteria 6719
107 Ga0070710_10008612 3300005437 Bacteria 4968
108 Ga0070710_10018846 3300005437 Unclassified 3557
109 Ga0070710_10036605 3300005437 Bacteria 2684
110 Ga0070710_10063073 3300005437 Unclassified 2116
111 Ga0070710_10177556 3300005437 Bacteria 1331
112 Ga0070710_10449011 3300005437 Bacteria 874
113 Ga0070710_10562122 3300005437 Unclassified 789
114 Ga0070710_10746320 3300005437 Bacteria 695
115 Ga0070710_11352799 3300005437 Unclassified 531
116 Ga0070711_100000189 3300005439 Bacteria 32578
117 Ga0070711_100000517 3300005439 Bacteria 20051
118 Ga0070711_100021434 3300005439 Bacteria 4179
119 Ga0070711_100027778 3300005439 Bacteria 3717
120 Ga0070711_100028299 3300005439 Bacteria 3687
121 Ga0070711_100070816 3300005439 Bacteria 2456
122 Ga0070711_100101824 3300005439 Bacteria 2091
123 Ga0070711_100192634 3300005439 Archaea 1568
124 Ga0070711_100329372 3300005439 Bacteria 1222
125 Ga0070711_100707041 3300005439 Unclassified 849
126 Ga0070711_101120001 3300005439 Unclassified 679
127 Ga0070711_101505264 3300005439 Unclassified 587
128 Ga0070711_101848589 3300005439 Unclassified 530
129 Ga0070705_100139729 3300005440 Bacteria 1592
130 Ga0070705_100537550 3300005440 Bacteria 894
131 Ga0070705_101464647 3300005440 Unclassified 571
132 Ga0070700_101289745 3300005441 Unclassified 613
133 Ga0070700_102002774 3300005441 Unclassified 502
134 Ga0070694_100715056 3300005444 Bacteria 815
135 Ga0070708_100015770 3300005445 Bacteria 6246
136 Ga0070708_100047367 3300005445 Bacteria 3797
137 Ga0070708_100063530 3300005445 Bacteria 3305
138 Ga0070708_100149015 3300005445 Bacteria 2175
139 Ga0070708_100153456 3300005445 Unclassified 2143
140 Ga0070708_100181480 3300005445 Bacteria 1967
141 Ga0070708_101268910 3300005445 Unclassified 688
142 Ga0070708_101869785 3300005445 Unclassified 557
143 Ga0070663_100088468 3300005455 Bacteria 2290
144 Ga0070663_100110977 3300005455 Bacteria 2060
145 Ga0070663_101881138 3300005455 Unclassified 537
146 Ga0070678_100123198 3300005456 Bacteria 2048
147 Ga0070678_100473910 3300005456 Unclassified 1100
148 Ga0070662_100003450 3300005457 Bacteria 9856
149 Ga0070662_100125237 3300005457 Bacteria 1974
150 Ga0070681_10031904 3300005458 Bacteria 5289
151 Ga0070681_10069256 3300005458 Bacteria 3495
152 Ga0070681_10224598 3300005458 Bacteria 1793
153 Ga0070681_10678026 3300005458 Unclassified 946
154 Ga0070681_10945325 3300005458 Bacteria 781
155 Ga0068867_100054635 3300005459 Unclassified 2950
156 Ga0070685_10068999 3300005466 Bacteria 2089
157 Ga0070685_10198125 3300005466 Bacteria 1304
158 Ga0070706_100001770 3300005467 Bacteria 22364
159 Ga0070706_100002201 3300005467 Bacteria 19839
160 Ga0070706_100016311 3300005467 Bacteria 6863
161 Ga0070706_100052308 3300005467 Bacteria 3770
162 Ga0070706_100064806 3300005467 Bacteria 3378
163 Ga0070706_101416023 3300005467 Bacteria 636
164 Ga0070707_100000091 3300005468 Bacteria 81794
165 Ga0070707_100011671 3300005468 Bacteria 8196
166 Ga0070707_100026901 3300005468 Bacteria 5467
167 Ga0070707_100083496 3300005468 Bacteria 3086
168 Ga0070707_100258880 3300005468 Bacteria 1693
169 Ga0070707_100320872 3300005468 Bacteria 1505
170 Ga0070707_100460490 3300005468 Bacteria 1232
171 Ga0070707_100699198 3300005468 Bacteria 977
172 Ga0070707_100771738 3300005468 Unclassified 925
173 Ga0070707_100924642 3300005468 Bacteria 837
174 Ga0070707_101391438 3300005468 Bacteria 668
175 Ga0070707_101563240 3300005468 Bacteria 626
176 Ga0070698_100000027 3300005471 Bacteria 98052
177 Ga0070698_100000226 3300005471 Bacteria 55431
178 Ga0070698_100112749 3300005471 Bacteria 2684
179 Ga0070698_100678324 3300005471 Bacteria 972
180 Ga0070699_100000032 3300005518 Bacteria 136937
181 Ga0070699_100002069 3300005518 Bacteria 18149
182 Ga0070699_100003662 3300005518 Bacteria 13612
183 Ga0070699_100006912 3300005518 Bacteria 9865
184 Ga0070699_100247343 3300005518 Bacteria 1593
185 Ga0070699_100442637 3300005518 Unclassified 1178
186 Ga0070699_100847951 3300005518 Unclassified 836
187 Ga0070699_101213218 3300005518 Unclassified 692
188 Ga0070679_100044249 3300005530 Bacteria 4435
189 Ga0070679_100109442 3300005530 Bacteria 2749
190 Ga0070679_100905130 3300005530 Unclassified 826
191 Ga0070679_101177647 3300005530 Unclassified 711
192 Ga0070679_101178838 3300005530 Bacteria 711
193 Ga0070684_100039308 3300005535 Bacteria 4068
194 Ga0070684_100066892 3300005535 Bacteria 3155
195 Ga0070684_100854368 3300005535 Unclassified 852
196 Ga0070697_100000166 3300005536 Bacteria 53539
197 Ga0070697_100000902 3300005536 Bacteria 22350
198 Ga0070697_100002343 3300005536 Bacteria 14568
199 Ga0070697_100048678 3300005536 Unclassified 3437
200 Ga0070697_100235277 3300005536 Bacteria 1563
201 Ga0070697_100321207 3300005536 Unclassified 1333
202 Ga0070697_100342055 3300005536 Bacteria 1291
203 Ga0070697_100366232 3300005536 Unclassified 1246
204 Ga0068853_100012730 3300005539 Bacteria 6849
205 Ga0068853_100182064 3300005539 Bacteria 1906
206 Ga0070672_100338745 3300005543 Bacteria 1280
207 Ga0070686_100017238 3300005544 Bacteria 4217
208 Ga0070686_100030478 3300005544 Bacteria 3291
209 Ga0070686_100085327 3300005544 Unclassified 2100
210 Ga0070695_100100752 3300005545 Unclassified 1945
211 Ga0070695_100210766 3300005545 Bacteria 1394
212 Ga0070696_100104103 3300005546 Bacteria 2037
213 Ga0070696_100542363 3300005546 Unclassified 931
214 Ga0070696_100732162 3300005546 Bacteria 809
215 Ga0070693_100107977 3300005547 Bacteria 1707
216 Ga0070693_100110100 3300005547 Bacteria 1693
217 Ga0070665_100013996 3300005548 Bacteria 8068
218 Ga0070665_102382087 3300005548 Unclassified 532
219 Ga0070704_100402147 3300005549 Bacteria 1169
220 Ga0068855_100029749 3300005563 Bacteria 6530
221 Ga0068855_100063210 3300005563 Bacteria 4320
222 Ga0070664_100088635 3300005564 Bacteria 2675
223 Ga0070664_100650380 3300005564 Bacteria 980
224 Ga0070664_100765937 3300005564 Bacteria 901
225 Ga0068857_100029312 3300005577 Bacteria 4856
226 Ga0068857_100068768 3300005577 Bacteria 3152
227 Ga0068857_101840300 3300005577 Unclassified 593
228 Ga0068854_100011566 3300005578 Bacteria 5753
229 Ga0068854_100057319 3300005578 Bacteria 2810
230 Ga0068854_100895755 3300005578 Bacteria 779
231 Ga0068854_101139569 3300005578 Unclassified 696
232 Ga0068856_100028207 3300005614 Bacteria 5480
233 Ga0068856_100051815 3300005614 Bacteria 4046
234 Ga0068856_100150978 3300005614 Bacteria 2332
235 Ga0068856_100211765 3300005614 Bacteria 1953
236 Ga0070702_100086640 3300005615 Bacteria 1890
237 Ga0068852_100004955 3300005616 Bacteria 9460
238 Ga0068852_100054381 3300005616 Bacteria 3450
239 Ga0068852_102719078 3300005616 Unclassified 514
240 Ga0068859_100017990 3300005617 Bacteria 7102
241 Ga0068859_100207857 3300005617 Bacteria 2043
242 Ga0068859_102239659 3300005617 Unclassified 603
243 Ga0068864_100109218 3300005618 Bacteria 2462
244 Ga0068864_100195502 3300005618 Bacteria 1856
245 Ga0068864_101977081 3300005618 Unclassified 589
246 Ga0068866_10067230 3300005718 Unclassified 1880
247 Ga0068866_10082174 3300005718 Unclassified 1732
248 Ga0068861_100059708 3300005719 Bacteria 2921
249 Ga0068861_100333469 3300005719 Bacteria 1325
250 Ga0068851_10008145 3300005834 Bacteria 4839
251 Ga0068851_10012378 3300005834 Bacteria 4020
252 Ga0068870_10019594 3300005840 Bacteria 3283
253 Ga0068863_100121543 3300005841 Bacteria 2491
254 Ga0068863_100451812 3300005841 Bacteria 1261
255 Ga0068863_100908603 3300005841 Bacteria 881
256 Ga0068863_101505225 3300005841 Bacteria 681
257 Ga0068858_100092904 3300005842 Bacteria 2808
258 Ga0068858_100150484 3300005842 Bacteria 2188
259 Ga0068858_101240465 3300005842 Unclassified 733
260 Ga0068860_100014669 3300005843 Bacteria 7667
261 Ga0068860_100229000 3300005843 Unclassified 1806
262 Ga0068860_100844126 3300005843 Bacteria 930
263 Ga0068862_100029977 3300005844 Bacteria 4584
264 Ga0068862_100183452 3300005844 Bacteria 1879
265 Ga0068862_101613508 3300005844 Unclassified 656
266 Ga0081540_1084424 3300005983 Bacteria 1417
267 Ga0081540_1091210 3300005983 Bacteria 1340
268 Ga0081540_1156292 3300005983 Bacteria 892
269 Ga0070717_10005218 3300006028 Bacteria 9466
270 Ga0070717_10010950 3300006028 Bacteria 6868
271 Ga0070717_10026950 3300006028 Bacteria 4590
272 Ga0070717_10071635 3300006028 Bacteria 2892
273 Ga0070717_10086417 3300006028 Unclassified 2640
274 Ga0070717_10095308 3300006028 Unclassified 2519
275 Ga0070717_10110467 3300006028 Bacteria 2345
276 Ga0070717_10130139 3300006028 Unclassified 2164
277 Ga0070717_10238559 3300006028 Bacteria 1602
278 Ga0070717_10370925 3300006028 Bacteria 1282
279 Ga0070717_10395501 3300006028 Archaea 1241
280 Ga0070717_10497236 3300006028 Bacteria 1102
281 Ga0070717_10511264 3300006028 Bacteria 1086
282 Ga0070717_10702149 3300006028 Bacteria 919
283 Ga0070717_11273395 3300006028 Bacteria 669
