F488138

General Info

Members Datasets Scaffolds Average Seq Length
1011 383 1011 79

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10942200|Ga0075433_109422002
Length 81
Sequence MRATVLVRPKPGILDPQGEAVESSLRQLGFAVEGARIGRVVDLELAEDGDPDQARAELERMCEQLLANPLIESYEITVSPR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
236 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
240 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 5.44
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10251041 3300003203 Bacteria 520
2 JGI25407J50210_10002049 3300003373 Bacteria 4700
3 JGI25407J50210_10008089 3300003373 Bacteria 2647
4 JGI25407J50210_10021986 3300003373 Bacteria 1658
5 Ga0070658_10041042 3300005327 Bacteria 3733
6 Ga0070658_10071609 3300005327 Bacteria 2839
7 Ga0070676_10147255 3300005328 Bacteria 1504
8 Ga0070676_10199909 3300005328 Bacteria 1310
9 Ga0070683_100032146 3300005329 Bacteria 4776
10 Ga0070683_100134534 3300005329 Bacteria 2341
11 Ga0070683_100232524 3300005329 Bacteria 1752
12 Ga0070683_100642644 3300005329 Bacteria 1016
13 Ga0070683_101246098 3300005329 Bacteria 715
14 Ga0070690_100061860 3300005330 Bacteria 2413
15 Ga0070690_100154933 3300005330 Bacteria 1566
16 Ga0070670_100012063 3300005331 Bacteria 7394
17 Ga0070677_10598854 3300005333 Bacteria 610
18 Ga0070680_100372708 3300005336 Bacteria 1215
19 Ga0070680_100422080 3300005336 Bacteria 1138
20 Ga0068868_100009800 3300005338 Bacteria 6912
21 Ga0068868_100199714 3300005338 Bacteria 1666
22 Ga0070660_100036640 3300005339 Bacteria 3716
23 Ga0070660_100089448 3300005339 Bacteria 2426
24 Ga0070660_100099996 3300005339 Bacteria 2296
25 Ga0070660_100105678 3300005339 Bacteria 2235
26 Ga0070660_100105719 3300005339 Bacteria 2234
27 Ga0070689_100086408 3300005340 Bacteria 2467
28 Ga0070691_10112593 3300005341 Bacteria 1363
29 Ga0070687_100837323 3300005343 Bacteria 655
30 Ga0070687_100934801 3300005343 Bacteria 624
31 Ga0070661_100073267 3300005344 Bacteria 2521
32 Ga0070661_101279068 3300005344 Bacteria 615
33 Ga0070692_10031854 3300005345 Bacteria 2646
34 Ga0070692_10212574 3300005345 Bacteria 1139
35 Ga0070668_100067168 3300005347 Bacteria 2785
36 Ga0070668_100245341 3300005347 Bacteria 1485
37 Ga0070668_100711714 3300005347 Bacteria 886
38 Ga0070669_100140917 3300005353 Bacteria 1859
39 Ga0070669_100190141 3300005353 Bacteria 1610
40 Ga0070675_100036720 3300005354 Bacteria 3989
41 Ga0070675_100218778 3300005354 Bacteria 1658
42 Ga0070671_100024149 3300005355 Bacteria 4976
43 Ga0070674_100052243 3300005356 Bacteria 2819
44 Ga0070674_100063864 3300005356 Bacteria 2578
45 Ga0070674_101424588 3300005356 Bacteria 621
46 Ga0070673_100078689 3300005364 Bacteria 2668
47 Ga0070673_100979575 3300005364 Bacteria 787
48 Ga0070688_100038915 3300005365 Bacteria 2907
49 Ga0070688_100501513 3300005365 Bacteria 915
50 Ga0070659_100114457 3300005366 Bacteria 2179
51 Ga0070659_100195315 3300005366 Bacteria 1664
52 Ga0070659_101740276 3300005366 Bacteria 558
53 Ga0070667_100094096 3300005367 Bacteria 2581
54 Ga0070703_10479389 3300005406 Bacteria 556
