F488178

General Info

Members Datasets Scaffolds Average Seq Length
1012 811 400 384

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0009514|Ga0495605_0009514_1557_2933
Length 458
Sequence MAICVLVIGNWHSFRALDTMAGLMVVNLNRQITARSAVLKPEFSRPRINRGIVNSQLLRQLSGRHQNLKREAILFSISKRSDVEPFHAMDVLAEATKRRAAGHPVISMAVGQPSHPTPQAALDAARSALEEGRIGYTDALGTARLKHALARHYRDRHGLEIDPGRIAVTTGSSAGFNLAFLSLFDAGDAVAIARPGYPAYRNILGALGLKVLEVPVTADTHFTLTPESLEAAQKESGVTLKGVLLASPANPTGTVTGREGLKALADYCAAHSIAFISDEIYHGLTFAGEETSVLELTDEAIAINSFSKYYCMTGWRIGWMVLPERLVRPIERVAQSLYISPPELSQIAATAALGASAELDVYKASYAANRDFLMKRLPEMGLAIASPMDGAFYAYVDVTRFTNDSMAFAKRMLAEINVAATPGLDFDPLEGNRTMRMSYAGAETEIAEAAERMAAWLK

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
25 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
29 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
33 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
42 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
43 2534681786 Brucella suis 92/29 Isolate Unclassified
44 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
45 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
51 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
52 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
53 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
54 2582580736 Prauserella sp. Am3 Isolate Unclassified
55 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
56 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
60 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
61 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
62 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
63 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
64 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
65 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
66 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
67 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
68 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
69 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
70 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
71 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
72 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
73 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
74 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
75 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
76 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
77 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
78 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
79 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
80 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
81 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
82 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
83 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
84 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
85 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
86 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
87 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
88 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
89 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
90 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
91 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
92 2643221557 Ensifer sp. Root558 Isolate Unclassified
93 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
94 2643221568 Rhizobium sp. Root564 Isolate Unclassified
95 2643221582 Rhizobium sp. Root651 Isolate Unclassified
96 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
97 2643221607 Rhizobium sp. Root73 Isolate Unclassified
98 2643221610 Ensifer sp. Root74 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221626 Ensifer sp. Root31 Isolate Unclassified
101 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
105 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
106 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
107 2643221655 Ensifer sp. Root1252 Isolate Unclassified
108 2643221659 Ensifer sp. Root127 Isolate Unclassified
109 2643221668 Ensifer sp. Root423 Isolate Unclassified
110 2643221675 Ensifer sp. Root1298 Isolate Unclassified
111 2643221680 Ensifer sp. Root1312 Isolate Unclassified
112 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
113 2643221688 Rhizobium sp. Root482 Isolate Unclassified
114 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
115 2643221693 Rhizobium sp. Root491 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221718 Rhizobium sp. Root268 Isolate Unclassified
119 2643221719 Rhizobium sp. Root274 Isolate Unclassified
120 2643221723 Ensifer sp. Root278 Isolate Unclassified
121 2643221726 Ensifer sp. Root954 Isolate Unclassified
122 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
123 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
124 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
125 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
126 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
127 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
128 2738543024 Aminobacter sp. AP02 Isolate Unclassified
129 2751185800 Brucella pituitosa AA2 Isolate Unclassified
130 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
131 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
132 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
133 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
134 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
135 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
136 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
137 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
138 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
139 2791355260 Rhizobium sp. L9 Isolate Nodule
140 2791355261 Rhizobium sp. J15 Isolate Nodule
141 2791355263 Rhizobium chutanense C5 Isolate Nodule
142 2791355266 Rhizobium sp. L43 Isolate Nodule
143 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
144 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
145 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
146 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
147 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
148 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
149 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
150 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
151 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
152 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
153 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
154 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
155 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
156 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
157 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
158 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
159 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
160 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
161 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
162 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
163 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
164 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
165 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
166 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
167 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
168 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
169 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
170 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
171 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
172 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
173 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
174 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
175 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
176 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
177 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
178 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
179 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
180 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
181 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
182 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
183 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
184 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
185 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
186 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
187 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
188 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
189 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
190 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
191 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
192 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
193 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
194 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
195 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
196 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
197 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
198 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
199 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
200 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
201 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
202 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
203 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
204 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
205 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
206 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
207 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
208 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
209 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
210 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
211 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
212 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
213 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
214 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
215 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
216 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
217 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
218 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
219 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
220 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
221 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
224 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
225 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
226 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
227 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
228 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
229 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
230 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
231 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
232 2844163670 Ensifer sp. 1H6 Isolate Unclassified
233 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
234 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
235 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
236 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
237 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
238 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
239 2854911287 Brucella lupini LUP21 Isolate Unclassified
240 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
241 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
242 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
243 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
244 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
245 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
246 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
247 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
248 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
249 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
250 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
251 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
252 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
253 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
254 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
255 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
256 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
257 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
258 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
259 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
260 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
261 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
262 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
263 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
264 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
265 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
266 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
267 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
268 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
269 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
270 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
271 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
272 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
273 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
274 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
275 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
276 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
277 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
278 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
279 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
280 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
281 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
282 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
283 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
284 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
285 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
286 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
287 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
288 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
289 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
290 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
291 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
292 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
293 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
294 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
295 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
296 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