284 Ga0070717_11579976 3300006028 Unclassified 595
285 Ga0070715_10006750 3300006163 Bacteria 3918
286 Ga0070715_10013201 3300006163 Bacteria 3028
287 Ga0070715_10020846 3300006163 Bacteria 2533
288 Ga0070715_10084048 3300006163 Bacteria 1451
289 Ga0070715_10311557 3300006163 Unclassified 846
290 Ga0070715_10423818 3300006163 Unclassified 745
291 Ga0070715_10584465 3300006163 Bacteria 652
292 Ga0070715_10834544 3300006163 Unclassified 562
293 Ga0070716_100000881 3300006173 Bacteria 12956
294 Ga0070716_100006268 3300006173 Bacteria 5806
295 Ga0070716_100011280 3300006173 Unclassified 4500
296 Ga0070716_100084619 3300006173 Unclassified 1903
297 Ga0070716_100145850 3300006173 Bacteria 1516
298 Ga0070716_100188448 3300006173 Bacteria 1361
299 Ga0070716_100188496 3300006173 Unclassified 1361
300 Ga0070716_100268442 3300006173 Bacteria 1171
301 Ga0070716_100304032 3300006173 Bacteria 1111
302 Ga0070716_100308818 3300006173 Bacteria 1103
303 Ga0070716_100596644 3300006173 Bacteria 830
304 Ga0070716_101014513 3300006173 Unclassified 657
305 Ga0070716_101084443 3300006173 Unclassified 638
306 Ga0070712_100000047 3300006175 Bacteria 65314
307 Ga0070712_100000156 3300006175 Bacteria 36864
308 Ga0070712_100000649 3300006175 Bacteria 20433
309 Ga0070712_100001728 3300006175 Bacteria 13362
310 Ga0070712_100046295 3300006175 Unclassified 3007
311 Ga0070712_100328358 3300006175 Bacteria 1246
312 Ga0070712_100359344 3300006175 Bacteria 1194
313 Ga0070712_100390079 3300006175 Unclassified 1148
314 Ga0070712_100506173 3300006175 Bacteria 1013
315 Ga0070712_100534253 3300006175 Bacteria 986
316 Ga0070712_101065742 3300006175 Unclassified 701
317 Ga0097621_100012031 3300006237 Bacteria 6402
318 Ga0097621_100060568 3300006237 Unclassified 3103
319 Ga0097621_100137826 3300006237 Bacteria 2083
320 Ga0097621_100209749 3300006237 Bacteria 1694
321 Ga0097621_100367318 3300006237 Unclassified 1283
322 Ga0097621_100805015 3300006237 Bacteria 871
323 Ga0097621_101002169 3300006237 Unclassified 781
324 Ga0068871_100015762 3300006358 Bacteria 5670
325 Ga0068871_100170472 3300006358 Bacteria 1865
326 Ga0068871_100245901 3300006358 Bacteria 1557
327 Ga0068871_101749361 3300006358 Unclassified 590
328 Ga0075433_10000203 3300006852 Bacteria 33282
329 Ga0075433_10174181 3300006852 Bacteria 1914
330 Ga0075434_100000016 3300006871 Bacteria 75294
331 Ga0075434_100001747 3300006871 Bacteria 18672
332 Ga0075434_100775620 3300006871 Unclassified 975
333 Ga0075434_100923064 3300006871 Bacteria 888
334 Ga0075434_102176069 3300006871 Bacteria 559
335 Ga0068865_100048226 3300006881 Bacteria 2930
336 Ga0075436_100002204 3300006914 Bacteria 13447
337 Ga0075436_100101665 3300006914 Unclassified 2002
338 Ga0075436_100710867 3300006914 Bacteria 745
339 Ga0097620_100017990 3300006931 Bacteria 7102
340 Ga0097620_100207853 3300006931 Bacteria 2043
341 Ga0097620_102239811 3300006931 Unclassified 603
342 Ga0075435_100000173 3300007076 Bacteria 37964
343 Ga0075435_100035103 3300007076 Bacteria 3978
344 Ga0075435_100111091 3300007076 Bacteria 2280
345 Ga0075435_100217729 3300007076 Bacteria 1621
346 Ga0075435_101220917 3300007076 Unclassified 658
347 Ga0099794_10093523 3300007265 Bacteria 1494
348 Ga0099794_10235581 3300007265 Unclassified 942
349 Ga0099794_10269852 3300007265 Bacteria 879
350 Ga0099794_10620459 3300007265 Unclassified 573
351 Ga0099795_10006741 3300007788 Bacteria 3152
352 Ga0099795_10180885 3300007788 Unclassified 880
353 Ga0105250_10071717 3300009092 Bacteria 1399
354 Ga0105250_10307856 3300009092 Bacteria 686
355 Ga0105240_10037841 3300009093 Bacteria 6196
356 Ga0105240_10071887 3300009093 Bacteria 4277
357 Ga0105240_10146767 3300009093 Bacteria 2814
358 Ga0105240_10151677 3300009093 Bacteria 2760
359 Ga0105240_12634126 3300009093 Unclassified 519
360 Ga0111539_11457666 3300009094 Unclassified 794
361 Ga0105245_10023080 3300009098 Bacteria 5460
362 Ga0105245_10030677 3300009098 Bacteria 4755
363 Ga0105245_10149993 3300009098 Bacteria 2204
364 Ga0105245_10417509 3300009098 Bacteria 1344
365 Ga0105247_10017833 3300009101 Bacteria 4257
366 Ga0105247_10104225 3300009101 Bacteria 1817
367 Ga0105247_10404589 3300009101 Bacteria 973
368 Ga0105247_10547382 3300009101 Unclassified 850
369 Ga0105247_10932564 3300009101 Bacteria 673
370 Ga0114129_10286706 3300009147 Bacteria 2198
371 Ga0114129_13438347 3300009147 Unclassified 508
372 Ga0105243_10008143 3300009148 Bacteria 8049
373 Ga0105241_10063812 3300009174 Bacteria 2843
374 Ga0105241_10138828 3300009174 Bacteria 1977
375 Ga0105241_10152210 3300009174 Bacteria 1893
376 Ga0105241_10319013 3300009174 Unclassified 1339
377 Ga0105241_11536629 3300009174 Unclassified 642
378 Ga0105242_10009635 3300009176 Bacteria 7402
379 Ga0105242_11269840 3300009176 Unclassified 759
380 Ga0105242_13103109 3300009176 Unclassified 515
381 Ga0105248_10004294 3300009177 Bacteria 15771
382 Ga0105248_10117024 3300009177 Unclassified 3006
383 Ga0105248_10129281 3300009177 Bacteria 2849
384 Ga0105248_10339967 3300009177 Bacteria 1690
385 Ga0105237_10029573 3300009545 Bacteria 5567
386 Ga0105237_10101265 3300009545 Bacteria 2873
387 Ga0105237_10144905 3300009545 Unclassified 2370
388 Ga0105237_10188217 3300009545 Bacteria 2064
389 Ga0105237_10461130 3300009545 Bacteria 1277
390 Ga0105237_12360198 3300009545 Unclassified 542
391 Ga0105237_12532673 3300009545 Unclassified 523
392 Ga0105238_10052183 3300009551 Bacteria 4111
393 Ga0105238_10235410 3300009551 Bacteria 1808
394 Ga0105238_11116841 3300009551 Unclassified 811
395 Ga0105249_10090658 3300009553 Bacteria 2858
396 Ga0105249_10107384 3300009553 Bacteria 2634
397 Ga0105249_10147805 3300009553 Unclassified 2259
398 Ga0099796_10020949 3300010159 Bacteria 2006
399 Ga0099796_10079919 3300010159 Bacteria 1197
400 Ga0099796_10084822 3300010159 Bacteria 1168
401 Ga0099796_10344619 3300010159 Unclassified 641
402 Ga0105239_10014054 3300010375 Bacteria 8887
403 Ga0105239_12021631 3300010375 Unclassified 669
404 Ga0105246_10006433 3300011119 Bacteria 7178
405 Ga0105246_10072271 3300011119 Unclassified 2432
406 Ga0105246_10460634 3300011119 Unclassified 1071
407 Ga0157325_1023642 3300012485 Unclassified 568
408 Ga0157373_10001333 3300013100 Bacteria 18897
409 Ga0157373_11535892 3300013100 Unclassified 509
410 Ga0157371_10007438 3300013102 Bacteria 8868
411 Ga0157371_10022254 3300013102 Bacteria 4648
412 Ga0157370_10150403 3300013104 Unclassified 2166
413 Ga0157370_10373164 3300013104 Unclassified 1314
414 Ga0157369_10048322 3300013105 Bacteria 4617
415 Ga0157369_10221669 3300013105 Bacteria 1980
416 Ga0157374_10002103 3300013296 Bacteria 16740
417 Ga0157374_10014783 3300013296 Bacteria 6835
418 Ga0157374_10369244 3300013296 Bacteria 1428
419 Ga0157374_12848252 3300013296 Unclassified 511
420 Ga0157378_10119785 3300013297 Unclassified 2424
421 Ga0157378_10244259 3300013297 Unclassified 1716
422 Ga0157378_10298489 3300013297 Unclassified 1558
423 Ga0157378_11795408 3300013297 Unclassified 661
424 Ga0157378_12046670 3300013297 Unclassified 623
425 Ga0157378_12351309 3300013297 Bacteria 585
426 Ga0163162_10013430 3300013306 Bacteria 7994
427 Ga0163162_10057046 3300013306 Unclassified 3933
428 Ga0163162_10067390 3300013306 Bacteria 3630
429 Ga0163162_10412528 3300013306 Bacteria 1483
430 Ga0157372_10013384 3300013307 Bacteria 8758
431 Ga0157372_10014532 3300013307 Bacteria 8425
432 Ga0157372_10020193 3300013307 Bacteria 7183
433 Ga0157372_10431276 3300013307 Bacteria 1536
434 Ga0157372_11680122 3300013307 Unclassified 731
435 Ga0157375_10069523 3300013308 Bacteria 3528
436 Ga0157375_10827844 3300013308 Bacteria 1073
437 Ga0163163_10012687 3300014325 Bacteria 7686
438 Ga0163163_10028596 3300014325 Bacteria 5356
439 Ga0163163_10398171 3300014325 Bacteria 1435
440 Ga0163163_10875057 3300014325 Bacteria 962
441 Ga0157380_10117385 3300014326 Bacteria 2247
442 Ga0182008_10029883 3300014497 Bacteria 2750
443 Ga0157377_10010559 3300014745 Bacteria 4571
444 Ga0157379_10003230 3300014968 Bacteria 13811
445 Ga0157379_10042368 3300014968 Bacteria 4064
446 Ga0157379_10057309 3300014968 Bacteria 3482
447 Ga0157379_10331916 3300014968 Unclassified 1390
448 Ga0157376_10019022 3300014969 Bacteria 5283
449 Ga0157376_10033236 3300014969 Bacteria 4150
450 Ga0157376_10699902 3300014969 Unclassified 1018
451 Ga0157376_12502725 3300014969 Bacteria 556
452 Ga0182006_1047945 3300015261 Bacteria 1654
453 Ga0182007_10132730 3300015262 Unclassified 838
454 Ga0182005_1084277 3300015265 Unclassified 880
455 Ga0163161_10003472 3300017792 Bacteria 11047
456 Ga0213873_10014330 3300021358 Bacteria 1755
457 Ga0224569_104280 3300022732 Bacteria 1086
458 Ga0224571_101031 3300022734 Bacteria 1692
459 Ga0224572_1012871 3300024225 Bacteria 1594
460 Ga0224572_1050267 3300024225 Unclassified 777
461 Ga0228598_1002428 3300024227 Bacteria 4069
462 Ga0228598_1014444 3300024227 Bacteria 1562