55 Ga0070714_101183168 3300005435 Bacteria 746
56 Ga0070714_101580110 3300005435 Bacteria 641
57 Ga0070714_101958207 3300005435 Bacteria 572
58 Ga0070713_100908720 3300005436 Bacteria 847
59 Ga0070701_10001787 3300005438 Bacteria 8122
60 Ga0070701_10026825 3300005438 Bacteria 2814
61 Ga0070711_100851545 3300005439 Bacteria 776
62 Ga0070705_100068894 3300005440 Bacteria 2131
63 Ga0070705_100383658 3300005440 Bacteria 1035
64 Ga0070700_100040890 3300005441 Bacteria 2840
65 Ga0070700_100075514 3300005441 Bacteria 2162
66 Ga0070694_100030536 3300005444 Bacteria 3526
67 Ga0070708_100366985 3300005445 Bacteria 1357
68 Ga0070708_100478703 3300005445 Bacteria 1175
69 Ga0070708_100797351 3300005445 Bacteria 888
70 Ga0070708_101703692 3300005445 Bacteria 586
71 Ga0070708_101764047 3300005445 Bacteria 575
72 Ga0070663_100841179 3300005455 Bacteria 789
73 Ga0070678_100005514 3300005456 Bacteria 7329
74 Ga0070678_100092857 3300005456 Bacteria 2319
75 Ga0070678_100852907 3300005456 Bacteria 830
76 Ga0070662_100039085 3300005457 Bacteria 3374
77 Ga0070662_100376434 3300005457 Bacteria 1168
78 Ga0070662_100678086 3300005457 Bacteria 871
79 Ga0070662_101065520 3300005457 Bacteria 693
80 Ga0070662_101890230 3300005457 Bacteria 516
81 Ga0070681_10025676 3300005458 Bacteria 5925
82 Ga0070681_10123201 3300005458 Bacteria 2525
83 Ga0068867_100131752 3300005459 Bacteria 1944
84 Ga0068867_100379120 3300005459 Bacteria 1187
85 Ga0068867_100818565 3300005459 Bacteria 832
86 Ga0068867_102100627 3300005459 Bacteria 535
87 Ga0070685_10226471 3300005466 Bacteria 1227
88 Ga0070685_10415609 3300005466 Bacteria 935
89 Ga0070706_100091147 3300005467 Bacteria 2827
90 Ga0070706_100171522 3300005467 Bacteria 2026
91 Ga0070706_100772320 3300005467 Bacteria 890
92 Ga0070706_100840711 3300005467 Bacteria 849
93 Ga0070706_101483282 3300005467 Bacteria 620
94 Ga0070706_101527819 3300005467 Bacteria 610
95 Ga0070707_100123638 3300005468 Bacteria 2513
96 Ga0070707_100148135 3300005468 Bacteria 2285
97 Ga0070707_100927155 3300005468 Bacteria 836
98 Ga0070698_100095830 3300005471 Bacteria 2944
99 Ga0070698_100154464 3300005471 Bacteria 2241
100 Ga0070698_100263584 3300005471 Bacteria 1655
101 Ga0070698_100484592 3300005471 Bacteria 1174
102 Ga0070698_101774881 3300005471 Bacteria 570
103 Ga0070699_100013074 3300005518 Bacteria 7153
104 Ga0070699_100166587 3300005518 Bacteria 1952
105 Ga0070699_100414704 3300005518 Bacteria 1218
106 Ga0070679_100137802 3300005530 Bacteria 2421
107 Ga0070679_101720338 3300005530 Bacteria 575
108 Ga0070684_100006063 3300005535 Bacteria 9316
109 Ga0070684_100025466 3300005535 Bacteria 4974
110 Ga0070684_100562471 3300005535 Bacteria 1059
111 Ga0068853_100476887 3300005539 Bacteria 1176
112 Ga0068853_100507827 3300005539 Bacteria 1139
113 Ga0068853_100856668 3300005539 Bacteria 872
114 Ga0068853_102350427 3300005539 Bacteria 516
115 Ga0070672_100108172 3300005543 Bacteria 2263
116 Ga0070672_101562316 3300005543 Bacteria 592
117 Ga0070686_100021879 3300005544 Bacteria 3805
118 Ga0070686_100053536 3300005544 Bacteria 2577