297 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
298 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
299 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
300 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
301 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
302 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
303 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
304 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
305 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
306 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
307 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
308 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
309 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
310 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
311 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
312 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
313 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
314 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
315 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
316 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
317 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
318 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
319 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
320 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
321 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
322 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
323 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
324 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
325 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
326 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
327 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
328 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
329 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
330 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
331 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
332 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
333 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
334 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
335 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
336 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
337 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
338 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
339 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
340 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
341 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
342 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
343 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
344 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
345 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
346 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
347 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
348 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
349 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
350 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
351 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
352 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
353 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
354 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
355 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
356 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
357 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
358 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
359 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
360 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
361 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
362 2933599457 Rhizobium phaseoli M3 Isolate Nodule
363 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
364 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
365 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
366 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
367 2936381700 Rhizobium chutanense C16 Isolate Unclassified
368 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
369 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
370 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
371 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
372 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
373 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
374 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
375 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
376 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
377 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
378 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
379 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
380 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
381 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
382 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
383 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
384 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
385 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
386 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
387 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
388 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
389 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
390 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
391 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
392 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
393 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
394 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
395 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
396 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
397 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
398 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
399 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
400 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
401 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
402 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
403 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
404 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
405 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
406 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
407 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
408 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
409 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
410 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
411 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
412 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
413 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
414 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
415 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
416 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
417 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
418 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
419 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
420 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
421 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
422 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
423 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
424 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
425 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
426 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
427 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
428 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
429 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
430 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
431 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
432 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
433 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
434 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
435 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
436 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
437 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
438 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
439 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
440 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
441 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
442 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
443 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
444 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
445 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
446 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
447 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
448 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
449 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
450 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
451 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
452 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
453 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
454 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
455 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
456 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
457 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
458 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
459 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
460 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
461 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
462 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
463 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
464 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
465 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
466 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
467 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
468 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
469 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
470 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
471 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
472 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
473 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
474 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
475 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
476 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
477 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
478 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
479 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
480 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
481 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
482 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
483 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
484 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
485 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
486 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
487 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
488 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
489 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
490 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
491 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
492 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
493 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
494 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
495 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
496 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
497 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
498 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
499 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
500 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
501 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
502 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
503 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
504 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
505 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
506 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
507 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
508 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
509 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
510 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
511 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
512 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
513 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
514 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
515 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
516 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
517 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
518 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
519 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
520 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
521 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
522 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
523 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
524 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
525 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
526 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
527 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
528 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
529 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
530 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
531 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
532 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
533 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
534 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
535 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
536 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
537 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
538 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
539 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
540 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
541 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
542 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
543 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
544 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
545 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
546 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
547 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
548 2996887358 Rhizobium sp. R711 Isolate Nodule
549 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