463 Ga0228598_1033115 3300024227 Bacteria 1018
464 Ga0207697_10005682 3300025315 Bacteria 5755
465 Ga0207656_10001681 3300025321 Bacteria 7348
466 Ga0207656_10032949 3300025321 Bacteria 2155
467 Ga0207696_1112319 3300025711 Bacteria 738
468 Ga0207696_1183839 3300025711 Unclassified 552
469 Ga0207682_10091582 3300025893 Unclassified 1319
470 Ga0207692_10008567 3300025898 Bacteria 4238
471 Ga0207692_10013176 3300025898 Unclassified 3580
472 Ga0207692_10083891 3300025898 Bacteria 1711
473 Ga0207692_10092337 3300025898 Bacteria 1644
474 Ga0207692_10516941 3300025898 Bacteria 759
475 Ga0207692_10517462 3300025898 Unclassified 759
476 Ga0207692_10561048 3300025898 Bacteria 731
477 Ga0207642_10014209 3300025899 Bacteria 2931
478 Ga0207642_10018561 3300025899 Bacteria 2673
479 Ga0207642_10915337 3300025899 Unclassified 562
480 Ga0207710_10030416 3300025900 Unclassified 2356
481 Ga0207710_10046728 3300025900 Bacteria 1933
482 Ga0207710_10148325 3300025900 Bacteria 1136
483 Ga0207710_10383881 3300025900 Unclassified 719
484 Ga0207688_10026648 3300025901 Unclassified 3180
485 Ga0207680_10011553 3300025903 Bacteria 4466
486 Ga0207680_10063583 3300025903 Unclassified 2259
487 Ga0207647_10037541 3300025904 Bacteria 3071
488 Ga0207647_10093744 3300025904 Bacteria 1789
489 Ga0207685_10011500 3300025905 Bacteria 2662
490 Ga0207685_10021033 3300025905 Bacteria 2179
491 Ga0207685_10036902 3300025905 Bacteria 1795
492 Ga0207685_10145109 3300025905 Unclassified 1068
493 Ga0207685_10316401 3300025905 Unclassified 777
494 Ga0207699_10019860 3300025906 Bacteria 3592
495 Ga0207699_10142458 3300025906 Bacteria 1577
496 Ga0207699_10165923 3300025906 Bacteria 1474
497 Ga0207699_10216972 3300025906 Bacteria 1304
498 Ga0207699_10273896 3300025906 Bacteria 1171
499 Ga0207699_10311664 3300025906 Unclassified 1101
500 Ga0207699_10320229 3300025906 Bacteria 1087
501 Ga0207699_10449664 3300025906 Unclassified 924
502 Ga0207699_10454268 3300025906 Unclassified 919
503 Ga0207699_10557740 3300025906 Bacteria 831
504 Ga0207699_10597405 3300025906 Bacteria 803
505 Ga0207699_10696845 3300025906 Unclassified 743
506 Ga0207699_11065101 3300025906 Bacteria 598
507 Ga0207699_11122367 3300025906 Unclassified 582
508 Ga0207699_11178849 3300025906 Unclassified 567
509 Ga0207645_10000021 3300025907 Bacteria 104186
510 Ga0207645_10004345 3300025907 Bacteria 10499
511 Ga0207643_10007444 3300025908 Bacteria 5874
512 Ga0207643_10436204 3300025908 Unclassified 832
513 Ga0207705_10594852 3300025909 Bacteria 860
514 Ga0207684_10000238 3300025910 Bacteria 83165
515 Ga0207684_10001028 3300025910 Bacteria 31287
516 Ga0207684_10002047 3300025910 Bacteria 20752
517 Ga0207684_10057239 3300025910 Bacteria 3307
518 Ga0207684_10244115 3300025910 Bacteria 1549
519 Ga0207684_10247668 3300025910 Bacteria 1537
520 Ga0207654_10042939 3300025911 Bacteria 2561
521 Ga0207654_10179570 3300025911 Bacteria 1380
522 Ga0207654_10722339 3300025911 Bacteria 716
523 Ga0207654_11054510 3300025911 Unclassified 592
524 Ga0207707_10016277 3300025912 Bacteria 6487
525 Ga0207707_10055851 3300025912 Bacteria 3435
526 Ga0207707_10447399 3300025912 Bacteria 1106
527 Ga0207707_10754267 3300025912 Unclassified 814
528 Ga0207695_10007368 3300025913 Bacteria 14040
529 Ga0207695_10016928 3300025913 Bacteria 8506
530 Ga0207695_10318637 3300025913 Bacteria 1444
531 Ga0207695_10389091 3300025913 Unclassified 1279
532 Ga0207695_10470820 3300025913 Unclassified 1139
533 Ga0207695_10749349 3300025913 Bacteria 857
534 Ga0207695_10881542 3300025913 Bacteria 774
535 Ga0207671_10064944 3300025914 Bacteria 2714
536 Ga0207671_10938039 3300025914 Unclassified 683
537 Ga0207671_11169156 3300025914 Unclassified 603
538 Ga0207671_11264466 3300025914 Bacteria 576
539 Ga0207693_10000044 3300025915 Bacteria 103362
540 Ga0207693_10000097 3300025915 Bacteria 77565
541 Ga0207693_10000546 3300025915 Bacteria 34039
542 Ga0207693_10006025 3300025915 Bacteria 10050
543 Ga0207693_10066246 3300025915 Bacteria 2828
544 Ga0207693_10113772 3300025915 Bacteria 2123
545 Ga0207693_10116175 3300025915 Bacteria 2101
546 Ga0207693_10137353 3300025915 Bacteria 1922
547 Ga0207693_10366040 3300025915 Bacteria 1128
548 Ga0207693_10539978 3300025915 Bacteria 909
549 Ga0207693_10869690 3300025915 Bacteria 692
550 Ga0207663_10000276 3300025916 Bacteria 22338
551 Ga0207663_10001127 3300025916 Bacteria 12306
552 Ga0207663_10030227 3300025916 Bacteria 3193
553 Ga0207663_10096029 3300025916 Bacteria 1979
554 Ga0207663_10123387 3300025916 Bacteria 1777
555 Ga0207663_10132697 3300025916 Bacteria 1723
556 Ga0207663_10234390 3300025916 Bacteria 1343
557 Ga0207663_10386717 3300025916 Archaea 1067
558 Ga0207663_10389470 3300025916 Unclassified 1063
559 Ga0207663_10688931 3300025916 Bacteria 808
560 Ga0207663_10740562 3300025916 Bacteria 780
561 Ga0207663_11058094 3300025916 Bacteria 652
562 Ga0207663_11422740 3300025916 Unclassified 558
563 Ga0207663_11600215 3300025916 Unclassified 524
564 Ga0207660_10362344 3300025917 Bacteria 1163
565 Ga0207660_10819818 3300025917 Unclassified 759
566 Ga0207662_10015324 3300025918 Bacteria 4314
567 Ga0207657_10001918 3300025919 Bacteria 22449
568 Ga0207657_10004787 3300025919 Bacteria 14280
569 Ga0207649_10000836 3300025920 Bacteria 19838
570 Ga0207649_10132580 3300025920 Bacteria 1695
571 Ga0207652_10024152 3300025921 Bacteria 5042
572 Ga0207652_10146421 3300025921 Bacteria 2114
573 Ga0207646_10000073 3300025922 Bacteria 140267
574 Ga0207646_10001530 3300025922 Bacteria 28310
575 Ga0207646_10096540 3300025922 Bacteria 2648
576 Ga0207646_10182814 3300025922 Unclassified 1894
577 Ga0207646_10513541 3300025922 Bacteria 1079
578 Ga0207646_11188135 3300025922 Unclassified 669
579 Ga0207646_11292698 3300025922 Bacteria 637
580 Ga0207646_11449621 3300025922 Bacteria 596
581 Ga0207646_11506863 3300025922 Unclassified 582
582 Ga0207681_10035914 3300025923 Bacteria 3267
583 Ga0207681_10774621 3300025923 Bacteria 800
584 Ga0207694_10162801 3300025924 Bacteria 1803
585 Ga0207694_10239595 3300025924 Bacteria 1482
586 Ga0207694_10643205 3300025924 Unclassified 893
587 Ga0207650_10000097 3300025925 Bacteria 115583
588 Ga0207650_10216033 3300025925 Unclassified 1541
589 Ga0207650_11646433 3300025925 Unclassified 544
590 Ga0207659_10555648 3300025926 Bacteria 976
591 Ga0207659_11668407 3300025926 Bacteria 543
592 Ga0207687_10018851 3300025927 Unclassified 4562
593 Ga0207687_10075610 3300025927 Bacteria 2418
594 Ga0207687_10163917 3300025927 Unclassified 1708
595 Ga0207687_11213842 3300025927 Bacteria 648
596 Ga0207700_10000227 3300025928 Bacteria 33670
597 Ga0207700_10002357 3300025928 Bacteria 10847
598 Ga0207700_10033743 3300025928 Bacteria 3665
599 Ga0207700_10044086 3300025928 Bacteria 3281
600 Ga0207700_10148298 3300025928 Bacteria 1936
601 Ga0207700_10155263 3300025928 Bacteria 1896
602 Ga0207700_10270357 3300025928 Bacteria 1459
603 Ga0207700_10295320 3300025928 Bacteria 1398
604 Ga0207700_10401378 3300025928 Bacteria 1201
605 Ga0207700_10406850 3300025928 Bacteria 1193
606 Ga0207700_10444398 3300025928 Bacteria 1142
607 Ga0207700_10706066 3300025928 Bacteria 900
608 Ga0207700_10866673 3300025928 Bacteria 808
609 Ga0207700_11449954 3300025928 Unclassified 610
610 Ga0207700_11521598 3300025928 Unclassified 593
611 Ga0207664_10000033 3300025929 Bacteria 176549
612 Ga0207664_10008409 3300025929 Bacteria 7196
613 Ga0207664_10027738 3300025929 Bacteria 4298
614 Ga0207664_10064432 3300025929 Bacteria 2931
615 Ga0207664_10138671 3300025929 Bacteria 2055
616 Ga0207664_10319773 3300025929 Bacteria 1369
617 Ga0207664_10485846 3300025929 Unclassified 1105
618 Ga0207664_10642628 3300025929 Bacteria 953
619 Ga0207664_10684730 3300025929 Unclassified 922
620 Ga0207664_10819453 3300025929 Unclassified 837
621 Ga0207664_11031224 3300025929 Bacteria 737
622 Ga0207664_11069052 3300025929 Unclassified 722
623 Ga0207664_11408966 3300025929 Unclassified 618
624 Ga0207664_11443092 3300025929 Unclassified 609
625 Ga0207644_10091967 3300025931 Bacteria 2262
626 Ga0207690_10059602 3300025932 Bacteria 2587
627 Ga0207706_10000048 3300025933 Bacteria 117454
628 Ga0207706_10004287 3300025933 Bacteria 13405
629 Ga0207686_10200339 3300025934 Bacteria 1429
630 Ga0207709_10014364 3300025935 Bacteria 4371
631 Ga0207670_10372013 3300025936 Bacteria 1136
632 Ga0207669_10277933 3300025937 Unclassified 1261
633 Ga0207669_11016033 3300025937 Bacteria 697
634 Ga0207704_10009462 3300025938 Bacteria 4703
635 Ga0207704_10040610 3300025938 Bacteria 2721
636 Ga0207665_10000326 3300025939 Bacteria 32993
637 Ga0207665_10001590 3300025939 Bacteria 15301
638 Ga0207665_10007003 3300025939 Bacteria 7464
639 Ga0207665_10042800 3300025939 Bacteria 3027
640 Ga0207665_10048543 3300025939 Bacteria 2850
641 Ga0207665_10057230 3300025939 Bacteria 2633
642 Ga0207665_10122612 3300025939 Bacteria 1837