119 Ga0070695_100000253 3300005545 Bacteria 26811
120 Ga0070695_100091853 3300005545 Bacteria 2028
121 Ga0070696_100008304 3300005546 Bacteria 6948
122 Ga0070696_100364690 3300005546 Bacteria 1122
123 Ga0070693_100155242 3300005547 Bacteria 1453
124 Ga0070693_100744076 3300005547 Bacteria 722
125 Ga0070665_100097278 3300005548 Bacteria 2948
126 Ga0070704_100819874 3300005549 Bacteria 832
127 Ga0070704_101517744 3300005549 Bacteria 616
128 Ga0070704_102015718 3300005549 Bacteria 536
129 Ga0070704_102314717 3300005549 Bacteria 500
130 Ga0068855_100052596 3300005563 Bacteria 4794
131 Ga0068855_100379822 3300005563 Bacteria 1551
132 Ga0068855_100967750 3300005563 Bacteria 896
133 Ga0068855_101600124 3300005563 Bacteria 667
134 Ga0070664_100016814 3300005564 Bacteria 6004
135 Ga0070664_100953188 3300005564 Bacteria 805
136 Ga0068857_100125983 3300005577 Bacteria 2308
137 Ga0068857_100938262 3300005577 Bacteria 831
138 Ga0068854_100024258 3300005578 Bacteria 4150
139 Ga0068854_100314991 3300005578 Bacteria 1270
140 Ga0068854_101470510 3300005578 Bacteria 618
141 Ga0070702_100094117 3300005615 Bacteria 1823
142 Ga0070702_100722147 3300005615 Bacteria 762
143 Ga0070702_101770771 3300005615 Bacteria 515
144 Ga0068864_100042736 3300005618 Bacteria 3878
145 Ga0068866_10787703 3300005718 Bacteria 660
146 Ga0068861_100071708 3300005719 Bacteria 2685
147 Ga0068861_101253710 3300005719 Bacteria 719
148 Ga0068870_10000204 3300005840 Bacteria 21239
149 Ga0068870_10159381 3300005840 Bacteria 1337
150 Ga0068870_11250083 3300005840 Bacteria 539
151 Ga0068863_100732365 3300005841 Bacteria 984
152 Ga0068860_102499418 3300005843 Bacteria 536
153 Ga0068862_100103543 3300005844 Bacteria 2493
154 Ga0068862_102355462 3300005844 Bacteria 544
155 Ga0081455_10006997 3300005937 Bacteria 11986
156 Ga0081455_10015572 3300005937 Bacteria 7381
157 Ga0081455_10018033 3300005937 Bacteria 6741
158 Ga0081455_10046898 3300005937 Bacteria 3745
159 Ga0081455_10047704 3300005937 Bacteria 3707
160 Ga0081455_10125053 3300005937 Bacteria 2020
161 Ga0081455_10225344 3300005937 Bacteria 1387
162 Ga0081455_10239546 3300005937 Bacteria 1334
163 Ga0081455_10527867 3300005937 Bacteria 786
164 Ga0081538_10000649 3300005981 Bacteria 38484
165 Ga0081538_10000751 3300005981 Bacteria 35387
166 Ga0081538_10005541 3300005981 Bacteria 11330
167 Ga0081538_10005970 3300005981 Bacteria 10840
168 Ga0081538_10033372 3300005981 Bacteria 3429
169 Ga0081538_10049184 3300005981 Bacteria 2560
170 Ga0081538_10101239 3300005981 Bacteria 1450
171 Ga0081540_1007112 3300005983 Bacteria 8033
172 Ga0081539_10003424 3300005985 Bacteria 19515
173 Ga0081539_10173303 3300005985 Bacteria 1018
174 Ga0081539_10377070 3300005985 Bacteria 592
175 Ga0070717_10147034 3300006028 Bacteria 2036
176 Ga0070717_11235431 3300006028 Bacteria 680
177 Ga0075365_10044105 3300006038 Bacteria 2921
178 Ga0075365_10750378 3300006038 Bacteria 689
179 Ga0075365_10802682 3300006038 Bacteria 664
180 Ga0075364_10123477 3300006051 Bacteria 1734
181 Ga0075432_10022148 3300006058 Bacteria 2172