550 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
551 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
552 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
553 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
554 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
555 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
556 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
557 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
558 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
559 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
560 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
561 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
562 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
563 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
564 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
565 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
566 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
567 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
568 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
569 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
570 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
571 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
572 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
573 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
574 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
575 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
576 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
577 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
578 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
579 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
580 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
581 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
582 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
583 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
584 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
585 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
586 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
587 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
588 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
589 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
590 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
591 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
592 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
593 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
594 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
595 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
596 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
597 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
598 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
599 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
600 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
601 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
602 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
603 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
604 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
605 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
606 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
607 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
608 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
609 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
610 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
611 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
612 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
613 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
614 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
615 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
616 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
617 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
618 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
620 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
621 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
622 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
624 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
625 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
626 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
627 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
628 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
629 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
630 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
631 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
632 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
641 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
642 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
643 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
645 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
646 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
647 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
648 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
649 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
650 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
651 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
652 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
653 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
654 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
655 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
656 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
657 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
658 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
659 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
660 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
661 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
662 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
663 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
664 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
665 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
666 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
667 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
668 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
669 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
670 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
671 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
672 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
673 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
674 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
675 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
676 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
677 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
678 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
679 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
680 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
681 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
682 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
683 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
684 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
685 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
686 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
687 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
688 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
689 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
690 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
691 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
692 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
693 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
694 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
695 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
696 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
697 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
698 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
699 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
700 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
701 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
702 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
703 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
704 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
705 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
706 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
707 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
708 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
709 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
710 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
711 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
712 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
713 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
714 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
716 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
717 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
719 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
722 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
726 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
727 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
728 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
729 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
730 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
731 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
732 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
733 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
734 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
735 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
736 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
737 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
738 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
739 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
740 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
741 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
742 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
743 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
744 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
745 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
746 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
747 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
748 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
749 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
750 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
751 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
752 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
753 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
754 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
755 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
756 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
757 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
758 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
759 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
760 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
761 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
762 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
763 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
764 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
765 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
766 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
767 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
768 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
769 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
770 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
771 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
772 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
773 8005258706 Rhizobium sp. R693 Isolate Nodule
774 8005275841 Rhizobium sp. N4311 Isolate Nodule
775 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
776 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
777 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
778 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
779 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
780 8005321885 Rhizobium sp. R72 Isolate Nodule
781 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
782 8005382845 Rhizobium sp. R634 Isolate Nodule
783 8005395548 Rhizobium sp. R339 Isolate Nodule
784 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
785 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
786 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
787 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
788 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
789 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
790 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
791 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
792 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
793 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
794 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
795 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
796 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
797 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
798 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
799 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
800 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
801 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
802 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
803 8024501048 Rhizobium sp. H4 Isolate Nodule
804 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
805 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
806 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
807 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
808 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
809 8056382006 Rhizobium croatiense 13T Isolate Nodule
810 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
811 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.53
Metatranscriptomes 0
Isolates 60.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 14.03
Nodule 46.54
Rhizoplane 1.38
Rhizosphere 20.16
Stem 0
Stem Tuber 0.1
Unclassified 17.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000019 3300002704 Bacteria 155636
2 JGI25156J39149_1000020 3300002705 Bacteria 156628
3 JGI25154J39366_1000355 3300002738 Bacteria 26026
4 JGI25157J39369_1000129 3300002741 Bacteria 63620
5 JGI25152J39213_1001416 3300002773 Bacteria 10380
6 JGI25152J39213_1007446 3300002773 Bacteria 2833