643 Ga0207665_10126324 3300025939 Unclassified 1811
644 Ga0207665_10232142 3300025939 Bacteria 1356
645 Ga0207665_10392708 3300025939 Bacteria 1055
646 Ga0207665_10537036 3300025939 Unclassified 907
647 Ga0207665_10554499 3300025939 Unclassified 893
648 Ga0207665_10626121 3300025939 Unclassified 842
649 Ga0207665_10655792 3300025939 Unclassified 823
650 Ga0207665_11527637 3300025939 Unclassified 530
651 Ga0207665_11568423 3300025939 Unclassified 522
652 Ga0207691_10000721 3300025940 Bacteria 32643
653 Ga0207711_10002079 3300025941 Bacteria 18085
654 Ga0207711_10058222 3300025941 Bacteria 3324
655 Ga0207711_11551166 3300025941 Unclassified 605
656 Ga0207689_10010374 3300025942 Bacteria 8028
657 Ga0207689_10041384 3300025942 Bacteria 3812
658 Ga0207689_10078781 3300025942 Unclassified 2708
659 Ga0207689_11135203 3300025942 Bacteria 658
660 Ga0207661_10001148 3300025944 Bacteria 17682
661 Ga0207661_10063706 3300025944 Bacteria 2987
662 Ga0207661_11914218 3300025944 Unclassified 539
663 Ga0207679_10003643 3300025945 Bacteria 9546
664 Ga0207679_10202739 3300025945 Bacteria 1658
665 Ga0207679_11096265 3300025945 Unclassified 730
666 Ga0207667_10004050 3300025949 Bacteria 18001
667 Ga0207667_10135994 3300025949 Bacteria 2531
668 Ga0207651_10065812 3300025960 Bacteria 2543
669 Ga0207712_10007284 3300025961 Bacteria 6977
670 Ga0207712_10036002 3300025961 Unclassified 3368
671 Ga0207712_10823536 3300025961 Unclassified 817
672 Ga0207668_10052806 3300025972 Bacteria 2813
673 Ga0207668_11328446 3300025972 Unclassified 647
674 Ga0207640_10002588 3300025981 Bacteria 9689
675 Ga0207640_10511208 3300025981 Unclassified 1002
676 Ga0207640_10728350 3300025981 Bacteria 853
677 Ga0207658_10065657 3300025986 Bacteria 2726
678 Ga0207658_10080617 3300025986 Bacteria 2493
679 Ga0207677_10234952 3300026023 Bacteria 1479
680 Ga0207677_10288090 3300026023 Bacteria 1351
681 Ga0207677_10467629 3300026023 Bacteria 1084
682 Ga0207703_10093417 3300026035 Bacteria 2533
683 Ga0207703_11029506 3300026035 Bacteria 790
684 Ga0207703_11163802 3300026035 Unclassified 741
685 Ga0207639_10063533 3300026041 Bacteria 2859
686 Ga0207639_10251123 3300026041 Unclassified 1542
687 Ga0207678_10000388 3300026067 Bacteria 40020
688 Ga0207678_10002928 3300026067 Bacteria 15472
689 Ga0207678_10306755 3300026067 Unclassified 1364
690 Ga0207708_10233545 3300026075 Bacteria 1477
691 Ga0207702_10026929 3300026078 Bacteria 4774
692 Ga0207702_10098919 3300026078 Bacteria 2570
693 Ga0207702_10338684 3300026078 Bacteria 1436
694 Ga0207702_11033687 3300026078 Bacteria 815
695 Ga0207641_10000183 3300026088 Bacteria 87085
696 Ga0207641_10065899 3300026088 Bacteria 3099
697 Ga0207641_10076011 3300026088 Bacteria 2902
698 Ga0207641_10980716 3300026088 Bacteria 841
699 Ga0207648_10000063 3300026089 Bacteria 99270
700 Ga0207648_10099896 3300026089 Bacteria 2541
701 Ga0207676_10000536 3300026095 Bacteria 31866
702 Ga0207676_10772830 3300026095 Bacteria 935
703 Ga0207674_10001582 3300026116 Bacteria 29319
704 Ga0207674_10249442 3300026116 Bacteria 1722
705 Ga0207675_100013698 3300026118 Bacteria 7569
706 Ga0207675_100147440 3300026118 Bacteria 2238
707 Ga0207683_10003861 3300026121 Bacteria 13007
708 Ga0207683_10119691 3300026121 Unclassified 2363
709 Ga0207698_10039524 3300026142 Bacteria 3496
710 Ga0207698_10572119 3300026142 Bacteria 1110
711 Ga0209179_1032941 3300027512 Bacteria 1069
712 Ga0209588_1058833 3300027671 Bacteria 1242
713 Ga0209974_10352875 3300027876 Unclassified 571
714 Ga0265354_1012680 3300028016 Unclassified 799
715 Ga0265354_1017113 3300028016 Unclassified 687
716 Ga0265356_1000009 3300028017 Bacteria 31596
717 Ga0265356_1003264 3300028017 Bacteria 2064
718 Ga0265356_1006394 3300028017 Unclassified 1378
719 Ga0265355_1001124 3300028036 Bacteria 1659
720 Ga0265355_1009222 3300028036 Unclassified 797
721 Ga0268266_10008112 3300028379 Bacteria 9376
722 Ga0268266_10078715 3300028379 Bacteria 2869
723 Ga0268266_10553817 3300028379 Unclassified 1102
724 Ga0268266_12051644 3300028379 Unclassified 545
725 Ga0268265_10012882 3300028380 Bacteria 5675
726 Ga0268265_10130047 3300028380 Bacteria 2090
727 Ga0268264_10039167 3300028381 Bacteria 3916
728 Ga0268264_10060775 3300028381 Bacteria 3167
729 Ga0268264_10706010 3300028381 Unclassified 1002
730 Ga0265336_10130114 3300028666 Unclassified 749
731 Ga0265338_10002910 3300028800 Bacteria 24891
732 Ga0265338_10091787 3300028800 Unclassified 2507
733 Ga0265338_10160047 3300028800 Unclassified 1740
734 Ga0265338_10263307 3300028800 Unclassified 1266
735 Ga0265338_11038433 3300028800 Bacteria 554
736 Ga0265762_1003153 3300030760 Bacteria 2945
737 Ga0265762_1003335 3300030760 Bacteria 2870
738 Ga0265762_1050535 3300030760 Bacteria 834
739 Ga0265762_1082697 3300030760 Unclassified 690
740 Ga0265762_1181968 3300030760 Unclassified 518
741 Ga0265763_1049870 3300030763 Bacteria 525
742 Ga0265770_1047779 3300030878 Bacteria 766
743 Ga0265770_1099058 3300030878 Unclassified 591
744 Ga0265765_1000774 3300030879 Bacteria 2733
745 Ga0265765_1037590 3300030879 Unclassified 635
746 Ga0265769_122017 3300030888 Bacteria 511
747 Ga0265771_1000422 3300031010 Unclassified 1527
748 Ga0265773_1009065 3300031018 Unclassified 812
749 Ga0265773_1011646 3300031018 Bacteria 759
750 Ga0265760_10000974 3300031090 Bacteria 8273
751 Ga0265760_10001465 3300031090 Bacteria 6948
752 Ga0265760_10022711 3300031090 Bacteria 1819
753 Ga0265760_10045646 3300031090 Bacteria 1313
754 Ga0265760_10064779 3300031090 Bacteria 1115
755 Ga0265760_10154806 3300031090 Unclassified 753
756 Ga0265760_10310012 3300031090 Unclassified 560
757 Ga0265325_10015165 3300031241 Bacteria 4340
758 Ga0265325_10058038 3300031241 Bacteria 1972
759 Ga0265325_10109702 3300031241 Unclassified 1342
760 Ga0265325_10468160 3300031241 Unclassified 548
761 Ga0265340_10015612 3300031247 Bacteria 3945
762 Ga0265340_10192784 3300031247 Bacteria 918
763 Ga0265339_10072160 3300031249 Bacteria 1837
764 Ga0307408_100688626 3300031548 Bacteria 918
765 Ga0307508_10783486 3300031616 Unclassified 569
766 Ga0265342_10114337 3300031712 Bacteria 1525
767 Ga0316212_1005341 3300033547 Bacteria 1867
768 Ga0373948_0146517 3300034817 Bacteria 587
769 Ga0373958_0170857 3300034819 Unclassified 555
770 Ga0373959_0065550 3300034820 Bacteria 812
771 Ga0373938_0008616 3300034957 Bacteria 1827
772 Ga0373926_0036187 3300035083 Bacteria 1753
773 Ga0373926_0460245 3300035083 Unclassified 505
774 Ga0373929_0037319 3300035085 Bacteria 1065
775 Ga0373934_0108590 3300035086 Bacteria 1124
776 Ga0373940_0047243 3300035088 Bacteria 1200
777 Ga0373940_0113526 3300035088 Bacteria 834
778 Ga0373949_0021801 3300035090 Bacteria 1473
779 Ga0373952_0146949 3300035092 Unclassified 659
780 Ga0373923_0002660 3300035111 Bacteria 5552
781 Ga0373923_0153437 3300035111 Bacteria 1047
782 Ga0373923_0201757 3300035111 Bacteria 920
783 Ga0373923_0379353 3300035111 Unclassified 678
784 Ga0373923_0582411 3300035111 Unclassified 550
785 Ga0373932_0026611 3300035112 Bacteria 1575
786 Ga0373932_0277330 3300035112 Bacteria 619
787 Ga0373936_0006971 3300035113 Bacteria 4253
788 Ga0373936_0040082 3300035113 Bacteria 1875
789 Ga0373936_0530870 3300035113 Unclassified 549
790 Ga0373945_0016630 3300035116 Bacteria 2483
791 Ga0373945_0492695 3300035116 Unclassified 545
792 Ga0373953_0245631 3300035117 Bacteria 777
793 Ga0373954_0016939 3300035118 Bacteria 3269
794 Ga0373954_0484467 3300035118 Unclassified 613
795 Ga0373957_0010409 3300035120 Bacteria 3075
796 Ga0373957_0171387 3300035120 Bacteria 897
797 Ga0373960_0187294 3300035121 Unclassified 725
798 Ga0373943_0000271 3300035170 Bacteria 21388
799 Ga0373943_0061016 3300035170 Unclassified 1884
800 Ga0373943_0681143 3300035170 Unclassified 609
801 Ga0373946_0007194 3300035171 Bacteria 4064
802 Ga0373946_0643407 3300035171 Unclassified 552
803 Ga0373955_0044395 3300035172 Bacteria 2394
804 Ga0373955_0186295 3300035172 Bacteria 1233
805 Ga0373955_0367341 3300035172 Bacteria 872
806 Ga0373955_0390853 3300035172 Unclassified 845
807 Ga0373942_0201860 3300035207 Bacteria 660
808 Ga0373961_0026579 3300035241 Bacteria 1583
809 Ga0373962_0391269 3300035242 Unclassified 510
810 Ga0373924_0010668 3300035410 Bacteria 3397
811 Ga0373924_0109748 3300035410 Bacteria 1192
812 Ga0373924_0567196 3300035410 Unclassified 511
813 Ga0373931_0018942 3300035691 Bacteria 3429
814 Ga0373935_0042083 3300035692 Bacteria 2871
815 Ga0373935_0062176 3300035692 Unclassified 2391
816 Ga0373935_0062581 3300035692 Unclassified 2384
817 Ga0373935_0369325 3300035692 Bacteria 1026
818 Ga0373935_0621461 3300035692 Unclassified 791
819 Ga0373935_0794054 3300035692 Bacteria 699
820 Ga0373935_1001166 3300035692 Unclassified 621
821 Ga0373935_1177768 3300035692 Unclassified 571
822 Ga0373935_1219064 3300035692 Unclassified 561
823 Ga0373927_0000123 3300035695 Bacteria 58803