182 Ga0070715_10934238 3300006163 Unclassified 536
183 Ga0070716_100371430 3300006173 Bacteria 1019
184 Ga0070712_100469060 3300006175 Bacteria 1051
185 Ga0070712_100507330 3300006175 Bacteria 1012
186 Ga0070712_101716432 3300006175 Bacteria 550
187 Ga0097621_100847451 3300006237 Bacteria 849
188 Ga0068871_100597677 3300006358 Unclassified 1003
189 Ga0068871_101191219 3300006358 Bacteria 714
190 Ga0075428_100004766 3300006844 Bacteria 15015
191 Ga0075428_100530489 3300006844 Bacteria 1259
192 Ga0075430_100460406 3300006846 Bacteria 1049
193 Ga0075430_100643219 3300006846 Bacteria 875
194 Ga0075430_100677560 3300006846 Bacteria 850
195 Ga0075431_100096511 3300006847 Bacteria 3052
196 Ga0075431_100257360 3300006847 Bacteria 1772
197 Ga0075431_100453387 3300006847 Bacteria 1278
198 Ga0075431_100843401 3300006847 Bacteria 888
199 Ga0075431_101002397 3300006847 Bacteria 802
200 Ga0075431_101602932 3300006847 Bacteria 609
201 Ga0075433_10942200 3300006852 Bacteria 753
202 Ga0075434_100369782 3300006871 Bacteria 1455
203 Ga0075434_100377703 3300006871 Bacteria 1438
204 Ga0075434_102031281 3300006871 Bacteria 580
205 Ga0075429_100007732 3300006880 Bacteria 9330
206 Ga0075429_100064851 3300006880 Bacteria 3180
207 Ga0075429_100064970 3300006880 Bacteria 3177
208 Ga0075429_100230780 3300006880 Bacteria 1621
209 Ga0075429_100429062 3300006880 Bacteria 1158
210 Ga0075429_101740763 3300006880 Bacteria 541
211 Ga0068865_100087363 3300006881 Bacteria 2253
212 Ga0068865_101019356 3300006881 Bacteria 726
213 Ga0075436_101374645 3300006914 Bacteria 535
214 Ga0075435_100225790 3300007076 Bacteria 1591
215 Ga0075435_100692391 3300007076 Bacteria 886
216 Ga0105240_10050080 3300009093 Bacteria 5268
217 Ga0105240_10180280 3300009093 Bacteria 2493
218 Ga0105240_10674117 3300009093 Bacteria 1131
219 Ga0105240_12314404 3300009093 Bacteria 556
220 Ga0111539_10307430 3300009094 Bacteria 1845
221 Ga0111539_10569473 3300009094 Bacteria 1319
222 Ga0111539_11562958 3300009094 Bacteria 765
223 Ga0111539_12122661 3300009094 Bacteria 652
224 Ga0111539_12238950 3300009094 Unclassified 634
225 Ga0105245_10114118 3300009098 Bacteria 2516
226 Ga0105245_10220112 3300009098 Bacteria 1831
227 Ga0105245_10247935 3300009098 Bacteria 1729
228 Ga0114129_10004963 3300009147 Bacteria 18757
229 Ga0114129_10008112 3300009147 Bacteria 14966
230 Ga0114129_10032178 3300009147 Bacteria 7415
231 Ga0114129_10112786 3300009147 Bacteria 3750
232 Ga0114129_10166093 3300009147 Bacteria 3012
233 Ga0114129_10628569 3300009147 Bacteria 1388
234 Ga0114129_10897394 3300009147 Bacteria 1123
235 Ga0114129_11186749 3300009147 Bacteria 951
236 Ga0114129_11531467 3300009147 Bacteria 818
237 Ga0114129_11862922 3300009147 Bacteria 730
238 Ga0114129_12088840 3300009147 Bacteria 684
239 Ga0105243_10029447 3300009148 Bacteria 4222
240 Ga0105243_10076784 3300009148 Bacteria 2715
241 Ga0105243_10335752 3300009148 Bacteria 1382
242 Ga0105243_11485376 3300009148 Bacteria 701
243 Ga0105241_11631307 3300009174 Bacteria 625
244 Ga0105242_10228821 3300009176 Bacteria 1665