7 JGI25152J39213_1010485 3300002773 Bacteria 2116
8 JGI25150J39212_1003234 3300002774 Bacteria 3851
9 JGI25150J39212_1003455 3300002774 Bacteria 3693
10 JGI25159J45721_1000002 3300002987 Bacteria 289163
11 JGI25159J45721_1000980 3300002987 Bacteria 12335
12 JGI25159J45721_1001906 3300002987 Bacteria 8339
13 JGI25151J46595_10000202 3300003187 Bacteria 73308
14 JGI25151J46595_10004677 3300003187 Bacteria 7198
15 JGI25151J46595_10010603 3300003187 Bacteria 4272
16 JGI25151J46595_10010765 3300003187 Bacteria 4232
17 JGI25165J46597_1001254 3300003214 Bacteria 14994
18 JGI25153J46596_10014589 3300003215 Bacteria 3255
19 JGI25153J46596_10014620 3300003215 Bacteria 3251
20 JGI25153J46596_10021142 3300003215 Bacteria 2434
21 rootL2_10036886 3300003322 Bacteria 4684
22 rootH1_10016157 3300003323 Bacteria 5463
23 rootH1_10111348 3300003323 Bacteria 2342
24 JGI25160J50197_1000008 3300003354 Bacteria 289163
25 JGI25160J50197_1000015 3300003354 Bacteria 250902
26 JGI25161J50226_1000005 3300003374 Bacteria 292548
27 JGI25161J50226_1000053 3300003374 Bacteria 106635
28 JGI25161J50226_1000806 3300003374 Bacteria 11804
29 Ga0055542_1001254 3300003762 Bacteria 14004
30 Ga0055526_1005935 3300003771 Bacteria 6810
31 Ga0055526_1009889 3300003771 Bacteria 4520
32 Ga0055524_1008166 3300003775 Bacteria 4372
33 Ga0055524_1011673 3300003775 Bacteria 3419
34 Ga0055524_1012225 3300003775 Bacteria 3306
35 Ga0055528_1001627 3300003790 Bacteria 13253
36 Ga0055528_1001795 3300003790 Bacteria 12305
37 Ga0055528_1002851 3300003790 Bacteria 9022
38 Ga0055528_1003705 3300003790 Bacteria 7562
39 Ga0055528_1004157 3300003790 Bacteria 7045
40 Ga0055528_1011336 3300003790 Bacteria 3550
41 Ga0055540_1001936 3300003792 Bacteria 11577
42 Ga0055540_1005993 3300003792 Bacteria 4928
43 Ga0055543_1000019 3300004625 Bacteria 161035
44 Ga0055543_1000027 3300004625 Bacteria 136033
45 Ga0055543_1000109 3300004625 Bacteria 71370
46 Ga0065165_1000015 3300005262 Bacteria 289201
47 Ga0065165_1000915 3300005262 Bacteria 38053
48 Ga0065165_1013694 3300005262 Bacteria 3204
49 Ga0070671_100016258 3300005355 Bacteria 6018
50 Ga0070663_100077398 3300005455 Bacteria 2435
51 Ga0068853_100016315 3300005539 Bacteria 6111
52 Ga0070665_100243844 3300005548 Bacteria 1797
53 Ga0068855_100165758 3300005563 Bacteria 2505
54 Ga0068857_100128688 3300005577 Bacteria 2283
55 Ga0068852_100261718 3300005616 Bacteria 1661
56 Ga0081455_10000290 3300005937 Bacteria 66541
57 Ga0075365_10012434 3300006038 Bacteria 5057
58 Ga0075365_10023974 3300006038 Bacteria 3844
59 Ga0075365_10027559 3300006038 Bacteria 3616
60 Ga0075367_10033019 3300006178 Bacteria 2981
61 Ga0075369_10000841 3300006186 Bacteria 10102
62 Ga0075369_10005679 3300006186 Bacteria 4677
63 Ga0075429_100159863 3300006880 Bacteria 1973
64 Ga0099826_10021676 3300006948 Bacteria 4811
65 Ga0105240_10004701 3300009093 Bacteria 20645
66 Ga0105240_10291129 3300009093 Bacteria 1872
67 Ga0105247_10188996 3300009101 Bacteria 1378
68 Ga0105243_10015458 3300009148 Bacteria 5768
69 Ga0105248_10106365 3300009177 Bacteria 3163
70 Ga0105237_10002935 3300009545 Bacteria 20647
71 Ga0105238_10013392 3300009551 Bacteria 8278
72 Ga0123341_1000001 3300009765 Bacteria 314908
73 Ga0123342_1017951 3300009766 Bacteria 5767
74 Ga0105239_10016921 3300010375 Bacteria 8059
75 Ga0105239_10464388 3300010375 Bacteria 1437
76 Ga0105239_10505569 3300010375 Bacteria 1374
77 Ga0157371_10000132 3300013102 Bacteria 112593
78 Ga0157371_10047427 3300013102 Bacteria 3055
79 Ga0157370_10009036 3300013104 Bacteria 10694
80 Ga0157370_10026075 3300013104 Bacteria 5775
81 Ga0163163_10286487 3300014325 Bacteria 1699
82 Ga0182007_10005369 3300015262 Bacteria 5637
83 Ga0182005_1008308 3300015265 Bacteria 3066
84 Ga0183363_1060 3300015690 Bacteria 33607
85 Ga0214544_1001462 3300021320 Bacteria 49095
86 Ga0214542_1000006 3300021321 Bacteria 345164
87 Ga0214542_1006436 3300021321 Bacteria 21426
88 Ga0214543_1000003 3300021327 Bacteria 692327
89 Ga0214543_1000014 3300021327 Bacteria 324986
90 Ga0228711_1000015 3300022739 Bacteria 126974
91 Ga0228710_1000015 3300022740 Bacteria 133640
92 Ga0209435_100024 3300025206 Bacteria 199665
93 Ga0209760_102334 3300025207 Bacteria 1787
94 Ga0209436_100826 3300025208 Bacteria 12575
95 Ga0209436_103673 3300025208 Bacteria 3993
96 Ga0209437_100033 3300025233 Bacteria 512520
97 Ga0209437_100075 3300025233 Bacteria 297202
98 Ga0207425_1000010 3300025245 Bacteria 572898
99 Ga0207425_1004650 3300025245 Bacteria 4062
100 Ga0209646_1000064 3300025246 Bacteria 246524
101 Ga0209026_1000053 3300025250 Bacteria 246524
102 Ga0209677_102131 3300025253 Bacteria 7757
103 Ga0209148_1000038 3300025254 Bacteria 493744
104 Ga0209759_1000042 3300025256 Bacteria 246524
105 Ga0209129_1000034 3300025258 Bacteria 330950
106 Ga0209129_1000285 3300025258 Bacteria 48259
107 Ga0209129_1001399 3300025258 Bacteria 13499
108 Ga0209129_1001903 3300025258 Bacteria 11008
109 Ga0209129_1002726 3300025258 Bacteria 8273
110 Ga0209129_1003445 3300025258 Bacteria 6867
111 Ga0209129_1006070 3300025258 Bacteria 4039
112 Ga0209233_1000262 3300025261 Bacteria 79485
113 Ga0209233_1000277 3300025261 Bacteria 72470
114 Ga0209233_1001590 3300025261 Bacteria 8885
115 Ga0209455_1000068 3300025272 Bacteria 310024
116 Ga0209673_1000041 3300025273 Bacteria 307397
117 Ga0209673_1000456 3300025273 Bacteria 69267
118 Ga0209673_1004617 3300025273 Bacteria 7295
119 Ga0209673_1006095 3300025273 Bacteria 5913
120 Ga0209673_1007454 3300025273 Bacteria 5038
121 Ga0209673_1016433 3300025273 Bacteria 2768
122 Ga0209673_1024715 3300025273 Bacteria 2012
123 Ga0209130_1000006 3300025284 Bacteria 596528
124 Ga0209130_1000007 3300025284 Bacteria 591584
125 Ga0209130_1000018 3300025284 Bacteria 388301
126 Ga0209025_1000022 3300025294 Bacteria 574487
127 Ga0209025_1000097 3300025294 Bacteria 236632
128 Ga0209025_1000303 3300025294 Bacteria 110086
129 Ga0209025_1000361 3300025294 Bacteria 97060
130 Ga0209025_1001170 3300025294 Bacteria 37166
131 Ga0209025_1001792 3300025294 Bacteria 25500
132 Ga0209025_1006333 3300025294 Bacteria 9228
133 Ga0209025_1014436 3300025294 Bacteria 4854
134 Ga0209025_1014956 3300025294 Bacteria 4724
135 Ga0209025_1023084 3300025294 Bacteria 3269
136 Ga0209025_1040867 3300025294 Bacteria 1997
137 Ga0209564_1000453 3300025295 Bacteria 69474
138 Ga0209564_1000549 3300025295 Bacteria 60609
139 Ga0209564_1001900 3300025295 Bacteria 18728
140 Ga0209564_1010897 3300025295 Bacteria 4135
141 Ga0209564_1015767 3300025295 Bacteria 3054
142 Ga0209758_1000080 3300025297 Bacteria 261472
143 Ga0209758_1000837 3300025297 Bacteria 42938
144 Ga0209758_1001553 3300025297 Bacteria 26371
145 Ga0209758_1007221 3300025297 Bacteria 7646
146 Ga0209758_1009190 3300025297 Bacteria 6213
147 Ga0209758_1009197 3300025297 Bacteria 6206
148 Ga0209050_1002665 3300025298 Bacteria 14590
149 Ga0209256_1000522 3300025299 Bacteria 56073
150 Ga0209256_1000603 3300025299 Bacteria 49871
151 Ga0209256_1001237 3300025299 Bacteria 28317
152 Ga0209256_1004273 3300025299 Bacteria 9122
153 Ga0209256_1006071 3300025299 Bacteria 6582
154 Ga0209256_1008224 3300025299 Bacteria 4891
155 Ga0209256_1014693 3300025299 Bacteria 2794
156 Ga0209256_1020362 3300025299 Bacteria 2073
157 Ga0207426_1000003 3300025302 Bacteria 1063212
158 Ga0207426_1000044 3300025302 Bacteria 428043
159 Ga0207426_1000064 3300025302 Bacteria 358276
160 Ga0207426_1000094 3300025302 Bacteria 275293
161 Ga0207426_1000464 3300025302 Bacteria 62646
162 Ga0209051_1000166 3300025303 Bacteria 120265
163 Ga0209051_1002352 3300025303 Bacteria 13683
164 Ga0209051_1008737 3300025303 Bacteria 5324
165 Ga0209051_1020412 3300025303 Bacteria 2853
166 Ga0207647_10006647 3300025904 Bacteria 8401
167 Ga0207695_10003914 3300025913 Bacteria 20605
168 Ga0207671_10004258 3300025914 Bacteria 13774
169 Ga0207694_10072630 3300025924 Bacteria 2690
170 Ga0207650_10008730 3300025925 Bacteria 6921
171 Ga0207711_10237075 3300025941 Bacteria 1672
172 Ga0207678_10000146 3300026067 Bacteria 58091
173 Ga0207678_10037751 3300026067 Bacteria 4201
174 Ga0207674_10085394 3300026116 Bacteria 3151
175 Ga0207674_10242399 3300026116 Bacteria 1750
176 Ga0209281_1000339 3300027111 Bacteria 79862
177 Ga0209281_1000482 3300027111 Bacteria 55407
178 Ga0209371_1000021 3300027312 Bacteria 555864
179 Ga0209371_1002195 3300027312 Bacteria 11374
180 Ga0209371_1003253 3300027312 Bacteria 8095
181 Ga0209282_1000022 3300027666 Bacteria 173388
182 Ga0209282_1001624 3300027666 Bacteria 12469
183 Ga0268266_10033309 3300028379 Bacteria 4380
184 Ga0268266_10120899 3300028379 Bacteria 2331
185 Ga0268266_10163690 3300028379 Bacteria 2014
186 Ga0307515_10001636 3300028794 Bacteria 49786
187 Ga0307515_10030988 3300028794 Bacteria 8947
188 Ga0268256_1000020 3300030500 Bacteria 557873
189 Ga0268256_1011136 3300030500 Bacteria 2868
190 Ga0307513_10007185 3300031456 Bacteria 14462
191 Ga0307405_10009602 3300031731 Bacteria 4968
192 Ga0307518_10001252 3300031838 Bacteria 19089
193 Ga0307412_10053174 3300031911 Bacteria 2684
194 Ga0315914_1000013 3300031967 Bacteria 133640
195 Ga0307510_10025546 3300033180 Bacteria 6808
196 Ga0315913_1000029 3300033430 Bacteria 76154
197 Ga0315915_1000001 3300033464 Bacteria 481518
198 Ga0395900_0026469 3300037418 Bacteria 5939
199 Ga0395900_0228017 3300037418 Bacteria 1875
200 Ga0395905_0118936 3300037471 Bacteria 2483
201 Ga0395905_0246948 3300037471 Bacteria 1667
202 Ga0395901_0061039 3300038443 Bacteria 3923
203 Ga0439436_0033658 3300041404 Bacteria 1483
204 Ga0439465_0003609 3300041413 Bacteria 5049
205 Ga0439465_0010987 3300041413 Bacteria 2839
206 Ga0439465_0013934 3300041413 Bacteria 2503
207 Ga0451787_114143 3300041441 Bacteria 2746
208 Ga0451833_0722006 3300041491 Bacteria 3529
209 Ga0451839_0703428 3300041496 Bacteria 4595
210 Ga0451845_0606676 3300041501 Bacteria 3735
211 Ga0451847_0034164 3300041503 Bacteria 5332
212 Ga0439449_0009859 3300042007 Bacteria 3614
213 Ga0439462_0020284 3300042015 Bacteria 1733
214 Ga0439462_0025283 3300042015 Bacteria 1563
215 Ga0439434_0004827 3300042435 Bacteria 3944
216 Ga0450918_016393 3300042531 Bacteria 1287
217 Ga0466972_0007039 3300044658 Bacteria 5642
218 Ga0495629_0018391 3300046459 Bacteria 5003
219 Ga0495638_0004035 3300046460 Bacteria 11256
220 Ga0495638_0010365 3300046460 Bacteria 6481
221 Ga0495605_0009514 3300046474 Bacteria 5458
222 Ga0495605_0033618 3300046474 Bacteria 2601
223 Ga0495664_0039136 3300046477 Bacteria 2801
224 Ga0495585_0013185 3300046492 Bacteria 4843
225 Ga0495585_0021341 3300046492 Bacteria 3719
226 Ga0495583_0003707 3300046506 Bacteria 11365
227 Ga0495583_0011864 3300046506 Bacteria 4975
228 Ga0495606_0011305 3300046507 Bacteria 7295
229 Ga0495606_0057475 3300046507 Bacteria 2505
230 Ga0495610_0015909 3300046512 Bacteria 4350
231 Ga0495616_0032591 3300046513 Bacteria 2720
232 Ga0495628_0150407 3300046516 Bacteria 1774
233 Ga0495631_0002092 3300046518 Bacteria 11593
234 Ga0495632_0005211 3300046519 Bacteria 8665
235 Ga0495632_0024108 3300046519 Bacteria 3238
236 Ga0495632_0043917 3300046519 Bacteria 2232
237 Ga0495643_0015315 3300046522 Bacteria 4534
238 Ga0495643_0048672 3300046522 Bacteria 2289
239 Ga0495643_0056037 3300046522 Bacteria 2105
240 Ga0495652_0079747 3300046529 Bacteria 2706
241 Ga0495609_0042144 3300046538 Bacteria 2050
242 Ga0495622_0014684 3300046557 Bacteria 3638
243 Ga0495668_0015751 3300046616 Bacteria 4407
244 Ga0495668_0023002 3300046616 Bacteria 3559
245 Ga0495668_0024950 3300046616 Bacteria 3398
246 Ga0495611_0004168 3300046648 Bacteria 6292
247 Ga0495611_0018034 3300046648 Bacteria 3025
248 Ga0495625_0020061 3300046660 Bacteria 5166
249 Ga0495635_0222604 3300046663 Bacteria 1276
250 Ga0495661_0072397 3300046665 Bacteria 2011
251 Ga0495661_0113622 3300046665 Bacteria 1506
252 Ga0495588_0005347 3300046674 Bacteria 5712
253 Ga0495657_0047784 3300046675 Bacteria 2891
254 Ga0495671_0033406 3300046692 Bacteria 2621
255 Ga0495660_0006974 3300046810 Bacteria 6658
256 Ga0495604_0052259 3300047317 Bacteria 3165
257 Ga0495672_0019908 3300047320 Bacteria 4413
258 Ga0495686_0014181 3300047472 Bacteria 5494
259 Ga0495686_0017416 3300047472 Bacteria 4843
260 Ga0495686_0026395 3300047472 Bacteria 3800
261 Ga0495626_0019178 3300048091 Bacteria 3423
262 Ga0496100_0027627 3300048903 Bacteria 3491
263 Ga0496102_0032820 3300048905 Bacteria 4665
264 Ga0496106_0003949 3300048909 Bacteria 11076
265 Ga0496113_0170764 3300048916 Bacteria 1722
266 Ga0496113_0202762 3300048916 Bacteria 1577
267 Ga0496116_0000043 3300048919 Bacteria 328085
268 Ga0496116_0008619 3300048919 Bacteria 8822
269 Ga0496116_0018497 3300048919 Bacteria 5369
270 Ga0496116_0049065 3300048919 Bacteria 2827
271 Ga0496117_0000002 3300048920 Bacteria 2483758
272 Ga0496117_0017715 3300048920 Bacteria 5941
273 Ga0496117_0028613 3300048920 Bacteria 4313
274 Ga0496117_0033822 3300048920 Bacteria 3861
275 Ga0496117_0100966 3300048920 Bacteria 1826
276 Ga0496118_0006705 3300048921 Bacteria 12546
277 Ga0496118_0019792 3300048921 Bacteria 6003
278 Ga0496118_0021271 3300048921 Bacteria 5717
279 Ga0496118_0023919 3300048921 Bacteria 5289
280 Ga0496118_0024860 3300048921 Bacteria 5156
281 Ga0496118_0068245 3300048921 Bacteria 2584
282 Ga0496118_0083878 3300048921 Bacteria 2226
283 Ga0496119_0004434 3300048922 Bacteria 13978
284 Ga0496119_0015696 3300048922 Bacteria 5809
285 Ga0496119_0035951 3300048922 Bacteria 3239
286 Ga0496119_0072393 3300048922 Bacteria 2014
287 Ga0496120_0000431 3300048923 Bacteria 66335
288 Ga0496120_0014611 3300048923 Bacteria 5223
289 Ga0496120_0039804 3300048923 Bacteria 2769
290 Ga0496120_0123725 3300048923 Bacteria 1334
291 Ga0496121_0000001 3300048924 Bacteria 1830318
292 Ga0496121_0008512 3300048924 Bacteria 12039
293 Ga0496121_0015335 3300048924 Bacteria 8040
294 Ga0496121_0017788 3300048924 Bacteria 7225
295 Ga0496121_0029893 3300048924 Bacteria 5020
296 Ga0496121_0069518 3300048924 Bacteria 2840
297 Ga0496121_0089659 3300048924 Bacteria 2406
298 Ga0496122_0000001 3300048925 Bacteria 1827766
299 Ga0496122_0013614 3300048925 Bacteria 7941
300 Ga0496122_0036204 3300048925 Bacteria 3997
301 Ga0496122_0036369 3300048925 Bacteria 3982
302 Ga0496122_0036924 3300048925 Bacteria 3942
303 Ga0496122_0042561 3300048925 Bacteria 3571
304 Ga0496122_0084276 3300048925 Bacteria 2199
305 Ga0496122_0087810 3300048925 Bacteria 2134
306 Ga0496123_0000001 3300048926 Bacteria 1831497
307 Ga0496123_0017809 3300048926 Bacteria 5689
308 Ga0496123_0025657 3300048926 Bacteria 4436
309 Ga0496123_0032345 3300048926 Bacteria 3789
310 Ga0496123_0127828 3300048926 Bacteria 1415
311 Ga0496124_0000112 3300048927 Bacteria 166282
312 Ga0496124_0005607 3300048927 Bacteria 14042
313 Ga0496124_0025856 3300048927 Bacteria 5305
314 Ga0496124_0084039 3300048927 Bacteria 2611