824 Ga0373927_0079107 3300035695 Bacteria 2130
825 Ga0373927_0204889 3300035695 Unclassified 1295
826 Ga0373927_0461421 3300035695 Unclassified 839
827 Ga0373927_0577607 3300035695 Unclassified 743
828 Ga0373927_0611731 3300035695 Unclassified 720
829 Ga0373927_0728678 3300035695 Unclassified 655
830 Ga0373927_0861255 3300035695 Unclassified 598
831 Ga0373933_0342245 3300035724 Unclassified 971
832 Ga0373933_0422705 3300035724 Unclassified 870
833 Ga0373933_0434460 3300035724 Bacteria 858
834 Ga0373933_0505313 3300035724 Bacteria 792
835 Ga0373933_0575532 3300035724 Unclassified 739
836 Ga0373933_0990092 3300035724 Unclassified 554
837 Ga0373933_1011507 3300035724 Unclassified 547
838 Ga0373947_0000757 3300035725 Bacteria 19372
839 Ga0373947_0086316 3300035725 Bacteria 1950
840 Ga0373947_0102449 3300035725 Bacteria 1800
841 Ga0373947_0166554 3300035725 Bacteria 1428
842 Ga0373947_0326586 3300035725 Bacteria 1027
843 Ga0373937_0086094 3300036401 Bacteria 2908
844 Ga0373937_0305068 3300036401 Unclassified 1505
845 Ga0373937_0344397 3300036401 Bacteria 1411
846 Ga0373937_0455024 3300036401 Unclassified 1216
847 Ga0373937_0668956 3300036401 Unclassified 984
848 Ga0373937_1049736 3300036401 Unclassified 764
849 Ga0373937_1186039 3300036401 Unclassified 712
850 Ga0373925_0000589 3300037068 Bacteria 35013
851 Ga0373925_0006557 3300037068 Bacteria 8556
852 Ga0373925_0023231 3300037068 Bacteria 4525
853 Ga0373925_0035914 3300037068 Bacteria 3658
854 Ga0373925_0345084 3300037068 Bacteria 1208
855 Ga0373925_0487777 3300037068 Bacteria 1011
856 Ga0373925_1166428 3300037068 Unclassified 633
857 Ga0373925_1222548 3300037068 Unclassified 617
858 Ga0395905_0818467 3300037471 Unclassified 834
859 Ga0436365_0213101 3300039437 Bacteria 2661
860 Ga0436360_0116685 3300039438 Unclassified 758
861 Ga0436360_0643861 3300039438 Bacteria 1357
862 Ga0436361_1024562 3300039447 Unclassified 618
863 Ga0436363_1306274 3300039450 Bacteria 1084
864 Ga0436363_1601056 3300039450 Unclassified 766
865 Ga0436362_0088740 3300039453 Bacteria 10371
866 Ga0436362_0743766 3300039453 Bacteria 659
867 Ga0451577_0041323 3300042876 Bacteria 4139
868 Ga0453683_0066458 3300044673 Bacteria 2254
869 Ga0453683_0119261 3300044673 Bacteria 1660
870 Ga0453684_0564639 3300044712 Bacteria 1252
871 Ga0466959_1200536 3300045049 Unclassified 504
872 Ga0451576_0057431 3300045051 Bacteria 4068
873 Ga0451576_0203839 3300045051 Bacteria 2066
874 Ga0451576_0508087 3300045051 Unclassified 1266
875 Ga0466958_0691657 3300045836 Unclassified 664
876 Ga0466967_0331126 3300045976 Bacteria 1471
877 Ga0495592_0372076 3300046454 Bacteria 911
878 Ga0495603_0224756 3300046455 Bacteria 1083
879 Ga0495590_0035373 3300046457 Unclassified 1744
880 Ga0495629_0009854 3300046459 Bacteria 6972
881 Ga0495651_0184121 3300046462 Bacteria 1476
882 Ga0495651_0659480 3300046462 Unclassified 655
883 Ga0495653_0734525 3300046463 Bacteria 597
884 Ga0495580_0000609 3300046472 Bacteria 30239
885 Ga0495580_0001590 3300046472 Bacteria 19932
886 Ga0495580_0003591 3300046472 Bacteria 13156
887 Ga0495580_0006112 3300046472 Bacteria 9847
888 Ga0495580_0022020 3300046472 Bacteria 4696
889 Ga0495580_0026006 3300046472 Bacteria 4271
890 Ga0495580_0039583 3300046472 Bacteria 3373
891 Ga0495580_0121243 3300046472 Unclassified 1815
892 Ga0495580_0840009 3300046472 Unclassified 593
893 Ga0495582_0016523 3300046473 Bacteria 4042
894 Ga0495582_0803187 3300046473 Unclassified 544
895 Ga0495639_0108256 3300046475 Bacteria 1317
896 Ga0495664_0081591 3300046477 Bacteria 1939
897 Ga0495664_0682675 3300046477 Unclassified 607
898 Ga0495594_0776007 3300046499 Unclassified 541
899 Ga0495618_0604965 3300046514 Unclassified 652
900 Ga0495628_0440303 3300046516 Unclassified 948
901 Ga0495630_0045503 3300046517 Unclassified 3280
902 Ga0495630_0459745 3300046517 Unclassified 975
903 Ga0495666_0089516 3300046526 Bacteria 1453
904 Ga0495652_0354739 3300046529 Bacteria 1050
905 Ga0495665_0262826 3300046531 Bacteria 887
906 Ga0495640_0804633 3300046533 Unclassified 560
907 Ga0495640_0894317 3300046533 Bacteria 526
908 Ga0495622_0093102 3300046557 Bacteria 1384
909 Ga0495667_0221960 3300046559 Unclassified 1206
910 Ga0495635_0470649 3300046663 Bacteria 829
911 Ga0495635_0547667 3300046663 Unclassified 759
912 Ga0495659_0004901 3300046664 Bacteria 4215
913 Ga0495657_0378144 3300046675 Unclassified 836
914 Ga0495657_0743095 3300046675 Unclassified 563
915 Ga0495599_0391856 3300046678 Unclassified 828
916 Ga0495623_0349843 3300046679 Bacteria 805
917 Ga0495646_0174941 3300046680 Bacteria 1181
918 Ga0495658_0567108 3300046683 Unclassified 727
919 Ga0495658_0658787 3300046683 Bacteria 671
920 Ga0495658_0858505 3300046683 Unclassified 581
921 Ga0495669_0321211 3300046684 Unclassified 747
922 Ga0495669_0589745 3300046684 Bacteria 541
923 Ga0495624_0593954 3300046690 Unclassified 660
924 Ga0495624_0794473 3300046690 Bacteria 559
925 Ga0495581_0423544 3300047315 Unclassified 776
926 Ga0495581_0694354 3300047315 Unclassified 587
927 Ga0495674_0015928 3300047319 Bacteria 7019
928 Ga0495674_0048500 3300047319 Bacteria 3758
929 Ga0495674_0133422 3300047319 Unclassified 2091
930 Ga0495674_0721518 3300047319 Unclassified 781
931 Ga0495675_0797622 3300047444 Unclassified 523
932 Ga0495684_0784390 3300047471 Unclassified 624
933 Ga0495684_1054619 3300047471 Unclassified 513
934 Ga0495593_0536115 3300047673 Bacteria 587
935 Ga0495602_0385403 3300048088 Bacteria 1003
936 Ga0495602_0941697 3300048088 Unclassified 573
937 Ga0495614_0206261 3300048089 Bacteria 891
938 Ga0496100_0280788 3300048903 Bacteria 1241
939 Ga0496100_0597044 3300048903 Bacteria 857
940 Ga0496100_0742905 3300048903 Unclassified 767
941 Ga0496101_0052127 3300048904 Bacteria 2950
942 Ga0496101_0105617 3300048904 Bacteria 2114
943 Ga0496101_0571265 3300048904 Bacteria 894
944 Ga0496101_0624846 3300048904 Unclassified 851
945 Ga0496102_0001608 3300048905 Bacteria 19914
946 Ga0496102_0037848 3300048905 Bacteria 4352
947 Ga0496102_0073308 3300048905 Bacteria 3147
948 Ga0496102_0208403 3300048905 Bacteria 1843
949 Ga0496103_0001131 3300048906 Bacteria 18549
950 Ga0496103_0126374 3300048906 Bacteria 1631
951 Ga0496104_0020814 3300048907 Bacteria 6015
952 Ga0496104_0058780 3300048907 Bacteria 3640
953 Ga0496104_0230524 3300048907 Bacteria 1764
954 Ga0496104_0275215 3300048907 Unclassified 1596
955 Ga0496104_0608573 3300048907 Unclassified 1003
956 Ga0496105_0056250 3300048908 Bacteria 3247
957 Ga0496105_0466397 3300048908 Bacteria 995
958 Ga0496105_0915144 3300048908 Bacteria 660
959 Ga0496105_1230022 3300048908 Unclassified 550
960 Ga0496106_0449594 3300048909 Bacteria 1035
961 Ga0496106_0867368 3300048909 Unclassified 714
962 Ga0496107_0209947 3300048910 Bacteria 1448
963 Ga0496107_0252824 3300048910 Bacteria 1311
964 Ga0496107_0287070 3300048910 Bacteria 1225
965 Ga0496108_0002049 3300048911 Bacteria 16155
966 Ga0496108_0304228 3300048911 Bacteria 1389
967 Ga0496109_0001965 3300048912 Bacteria 17051
968 Ga0496109_0756972 3300048912 Bacteria 909
969 Ga0496110_0000608 3300048913 Bacteria 24639
970 Ga0496110_0083303 3300048913 Bacteria 2853
971 Ga0496111_0003481 3300048914 Bacteria 9740
972 Ga0496111_0880988 3300048914 Bacteria 645
973 Ga0496112_0000225 3300048915 Bacteria 36816
974 Ga0496112_0003304 3300048915 Bacteria 13311
975 Ga0496112_0023777 3300048915 Bacteria 5861
976 Ga0496113_0000151 3300048916 Bacteria 30342
977 Ga0496113_0054633 3300048916 Bacteria 2990
978 Ga0496113_0504699 3300048916 Bacteria 971
979 Ga0496113_0783005 3300048916 Unclassified 758
980 Ga0496113_0936958 3300048916 Unclassified 684
981 Ga0496114_0141394 3300048917 Bacteria 2084
982 Ga0496114_1139542 3300048917 Unclassified 665
983 Ga0496115_0004761 3300048918 Bacteria 9850
984 Ga0496115_0100396 3300048918 Bacteria 2372
985 Ga0496115_0177475 3300048918 Bacteria 1761
986 Ga0496115_0553950 3300048918 Bacteria 919
987 Ga0496115_0804501 3300048918 Bacteria 731
988 Ga0501299_032904 3300049522 Bacteria 1009
989 Ga0501069_0789096 3300049585 Unclassified 575
990 Ga0501236_124659 3300049670 Unclassified 526
991 nmdc:mga05p37_346514_c1 3300050507 Bacteria 1750
992 nmdc:mga08y16_1472035_c1 3300050511 Unclassified 642
993 nmdc:mga0n895_1211_c1 3300050512 Bacteria 19031
994 nmdc:mga0n895_1230_c1 3300050512 Bacteria 18879
995 nmdc:mga0n895_717532_c1 3300050512 Bacteria 995
996 nmdc:mga0rr50_1238948_c1 3300050513 Unclassified 633
997 nmdc:mga0rr50_1398859_c1 3300050513 Unclassified 592
998 nmdc:mga0rr50_1847_c2 3300050513 Bacteria 7575
999 nmdc:mga0rr50_21376_c1 3300050513 Bacteria 4416
1000 nmdc:mga0rr50_466232_c1 3300050513 Unclassified 1072
1001 nmdc:mga0rr50_550098_c1 3300050513 Unclassified 983
1002 nmdc:mga0rr50_560108_c1 3300050513 Bacteria 973
1003 nmdc:mga08x19_12995_c1 3300050514 Bacteria 5026
1004 nmdc:mga08x19_166456_c1 3300050514 Bacteria 1499