245 Ga0105242_10348470 3300009176 Bacteria 1367
246 Ga0105242_11011832 3300009176 Bacteria 839
247 Ga0105248_10265464 3300009177 Bacteria 1932
248 Ga0105237_10172828 3300009545 Bacteria 2161
249 Ga0105237_10220836 3300009545 Bacteria 1895
250 Ga0105237_11558619 3300009545 Bacteria 667
251 Ga0105238_10074304 3300009551 Bacteria 3392
252 Ga0105238_12400477 3300009551 Bacteria 563
253 Ga0105249_10100015 3300009553 Bacteria 2726
254 Ga0105249_10198791 3300009553 Bacteria 1961
255 Ga0105249_10960856 3300009553 Bacteria 922
256 Ga0105239_10058288 3300010375 Bacteria 4237
257 Ga0105239_10363417 3300010375 Bacteria 1635
258 Ga0105239_10612142 3300010375 Bacteria 1243
259 Ga0105246_10003846 3300011119 Bacteria 9105
260 Ga0105246_10038443 3300011119 Bacteria 3217
261 Ga0105246_10170195 3300011119 Bacteria 1668
262 Ga0105246_10508562 3300011119 Bacteria 1024
263 Ga0105246_10882669 3300011119 Bacteria 800
264 Ga0105246_11838747 3300011119 Bacteria 580
265 Ga0157345_1038507 3300012498 Bacteria 566
266 Ga0157373_10256485 3300013100 Bacteria 1237
267 Ga0157373_10326773 3300013100 Bacteria 1092
268 Ga0157371_10061637 3300013102 Bacteria 2659
269 Ga0157371_10622663 3300013102 Bacteria 804
270 Ga0157371_11236903 3300013102 Bacteria 576
271 Ga0157370_10008749 3300013104 Bacteria 10886
272 Ga0157370_10068398 3300013104 Bacteria 3356
273 Ga0157369_10506115 3300013105 Bacteria 1249
274 Ga0157369_10653808 3300013105 Bacteria 1084
275 Ga0157369_11310104 3300013105 Bacteria 738
276 Ga0157369_12199890 3300013105 Bacteria 559
277 Ga0157369_12483550 3300013105 Bacteria 525
278 Ga0157374_11879071 3300013296 Bacteria 624
279 Ga0157374_12165817 3300013296 Bacteria 583
280 Ga0157378_10042424 3300013297 Bacteria 4038
281 Ga0163162_10057234 3300013306 Bacteria 3926
282 Ga0157372_10232874 3300013307 Bacteria 2136
283 Ga0157372_10688003 3300013307 Bacteria 1190
284 Ga0157375_10015581 3300013308 Bacteria 6809
285 Ga0157375_10099132 3300013308 Bacteria 2992
286 Ga0163163_10012068 3300014325 Bacteria 7860
287 Ga0163163_10689116 3300014325 Bacteria 1085
288 Ga0157380_10089631 3300014326 Bacteria 2534
289 Ga0157380_10149878 3300014326 Bacteria 2015
290 Ga0182008_10542734 3300014497 Bacteria 645
291 Ga0157377_10013668 3300014745 Bacteria 4114
292 Ga0157377_10077913 3300014745 Bacteria 1931
293 Ga0157379_10218843 3300014968 Bacteria 1725
294 Ga0157376_10064073 3300014969 Bacteria 3098
295 Ga0157376_10422785 3300014969 Bacteria 1294
296 Ga0157376_10853195 3300014969 Bacteria 926
297 Ga0157376_11049879 3300014969 Bacteria 839
298 Ga0157376_11181067 3300014969 Bacteria 793
299 Ga0182005_1092243 3300015265 Bacteria 843
300 Ga0163161_10276093 3300017792 Bacteria 1317
301 Ga0197907_11268269 3300020069 Bacteria 2854
302 Ga0197907_11292483 3300020069 Bacteria 524
303 Ga0197907_11347809 3300020069 Bacteria 894
304 Ga0206356_11016126 3300020070 Bacteria 5157
305 Ga0206355_1264501 3300020076 Bacteria 617
306 Ga0206354_10206368 3300020081 Bacteria 1203
307 Ga0206354_10970272 3300020081 Bacteria 584
308 Ga0206353_10745444 3300020082 Bacteria 1608