315 Ga0496124_0134400 3300048927 Bacteria 1960
316 Ga0496125_0021697 3300048928 Bacteria 5978
317 Ga0496125_0026418 3300048928 Bacteria 5292
318 Ga0496125_0027795 3300048928 Bacteria 5120
319 Ga0496125_0123605 3300048928 Bacteria 1839
320 Ga0496126_0000369 3300048929 Bacteria 92814
321 Ga0496126_0056867 3300048929 Bacteria 3534
322 Ga0496126_0144176 3300048929 Bacteria 2047
323 Ga0496126_0310956 3300048929 Bacteria 1297
324 Ga0495678_012417 3300049459 Bacteria 4039
325 Ga0501031_0000013 3300049568 Bacteria 129659
326 Ga0501031_0019588 3300049568 Bacteria 4407
327 Ga0501031_0026036 3300049568 Bacteria 3816
328 Ga0501032_0000192 3300049569 Bacteria 50676
329 Ga0501032_0000425 3300049569 Bacteria 34971
330 Ga0501032_0019410 3300049569 Bacteria 4756
331 Ga0501033_0000044 3300049570 Bacteria 129614
332 Ga0501033_0003970 3300049570 Bacteria 11988
333 Ga0501033_0045492 3300049570 Bacteria 3266
334 Ga0501034_0000155 3300049571 Bacteria 129711
335 Ga0501034_0000314 3300049571 Bacteria 86025
336 Ga0501036_0000016 3300049572 Bacteria 129660
337 Ga0501036_0000577 3300049572 Bacteria 26453
338 Ga0501037_0000033 3300049573 Bacteria 129768
339 Ga0501037_0000296 3300049573 Bacteria 42150
340 Ga0501037_0015615 3300049573 Bacteria 5588
341 Ga0501038_0000085 3300049574 Bacteria 79192
342 Ga0501038_0000106 3300049574 Bacteria 70708
343 Ga0501039_0000003 3300049575 Bacteria 357424
344 Ga0501039_0000007 3300049575 Bacteria 277831
345 Ga0501040_0001250 3300049576 Bacteria 16148
346 Ga0501042_0101863 3300049578 Bacteria 2065
347 Ga0501043_0000068 3300049579 Bacteria 93023
348 Ga0501043_0000187 3300049579 Bacteria 56118
349 Ga0501043_0072640 3300049579 Bacteria 2702
350 Ga0501043_0153521 3300049579 Bacteria 1801
351 Ga0501046_0071429 3300049580 Bacteria 2697
352 Ga0501046_0115429 3300049580 Bacteria 2048
353 Ga0501046_0117657 3300049580 Bacteria 2024
354 Ga0501047_0001049 3300049581 Bacteria 27555
355 Ga0501047_0038419 3300049581 Bacteria 4632
356 Ga0501048_0040722 3300049582 Bacteria 3327
357 Ga0501067_0010529 3300049583 Bacteria 5122
358 Ga0501070_0010552 3300049586 Bacteria 7809
359 Ga0501072_0045298 3300049588 Bacteria 3458
360 Ga0501073_0017149 3300049589 Bacteria 5245
361 Ga0501080_0054107 3300049742 Bacteria 3738
362 Ga0501080_0059797 3300049742 Bacteria 3546
363 Ga0501035_0000032 3300049822 Bacteria 175435
364 Ga0501035_0000171 3300049822 Bacteria 79214
365 Ga0501035_0248363 3300049822 Bacteria 1512
366 Ga0501044_0000175 3300049823 Bacteria 79214
367 Ga0501044_0017877 3300049823 Bacteria 7606
368 Ga0501044_0092715 3300049823 Bacteria 3046
369 Ga0501044_0446441 3300049823 Bacteria 1201
370 Ga0501044_0450744 3300049823 Bacteria 1193
371 Ga0501045_0004424 3300049824 Bacteria 9696
372 nmdc:mga0yw44_704_c1 3300050492 Bacteria 12245
373 nmdc:mga0yw44_7599_c1 3300050492 Bacteria 5345
374 nmdc:mga0k408_117846_c1 3300050493 Bacteria 1572
375 nmdc:mga0k408_18795_c1 3300050493 Bacteria 3859
376 nmdc:mga06z11_15015_c1 3300050494 Bacteria 3448
377 nmdc:mga04h51_44303_c1 3300050495 Bacteria 1467
378 nmdc:mga09592_147898_c1 3300050508 Bacteria 2026
379 nmdc:mga0sz30_13568_c1 3300050516 Bacteria 3193
380 nmdc:mga0sz30_2901_c1 3300050516 Bacteria 6141
381 Ga0500643_007732 3300053087 Bacteria 4293
382 Ga0500569_003291 3300053109 Bacteria 3285
383 Ga0500572_013310 3300053111 Bacteria 2033
384 Ga0500594_0004872 3300053118 Bacteria 2967
385 Ga0500618_010083 3300053125 Bacteria 2547
386 Ga0500618_017606 3300053125 Bacteria 1775
387 Ga0500659_0053100 3300053135 Bacteria 2178
388 Ga0500568_0003769 3300053139 Bacteria 8296
389 Ga0500568_0007872 3300053139 Bacteria 5189
390 Ga0500577_0043254 3300053142 Bacteria 1654
391 Ga0500590_010286 3300053148 Bacteria 4722
392 Ga0500616_0005791 3300053153 Bacteria 8295
393 Ga0500616_0008910 3300053153 Bacteria 6158
394 Ga0500622_0003208 3300053156 Bacteria 11126
395 Ga0500622_0020302 3300053156 Bacteria 3528
396 Ga0500634_0005622 3300053161 Bacteria 5971
397 Ga0500636_0008365 3300053177 Bacteria 6002
398 Ga0501084_0017774 3300054114 Bacteria 5917
399 Ga0501082_0022618 3300060353 Bacteria 5415
400 Ga0466962_0024041 3300061719 Bacteria 2928

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10291129 Ga0105240_102911292 319
2 3300049823 Ga0501044_0446441 Ga0501044_0446441_175_1179 334
3 iso_pu_bacteria 2924710171 2924712402 335
4 3300025924 Ga0207694_10072630 Ga0207694_100726302 337
5 iso_pu_bacteria 2906370794 2906376014 337
6 iso_pu_bacteria 8004695233 8004695233 343
7 3300005548 Ga0070665_100243844 Ga0070665_1002438443 346
8 3300028379 Ga0268266_10033309 Ga0268266_100333092 346
9 iso_pu_bacteria 2597489875 2597814664 346
10 3300009101 Ga0105247_10188996 Ga0105247_101889962 350
11 iso_pu_bacteria 2551306091 2551729069 352
12 3300046460 Ga0495638_0004035 Ga0495638_0004035_5698_6849 356
13 3300010375 Ga0105239_10505569 Ga0105239_105055691 359
14 3300048929 Ga0496126_0310956 Ga0496126_0310956_64_1212 359
15 iso_pu_bacteria 2958041894 2958043947 361
16 iso_pu_bacteria 2643221550 2643771574 362
17 iso_pu_bacteria 2757320392 2757570920 362
18 iso_pu_bacteria 2899359706 2899369115 364
19 3300005577 Ga0068857_100128688 Ga0068857_1001286882 365
20 3300005937 Ga0081455_10000290 Ga0081455_1000029053 365
21 3300006880 Ga0075429_100159863 Ga0075429_1001598632 365
22 3300026067 Ga0207678_10000146 Ga0207678_1000014613 365
23 3300026116 Ga0207674_10085394 Ga0207674_100853943 365
24 3300028379 Ga0268266_10120899 Ga0268266_101208992 365
25 3300031838 Ga0307518_10001252 Ga0307518_1000125220 365
26 3300033180 Ga0307510_10025546 Ga0307510_100255464 365
27 3300044658 Ga0466972_0007039 Ga0466972_0007039_1251_2411 365
28 3300048924 Ga0496121_0008512 Ga0496121_0008512_5555_6667 365
29 3300049588 Ga0501072_0045298 Ga0501072_0045298_1433_2575 365
30 3300049589 Ga0501073_0017149 Ga0501073_0017149_155_1297 365
31 3300049742 Ga0501080_0059797 Ga0501080_0059797_237_1379 365
32 3300049823 Ga0501044_0450744 Ga0501044_0450744_30_1169 365
33 3300050508 nmdc:mga09592_147898_c1 nmdc:mga09592_147898_c1_113_1297 365
34 3300054114 Ga0501084_0017774 Ga0501084_0017774_1285_2427 365
35 3300060353 Ga0501082_0022618 Ga0501082_0022618_125_1267 365
36 iso_pu_bacteria 2582580736 2583152161 365
37 iso_pu_bacteria 2585427649 2586065425 365
38 iso_pu_bacteria 2808606522 2809593817 365
39 iso_pu_bacteria 2899370129 2899376927 365
40 iso_pu_bacteria 2915768154 2915772998 365
41 iso_pu_bacteria 2917736166 2917744062 365
42 3300003762 Ga0055542_1001254 Ga0055542_10012543 366
43 3300005539 Ga0068853_100016315 Ga0068853_1000163153 366
44 3300006038 Ga0075365_10027559 Ga0075365_100275593 366
45 3300006186 Ga0075369_10005679 Ga0075369_100056792 366
46 3300009551 Ga0105238_10013392 Ga0105238_100133926 366
47 3300010375 Ga0105239_10464388 Ga0105239_104643882 366
48 3300025254 Ga0209148_1000038 Ga0209148_1000038165 366
49 3300025272 Ga0209455_1000068 Ga0209455_1000068261 366
50 3300025297 Ga0209758_1007221 Ga0209758_10072215 366
51 3300025904 Ga0207647_10006647 Ga0207647_100066476 366
52 3300026116 Ga0207674_10242399 Ga0207674_102423991 366
53 3300037418 Ga0395900_0026469 Ga0395900_0026469_2685_3833 366
54 3300037418 Ga0395900_0228017 Ga0395900_0228017_46_1146 366
55 3300037471 Ga0395905_0118936 Ga0395905_0118936_1175_2323 366
56 3300037471 Ga0395905_0246948 Ga0395905_0246948_183_1331 366
57 3300038443 Ga0395901_0061039 Ga0395901_0061039_161_1309 366
58 3300041413 Ga0439465_0010987 Ga0439465_0010987_823_1971 366
59 3300048916 Ga0496113_0202762 Ga0496113_0202762_315_1415 366
60 3300049568 Ga0501031_0000013 Ga0501031_0000013_105113_106261 366
61 3300049568 Ga0501031_0019588 Ga0501031_0019588_686_1846 366
62 3300049568 Ga0501031_0026036 Ga0501031_0026036_219_1370 366
63 3300049569 Ga0501032_0000192 Ga0501032_0000192_23426_24577 366
64 3300049569 Ga0501032_0000425 Ga0501032_0000425_10425_11573 366
65 3300049570 Ga0501033_0000044 Ga0501033_0000044_23399_24547 366
66 3300049570 Ga0501033_0003970 Ga0501033_0003970_7887_9038 366
67 3300049570 Ga0501033_0045492 Ga0501033_0045492_1681_2856 366
68 3300049571 Ga0501034_0000155 Ga0501034_0000155_23399_24547 366
69 3300049571 Ga0501034_0000314 Ga0501034_0000314_630_1781 366
70 3300049572 Ga0501036_0000016 Ga0501036_0000016_23399_24547 366
71 3300049572 Ga0501036_0000577 Ga0501036_0000577_15703_16854 366
72 3300049573 Ga0501037_0000033 Ga0501037_0000033_105222_106370 366
73 3300049573 Ga0501037_0000296 Ga0501037_0000296_32970_34121 366
74 3300049573 Ga0501037_0015615 Ga0501037_0015615_686_1846 366
75 3300049574 Ga0501038_0000085 Ga0501038_0000085_54646_55794 366
76 3300049574 Ga0501038_0000106 Ga0501038_0000106_23426_24577 366
77 3300049575 Ga0501039_0000003 Ga0501039_0000003_286980_288131 366
78 3300049575 Ga0501039_0000007 Ga0501039_0000007_23399_24547 366
79 3300049576 Ga0501040_0001250 Ga0501040_0001250_10411_11559 366
80 3300049578 Ga0501042_0101863 Ga0501042_0101863_792_1952 366
81 3300049579 Ga0501043_0000068 Ga0501043_0000068_5044_6195 366
82 3300049579 Ga0501043_0000187 Ga0501043_0000187_31711_32859 366
83 3300049579 Ga0501043_0072640 Ga0501043_0072640_179_1339 366
84 3300049580 Ga0501046_0071429 Ga0501046_0071429_754_1905 366
85 3300049580 Ga0501046_0117657 Ga0501046_0117657_179_1339 366
86 3300049581 Ga0501047_0001049 Ga0501047_0001049_15809_16957 366
87 3300049581 Ga0501047_0038419 Ga0501047_0038419_2489_3640 366
88 3300049582 Ga0501048_0040722 Ga0501048_0040722_1764_2924 366
89 3300049583 Ga0501067_0010529 Ga0501067_0010529_1006_2169 366
90 3300049586 Ga0501070_0010552 Ga0501070_0010552_74_1222 366
91 3300049742 Ga0501080_0054107 Ga0501080_0054107_24_1184 366
92 3300049822 Ga0501035_0000032 Ga0501035_0000032_69056_70207 366
93 3300049822 Ga0501035_0000171 Ga0501035_0000171_54668_55816 366
94 3300049823 Ga0501044_0000175 Ga0501044_0000175_23399_24547 366
95 3300049823 Ga0501044_0017877 Ga0501044_0017877_3597_4748 366
96 3300049823 Ga0501044_0092715 Ga0501044_0092715_1112_2287 366
97 3300049824 Ga0501045_0004424 Ga0501045_0004424_6551_7711 366
98 3300050492 nmdc:mga0yw44_704_c1 nmdc:mga0yw44_704_c1_35_1183 366
99 3300053087 Ga0500643_007732 Ga0500643_007732_2369_3517 366
100 iso_pu_bacteria 2508501127 2509144111 366
101 iso_pu_bacteria 2513237305 2514417792 366
102 iso_pu_bacteria 2513237351 2514590198 366
103 iso_pu_bacteria 2599185301 2599937608 366
104 iso_pu_bacteria 2643221551 2643775110 366
105 iso_pu_bacteria 2643221555 2643793555 366
106 iso_pu_bacteria 2643221564 2643839928 366
107 iso_pu_bacteria 2643221595 2643989490 366
108 iso_pu_bacteria 2643221627 2644153932 366
109 iso_pu_bacteria 2693429783 2694631851 366
110 iso_pu_bacteria 2693429784 2694640281 366
111 iso_pu_bacteria 2738543024 2739309309 366
112 iso_pu_bacteria 2791355123 2792751783 366
113 iso_pu_bacteria 2841734538 2841740528 366
114 iso_pu_bacteria 2847670302 2847670965 366
115 iso_pu_bacteria 2856314179 2856316436 366
116 iso_pu_bacteria 2856342000 2856344562 366
117 iso_pu_bacteria 2856349417 2856352903 366
118 iso_pu_bacteria 2856364286 2856367183 366
119 iso_pu_bacteria 2857349434 2857355522 366
120 iso_pu_bacteria 2869162929 2869169058 366
121 iso_pu_bacteria 2869285874 2869287488 366
122 iso_pu_bacteria 2871429161 2871431015 366
123 iso_pu_bacteria 2871435913 2871437272 366
124 iso_pu_bacteria 2871474448 2871481062 366
125 iso_pu_bacteria 2871488783 2871495322 366
126 iso_pu_bacteria 2871495908 2871500384 366
127 iso_pu_bacteria 2874123672 2874127982 366
128 iso_pu_bacteria 2874146452 2874150184 366
129 iso_pu_bacteria 2874155637 2874158508 366
130 iso_pu_bacteria 2876369609 2876376280 366
131 iso_pu_bacteria 2876377896 2876378974 366
132 iso_pu_bacteria 2876392853 2876395326 366
133 iso_pu_bacteria 2876413966 2876415637 366
134 iso_pu_bacteria 2878035449 2878041745 366
135 iso_pu_bacteria 2878745973 2878747636 366
136 iso_pu_bacteria 2878753008 2878758012 366
137 iso_pu_bacteria 2878760144 2878764473 366
138 iso_pu_bacteria 2878767105 2878771574 366
139 iso_pu_bacteria 2881147464 2881152483 366
140 iso_pu_bacteria 2881155292 2881155901 366
141 iso_pu_bacteria 2881161766 2881161858 366
142 iso_pu_bacteria 2881845957 2881847209 366
143 iso_pu_bacteria 2881853255 2881859417 366
144 iso_pu_bacteria 2881861095 2881863123 366
145 iso_pu_bacteria 2882912400 2882917378 366
146 iso_pu_bacteria 2885305155 2885310745 366
147 iso_pu_bacteria 2885312484 2885317513 366
148 iso_pu_bacteria 2885318864 2885321722 366
149 iso_pu_bacteria 2885326080 2885330685 366
150 iso_pu_bacteria 2885334103 2885336264 366
151 iso_pu_bacteria 2885342637 2885349269 366
152 iso_pu_bacteria 2885350715 2885352164 366
153 iso_pu_bacteria 2888343758 2888347991 366
154 iso_pu_bacteria 2888350351 2888356957 366
155 iso_pu_bacteria 2889010040 2889012001 366
156 iso_pu_bacteria 2889016732 2889023064 366
157 iso_pu_bacteria 2903492973 2903501601 366
158 iso_pu_bacteria 2903492973 2903502090 366
159 iso_pu_bacteria 2903540706 2903545197 366
160 iso_pu_bacteria 2904659560 2904661956 366
161 iso_pu_bacteria 2906308376 2906310028 366
162 iso_pu_bacteria 2906321335 2906322901 366
163 iso_pu_bacteria 2906354277 2906360143 366
164 iso_pu_bacteria 2906414383 2906416573 366
165 iso_pu_bacteria 2922185730 2922190569 366
166 iso_pu_bacteria 2924754689 2924760080 366
167 iso_pu_bacteria 2924784321 2924784724 366
168 iso_pu_bacteria 2937813078 2937813327 366
169 iso_pu_bacteria 2937836603 2937839919 366
170 iso_pu_bacteria 2937843397 2937845667 366
171 iso_pu_bacteria 2937994558 2937999045 366
172 iso_pu_bacteria 2938014810 2938018870 366
173 iso_pu_bacteria 2958071322 2958074368 366
174 iso_pu_bacteria 2958100919 2958106062 366
175 iso_pu_bacteria 2958130278 2958131891 366
176 iso_pu_bacteria 2958165035 2958169519 366
177 iso_pu_bacteria 2958172287 2958176195 366
178 iso_pu_bacteria 2958179912 2958181694 366
179 iso_pu_bacteria 2961077736 2961079537 366
180 iso_pu_bacteria 2961114664 2961117110 366
181 iso_pu_bacteria 2961163497 2961167979 366
182 iso_pu_bacteria 2961170736 2961174585 366
183 iso_pu_bacteria 2965018300 2965022798 366
184 iso_pu_bacteria 2965119406 2965124814 366
185 iso_pu_bacteria 2967996073 2968000577 366
186 iso_pu_bacteria 2968003550 2968010051 366
187 iso_pu_bacteria 2968110612 2968113018 366
188 iso_pu_bacteria 2968171901 2968176379 366
189 iso_pu_bacteria 2970489779 2970490990 366
190 iso_pu_bacteria 2970503327 2970507172 366
191 iso_pu_bacteria 2970524798 2970531885 366
192 iso_pu_bacteria 2970540015 2970546446 366
193 iso_pu_bacteria 2970554993 2970559318 366
194 iso_pu_bacteria 2977821940 2977828914 366
195 iso_pu_bacteria 2977828996 2977833720 366
196 iso_pu_bacteria 2977843712 2977846943 366
197 iso_pu_bacteria 2977864932 2977866669 366
198 iso_pu_bacteria 2977898635 2977906013 366
199 iso_pu_bacteria 2977942078 2977949024 366