1005 nmdc:mga08x19_5938_c1 3300050514 Bacteria 7225
1006 nmdc:mga0a205_225_c1 3300050515 Bacteria 39886
1007 nmdc:mga0a205_88236_c1 3300050515 Bacteria 2997
1008 Ga0495601_0387682 3300053077 Unclassified 906
1009 Ga0495601_0719154 3300053077 Bacteria 636
1010 Ga0495612_0060571 3300053078 Bacteria 1567
1011 Ga0495612_0481524 3300053078 Unclassified 568
1012 Ga0495655_0259050 3300053083 Unclassified 587
1013 Ga0587062_141171 3300059639 Bacteria 503
1014 Ga0070707_100078239
1015 JGI24741J21665_1033816
1016 JGI24752J21851_1006609
1017 JGI24743J22301_10012057
1018 JGI24748J21848_1025698
1019 JGI24749J21850_1056880
1020 JGI24033J26618_1067013
1021 JGI24034J26672_10002729
1022 JGI24751J29686_10003895
1023 Ga0058861_12068115
1024 Ga0065704_10033639
1025 Ga0065712_10338493
1026 Ga0065715_10113296
1027 Ga0065715_10667531
1028 Ga0065715_11082109
1029 Ga0070658_10600736
1030 Ga0070658_11979186
1031 Ga0070676_10003275
1032 Ga0070676_10081298
1033 Ga0070683_100004621
1034 Ga0070683_100176771
1035 Ga0070683_100569260
1036 Ga0070690_100037269
1037 Ga0070690_100103389
1038 Ga0070670_100038118
1039 Ga0070670_100167510
1040 Ga0070677_10100228
1041 Ga0070677_10182451
1042 Ga0068869_100041154
1043 Ga0068869_100044577
1044 Ga0068869_100164441
1045 Ga0070666_10017323
1046 Ga0070666_10114327
1047 Ga0070680_100148076
1048 Ga0070680_100963660
1049 Ga0070680_101799629
1050 Ga0070682_100010844
1051 Ga0070682_100017628
1052 Ga0068868_100006913
1053 Ga0068868_100296432
1054 Ga0068868_100448747
1055 Ga0068868_100604449
1056 Ga0070660_100035833
1057 Ga0070660_100118597
1058 Ga0070689_100144463
1059 Ga0070691_10052150
1060 Ga0070687_100037353
1061 Ga0070687_100656714
1062 Ga0070661_100010243
1063 Ga0070661_100261636
1064 Ga0070692_10145328
1065 Ga0070692_11372437
1066 Ga0070668_100027931
1067 Ga0070668_100048610
1068 Ga0070669_100037937
1069 Ga0070669_101792330
1070 Ga0070675_100151397
1071 Ga0070675_100187426
1072 Ga0070671_100245420
1073 Ga0070674_100277089
1074 Ga0070673_100079283
1075 Ga0070688_100030984
1076 Ga0070688_100147906
1077 Ga0070659_100011900
1078 Ga0070659_100013235
1079 Ga0070667_100017595
1080 Ga0070667_100828119
1081 Ga0070709_10000752
1082 Ga0070709_10026405
1083 Ga0070709_10059583
1084 Ga0070709_10084428
1085 Ga0070709_10109402
1086 Ga0070709_10167635
1087 Ga0070709_10240943
1088 Ga0070709_10259177
1089 Ga0070709_10279919
1090 Ga0070709_10280634
1091 Ga0070709_10409430
1092 Ga0070709_10830342
1093 Ga0070709_11187308
1094 Ga0070709_11520788
1095 Ga0070714_100000128
1096 Ga0070714_100003652
1097 Ga0070714_100100702
1098 Ga0070714_100271249
1099 Ga0070714_100549631
1100 Ga0070714_100573582
1101 Ga0070714_100604937
1102 Ga0070714_100728296
1103 Ga0070714_100740984
1104 Ga0070714_100943352
1105 Ga0070714_101027327
1106 Ga0070714_101947373
1107 Ga0070714_102219061
1108 Ga0070713_100000078
1109 Ga0070713_100000133
1110 Ga0070713_100078181
1111 Ga0070713_100080496
1112 Ga0070713_100101772
1113 Ga0070713_100127801
1114 Ga0070713_100145619
1115 Ga0070713_100147085
1116 Ga0070713_100314194
1117 Ga0070713_100392236
1118 Ga0070713_100585957
1119 Ga0070710_10004339
1120 Ga0070710_10008612
1121 Ga0070710_10018846
1122 Ga0070710_10036605
1123 Ga0070710_10063073
1124 Ga0070710_10177556
1125 Ga0070710_10449011
1126 Ga0070710_10562122
1127 Ga0070710_10746320
1128 Ga0070710_11352799
1129 Ga0070711_100000189
1130 Ga0070711_100000517
1131 Ga0070711_100021434
1132 Ga0070711_100027778
1133 Ga0070711_100028299
1134 Ga0070711_100070816
1135 Ga0070711_100101824
1136 Ga0070711_100192634
1137 Ga0070711_100329372
1138 Ga0070711_100707041
1139 Ga0070711_101120001
1140 Ga0070711_101505264
1141 Ga0070711_101848589
1142 Ga0070705_100139729
1143 Ga0070705_100537550
1144 Ga0070705_101464647
1145 Ga0070700_101289745
1146 Ga0070700_102002774
1147 Ga0070694_100715056
1148 Ga0070708_100015770
1149 Ga0070708_100047367
1150 Ga0070708_100063530
1151 Ga0070708_100149015
1152 Ga0070708_100153456
1153 Ga0070708_100181480
1154 Ga0070708_101268910
1155 Ga0070708_101869785
1156 Ga0070663_100088468
1157 Ga0070663_100110977
1158 Ga0070663_101881138
1159 Ga0070678_100123198
1160 Ga0070678_100473910
1161 Ga0070662_100003450
1162 Ga0070662_100125237
1163 Ga0070681_10031904
1164 Ga0070681_10069256
1165 Ga0070681_10224598
1166 Ga0070681_10678026
1167 Ga0070681_10945325
1168 Ga0068867_100054635
1169 Ga0070685_10068999
1170 Ga0070685_10198125
1171 Ga0070706_100001770
1172 Ga0070706_100002201
1173 Ga0070706_100016311
1174 Ga0070706_100052308
1175 Ga0070706_100064806
1176 Ga0070706_101416023
1177 Ga0070707_100000091
1178 Ga0070707_100011671
1179 Ga0070707_100026901
1180 Ga0070707_100083496
1181 Ga0070707_100258880
1182 Ga0070707_100320872
1183 Ga0070707_100460490
1184 Ga0070707_100699198
1185 Ga0070707_100771738
1186 Ga0070707_100924642
1187 Ga0070707_101391438
1188 Ga0070707_101563240
1189 Ga0070698_100000027
1190 Ga0070698_100000226
1191 Ga0070698_100112749
1192 Ga0070698_100678324
1193 Ga0070699_100000032
1194 Ga0070699_100002069
1195 Ga0070699_100003662
1196 Ga0070699_100006912
1197 Ga0070699_100247343
1198 Ga0070699_100442637
1199 Ga0070699_100847951
1200 Ga0070699_101213218
1201 Ga0070679_100044249
1202 Ga0070679_100109442
1203 Ga0070679_100905130
1204 Ga0070679_101177647
1205 Ga0070679_101178838
1206 Ga0070684_100039308
1207 Ga0070684_100066892
1208 Ga0070684_100854368
1209 Ga0070697_100000166
1210 Ga0070697_100000902
1211 Ga0070697_100002343
1212 Ga0070697_100048678
1213 Ga0070697_100235277
1214 Ga0070697_100321207
1215 Ga0070697_100342055
1216 Ga0070697_100366232
1217 Ga0068853_100012730
1218 Ga0068853_100182064
1219 Ga0070672_100338745
1220 Ga0070686_100017238
1221 Ga0070686_100030478
1222 Ga0070686_100085327
1223 Ga0070695_100100752
1224 Ga0070695_100210766
1225 Ga0070696_100104103
1226 Ga0070696_100542363
1227 Ga0070696_100732162
1228 Ga0070693_100107977
1229 Ga0070693_100110100
1230 Ga0070665_100013996
1231 Ga0070665_102382087
1232 Ga0070704_100402147
1233 Ga0068855_100029749
1234 Ga0068855_100063210
1235 Ga0070664_100088635
1236 Ga0070664_100650380
1237 Ga0070664_100765937
1238 Ga0068857_100029312
1239 Ga0068857_100068768
1240 Ga0068857_101840300
1241 Ga0068854_100011566
1242 Ga0068854_100057319
1243 Ga0068854_100895755
1244 Ga0068854_101139569
1245 Ga0068856_100028207
1246 Ga0068856_100051815
1247 Ga0068856_100150978
1248 Ga0068856_100211765
1249 Ga0070702_100086640
1250 Ga0068852_100004955
1251 Ga0068852_100054381
1252 Ga0068852_102719078
1253 Ga0068859_100017990
1254 Ga0068859_100207857
1255 Ga0068859_102239659
1256 Ga0068864_100109218
1257 Ga0068864_100195502
1258 Ga0068864_101977081
1259 Ga0068866_10067230
1260 Ga0068866_10082174
1261 Ga0068861_100059708
1262 Ga0068861_100333469
1263 Ga0068851_10008145
1264 Ga0068851_10012378
1265 Ga0068870_10019594
1266 Ga0068863_100121543
1267 Ga0068863_100451812
1268 Ga0068863_100908603
1269 Ga0068863_101505225
1270 Ga0068858_100092904
1271 Ga0068858_100150484
1272 Ga0068858_101240465
1273 Ga0068860_100014669
1274 Ga0068860_100229000
1275 Ga0068860_100844126
1276 Ga0068862_100029977
1277 Ga0068862_100183452
1278 Ga0068862_101613508
1279 Ga0081540_1084424
1280 Ga0081540_1091210
1281 Ga0081540_1156292
1282 Ga0070717_10005218
1283 Ga0070717_10010950
1284 Ga0070717_10026950
1285 Ga0070717_10071635
1286 Ga0070717_10086417
1287 Ga0070717_10095308
1288 Ga0070717_10110467
1289 Ga0070717_10130139
1290 Ga0070717_10238559
1291 Ga0070717_10370925
1292 Ga0070717_10395501
1293 Ga0070717_10497236
1294 Ga0070717_10511264
1295 Ga0070717_10702149
1296 Ga0070717_11273395
1297 Ga0070717_11579976
1298 Ga0070715_10006750
1299 Ga0070715_10013201
1300 Ga0070715_10020846
1301 Ga0070715_10084048
1302 Ga0070715_10311557
1303 Ga0070715_10423818
1304 Ga0070715_10584465
1305 Ga0070715_10834544
1306 Ga0070716_100000881
1307 Ga0070716_100006268
1308 Ga0070716_100011280
1309 Ga0070716_100084619
1310 Ga0070716_100145850
1311 Ga0070716_100188448
1312 Ga0070716_100188496
1313 Ga0070716_100268442
1314 Ga0070716_100304032
1315 Ga0070716_100308818
1316 Ga0070716_100596644
1317 Ga0070716_101014513
1318 Ga0070716_101084443
1319 Ga0070712_100000047
1320 Ga0070712_100000156
1321 Ga0070712_100000649
1322 Ga0070712_100001728
1323 Ga0070712_100046295
1324 Ga0070712_100328358
1325 Ga0070712_100359344
1326 Ga0070712_100390079
1327 Ga0070712_100506173
1328 Ga0070712_100534253
1329 Ga0070712_101065742
1330 Ga0097621_100012031
1331 Ga0097621_100060568
1332 Ga0097621_100137826
1333 Ga0097621_100209749
1334 Ga0097621_100367318
1335 Ga0097621_100805015
1336 Ga0097621_101002169
1337 Ga0068871_100015762
1338 Ga0068871_100170472
1339 Ga0068871_100245901
1340 Ga0068871_101749361
1341 Ga0075433_10000203
1342 Ga0075433_10174181
1343 Ga0075434_100000016
1344 Ga0075434_100001747
1345 Ga0075434_100775620
1346 Ga0075434_100923064
1347 Ga0075434_102176069
1348 Ga0068865_100048226
1349 Ga0075436_100002204
1350 Ga0075436_100101665