309 Ga0206353_10856979 3300020082 Bacteria 842
310 Ga0213871_10125034 3300021441 Bacteria 769
311 Ga0224712_10013163 3300022467 Bacteria 2625
312 Ga0207697_10145439 3300025315 Bacteria 1030
313 Ga0207692_10380809 3300025898 Bacteria 876
314 Ga0207692_10959026 3300025898 Bacteria 564
315 Ga0207688_10011254 3300025901 Bacteria 4869
316 Ga0207688_10206413 3300025901 Bacteria 1179
317 Ga0207688_10919792 3300025901 Bacteria 554
318 Ga0207645_10109298 3300025907 Bacteria 1789
319 Ga0207643_10011875 3300025908 Bacteria 4701
320 Ga0207643_10053630 3300025908 Bacteria 2291
321 Ga0207643_10455750 3300025908 Bacteria 814
322 Ga0207705_10042289 3300025909 Bacteria 3272
323 Ga0207705_10102409 3300025909 Bacteria 2108
324 Ga0207684_10113392 3300025910 Bacteria 2320
325 Ga0207707_10037726 3300025912 Bacteria 4222
326 Ga0207707_10082086 3300025912 Bacteria 2814
327 Ga0207695_10092078 3300025913 Bacteria 3043
328 Ga0207695_10594520 3300025913 Bacteria 988
329 Ga0207695_10847048 3300025913 Bacteria 794
330 Ga0207695_11489717 3300025913 Bacteria 557
331 Ga0207671_10083040 3300025914 Bacteria 2405
332 Ga0207693_10188205 3300025915 Bacteria 1625
333 Ga0207660_10158135 3300025917 Bacteria 1746
334 Ga0207657_10001344 3300025919 Bacteria 26151
335 Ga0207657_10269004 3300025919 Bacteria 1355
336 Ga0207649_10829454 3300025920 Bacteria 723
337 Ga0207652_11067171 3300025921 Bacteria 708
338 Ga0207652_11449819 3300025921 Bacteria 590
339 Ga0207652_11468098 3300025921 Bacteria 586
340 Ga0207652_11468591 3300025921 Unclassified 586
341 Ga0207646_10057680 3300025922 Bacteria 3469
342 Ga0207646_10401860 3300025922 Bacteria 1237
343 Ga0207646_10402168 3300025922 Bacteria 1237
344 Ga0207646_10928253 3300025922 Bacteria 771
345 Ga0207646_11408005 3300025922 Bacteria 606
346 Ga0207681_10985284 3300025923 Bacteria 707
347 Ga0207681_11307147 3300025923 Bacteria 609
348 Ga0207694_11110951 3300025924 Bacteria 669
349 Ga0207650_10087472 3300025925 Bacteria 2374
350 Ga0207650_10089829 3300025925 Bacteria 2345
351 Ga0207659_10380198 3300025926 Bacteria 1177
352 Ga0207659_11304145 3300025926 Bacteria 623
353 Ga0207687_10029710 3300025927 Bacteria 3678
354 Ga0207700_10035417 3300025928 Bacteria 3595
355 Ga0207664_10004888 3300025929 Bacteria 9110
356 Ga0207664_10034890 3300025929 Bacteria 3877
357 Ga0207664_10038111 3300025929 Bacteria 3725
358 Ga0207664_10389263 3300025929 Bacteria 1238
359 Ga0207664_10689026 3300025929 Bacteria 919
360 Ga0207664_11195736 3300025929 Bacteria 678
361 Ga0207664_11633991 3300025929 Bacteria 566
362 Ga0207644_11031046 3300025931 Bacteria 691
363 Ga0207690_10253058 3300025932 Bacteria 1361
364 Ga0207706_10375900 3300025933 Bacteria 1233
365 Ga0207706_10704815 3300025933 Bacteria 862
366 Ga0207686_10663609 3300025934 Bacteria 826
367 Ga0207709_10095324 3300025935 Bacteria 1955
368 Ga0207709_10468139 3300025935 Bacteria 977
369 Ga0207670_10032033 3300025936 Bacteria 3377
370 Ga0207669_10234025 3300025937 Bacteria 1357
371 Ga0207669_10490294 3300025937 Bacteria 981
372 Ga0207669_11145176 3300025937 Bacteria 658