200 iso_pu_bacteria 2977971508 2977980024 366
201 iso_pu_bacteria 2979710463 2979711667 366
202 iso_pu_bacteria 2979742915 2979751473 366
203 iso_pu_bacteria 2979808191 2979812367 366
204 iso_pu_bacteria 2987636660 2987640655 366
205 iso_pu_bacteria 2987652177 2987653593 366
206 iso_pu_bacteria 2987659509 2987663993 366
207 iso_pu_bacteria 2996310559 2996310910 366
208 iso_pu_bacteria 2996336353 2996340638 366
209 iso_pu_bacteria 3004188549 3004193048 366
210 iso_pu_bacteria 3004203850 3004208853 366
211 iso_pu_bacteria 8002285264 8002285564 366
212 iso_pu_bacteria 8004374579 8004379524 366
213 iso_pu_bacteria 8004387939 8004390227 366
214 iso_pu_bacteria 8004395343 8004395574 366
215 iso_pu_bacteria 8004633249 8004635532 366
216 iso_pu_bacteria 8004640170 8004643039 366
217 iso_pu_bacteria 8004714634 8004716290 366
218 iso_pu_bacteria 8055617313 8055622100 366
219 3300048922 Ga0496119_0004434 Ga0496119_0004434_7848_9050 368
220 3300048923 Ga0496120_0123725 Ga0496120_0123725_96_1298 368
221 3300048928 Ga0496125_0123605 Ga0496125_0123605_30_1232 368
222 iso_pu_bacteria 2534681786 2535484643 368
223 iso_pu_bacteria 2751185800 2753359225 368
224 iso_pu_bacteria 2758568016 2758641472 368
225 iso_pu_bacteria 2854911287 2854911840 368
226 iso_pu_bacteria 2915650412 2915651740 368
227 3300002704 JGI25155J39150_1000019 JGI25155J39150_1000019156 370
228 3300002705 JGI25156J39149_1000020 JGI25156J39149_100002016 370
229 3300002738 JGI25154J39366_1000355 JGI25154J39366_100035514 370
230 3300002741 JGI25157J39369_1000129 JGI25157J39369_100012915 370
231 3300002773 JGI25152J39213_1001416 JGI25152J39213_100141611 370
232 3300002773 JGI25152J39213_1007446 JGI25152J39213_10074462 370
233 3300002773 JGI25152J39213_1010485 JGI25152J39213_10104851 370
234 3300002774 JGI25150J39212_1003234 JGI25150J39212_10032344 370
235 3300002774 JGI25150J39212_1003455 JGI25150J39212_10034553 370
236 3300002987 JGI25159J45721_1000002 JGI25159J45721_100000216 370
237 3300002987 JGI25159J45721_1000980 JGI25159J45721_10009805 370
238 3300002987 JGI25159J45721_1001906 JGI25159J45721_10019067 370
239 3300003187 JGI25151J46595_10000202 JGI25151J46595_1000020274 370
240 3300003187 JGI25151J46595_10004677 JGI25151J46595_100046772 370
241 3300003187 JGI25151J46595_10010603 JGI25151J46595_100106032 370
242 3300003187 JGI25151J46595_10010765 JGI25151J46595_100107655 370
243 3300003214 JGI25165J46597_1001254 JGI25165J46597_100125415 370
244 3300003215 JGI25153J46596_10014589 JGI25153J46596_100145893 370
245 3300003215 JGI25153J46596_10014620 JGI25153J46596_100146202 370
246 3300003215 JGI25153J46596_10021142 JGI25153J46596_100211421 370
247 3300003322 rootL2_10036886 rootL2_100368863 370
248 3300003323 rootH1_10016157 rootH1_100161572 370
249 3300003323 rootH1_10111348 rootH1_101113483 370
250 3300003354 JGI25160J50197_1000008 JGI25160J50197_100000816 370
251 3300003354 JGI25160J50197_1000015 JGI25160J50197_1000015231 370
252 3300003374 JGI25161J50226_1000005 JGI25161J50226_100000511 370
253 3300003374 JGI25161J50226_1000053 JGI25161J50226_100005341 370
254 3300003374 JGI25161J50226_1000806 JGI25161J50226_10008067 370
255 3300003771 Ga0055526_1005935 Ga0055526_10059357 370
256 3300003771 Ga0055526_1009889 Ga0055526_10098893 370
257 3300003775 Ga0055524_1008166 Ga0055524_10081665 370
258 3300003775 Ga0055524_1011673 Ga0055524_10116733 370
259 3300003775 Ga0055524_1012225 Ga0055524_10122252 370
260 3300003790 Ga0055528_1001627 Ga0055528_10016278 370
261 3300003790 Ga0055528_1001795 Ga0055528_100179511 370
262 3300003790 Ga0055528_1002851 Ga0055528_10028518 370
263 3300003790 Ga0055528_1003705 Ga0055528_10037059 370
264 3300003790 Ga0055528_1004157 Ga0055528_10041573 370
265 3300003790 Ga0055528_1011336 Ga0055528_10113364 370
266 3300003792 Ga0055540_1001936 Ga0055540_10019369 370
267 3300003792 Ga0055540_1005993 Ga0055540_10059932 370
268 3300004625 Ga0055543_1000019 Ga0055543_1000019117 370
269 3300004625 Ga0055543_1000027 Ga0055543_1000027121 370
270 3300004625 Ga0055543_1000109 Ga0055543_100010956 370
271 3300005262 Ga0065165_1000015 Ga0065165_100001517 370
272 3300005262 Ga0065165_1000915 Ga0065165_100091524 370
273 3300005262 Ga0065165_1013694 Ga0065165_10136944 370
274 3300005355 Ga0070671_100016258 Ga0070671_1000162583 370
275 3300005455 Ga0070663_100077398 Ga0070663_1000773981 370
276 3300005563 Ga0068855_100165758 Ga0068855_1001657582 370
277 3300005616 Ga0068852_100261718 Ga0068852_1002617182 370
278 3300006038 Ga0075365_10012434 Ga0075365_100124344 370
279 3300006038 Ga0075365_10023974 Ga0075365_100239745 370
280 3300006178 Ga0075367_10033019 Ga0075367_100330191 370
281 3300006186 Ga0075369_10000841 Ga0075369_100008412 370
282 3300006948 Ga0099826_10021676 Ga0099826_100216766 370
283 3300009093 Ga0105240_10004701 Ga0105240_1000470118 370
284 3300009148 Ga0105243_10015458 Ga0105243_100154582 370
285 3300009177 Ga0105248_10106365 Ga0105248_101063651 370
286 3300009545 Ga0105237_10002935 Ga0105237_1000293517 370
287 3300009765 Ga0123341_1000001 Ga0123341_1000001112 370
288 3300009766 Ga0123342_1017951 Ga0123342_10179517 370
289 3300010375 Ga0105239_10016921 Ga0105239_100169216 370
290 3300013102 Ga0157371_10000132 Ga0157371_1000013269 370
291 3300013102 Ga0157371_10047427 Ga0157371_100474273 370
292 3300013104 Ga0157370_10009036 Ga0157370_100090369 370
293 3300013104 Ga0157370_10026075 Ga0157370_100260752 370
294 3300014325 Ga0163163_10286487 Ga0163163_102864871 370
295 3300015262 Ga0182007_10005369 Ga0182007_100053695 370
296 3300015265 Ga0182005_1008308 Ga0182005_10083082 370
297 3300015690 Ga0183363_1060 Ga0183363_106029 370
298 3300021320 Ga0214544_1001462 Ga0214544_100146241 370
299 3300021321 Ga0214542_1000006 Ga0214542_1000006308 370
300 3300021321 Ga0214542_1006436 Ga0214542_10064364 370
301 3300021327 Ga0214543_1000003 Ga0214543_1000003684 370
302 3300021327 Ga0214543_1000014 Ga0214543_100001415 370
303 3300022739 Ga0228711_1000015 Ga0228711_100001575 370
304 3300022740 Ga0228710_1000015 Ga0228710_100001574 370
305 3300025206 Ga0209435_100024 Ga0209435_100024152 370
306 3300025207 Ga0209760_102334 Ga0209760_1023342 370
307 3300025208 Ga0209436_100826 Ga0209436_1008264 370
308 3300025208 Ga0209436_103673 Ga0209436_1036734 370
309 3300025233 Ga0209437_100033 Ga0209437_100033492 370
310 3300025233 Ga0209437_100075 Ga0209437_10007514 370
311 3300025245 Ga0207425_1000010 Ga0207425_1000010123 370
312 3300025245 Ga0207425_1004650 Ga0207425_10046503 370
313 3300025246 Ga0209646_1000064 Ga0209646_1000064152 370
314 3300025250 Ga0209026_1000053 Ga0209026_1000053152 370
315 3300025253 Ga0209677_102131 Ga0209677_1021312 370
316 3300025256 Ga0209759_1000042 Ga0209759_1000042152 370
317 3300025258 Ga0209129_1000034 Ga0209129_1000034219 370
318 3300025258 Ga0209129_1000285 Ga0209129_100028523 370
319 3300025258 Ga0209129_1001399 Ga0209129_10013993 370
320 3300025258 Ga0209129_1001903 Ga0209129_10019034 370
321 3300025258 Ga0209129_1002726 Ga0209129_10027265 370
322 3300025258 Ga0209129_1003445 Ga0209129_10034453 370
323 3300025258 Ga0209129_1006070 Ga0209129_10060703 370
324 3300025261 Ga0209233_1000262 Ga0209233_100026262 370
325 3300025261 Ga0209233_1000277 Ga0209233_100027714 370
326 3300025261 Ga0209233_1001590 Ga0209233_10015906 370
327 3300025273 Ga0209673_1000041 Ga0209673_1000041310 370
328 3300025273 Ga0209673_1000456 Ga0209673_100045655 370
329 3300025273 Ga0209673_1004617 Ga0209673_10046173 370
330 3300025273 Ga0209673_1006095 Ga0209673_10060954 370
331 3300025273 Ga0209673_1007454 Ga0209673_10074545 370
332 3300025273 Ga0209673_1016433 Ga0209673_10164332 370
333 3300025273 Ga0209673_1024715 Ga0209673_10247152 370
334 3300025284 Ga0209130_1000006 Ga0209130_100000630 370
335 3300025284 Ga0209130_1000007 Ga0209130_1000007287 370
336 3300025284 Ga0209130_1000018 Ga0209130_100001842 370
337 3300025294 Ga0209025_1000022 Ga0209025_1000022459 370
338 3300025294 Ga0209025_1000097 Ga0209025_100009716 370
339 3300025294 Ga0209025_1000303 Ga0209025_100030343 370
340 3300025294 Ga0209025_1000361 Ga0209025_100036178 370
341 3300025294 Ga0209025_1001170 Ga0209025_100117015 370
342 3300025294 Ga0209025_1001792 Ga0209025_100179227 370
343 3300025294 Ga0209025_1006333 Ga0209025_10063338 370
344 3300025294 Ga0209025_1014436 Ga0209025_10144362 370
345 3300025294 Ga0209025_1014956 Ga0209025_10149564 370
346 3300025294 Ga0209025_1023084 Ga0209025_10230842 370
347 3300025294 Ga0209025_1040867 Ga0209025_10408672 370
348 3300025295 Ga0209564_1000453 Ga0209564_100045330 370
349 3300025295 Ga0209564_1000549 Ga0209564_100054935 370
350 3300025295 Ga0209564_1001900 Ga0209564_10019001 370
351 3300025295 Ga0209564_1010897 Ga0209564_10108974 370
352 3300025295 Ga0209564_1015767 Ga0209564_10157672 370
353 3300025297 Ga0209758_1000080 Ga0209758_100008060 370
354 3300025297 Ga0209758_1000837 Ga0209758_100083717 370
355 3300025297 Ga0209758_1001553 Ga0209758_100155315 370
356 3300025297 Ga0209758_1009190 Ga0209758_10091903 370
357 3300025297 Ga0209758_1009197 Ga0209758_10091973 370
358 3300025298 Ga0209050_1002665 Ga0209050_100266512 370
359 3300025299 Ga0209256_1000522 Ga0209256_10005222 370
360 3300025299 Ga0209256_1000603 Ga0209256_100060344 370
361 3300025299 Ga0209256_1001237 Ga0209256_10012375 370
362 3300025299 Ga0209256_1004273 Ga0209256_10042734 370
363 3300025299 Ga0209256_1006071 Ga0209256_10060712 370
364 3300025299 Ga0209256_1008224 Ga0209256_10082245 370
365 3300025299 Ga0209256_1014693 Ga0209256_10146932 370
366 3300025299 Ga0209256_1020362 Ga0209256_10203621 370
367 3300025302 Ga0207426_1000003 Ga0207426_1000003892 370
368 3300025302 Ga0207426_1000044 Ga0207426_1000044348 370
369 3300025302 Ga0207426_1000064 Ga0207426_1000064287 370
370 3300025302 Ga0207426_1000094 Ga0207426_100009480 370
371 3300025302 Ga0207426_1000464 Ga0207426_100046454 370
372 3300025303 Ga0209051_1000166 Ga0209051_1000166119 370
373 3300025303 Ga0209051_1002352 Ga0209051_100235212 370
374 3300025303 Ga0209051_1008737 Ga0209051_10087375 370
375 3300025303 Ga0209051_1020412 Ga0209051_10204123 370
376 3300025913 Ga0207695_10003914 Ga0207695_100039146 370
377 3300025914 Ga0207671_10004258 Ga0207671_100042586 370
378 3300025925 Ga0207650_10008730 Ga0207650_100087303 370
379 3300025941 Ga0207711_10237075 Ga0207711_102370752 370
380 3300026067 Ga0207678_10037751 Ga0207678_100377511 370
381 3300027111 Ga0209281_1000339 Ga0209281_100033964 370
382 3300027111 Ga0209281_1000482 Ga0209281_10004821 370
383 3300027312 Ga0209371_1000021 Ga0209371_1000021253 370
384 3300027312 Ga0209371_1002195 Ga0209371_100219510 370
385 3300027312 Ga0209371_1003253 Ga0209371_10032532 370
386 3300027666 Ga0209282_1000022 Ga0209282_10000228 370
387 3300027666 Ga0209282_1001624 Ga0209282_10016243 370
388 3300028379 Ga0268266_10163690 Ga0268266_101636902 370
389 3300028794 Ga0307515_10001636 Ga0307515_1000163621 370
390 3300028794 Ga0307515_10030988 Ga0307515_100309882 370
391 3300030500 Ga0268256_1000020 Ga0268256_1000020259 370
392 3300030500 Ga0268256_1011136 Ga0268256_10111362 370
393 3300031456 Ga0307513_10007185 Ga0307513_100071853 370
394 3300031731 Ga0307405_10009602 Ga0307405_100096025 370
395 3300031911 Ga0307412_10053174 Ga0307412_100531741 370
396 3300031967 Ga0315914_1000013 Ga0315914_100001374 370
397 3300033430 Ga0315913_1000029 Ga0315913_100002964 370
398 3300033464 Ga0315915_1000001 Ga0315915_100000174 370
399 3300041404 Ga0439436_0033658 Ga0439436_0033658_261_1454 370
400 3300041413 Ga0439465_0003609 Ga0439465_0003609_2717_3910 370
401 3300041413 Ga0439465_0013934 Ga0439465_0013934_275_1387 370
402 3300041441 Ga0451787_114143 Ga0451787_114143_1048_2160 370
403 3300041491 Ga0451833_0722006 Ga0451833_0722006_559_1716 370
404 3300041496 Ga0451839_0703428 Ga0451839_0703428_745_1902 370
405 3300041501 Ga0451845_0606676 Ga0451845_0606676_714_1871 370
406 3300041503 Ga0451847_0034164 Ga0451847_0034164_1114_2271 370
407 3300042007 Ga0439449_0009859 Ga0439449_0009859_102_1214 370
408 3300042015 Ga0439462_0020284 Ga0439462_0020284_351_1463 370
409 3300042015 Ga0439462_0025283 Ga0439462_0025283_272_1465 370
410 3300042435 Ga0439434_0004827 Ga0439434_0004827_1721_2914 370
411 3300042531 Ga0450918_016393 Ga0450918_016393_70_1263 370
412 3300046459 Ga0495629_0018391 Ga0495629_0018391_1028_2140 370
413 3300046460 Ga0495638_0010365 Ga0495638_0010365_2478_3653 370
414 3300046474 Ga0495605_0009514 Ga0495605_0009514_1557_2933 370
415 3300046474 Ga0495605_0033618 Ga0495605_0033618_432_1544 370
416 3300046477 Ga0495664_0039136 Ga0495664_0039136_437_1549 370
417 3300046492 Ga0495585_0013185 Ga0495585_0013185_658_1770 370
418 3300046492 Ga0495585_0021341 Ga0495585_0021341_1168_2343 370
419 3300046506 Ga0495583_0003707 Ga0495583_0003707_8132_9334 370
420 3300046506 Ga0495583_0011864 Ga0495583_0011864_1081_2457 370
421 3300046507 Ga0495606_0011305 Ga0495606_0011305_3253_4365 370
422 3300046507 Ga0495606_0057475 Ga0495606_0057475_67_1269 370
423 3300046512 Ga0495610_0015909 Ga0495610_0015909_189_1301 370
424 3300046513 Ga0495616_0032591 Ga0495616_0032591_38_1414 370
425 3300046516 Ga0495628_0150407 Ga0495628_0150407_458_1570 370
426 3300046518 Ga0495631_0002092 Ga0495631_0002092_9184_10560 370
427 3300046519 Ga0495632_0005211 Ga0495632_0005211_7133_8245 370
428 3300046519 Ga0495632_0024108 Ga0495632_0024108_819_2195 370
429 3300046519 Ga0495632_0043917 Ga0495632_0043917_166_1323 370
430 3300046522 Ga0495643_0015315 Ga0495643_0015315_542_1885 370
431 3300046522 Ga0495643_0048672 Ga0495643_0048672_31_1143 370
432 3300046522 Ga0495643_0056037 Ga0495643_0056037_69_1226 370
433 3300046529 Ga0495652_0079747 Ga0495652_0079747_1357_2469 370
434 3300046538 Ga0495609_0042144 Ga0495609_0042144_154_1329 370
435 3300046557 Ga0495622_0014684 Ga0495622_0014684_813_1925 370
436 3300046616 Ga0495668_0015751 Ga0495668_0015751_2292_3668 370
437 3300046616 Ga0495668_0023002 Ga0495668_0023002_983_2257 370
438 3300046616 Ga0495668_0024950 Ga0495668_0024950_1946_3058 370
439 3300046648 Ga0495611_0004168 Ga0495611_0004168_2536_3711 370
440 3300046648 Ga0495611_0018034 Ga0495611_0018034_1735_2847 370
441 3300046660 Ga0495625_0020061 Ga0495625_0020061_2729_3841 370
442 3300046663 Ga0495635_0222604 Ga0495635_0222604_114_1226 370
443 3300046665 Ga0495661_0072397 Ga0495661_0072397_847_1959 370
444 3300046665 Ga0495661_0113622 Ga0495661_0113622_122_1396 370
445 3300046674 Ga0495588_0005347 Ga0495588_0005347_3143_4291 370
446 3300046675 Ga0495657_0047784 Ga0495657_0047784_317_1429 370
447 3300046692 Ga0495671_0033406 Ga0495671_0033406_1343_2491 370
448 3300046810 Ga0495660_0006974 Ga0495660_0006974_1158_2270 370
449 3300047317 Ga0495604_0052259 Ga0495604_0052259_1229_2341 370
450 3300047320 Ga0495672_0019908 Ga0495672_0019908_952_2127 370