1351 Ga0075436_100710867
1352 Ga0097620_100017990
1353 Ga0097620_100207853
1354 Ga0097620_102239811
1355 Ga0075435_100000173
1356 Ga0075435_100035103
1357 Ga0075435_100111091
1358 Ga0075435_100217729
1359 Ga0075435_101220917
1360 Ga0099794_10093523
1361 Ga0099794_10235581
1362 Ga0099794_10269852
1363 Ga0099794_10620459
1364 Ga0099795_10006741
1365 Ga0099795_10180885
1366 Ga0105250_10071717
1367 Ga0105250_10307856
1368 Ga0105240_10037841
1369 Ga0105240_10071887
1370 Ga0105240_10146767
1371 Ga0105240_10151677
1372 Ga0105240_12634126
1373 Ga0111539_11457666
1374 Ga0105245_10023080
1375 Ga0105245_10030677
1376 Ga0105245_10149993
1377 Ga0105245_10417509
1378 Ga0105247_10017833
1379 Ga0105247_10104225
1380 Ga0105247_10404589
1381 Ga0105247_10547382
1382 Ga0105247_10932564
1383 Ga0114129_10286706
1384 Ga0114129_13438347
1385 Ga0105243_10008143
1386 Ga0105241_10063812
1387 Ga0105241_10138828
1388 Ga0105241_10152210
1389 Ga0105241_10319013
1390 Ga0105241_11536629
1391 Ga0105242_10009635
1392 Ga0105242_11269840
1393 Ga0105242_13103109
1394 Ga0105248_10004294
1395 Ga0105248_10117024
1396 Ga0105248_10129281
1397 Ga0105248_10339967
1398 Ga0105237_10029573
1399 Ga0105237_10101265
1400 Ga0105237_10144905
1401 Ga0105237_10188217
1402 Ga0105237_10461130
1403 Ga0105237_12360198
1404 Ga0105237_12532673
1405 Ga0105238_10052183
1406 Ga0105238_10235410
1407 Ga0105238_11116841
1408 Ga0105249_10090658
1409 Ga0105249_10107384
1410 Ga0105249_10147805
1411 Ga0099796_10020949
1412 Ga0099796_10079919
1413 Ga0099796_10084822
1414 Ga0099796_10344619
1415 Ga0105239_10014054
1416 Ga0105239_12021631
1417 Ga0105246_10006433
1418 Ga0105246_10072271
1419 Ga0105246_10460634
1420 Ga0157325_1023642
1421 Ga0157373_10001333
1422 Ga0157373_11535892
1423 Ga0157371_10007438
1424 Ga0157371_10022254
1425 Ga0157370_10150403
1426 Ga0157370_10373164
1427 Ga0157369_10048322
1428 Ga0157369_10221669
1429 Ga0157374_10002103
1430 Ga0157374_10014783
1431 Ga0157374_10369244
1432 Ga0157374_12848252
1433 Ga0157378_10119785
1434 Ga0157378_10244259
1435 Ga0157378_10298489
1436 Ga0157378_11795408
1437 Ga0157378_12046670
1438 Ga0157378_12351309
1439 Ga0163162_10013430
1440 Ga0163162_10057046
1441 Ga0163162_10067390
1442 Ga0163162_10412528
1443 Ga0157372_10013384
1444 Ga0157372_10014532
1445 Ga0157372_10020193
1446 Ga0157372_10431276
1447 Ga0157372_11680122
1448 Ga0157375_10069523
1449 Ga0157375_10827844
1450 Ga0163163_10012687
1451 Ga0163163_10028596
1452 Ga0163163_10398171
1453 Ga0163163_10875057
1454 Ga0157380_10117385
1455 Ga0182008_10029883
1456 Ga0157377_10010559
1457 Ga0157379_10003230
1458 Ga0157379_10042368
1459 Ga0157379_10057309
1460 Ga0157379_10331916
1461 Ga0157376_10019022
1462 Ga0157376_10033236
1463 Ga0157376_10699902
1464 Ga0157376_12502725
1465 Ga0182006_1047945
1466 Ga0182007_10132730
1467 Ga0182005_1084277
1468 Ga0163161_10003472
1469 Ga0213873_10014330
1470 Ga0224569_104280
1471 Ga0224571_101031
1472 Ga0224572_1012871
1473 Ga0224572_1050267
1474 Ga0228598_1002428
1475 Ga0228598_1014444
1476 Ga0228598_1033115
1477 Ga0207697_10005682
1478 Ga0207656_10001681
1479 Ga0207656_10032949
1480 Ga0207696_1112319
1481 Ga0207696_1183839
1482 Ga0207682_10091582
1483 Ga0207692_10008567
1484 Ga0207692_10013176
1485 Ga0207692_10083891
1486 Ga0207692_10092337
1487 Ga0207692_10516941
1488 Ga0207692_10517462
1489 Ga0207692_10561048
1490 Ga0207642_10014209
1491 Ga0207642_10018561
1492 Ga0207642_10915337
1493 Ga0207710_10030416
1494 Ga0207710_10046728
1495 Ga0207710_10148325
1496 Ga0207710_10383881
1497 Ga0207688_10026648
1498 Ga0207680_10011553
1499 Ga0207680_10063583
1500 Ga0207647_10037541
1501 Ga0207647_10093744
1502 Ga0207685_10011500
1503 Ga0207685_10021033
1504 Ga0207685_10036902
1505 Ga0207685_10145109
1506 Ga0207685_10316401
1507 Ga0207699_10019860
1508 Ga0207699_10142458
1509 Ga0207699_10165923
1510 Ga0207699_10216972
1511 Ga0207699_10273896
1512 Ga0207699_10311664
1513 Ga0207699_10320229
1514 Ga0207699_10449664
1515 Ga0207699_10454268
1516 Ga0207699_10557740
1517 Ga0207699_10597405
1518 Ga0207699_10696845
1519 Ga0207699_11065101
1520 Ga0207699_11122367
1521 Ga0207699_11178849
1522 Ga0207645_10000021
1523 Ga0207645_10004345
1524 Ga0207643_10007444
1525 Ga0207643_10436204
1526 Ga0207705_10594852
1527 Ga0207684_10000238
1528 Ga0207684_10001028
1529 Ga0207684_10002047
1530 Ga0207684_10057239
1531 Ga0207684_10244115
1532 Ga0207684_10247668
1533 Ga0207654_10042939
1534 Ga0207654_10179570
1535 Ga0207654_10722339
1536 Ga0207654_11054510
1537 Ga0207707_10016277
1538 Ga0207707_10055851
1539 Ga0207707_10447399
1540 Ga0207707_10754267
1541 Ga0207695_10007368
1542 Ga0207695_10016928
1543 Ga0207695_10318637
1544 Ga0207695_10389091
1545 Ga0207695_10470820
1546 Ga0207695_10749349
1547 Ga0207695_10881542
1548 Ga0207671_10064944
1549 Ga0207671_10938039
1550 Ga0207671_11169156
1551 Ga0207671_11264466
1552 Ga0207693_10000044
1553 Ga0207693_10000097
1554 Ga0207693_10000546
1555 Ga0207693_10006025
1556 Ga0207693_10066246
1557 Ga0207693_10113772
1558 Ga0207693_10116175
1559 Ga0207693_10137353
1560 Ga0207693_10366040
1561 Ga0207693_10539978
1562 Ga0207693_10869690
1563 Ga0207663_10000276
1564 Ga0207663_10001127
1565 Ga0207663_10030227
1566 Ga0207663_10096029
1567 Ga0207663_10123387
1568 Ga0207663_10132697
1569 Ga0207663_10234390
1570 Ga0207663_10386717
1571 Ga0207663_10389470
1572 Ga0207663_10688931
1573 Ga0207663_10740562
1574 Ga0207663_11058094
1575 Ga0207663_11422740
1576 Ga0207663_11600215
1577 Ga0207660_10362344
1578 Ga0207660_10819818
1579 Ga0207662_10015324
1580 Ga0207657_10001918
1581 Ga0207657_10004787
1582 Ga0207649_10000836
1583 Ga0207649_10132580
1584 Ga0207652_10024152
1585 Ga0207652_10146421
1586 Ga0207646_10000073
1587 Ga0207646_10001530
1588 Ga0207646_10096540
1589 Ga0207646_10182814
1590 Ga0207646_10513541
1591 Ga0207646_11188135
1592 Ga0207646_11292698
1593 Ga0207646_11449621
1594 Ga0207646_11506863
1595 Ga0207681_10035914
1596 Ga0207681_10774621
1597 Ga0207694_10162801
1598 Ga0207694_10239595
1599 Ga0207694_10643205
1600 Ga0207650_10000097
1601 Ga0207650_10216033
1602 Ga0207650_11646433
1603 Ga0207659_10555648
1604 Ga0207659_11668407
1605 Ga0207687_10018851
1606 Ga0207687_10075610
1607 Ga0207687_10163917
1608 Ga0207687_11213842
1609 Ga0207700_10000227
1610 Ga0207700_10002357
1611 Ga0207700_10033743
1612 Ga0207700_10044086
1613 Ga0207700_10148298
1614 Ga0207700_10155263
1615 Ga0207700_10270357
1616 Ga0207700_10295320
1617 Ga0207700_10401378
1618 Ga0207700_10406850
1619 Ga0207700_10444398
1620 Ga0207700_10706066
1621 Ga0207700_10866673
1622 Ga0207700_11449954
1623 Ga0207700_11521598
1624 Ga0207664_10000033
1625 Ga0207664_10008409
1626 Ga0207664_10027738
1627 Ga0207664_10064432
1628 Ga0207664_10138671
1629 Ga0207664_10319773
1630 Ga0207664_10485846
1631 Ga0207664_10642628
1632 Ga0207664_10684730
1633 Ga0207664_10819453
1634 Ga0207664_11031224
1635 Ga0207664_11069052
1636 Ga0207664_11408966
1637 Ga0207664_11443092
1638 Ga0207644_10091967
1639 Ga0207690_10059602
1640 Ga0207706_10000048
1641 Ga0207706_10004287
1642 Ga0207686_10200339
1643 Ga0207709_10014364
1644 Ga0207670_10372013
1645 Ga0207669_10277933
1646 Ga0207669_11016033
1647 Ga0207704_10009462
1648 Ga0207704_10040610
1649 Ga0207665_10000326
1650 Ga0207665_10001590
1651 Ga0207665_10007003
1652 Ga0207665_10042800
1653 Ga0207665_10048543
1654 Ga0207665_10057230
1655 Ga0207665_10122612
1656 Ga0207665_10126324
1657 Ga0207665_10232142
1658 Ga0207665_10392708
1659 Ga0207665_10537036
1660 Ga0207665_10554499
1661 Ga0207665_10626121
1662 Ga0207665_10655792
1663 Ga0207665_11527637
1664 Ga0207665_11568423
1665 Ga0207691_10000721
1666 Ga0207711_10002079
1667 Ga0207711_10058222
1668 Ga0207711_11551166
1669 Ga0207689_10010374
1670 Ga0207689_10041384
1671 Ga0207689_10078781
1672 Ga0207689_11135203
1673 Ga0207661_10001148
1674 Ga0207661_10063706
1675 Ga0207661_11914218
1676 Ga0207679_10003643
1677 Ga0207679_10202739
1678 Ga0207679_11096265
1679 Ga0207667_10004050
1680 Ga0207667_10135994
1681 Ga0207651_10065812
1682 Ga0207712_10007284
1683 Ga0207712_10036002
1684 Ga0207712_10823536
1685 Ga0207668_10052806
1686 Ga0207668_11328446
1687 Ga0207640_10002588
1688 Ga0207640_10511208
1689 Ga0207640_10728350
1690 Ga0207658_10065657
1691 Ga0207658_10080617
1692 Ga0207677_10234952
1693 Ga0207677_10288090
1694 Ga0207677_10467629
1695 Ga0207703_10093417
1696 Ga0207703_11029506
1697 Ga0207703_11163802
1698 Ga0207639_10063533
1699 Ga0207639_10251123
1700 Ga0207678_10000388
1701 Ga0207678_10002928
1702 Ga0207678_10306755
1703 Ga0207708_10233545
1704 Ga0207702_10026929
1705 Ga0207702_10098919
1706 Ga0207702_10338684
1707 Ga0207702_11033687
1708 Ga0207641_10000183
1709 Ga0207641_10065899
1710 Ga0207641_10076011
1711 Ga0207641_10980716
1712 Ga0207648_10000063
1713 Ga0207648_10099896
1714 Ga0207676_10000536
1715 Ga0207676_10772830
1716 Ga0207674_10001582
1717 Ga0207674_10249442