373 Ga0207669_11219044 3300025937 Bacteria 638
374 Ga0207669_11452963 3300025937 Bacteria 584
375 Ga0207704_10233912 3300025938 Bacteria 1368
376 Ga0207704_11123734 3300025938 Bacteria 668
377 Ga0207691_10020777 3300025940 Bacteria 6206
378 Ga0207691_10846008 3300025940 Bacteria 767
379 Ga0207661_10027567 3300025944 Bacteria 4340
380 Ga0207661_10137639 3300025944 Bacteria 2099
381 Ga0207661_10220261 3300025944 Bacteria 1677
382 Ga0207661_11062531 3300025944 Bacteria 746
383 Ga0207661_11101831 3300025944 Bacteria 731
384 Ga0207679_10078952 3300025945 Bacteria 2508
385 Ga0207667_10193872 3300025949 Bacteria 2084
386 Ga0207651_10407286 3300025960 Bacteria 1158
387 Ga0207712_10349595 3300025961 Bacteria 1228
388 Ga0207712_10413084 3300025961 Bacteria 1137
389 Ga0207712_10592159 3300025961 Bacteria 958
390 Ga0207712_10839038 3300025961 Bacteria 809
391 Ga0207668_10588354 3300025972 Bacteria 968
392 Ga0207640_10171865 3300025981 Bacteria 1616
393 Ga0207677_10053614 3300026023 Bacteria 2746
394 Ga0207677_10612805 3300026023 Bacteria 956
395 Ga0207677_11235076 3300026023 Bacteria 685
396 Ga0207703_11122240 3300026035 Bacteria 755
397 Ga0207639_10295059 3300026041 Bacteria 1431
398 Ga0207678_10336263 3300026067 Bacteria 1301
399 Ga0207708_10017519 3300026075 Bacteria 5393
400 Ga0207708_10829069 3300026075 Bacteria 797
401 Ga0207641_11592549 3300026088 Unclassified 655
402 Ga0207648_10270477 3300026089 Bacteria 1518
403 Ga0207648_10730661 3300026089 Bacteria 919
404 Ga0207648_10842126 3300026089 Bacteria 855
405 Ga0207648_10933553 3300026089 Bacteria 811
406 Ga0207676_10065149 3300026095 Bacteria 2901
407 Ga0207674_10069899 3300026116 Bacteria 3530
408 Ga0207674_10191379 3300026116 Bacteria 1996
409 Ga0207674_10520143 3300026116 Bacteria 1149
410 Ga0207674_11458198 3300026116 Bacteria 654
411 Ga0207674_11895992 3300026116 Bacteria 562
412 Ga0207675_100264743 3300026118 Bacteria 1667
413 Ga0207675_101717202 3300026118 Bacteria 647
414 Ga0207675_102388133 3300026118 Bacteria 541
415 Ga0207683_10009294 3300026121 Bacteria 8376
416 Ga0207683_10406718 3300026121 Bacteria 1252
417 Ga0207428_10099754 3300027907 Bacteria 2245
418 Ga0207428_10336080 3300027907 Bacteria 1113
419 Ga0268266_10065478 3300028379 Bacteria 3142
420 Ga0268265_10335497 3300028380 Bacteria 1375
421 Ga0268265_11540367 3300028380 Bacteria 669
422 Ga0265337_1094192 3300028556 Bacteria 816
423 Ga0265326_10060792 3300028558 Bacteria 1069
424 Ga0265319_1012507 3300028563 Bacteria 3428
425 Ga0265334_10126677 3300028573 Bacteria 910
426 Ga0265318_10026590 3300028577 Bacteria 2277
427 Ga0265322_10097652 3300028654 Bacteria 836
428 Ga0265336_10160360 3300028666 Bacteria 669
429 Ga0265338_10008087 3300028800 Bacteria 12858
430 Ga0265338_10023514 3300028800 Bacteria 6333
431 Ga0265338_10026119 3300028800 Bacteria 5901
432 Ga0265338_10112545 3300028800 Bacteria 2188
433 Ga0265330_10039496 3300031235 Bacteria 2096
434 Ga0265332_10008175 3300031238 Bacteria 4705
435 Ga0265320_10024893 3300031240 Bacteria 3155
436 Ga0265320_10497227 3300031240 Bacteria 539