451 3300047472 Ga0495686_0014181 Ga0495686_0014181_2817_3980 370
452 3300047472 Ga0495686_0017416 Ga0495686_0017416_2539_3651 370
453 3300047472 Ga0495686_0026395 Ga0495686_0026395_2234_3391 370
454 3300048091 Ga0495626_0019178 Ga0495626_0019178_2019_3131 370
455 3300048903 Ga0496100_0027627 Ga0496100_0027627_1527_2741 370
456 3300048905 Ga0496102_0032820 Ga0496102_0032820_1381_2595 370
457 3300048909 Ga0496106_0003949 Ga0496106_0003949_7410_8753 370
458 3300048916 Ga0496113_0170764 Ga0496113_0170764_76_1188 370
459 3300048919 Ga0496116_0000043 Ga0496116_0000043_71750_72919 370
460 3300048919 Ga0496116_0008619 Ga0496116_0008619_1653_2816 370
461 3300048919 Ga0496116_0018497 Ga0496116_0018497_2644_3858 370
462 3300048919 Ga0496116_0049065 Ga0496116_0049065_365_1708 370
463 3300048920 Ga0496117_0000002 Ga0496117_0000002_1259730_1260842 370
464 3300048920 Ga0496117_0017715 Ga0496117_0017715_1080_2243 370
465 3300048920 Ga0496117_0028613 Ga0496117_0028613_1313_2527 370
466 3300048920 Ga0496117_0033822 Ga0496117_0033822_2238_3581 370
467 3300048920 Ga0496117_0100966 Ga0496117_0100966_598_1803 370
468 3300048921 Ga0496118_0006705 Ga0496118_0006705_4126_5238 370
469 3300048921 Ga0496118_0019792 Ga0496118_0019792_2496_3803 370
470 3300048921 Ga0496118_0021271 Ga0496118_0021271_1660_2874 370
471 3300048921 Ga0496118_0023919 Ga0496118_0023919_1523_2686 370
472 3300048921 Ga0496118_0024860 Ga0496118_0024860_1006_2349 370
473 3300048921 Ga0496118_0068245 Ga0496118_0068245_439_1602 370
474 3300048921 Ga0496118_0083878 Ga0496118_0083878_894_2063 370
475 3300048922 Ga0496119_0015696 Ga0496119_0015696_1245_2408 370
476 3300048922 Ga0496119_0035951 Ga0496119_0035951_1573_2685 370
477 3300048922 Ga0496119_0072393 Ga0496119_0072393_262_1431 370
478 3300048923 Ga0496120_0000431 Ga0496120_0000431_16113_17225 370
479 3300048923 Ga0496120_0014611 Ga0496120_0014611_1216_2421 370
480 3300048923 Ga0496120_0039804 Ga0496120_0039804_590_1804 370
481 3300048924 Ga0496121_0000001 Ga0496121_0000001_1098578_1099783 370
482 3300048924 Ga0496121_0015335 Ga0496121_0015335_5724_6887 370
483 3300048924 Ga0496121_0017788 Ga0496121_0017788_3234_4346 370
484 3300048924 Ga0496121_0029893 Ga0496121_0029893_918_2261 370
485 3300048924 Ga0496121_0069518 Ga0496121_0069518_1693_2805 370
486 3300048924 Ga0496121_0089659 Ga0496121_0089659_1139_2296 370
487 3300048925 Ga0496122_0000001 Ga0496122_0000001_576842_577954 370
488 3300048925 Ga0496122_0013614 Ga0496122_0013614_6676_7839 370
489 3300048925 Ga0496122_0036204 Ga0496122_0036204_1266_2609 370
490 3300048925 Ga0496122_0036369 Ga0496122_0036369_1433_2647 370
491 3300048925 Ga0496122_0036924 Ga0496122_0036924_532_1695 370
492 3300048925 Ga0496122_0042561 Ga0496122_0042561_1425_2588 370
493 3300048925 Ga0496122_0084276 Ga0496122_0084276_400_1557 370
494 3300048925 Ga0496122_0087810 Ga0496122_0087810_420_1625 370
495 3300048926 Ga0496123_0000001 Ga0496123_0000001_580573_581685 370
496 3300048926 Ga0496123_0017809 Ga0496123_0017809_2864_4027 370
497 3300048926 Ga0496123_0025657 Ga0496123_0025657_539_1882 370
498 3300048926 Ga0496123_0032345 Ga0496123_0032345_1610_2824 370
499 3300048926 Ga0496123_0127828 Ga0496123_0127828_209_1369 370
500 3300048927 Ga0496124_0000112 Ga0496124_0000112_148691_149842 370
501 3300048927 Ga0496124_0005607 Ga0496124_0005607_4939_6102 370
502 3300048927 Ga0496124_0025856 Ga0496124_0025856_136_1341 370
503 3300048927 Ga0496124_0084039 Ga0496124_0084039_128_1285 370
504 3300048927 Ga0496124_0134400 Ga0496124_0134400_19_1131 370
505 3300048928 Ga0496125_0021697 Ga0496125_0021697_2168_3331 370
506 3300048928 Ga0496125_0026418 Ga0496125_0026418_1438_2652 370
507 3300048928 Ga0496125_0027795 Ga0496125_0027795_2635_3798 370
508 3300048929 Ga0496126_0000369 Ga0496126_0000369_54351_55520 370
509 3300048929 Ga0496126_0056867 Ga0496126_0056867_638_1852 370
510 3300048929 Ga0496126_0144176 Ga0496126_0144176_589_1746 370
511 3300049459 Ga0495678_012417 Ga0495678_012417_2222_3598 370
512 3300049569 Ga0501032_0019410 Ga0501032_0019410_822_1985 370
513 3300049579 Ga0501043_0153521 Ga0501043_0153521_346_1509 370
514 3300049580 Ga0501046_0115429 Ga0501046_0115429_701_1864 370
515 3300049822 Ga0501035_0248363 Ga0501035_0248363_185_1348 370
516 3300050492 nmdc:mga0yw44_7599_c1 nmdc:mga0yw44_7599_c1_2253_3410 370
517 3300050493 nmdc:mga0k408_117846_c1 nmdc:mga0k408_117846_c1_139_1251 370
518 3300050493 nmdc:mga0k408_18795_c1 nmdc:mga0k408_18795_c1_313_1470 370
519 3300050494 nmdc:mga06z11_15015_c1 nmdc:mga06z11_15015_c1_1143_2300 370
520 3300050495 nmdc:mga04h51_44303_c1 nmdc:mga04h51_44303_c1_293_1405 370
521 3300050516 nmdc:mga0sz30_13568_c1 nmdc:mga0sz30_13568_c1_420_1583 370
522 3300050516 nmdc:mga0sz30_2901_c1 nmdc:mga0sz30_2901_c1_2311_3423 370
523 3300053109 Ga0500569_003291 Ga0500569_003291_1178_2290 370
524 3300053111 Ga0500572_013310 Ga0500572_013310_111_1274 370
525 3300053118 Ga0500594_0004872 Ga0500594_0004872_1135_2511 370
526 3300053125 Ga0500618_010083 Ga0500618_010083_254_1366 370
527 3300053125 Ga0500618_017606 Ga0500618_017606_416_1573 370
528 3300053135 Ga0500659_0053100 Ga0500659_0053100_485_1642 370
529 3300053139 Ga0500568_0003769 Ga0500568_0003769_2291_3634 370
530 3300053139 Ga0500568_0007872 Ga0500568_0007872_2453_3628 370
531 3300053142 Ga0500577_0043254 Ga0500577_0043254_11_1123 370
532 3300053148 Ga0500590_010286 Ga0500590_010286_1622_2734 370
533 3300053153 Ga0500616_0005791 Ga0500616_0005791_2485_3660 370
534 3300053153 Ga0500616_0008910 Ga0500616_0008910_2929_4086 370
535 3300053156 Ga0500622_0003208 Ga0500622_0003208_2430_3773 370
536 3300053156 Ga0500622_0020302 Ga0500622_0020302_1927_3084 370
537 3300053161 Ga0500634_0005622 Ga0500634_0005622_1741_2853 370
538 3300053177 Ga0500636_0008365 Ga0500636_0008365_2624_3787 370
539 3300061719 Ga0466962_0024041 Ga0466962_0024041_313_1470 370
540 iso_pu_bacteria 2508501122 2509108722 370
541 iso_pu_bacteria 2509276019 2509374255 370
542 iso_pu_bacteria 2509276021 2509387228 370
543 iso_pu_bacteria 2509276033 2509442628 370
544 iso_pu_bacteria 2510065019 2510132824 370
545 iso_pu_bacteria 2510065057 2510307372 370
546 iso_pu_bacteria 2510461069 2510840098 370
547 iso_pu_bacteria 2510461076 2510894108 370
548 iso_pu_bacteria 2510461076 2510899133 370
549 iso_pu_bacteria 2510917022 2511132972 370
550 iso_pu_bacteria 2510917028 2511183475 370
551 iso_pu_bacteria 2510917030 2511199552 370
552 iso_pu_bacteria 2511231052 2511501218 370
553 iso_pu_bacteria 2512875026 2512972021 370
554 iso_pu_bacteria 2513237086 2513582990 370
555 iso_pu_bacteria 2513237088 2513594791 370
556 iso_pu_bacteria 2513237089 2513604690 370
557 iso_pu_bacteria 2513237091 2513616376 370
558 iso_pu_bacteria 2513237138 2513870346 370
559 iso_pu_bacteria 2513237140 2513880902 370
560 iso_pu_bacteria 2513237143 2513902138 370
561 iso_pu_bacteria 2513237144 2513908847 370
562 iso_pu_bacteria 2513237146 2513925904 370
563 iso_pu_bacteria 2513237156 2513987328 370
564 iso_pu_bacteria 2513237159 2514000981 370
565 iso_pu_bacteria 2513237160 2514007344 370
566 iso_pu_bacteria 2513237162 2514019814 370
567 iso_pu_bacteria 2515154107 2515608396 370
568 iso_pu_bacteria 2515154113 2515638206 370
569 iso_pu_bacteria 2515154116 2515656153 370
570 iso_pu_bacteria 2515154134 2515739143 370
571 iso_pu_bacteria 2516653046 2516892497 370
572 iso_pu_bacteria 2516653077 2517040461 370
573 iso_pu_bacteria 2516653085 2517075946 370
574 iso_pu_bacteria 2517093000 2517094608 370
575 iso_pu_bacteria 2517287029 2517406322 370
576 iso_pu_bacteria 2517487022 2517569318 370
577 iso_pu_bacteria 2519899620 2520379506 370
578 iso_pu_bacteria 2524023209 2524461502 370
579 iso_pu_bacteria 2529292951 2530645086 370
580 iso_pu_bacteria 2534681796 2535515988 370
581 iso_pu_bacteria 2537561587 2537874735 370
582 iso_pu_bacteria 2551306084 2551678302 370
583 iso_pu_bacteria 2551306085 2551689247 370
584 iso_pu_bacteria 2551306090 2551717334 370
585 iso_pu_bacteria 2551306090 2551721666 370
586 iso_pu_bacteria 2551306093 2551745464 370
587 iso_pu_bacteria 2558860100 2558863280 370
588 iso_pu_bacteria 2558860242 2559294562 370
589 iso_pu_bacteria 2558860983 2561466237 370
590 iso_pu_bacteria 2582581283 2585165779 370
591 iso_pu_bacteria 2582581294 2585199735 370
592 iso_pu_bacteria 2582581298 2585225957 370
593 iso_pu_bacteria 2582581299 2585231332 370
594 iso_pu_bacteria 2582581304 2585254203 370
595 iso_pu_bacteria 2582581306 2585269472 370
596 iso_pu_bacteria 2582581307 2585273052 370
597 iso_pu_bacteria 2582581308 2585283707 370
598 iso_pu_bacteria 2582581315 2585325259 370
599 iso_pu_bacteria 2582581316 2585329342 370
600 iso_pu_bacteria 2582581865 2585390934 370
601 iso_pu_bacteria 2582581866 2585393013 370
602 iso_pu_bacteria 2582581867 2585400515 370
603 iso_pu_bacteria 2585427526 2585528783 370
604 iso_pu_bacteria 2585427527 2585530940 370
605 iso_pu_bacteria 2585427529 2585546917 370
606 iso_pu_bacteria 2585427530 2585557930 370
607 iso_pu_bacteria 2585427531 2585559649 370
608 iso_pu_bacteria 2585427590 2585819922 370
609 iso_pu_bacteria 2585427608 2585902330 370
610 iso_pu_bacteria 2585427609 2585904973 370
611 iso_pu_bacteria 2585428125 2587979911 370
612 iso_pu_bacteria 2599185156 2599333554 370
613 iso_pu_bacteria 2599185170 2599418387 370
614 iso_pu_bacteria 2599185210 2599602307 370
615 iso_pu_bacteria 2599185352 2600192183 370
616 iso_pu_bacteria 2600255279 2601608448 370
617 iso_pu_bacteria 2600255308 2601745222 370
618 iso_pu_bacteria 2615840624 2616292872 370
619 iso_pu_bacteria 2615840698 2616554164 370
620 iso_pu_bacteria 2617270742 2617381454 370
621 iso_pu_bacteria 2643221557 2643806985 370
622 iso_pu_bacteria 2643221568 2643855693 370
623 iso_pu_bacteria 2643221582 2643919069 370
624 iso_pu_bacteria 2643221607 2644048195 370
625 iso_pu_bacteria 2643221610 2644067271 370
626 iso_pu_bacteria 2643221618 2644108780 370
627 iso_pu_bacteria 2643221626 2644151301 370
628 iso_pu_bacteria 2643221634 2644191421 370
629 iso_pu_bacteria 2643221636 2644200693 370
630 iso_pu_bacteria 2643221637 2644210527 370
631 iso_pu_bacteria 2643221643 2644238774 370
632 iso_pu_bacteria 2643221653 2644296618 370
633 iso_pu_bacteria 2643221655 2644311436 370
634 iso_pu_bacteria 2643221659 2644329694 370
635 iso_pu_bacteria 2643221668 2644378340 370
636 iso_pu_bacteria 2643221675 2644420901 370
637 iso_pu_bacteria 2643221680 2644454425 370
638 iso_pu_bacteria 2643221686 2644485172 370
639 iso_pu_bacteria 2643221688 2644493196 370
640 iso_pu_bacteria 2643221689 2644502186 370
641 iso_pu_bacteria 2643221693 2644518453 370
642 iso_pu_bacteria 2643221698 2644546368 370
643 iso_pu_bacteria 2643221712 2644617235 370
644 iso_pu_bacteria 2643221718 2644654079 370
645 iso_pu_bacteria 2643221719 2644654872 370
646 iso_pu_bacteria 2643221723 2644675351 370
647 iso_pu_bacteria 2643221726 2644689763 370
648 iso_pu_bacteria 2657244999 2657683059 370
649 iso_pu_bacteria 2667528174 2671114806 370
650 iso_pu_bacteria 2690316117 2692316579 370
651 iso_pu_bacteria 2738541317 2738946337 370
652 iso_pu_bacteria 2765235942 2766067990 370
653 iso_pu_bacteria 2775507266 2778177701 370
654 iso_pu_bacteria 2791355082 2792584396 370
655 iso_pu_bacteria 2791355092 2792628609 370
656 iso_pu_bacteria 2791355094 2792642851 370
657 iso_pu_bacteria 2791355259 2793315664 370
658 iso_pu_bacteria 2791355260 2793321297 370
659 iso_pu_bacteria 2791355261 2793330068 370
660 iso_pu_bacteria 2791355263 2793343113 370
661 iso_pu_bacteria 2791355266 2793360445 370
662 iso_pu_bacteria 2802428858 2802719331 370
663 iso_pu_bacteria 2802428859 2802723108 370
664 iso_pu_bacteria 2802428860 2802732531 370
665 iso_pu_bacteria 2802428861 2802738470 370
666 iso_pu_bacteria 2802428862 2802745094 370
667 iso_pu_bacteria 2802428863 2802751529 370
668 iso_pu_bacteria 2802429268 2804751553 370
669 iso_pu_bacteria 2808606387 2808985662 370
670 iso_pu_bacteria 2818991272 2819242311 370
671 iso_pu_bacteria 2818991439 2819555781 370
672 iso_pu_bacteria 2818991448 2819611383 370
673 iso_pu_bacteria 2818991453 2819638410 370
674 iso_pu_bacteria 2837651117 2837652914 370
675 iso_pu_bacteria 2838022645 2838028853 370
676 iso_pu_bacteria 2838029111 2838032431 370
677 iso_pu_bacteria 2838035591 2838037921 370
678 iso_pu_bacteria 2838068647 2838071276 370
679 iso_pu_bacteria 2838074704 2838076649 370
680 iso_pu_bacteria 2838661181 2838662919 370
681 iso_pu_bacteria 2838668709 2838669917 370
682 iso_pu_bacteria 2838675328 2838676494 370
683 iso_pu_bacteria 2838680041 2838682673 370
684 iso_pu_bacteria 2838686498 2838693068 370
685 iso_pu_bacteria 2838694306 2838697306 370
686 iso_pu_bacteria 2838701080 2838702289 370
687 iso_pu_bacteria 2838707686 2838709515 370
688 iso_pu_bacteria 2838714209 2838715377 370
689 iso_pu_bacteria 2838719591 2838720823 370
690 iso_pu_bacteria 2838724970 2838726135 370
691 iso_pu_bacteria 2838729681 2838736061 370
692 iso_pu_bacteria 2838742623 2838748946 370
693 iso_pu_bacteria 2841846520 2841847753 370
694 iso_pu_bacteria 2841851746 2841858282 370
695 iso_pu_bacteria 2841859092 2841859707 370
696 iso_pu_bacteria 2841864319 2841865006 370
697 iso_pu_bacteria 2842077413 2842077627 370
698 iso_pu_bacteria 2842110456 2842110999 370
699 iso_pu_bacteria 2842118031 2842119864 370
700 iso_pu_bacteria 2842124991 2842126217 370
701 iso_pu_bacteria 2842130223 2842131387 370
702 iso_pu_bacteria 2842146304 2842147166 370
703 iso_pu_bacteria 2842152218 2842153443 370
704 iso_pu_bacteria 2842156927 2842163121 370
705 iso_pu_bacteria 2842163707 2842165096 370
706 iso_pu_bacteria 2842170452 2842171620 370
707 iso_pu_bacteria 2842175837 2842177063 370
708 iso_pu_bacteria 2842180545 2842186753 370
709 iso_pu_bacteria 2842187318 2842188485 370
710 iso_pu_bacteria 2842192696 2842197112 370
711 iso_pu_bacteria 2842198810 2842204872 370
712 iso_pu_bacteria 2842205361 2842206514 370
713 iso_pu_bacteria 2842211629 2842212796 370
714 iso_pu_bacteria 2842217011 2842220526 370
715 iso_pu_bacteria 2842224351 2842225585 370
716 iso_pu_bacteria 2842229732 2842235924 370
717 iso_pu_bacteria 2842237096 2842238928 370
718 iso_pu_bacteria 2842243621 2842249783 370
719 iso_pu_bacteria 2842250916 2842252231 370
720 iso_pu_bacteria 2842257432 2842263856 370
721 iso_pu_bacteria 2842271015 2842277536 370
722 iso_pu_bacteria 2842278818 2842279971 370
723 iso_pu_bacteria 2842291075 2842291289 370
724 iso_pu_bacteria 2842298080 2842302826 370
725 iso_pu_bacteria 2842304105 2842310382 370
726 iso_pu_bacteria 2842311132 2842315335 370
727 iso_pu_bacteria 2842317721 2842318361 370
728 iso_pu_bacteria 2842341865 2842346998 370
729 iso_pu_bacteria 2842357229 2842361364 370
730 iso_pu_bacteria 2842363717 2842366831 370
731 iso_pu_bacteria 2842370503 2842373302 370