1718 Ga0207675_100013698
1719 Ga0207675_100147440
1720 Ga0207683_10003861
1721 Ga0207683_10119691
1722 Ga0207698_10039524
1723 Ga0207698_10572119
1724 Ga0209179_1032941
1725 Ga0209588_1058833
1726 Ga0209974_10352875
1727 Ga0265354_1012680
1728 Ga0265354_1017113
1729 Ga0265356_1000009
1730 Ga0265356_1003264
1731 Ga0265356_1006394
1732 Ga0265355_1001124
1733 Ga0265355_1009222
1734 Ga0268266_10008112
1735 Ga0268266_10078715
1736 Ga0268266_10553817
1737 Ga0268266_12051644
1738 Ga0268265_10012882
1739 Ga0268265_10130047
1740 Ga0268264_10039167
1741 Ga0268264_10060775
1742 Ga0268264_10706010
1743 Ga0265336_10130114
1744 Ga0265338_10002910
1745 Ga0265338_10091787
1746 Ga0265338_10160047
1747 Ga0265338_10263307
1748 Ga0265338_11038433
1749 Ga0265762_1003153
1750 Ga0265762_1003335
1751 Ga0265762_1050535
1752 Ga0265762_1082697
1753 Ga0265762_1181968
1754 Ga0265763_1049870
1755 Ga0265770_1047779
1756 Ga0265770_1099058
1757 Ga0265765_1000774
1758 Ga0265765_1037590
1759 Ga0265769_122017
1760 Ga0265771_1000422
1761 Ga0265773_1009065
1762 Ga0265773_1011646
1763 Ga0265760_10000974
1764 Ga0265760_10001465
1765 Ga0265760_10022711
1766 Ga0265760_10045646
1767 Ga0265760_10064779
1768 Ga0265760_10154806
1769 Ga0265760_10310012
1770 Ga0265325_10015165
1771 Ga0265325_10058038
1772 Ga0265325_10109702
1773 Ga0265325_10468160
1774 Ga0265340_10015612
1775 Ga0265340_10192784
1776 Ga0265339_10072160
1777 Ga0307408_100688626
1778 Ga0307508_10783486
1779 Ga0265342_10114337
1780 Ga0316212_1005341
1781 Ga0373948_0146517
1782 Ga0373958_0170857
1783 Ga0373959_0065550
1784 Ga0373938_0008616
1785 Ga0373926_0036187
1786 Ga0373926_0460245
1787 Ga0373929_0037319
1788 Ga0373934_0108590
1789 Ga0373940_0047243
1790 Ga0373940_0113526
1791 Ga0373949_0021801
1792 Ga0373952_0146949
1793 Ga0373923_0002660
1794 Ga0373923_0153437
1795 Ga0373923_0201757
1796 Ga0373923_0379353
1797 Ga0373923_0582411
1798 Ga0373932_0026611
1799 Ga0373932_0277330
1800 Ga0373936_0006971
1801 Ga0373936_0040082
1802 Ga0373936_0530870
1803 Ga0373945_0016630
1804 Ga0373945_0492695
1805 Ga0373953_0245631
1806 Ga0373954_0016939
1807 Ga0373954_0484467
1808 Ga0373957_0010409
1809 Ga0373957_0171387
1810 Ga0373960_0187294
1811 Ga0373943_0000271
1812 Ga0373943_0061016
1813 Ga0373943_0681143
1814 Ga0373946_0007194
1815 Ga0373946_0643407
1816 Ga0373955_0044395
1817 Ga0373955_0186295
1818 Ga0373955_0367341
1819 Ga0373955_0390853
1820 Ga0373942_0201860
1821 Ga0373961_0026579
1822 Ga0373962_0391269
1823 Ga0373924_0010668
1824 Ga0373924_0109748
1825 Ga0373924_0567196
1826 Ga0373931_0018942
1827 Ga0373935_0042083
1828 Ga0373935_0062176
1829 Ga0373935_0062581
1830 Ga0373935_0369325
1831 Ga0373935_0621461
1832 Ga0373935_0794054
1833 Ga0373935_1001166
1834 Ga0373935_1177768
1835 Ga0373935_1219064
1836 Ga0373927_0000123
1837 Ga0373927_0079107
1838 Ga0373927_0204889
1839 Ga0373927_0461421
1840 Ga0373927_0577607
1841 Ga0373927_0611731
1842 Ga0373927_0728678
1843 Ga0373927_0861255
1844 Ga0373933_0342245
1845 Ga0373933_0422705
1846 Ga0373933_0434460
1847 Ga0373933_0505313
1848 Ga0373933_0575532
1849 Ga0373933_0990092
1850 Ga0373933_1011507
1851 Ga0373947_0000757
1852 Ga0373947_0086316
1853 Ga0373947_0102449
1854 Ga0373947_0166554
1855 Ga0373947_0326586
1856 Ga0373937_0086094
1857 Ga0373937_0305068
1858 Ga0373937_0344397
1859 Ga0373937_0455024
1860 Ga0373937_0668956
1861 Ga0373937_1049736
1862 Ga0373937_1186039
1863 Ga0373925_0000589
1864 Ga0373925_0006557
1865 Ga0373925_0023231
1866 Ga0373925_0035914
1867 Ga0373925_0345084
1868 Ga0373925_0487777
1869 Ga0373925_1166428
1870 Ga0373925_1222548
1871 Ga0395905_0818467
1872 Ga0436365_0213101
1873 Ga0436360_0116685
1874 Ga0436360_0643861
1875 Ga0436361_1024562
1876 Ga0436363_1306274
1877 Ga0436363_1601056
1878 Ga0436362_0088740
1879 Ga0436362_0743766
1880 Ga0451577_0041323
1881 Ga0453683_0066458
1882 Ga0453683_0119261
1883 Ga0453684_0564639
1884 Ga0466959_1200536
1885 Ga0451576_0057431
1886 Ga0451576_0203839
1887 Ga0451576_0508087
1888 Ga0466958_0691657
1889 Ga0466967_0331126
1890 Ga0495592_0372076
1891 Ga0495603_0224756
1892 Ga0495590_0035373
1893 Ga0495629_0009854
1894 Ga0495651_0184121
1895 Ga0495651_0659480
1896 Ga0495653_0734525
1897 Ga0495580_0000609
1898 Ga0495580_0001590
1899 Ga0495580_0003591
1900 Ga0495580_0006112
1901 Ga0495580_0022020
1902 Ga0495580_0026006
1903 Ga0495580_0039583
1904 Ga0495580_0121243
1905 Ga0495580_0840009
1906 Ga0495582_0016523
1907 Ga0495582_0803187
1908 Ga0495639_0108256
1909 Ga0495664_0081591
1910 Ga0495664_0682675
1911 Ga0495594_0776007
1912 Ga0495618_0604965
1913 Ga0495628_0440303
1914 Ga0495630_0045503
1915 Ga0495630_0459745
1916 Ga0495666_0089516
1917 Ga0495652_0354739
1918 Ga0495665_0262826
1919 Ga0495640_0804633
1920 Ga0495640_0894317
1921 Ga0495622_0093102
1922 Ga0495667_0221960
1923 Ga0495635_0470649
1924 Ga0495635_0547667
1925 Ga0495659_0004901
1926 Ga0495657_0378144
1927 Ga0495657_0743095
1928 Ga0495599_0391856
1929 Ga0495623_0349843
1930 Ga0495646_0174941
1931 Ga0495658_0567108
1932 Ga0495658_0658787
1933 Ga0495658_0858505
1934 Ga0495669_0321211
1935 Ga0495669_0589745
1936 Ga0495624_0593954
1937 Ga0495624_0794473
1938 Ga0495581_0423544
1939 Ga0495581_0694354
1940 Ga0495674_0015928
1941 Ga0495674_0048500
1942 Ga0495674_0133422
1943 Ga0495674_0721518
1944 Ga0495675_0797622
1945 Ga0495684_0784390
1946 Ga0495684_1054619
1947 Ga0495593_0536115
1948 Ga0495602_0385403
1949 Ga0495602_0941697
1950 Ga0495614_0206261
1951 Ga0496100_0280788
1952 Ga0496100_0597044
1953 Ga0496100_0742905
1954 Ga0496101_0052127
1955 Ga0496101_0105617
1956 Ga0496101_0571265
1957 Ga0496101_0624846
1958 Ga0496102_0001608
1959 Ga0496102_0037848
1960 Ga0496102_0073308
1961 Ga0496102_0208403
1962 Ga0496103_0001131
1963 Ga0496103_0126374
1964 Ga0496104_0020814
1965 Ga0496104_0058780
1966 Ga0496104_0230524
1967 Ga0496104_0275215
1968 Ga0496104_0608573
1969 Ga0496105_0056250
1970 Ga0496105_0466397
1971 Ga0496105_0915144
1972 Ga0496105_1230022
1973 Ga0496106_0449594
1974 Ga0496106_0867368
1975 Ga0496107_0209947
1976 Ga0496107_0252824
1977 Ga0496107_0287070
1978 Ga0496108_0002049
1979 Ga0496108_0304228
1980 Ga0496109_0001965
1981 Ga0496109_0756972
1982 Ga0496110_0000608
1983 Ga0496110_0083303
1984 Ga0496111_0003481
1985 Ga0496111_0880988
1986 Ga0496112_0000225
1987 Ga0496112_0003304
1988 Ga0496112_0023777
1989 Ga0496113_0000151
1990 Ga0496113_0054633
1991 Ga0496113_0504699
1992 Ga0496113_0783005
1993 Ga0496113_0936958
1994 Ga0496114_0141394
1995 Ga0496114_1139542
1996 Ga0496115_0004761
1997 Ga0496115_0100396
1998 Ga0496115_0177475
1999 Ga0496115_0553950
2000 Ga0496115_0804501
2001 Ga0501299_032904
2002 Ga0501069_0789096
2003 Ga0501236_124659
2004 nmdc:mga05p37_346514_c1
2005 nmdc:mga08y16_1472035_c1
2006 nmdc:mga0n895_1211_c1
2007 nmdc:mga0n895_1230_c1
2008 nmdc:mga0n895_717532_c1
2009 nmdc:mga0rr50_1238948_c1
2010 nmdc:mga0rr50_1398859_c1
2011 nmdc:mga0rr50_1847_c2
2012 nmdc:mga0rr50_21376_c1
2013 nmdc:mga0rr50_466232_c1
2014 nmdc:mga0rr50_550098_c1
2015 nmdc:mga0rr50_560108_c1
2016 nmdc:mga08x19_12995_c1
2017 nmdc:mga08x19_166456_c1
2018 nmdc:mga08x19_5938_c1
2019 nmdc:mga0a205_225_c1
2020 nmdc:mga0a205_88236_c1
2021 Ga0495601_0387682
2022 Ga0495601_0719154
2023 Ga0495612_0060571
2024 Ga0495612_0481524
2025 Ga0495655_0259050
2026 Ga0587062_141171

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04325

DUF465

Protein of unknown function (DUF465)

29

78

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4um2-assembly1.cif.gz_A crystal structure of the tpr domain of smg6 0.9586 13 59
3k9a-assembly1.cif.gz_A crystal structure of hiv gp41 with mper 0.9036 13 74
6vli-assembly1.cif.gz_A crystal structure of transcriptional regulator from bacteriophage 186 0.9005 12 57
5lmg-assembly2.cif.gz_B structure of c-terminal domain from s. cerevisiae pat1 decapping activator bound to dcp2 hlm10 peptide (region 954-970) 0.8953 7 59
8iyj-assembly1.cif.gz_k cryo-em structure of the 48-nm repeat doublet microtubule from mouse sperm 0.8951 14 64
ID Description Score Start End Superfamily
af_Q9I7K6_253_427_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9723 17 74 1.25.40.10
2wmmB01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9582 11 61 1.20.5.420
af_Q2FYR1_179_367_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9477 14 69 3.40.630.30
2wmmA01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9379 11 61 1.20.5.420
2wmmB01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9208 11 61 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A2V9U374-F1-model_v4 DUF465 domain-containing protein 1.006 1 76
AF-A0A321LZQ7-F1-model_v4 DUF465 domain-containing protein 1.003 2 72
AF-A0A5C0SAU3-F1-model_v4 Spo0E like sporulation regulatory protein 1.003 12 68
AF-A0A497DZ56-F1-model_v4 DUF465 domain-containing protein 1.001 3 70
AF-A0A383A896-F1-model_v4 DUF465 domain-containing protein 1 4 70

Map