732 iso_pu_bacteria 2842377471 2842377685 370
733 iso_pu_bacteria 2842384541 2842386374 370
734 iso_pu_bacteria 2842395702 2842399582 370
735 iso_pu_bacteria 2842402390 2842404872 370
736 iso_pu_bacteria 2842409023 2842411454 370
737 iso_pu_bacteria 2842415677 2842418095 370
738 iso_pu_bacteria 2842422224 2842425068 370
739 iso_pu_bacteria 2842447887 2842451649 370
740 iso_pu_bacteria 2842475841 2842478940 370
741 iso_pu_bacteria 2842482326 2842483069 370
742 iso_pu_bacteria 2842489311 2842494403 370
743 iso_pu_bacteria 2842495871 2842500664 370
744 iso_pu_bacteria 2842502639 2842506340 370
745 iso_pu_bacteria 2842509118 2842509940 370
746 iso_pu_bacteria 2842515876 2842516492 370
747 iso_pu_bacteria 2842521101 2842526120 370
748 iso_pu_bacteria 2842922631 2842925037 370
749 iso_pu_bacteria 2844163670 2844168290 370
750 iso_pu_bacteria 2844454524 2844454566 370
751 iso_pu_bacteria 2847417321 2847418353 370
752 iso_pu_bacteria 2848992105 2848993332 370
753 iso_pu_bacteria 2850079185 2850080685 370
754 iso_pu_bacteria 2852387548 2852389310 370
755 iso_pu_bacteria 2855872281 2855878691 370
756 iso_pu_bacteria 2857516855 2857522980 370
757 iso_pu_bacteria 2858800743 2858801221 370
758 iso_pu_bacteria 2891048133 2891050775 370
759 iso_pu_bacteria 2896384573 2896386843 370
760 iso_pu_bacteria 2899792073 2899796755 370
761 iso_pu_bacteria 2899803654 2899807841 370
762 iso_pu_bacteria 2899845264 2899850288 370
763 iso_pu_bacteria 2913295892 2913301824 370
764 iso_pu_bacteria 2913308742 2913310748 370
765 iso_pu_bacteria 2915980308 2915985716 370
766 iso_pu_bacteria 2915986958 2915991753 370
767 iso_pu_bacteria 2915993759 2915995158 370
768 iso_pu_bacteria 2916007675 2916008706 370
769 iso_pu_bacteria 2916014648 2916018005 370
770 iso_pu_bacteria 2916021584 2916022091 370
771 iso_pu_bacteria 2916028427 2916031822 370
772 iso_pu_bacteria 2916035215 2916038632 370
773 iso_pu_bacteria 2916041962 2916046656 370
774 iso_pu_bacteria 2916048683 2916052690 370
775 iso_pu_bacteria 2916055098 2916055114 370
776 iso_pu_bacteria 2916061851 2916065842 370
777 iso_pu_bacteria 2916068649 2916073885 370
778 iso_pu_bacteria 2916076590 2916080235 370
779 iso_pu_bacteria 2919100787 2919104293 370
780 iso_pu_bacteria 2919114240 2919115470 370
781 iso_pu_bacteria 2919166419 2919167543 370
782 iso_pu_bacteria 2919408235 2919409527 370
783 iso_pu_bacteria 2920760137 2920765429 370
784 iso_pu_bacteria 2920822456 2920824060 370
785 iso_pu_bacteria 2921201388 2921202742 370
786 iso_pu_bacteria 2921208531 2921210811 370
787 iso_pu_bacteria 2921237296 2921242509 370
788 iso_pu_bacteria 2921244191 2921249309 370
789 iso_pu_bacteria 2921250672 2921251612 370
790 iso_pu_bacteria 2921257292 2921260806 370
791 iso_pu_bacteria 2921263974 2921263990 370
792 iso_pu_bacteria 2921282425 2921282844 370
793 iso_pu_bacteria 2921289301 2921294631 370
794 iso_pu_bacteria 2921296804 2921297129 370
795 iso_pu_bacteria 2923556063 2923560692 370
796 iso_pu_bacteria 2924144063 2924147345 370
797 iso_pu_bacteria 2924150972 2924155024 370
798 iso_pu_bacteria 2924158325 2924164999 370
799 iso_pu_bacteria 2924165586 2924168015 370
800 iso_pu_bacteria 2924172951 2924177098 370
801 iso_pu_bacteria 2924179722 2924184762 370
802 iso_pu_bacteria 2924186466 2924188868 370
803 iso_pu_bacteria 2924193448 2924197333 370
804 iso_pu_bacteria 2924200457 2924204213 370
805 iso_pu_bacteria 2924207177 2924212484 370
806 iso_pu_bacteria 2924214083 2924218813 370
807 iso_pu_bacteria 2924221636 2924225958 370
808 iso_pu_bacteria 2924228884 2924233921 370
809 iso_pu_bacteria 2926754445 2926756520 370
810 iso_pu_bacteria 2926760298 2926760762 370
811 iso_pu_bacteria 2929138655 2929139733 370
812 iso_pu_bacteria 2933006813 2933008087 370
813 iso_pu_bacteria 2933011516 2933012868 370
814 iso_pu_bacteria 2933016740 2933020460 370
815 iso_pu_bacteria 2933570622 2933576823 370
816 iso_pu_bacteria 2933586486 2933587024 370
817 iso_pu_bacteria 2933594066 2933595358 370
818 iso_pu_bacteria 2933599457 2933602075 370
819 iso_pu_bacteria 2935894831 2935900559 370
820 iso_pu_bacteria 2935901341 2935904931 370
821 iso_pu_bacteria 2936367885 2936373267 370
822 iso_pu_bacteria 2936375103 2936381365 370
823 iso_pu_bacteria 2936381700 2936384633 370
824 iso_pu_bacteria 2936996657 2937000854 370
825 iso_pu_bacteria 2937002841 2937006459 370
826 iso_pu_bacteria 2937009748 2937013089 370
827 iso_pu_bacteria 2937016420 2937019549 370
828 iso_pu_bacteria 2937023124 2937028646 370
829 iso_pu_bacteria 2937029754 2937030359 370
830 iso_pu_bacteria 2937036028 2937040742 370
831 iso_pu_bacteria 2937042894 2937044114 370
832 iso_pu_bacteria 2937049772 2937052981 370
833 iso_pu_bacteria 2937056579 2937059313 370
834 iso_pu_bacteria 2937063883 2937068629 370
835 iso_pu_bacteria 2937071275 2937071710 370
836 iso_pu_bacteria 2937078374 2937079393 370
837 iso_pu_bacteria 2937084907 2937091798 370
838 iso_pu_bacteria 2937091812 2937096153 370
839 iso_pu_bacteria 2937098957 2937103819 370
840 iso_pu_bacteria 2937106411 2937110964 370
841 iso_pu_bacteria 2937113482 2937114111 370
842 iso_pu_bacteria 2937119839 2937125611 370
843 iso_pu_bacteria 2937126314 2937126612 370
844 iso_pu_bacteria 2941499720 2941499992 370
845 iso_pu_bacteria 2957375807 2957377180 370
846 iso_pu_bacteria 2957382221 2957382895 370
847 iso_pu_bacteria 2957388812 2957388885 370
848 iso_pu_bacteria 2957395598 2957396515 370
849 iso_pu_bacteria 2957402308 2957407682 370
850 iso_pu_bacteria 2957408893 2957409562 370
851 iso_pu_bacteria 2957415311 2957419739 370
852 iso_pu_bacteria 2957422303 2957426507 370
853 iso_pu_bacteria 2957430029 2957431828 370
854 iso_pu_bacteria 2957437181 2957437851 370
855 iso_pu_bacteria 2957443900 2957446709 370
856 iso_pu_bacteria 2957450854 2957453248 370
857 iso_pu_bacteria 2957457609 2957458885 370
858 iso_pu_bacteria 2957464669 2957470971 370
859 iso_pu_bacteria 2957471148 2957475185 370
860 iso_pu_bacteria 2957478035 2957479773 370
861 iso_pu_bacteria 2957484790 2957489900 370
862 iso_pu_bacteria 2957491536 2957497682 370
863 iso_pu_bacteria 2957498199 2957498897 370
864 iso_pu_bacteria 2957505466 2957509105 370
865 iso_pu_bacteria 2960584000 2960586898 370
866 iso_pu_bacteria 2960591022 2960593475 370
867 iso_pu_bacteria 2960597568 2960598822 370
868 iso_pu_bacteria 2960603979 2960608706 370
869 iso_pu_bacteria 2960610863 2960615710 370
870 iso_pu_bacteria 2960617483 2960617947 370
871 iso_pu_bacteria 2960624210 2960628146 370
872 iso_pu_bacteria 2960631154 2960633867 370
873 iso_pu_bacteria 2960637947 2960642260 370
874 iso_pu_bacteria 2960645483 2960651584 370
875 iso_pu_bacteria 2960652885 2960655100 370
876 iso_pu_bacteria 2960660292 2960662788 370
877 iso_pu_bacteria 2960667422 2960671257 370
878 iso_pu_bacteria 2960674078 2960677165 370
879 iso_pu_bacteria 2960680706 2960685062 370
880 iso_pu_bacteria 2960687367 2960691533 370
881 iso_pu_bacteria 2960693952 2960698694 370
882 iso_pu_bacteria 2964607997 2964613697 370
883 iso_pu_bacteria 2964615318 2964618788 370
884 iso_pu_bacteria 2964621998 2964627007 370
885 iso_pu_bacteria 2964628898 2964632778 370
886 iso_pu_bacteria 2964636051 2964639374 370
887 iso_pu_bacteria 2964643177 2964648815 370
888 iso_pu_bacteria 2964649959 2964652796 370
889 iso_pu_bacteria 2964656573 2964657870 370
890 iso_pu_bacteria 2964663802 2964667905 370
891 iso_pu_bacteria 2964670856 2964673428 370
892 iso_pu_bacteria 2964678106 2964680996 370
893 iso_pu_bacteria 2964685014 2964687020 370
894 iso_pu_bacteria 2964691889 2964697750 370
895 iso_pu_bacteria 2964698721 2964700656 370
896 iso_pu_bacteria 2964705432 2964708738 370
897 iso_pu_bacteria 2964712639 2964714536 370
898 iso_pu_bacteria 2964719344 2964723812 370
899 iso_pu_bacteria 2967664464 2967670400 370
900 iso_pu_bacteria 2967671571 2967678648 370
901 iso_pu_bacteria 2967678726 2967680567 370
902 iso_pu_bacteria 2967686174 2967688587 370
903 iso_pu_bacteria 2967693043 2967693491 370
904 iso_pu_bacteria 2967699805 2967700206 370
905 iso_pu_bacteria 2967706974 2967711945 370
906 iso_pu_bacteria 2967714385 2967717939 370
907 iso_pu_bacteria 2967721400 2967726222 370
908 iso_pu_bacteria 2967728569 2967729700 370
909 iso_pu_bacteria 2967735183 2967738911 370
910 iso_pu_bacteria 2967742019 2967745924 370
911 iso_pu_bacteria 2967748971 2967754357 370
912 iso_pu_bacteria 2967755722 2967761605 370
913 iso_pu_bacteria 2967762386 2967766295 370
914 iso_pu_bacteria 2967769361 2967772331 370
915 iso_pu_bacteria 2967775926 2967777732 370
916 iso_pu_bacteria 2970019648 2970022699 370
917 iso_pu_bacteria 2970026789 2970027896 370
918 iso_pu_bacteria 2970033650 2970036737 370
919 iso_pu_bacteria 2970040964 2970043487 370
920 iso_pu_bacteria 2970047711 2970052097 370
921 iso_pu_bacteria 2970054988 2970058068 370
922 iso_pu_bacteria 2970061556 2970061934 370
923 iso_pu_bacteria 2970068827 2970072145 370
924 iso_pu_bacteria 2970076120 2970079634 370
925 iso_pu_bacteria 2970082768 2970086705 370
926 iso_pu_bacteria 2970088815 2970089752 370
927 iso_pu_bacteria 2970095765 2970098650 370
928 iso_pu_bacteria 2970102677 2970105800 370
929 iso_pu_bacteria 2970109326 2970111947 370
930 iso_pu_bacteria 2970116247 2970118501 370
931 iso_pu_bacteria 2970122695 2970123218 370
932 iso_pu_bacteria 2970129317 2970129763 370
933 iso_pu_bacteria 2970136068 2970141614 370
934 iso_pu_bacteria 2970143518 2970149762 370
935 iso_pu_bacteria 2970149975 2970154192 370
936 iso_pu_bacteria 2970156795 2970160622 370
937 iso_pu_bacteria 2970164137 2970167814 370
938 iso_pu_bacteria 2970170962 2970172949 370
939 iso_pu_bacteria 2970177841 2970178717 370
940 iso_pu_bacteria 2970184632 2970190291 370
941 iso_pu_bacteria 2970191845 2970194130 370
942 iso_pu_bacteria 2977516862 2977520552 370
943 iso_pu_bacteria 2977523885 2977527311 370
944 iso_pu_bacteria 2977530762 2977532297 370
945 iso_pu_bacteria 2977537788 2977538236 370
946 iso_pu_bacteria 2977544691 2977550250 370
947 iso_pu_bacteria 2977551784 2977557550 370
948 iso_pu_bacteria 2977558990 2977561116 370
949 iso_pu_bacteria 2977565890 2977567317 370
950 iso_pu_bacteria 2977572785 2977576681 370
951 iso_pu_bacteria 2977579622 2977584303 370
952 iso_pu_bacteria 2979089926 2979093960 370
953 iso_pu_bacteria 2979095461 2979098657 370
954 iso_pu_bacteria 2979100975 2979105991 370
955 iso_pu_bacteria 2984509177 2984512222 370
956 iso_pu_bacteria 2984518228 2984521416 370
957 iso_pu_bacteria 2984537506 2984540712 370
958 iso_pu_bacteria 2984587000 2984589319 370
959 iso_pu_bacteria 2984601300 2984602976 370
960 iso_pu_bacteria 2989776772 2989778410 370
961 iso_pu_bacteria 2995392953 2995395080 370
962 iso_pu_bacteria 2996887358 2996892203 370
963 iso_pu_bacteria 3003930520 3003932909 370
964 iso_pu_bacteria 3005409236 3005412662 370
965 iso_pu_bacteria 3005416602 3005417771 370
966 iso_pu_bacteria 3005445848 3005447147 370
967 iso_pu_bacteria 3005452660 3005453764 370
968 iso_pu_bacteria 643692032 643825316 370
969 iso_pu_bacteria 648276728 648736610 370
970 iso_pu_bacteria 650716007 650739764 370
971 iso_pu_bacteria 8003570095 8003570820 370
972 iso_pu_bacteria 8003992118 8003993192 370
973 iso_pu_bacteria 8003999396 8004000449 370
974 iso_pu_bacteria 8005246636 8005251070 370
975 iso_pu_bacteria 8005258706 8005259549 370
976 iso_pu_bacteria 8005275841 8005280122 370
977 iso_pu_bacteria 8005282627 8005288191 370
978 iso_pu_bacteria 8005289223 8005294705 370
979 iso_pu_bacteria 8005301065 8005307123 370
980 iso_pu_bacteria 8005307578 8005314650 370
981 iso_pu_bacteria 8005314921 8005316518 370
982 iso_pu_bacteria 8005321885 8005326730 370
983 iso_pu_bacteria 8005376324 8005378700 370
984 iso_pu_bacteria 8005382845 8005384955 370
985 iso_pu_bacteria 8005395548 8005397119 370
986 iso_pu_bacteria 8005430974 8005436189 370
987 iso_pu_bacteria 8005460587 8005462429 370
988 iso_pu_bacteria 8005484373 8005485410 370
989 iso_pu_bacteria 8005542996 8005544628 370
990 iso_pu_bacteria 8005556819 8005558207 370
991 iso_pu_bacteria 8005563573 8005569387 370
992 iso_pu_bacteria 8005570704 8005575347 370
993 iso_pu_bacteria 8005619151 8005621130 370
994 iso_pu_bacteria 8005626139 8005631519 370
995 iso_pu_bacteria 8005645114 8005650064 370
996 iso_pu_bacteria 8005658619 8005659772 370
997 iso_pu_bacteria 8005682033 8005686615 370
998 iso_pu_bacteria 8005688590 8005695031 370
999 iso_pu_bacteria 8005695170 8005696255 370
1000 iso_pu_bacteria 8018127388 8018128158 370
1001 iso_pu_bacteria 8018163183 8018168005 370
1002 iso_pu_bacteria 8023680758 8023680881 370
1003 iso_pu_bacteria 8024479707 8024485652 370
1004 iso_pu_bacteria 8024486573 8024489539 370
1005 iso_pu_bacteria 8024501048 8024505122 370
1006 iso_pu_bacteria 8046767195 8046769289 370
1007 iso_pu_bacteria 8049293176 8049294239 370
1008 iso_pu_bacteria 8055431914 8055432867 370
1009 iso_pu_bacteria 8056375014 8056380066 370
1010 iso_pu_bacteria 8056382006 8056387647 370
1011 iso_pu_bacteria 8057575449 8057577078 370
1012 iso_pu_bacteria 8057874678 8057875588 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

103

453

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h14-assembly1.cif.gz_A crystal structure of a putative aminotransferase from silicibacter pomeroyi 0.964 1 369
5yhv-assembly1.cif.gz_B crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9607 1 369
5yhv-assembly1.cif.gz_D crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9574 1 361
5yhv-assembly1.cif.gz_B crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9556 1 369
2z61-assembly1.cif.gz_A-2 crystal structure of mj0684 from methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases 0.9402 1 370
ID Description Score Start End Superfamily
3h14A00 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9589 2 368 3.40.640.10
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9552 1 369 3.40.640.10
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9501 1 369 3.40.640.10
2z61A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9393 267 365 3.90.1150.10
af_Q58097_268_366_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9359 268 365 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7X6FDL4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9948 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A0F4FUP0-F1-model_v4 deleted 0.9926 14 370
AF-A0A7X6FDL4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9921 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A537T6U4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9776 1 275 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A537NJD5-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.977 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
95.58 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map