437 Ga0265325_10083827 3300031241 Bacteria 1580
438 Ga0265329_10097310 3300031242 Bacteria 935
439 Ga0265340_10011483 3300031247 Bacteria 4705
440 Ga0265339_10034059 3300031249 Bacteria 2863
441 Ga0265339_10138705 3300031249 Bacteria 1238
442 Ga0265331_10022073 3300031250 Bacteria 3250
443 Ga0265327_10009229 3300031251 Bacteria 7154
444 Ga0265327_10032608 3300031251 Bacteria 2913
445 Ga0265316_10246529 3300031344 Bacteria 1312
446 Ga0307408_101505677 3300031548 Bacteria 636
447 Ga0265313_10033372 3300031595 Bacteria 2616
448 Ga0265313_10232256 3300031595 Bacteria 757
449 Ga0265314_10053808 3300031711 Bacteria 2789
450 Ga0265342_10112991 3300031712 Bacteria 1535
451 Ga0307405_10601290 3300031731 Bacteria 897
452 Ga0307407_11068487 3300031903 Bacteria 626
453 Ga0307412_11086913 3300031911 Bacteria 711
454 Ga0307409_101781581 3300031995 Bacteria 645
455 Ga0307416_100224144 3300032002 Bacteria 1806
456 Ga0307416_100291364 3300032002 Bacteria 1616
457 Ga0307416_100987803 3300032002 Bacteria 944
458 Ga0307415_100116744 3300032126 Bacteria 1992
459 Ga0307415_101553420 3300032126 Bacteria 634
460 Ga0307415_102351166 3300032126 Bacteria 523
461 Ga0316583_10164784 3300032133 Bacteria 771
462 Ga0373953_0237012 3300035117 Bacteria 792
463 Ga0373954_0445572 3300035118 Bacteria 641
464 Ga0373956_0035721 3300035119 Bacteria 2193
465 Ga0373957_0432062 3300035120 Bacteria 569
466 Ga0373960_0312332 3300035121 Bacteria 587
467 Ga0373943_0433594 3300035170 Bacteria 762
468 Ga0373955_0055386 3300035172 Bacteria 2172
469 Ga0373962_0183850 3300035242 Bacteria 700
470 Ga0373924_0103675 3300035410 Bacteria 1225
471 Ga0373935_0583300 3300035692 Bacteria 817
472 Ga0373933_0056141 3300035724 Bacteria 2363
473 Ga0373933_0057624 3300035724 Bacteria 2335
474 Ga0373947_0765657 3300035725 Bacteria 659
475 Ga0373947_1192377 3300035725 Bacteria 519
476 Ga0373937_0000107 3300036401 Bacteria 79333
477 Ga0373937_0078927 3300036401 Bacteria 3042
478 Ga0373925_1141343 3300037068 Bacteria 641
479 Ga0395899_0000899 3300037312 Bacteria 28042
480 Ga0395899_0033726 3300037312 Bacteria 3845
481 Ga0395899_0039855 3300037312 Bacteria 3515
482 Ga0395899_0065589 3300037312 Bacteria 2668
483 Ga0395899_0074492 3300037312 Bacteria 2480
484 Ga0395899_0088103 3300037312 Bacteria 2252
485 Ga0395899_0224379 3300037312 Bacteria 1300
486 Ga0395899_0305651 3300037312 Bacteria 1075
487 Ga0395899_0343728 3300037312 Bacteria 1000
488 Ga0395899_0649067 3300037312 Bacteria 667
489 Ga0395900_0001819 3300037418 Bacteria 24397
490 Ga0395900_0008064 3300037418 Bacteria 10840
491 Ga0395900_0074115 3300037418 Bacteria 3500
492 Ga0395900_0076426 3300037418 Bacteria 3442
493 Ga0395900_0127255 3300037418 Bacteria 2612
494 Ga0395900_0156628 3300037418 Bacteria 2326
495 Ga0395900_0226912 3300037418 Bacteria 1880
496 Ga0395900_0365508 3300037418 Bacteria 1413
497 Ga0395900_0431182 3300037418 Bacteria 1277
498 Ga0395900_0485120 3300037418 Bacteria 1188
499 Ga0395900_0523272 3300037418 Bacteria 1133
500 Ga0395900_0845139 3300037418 Bacteria 841
501 Ga0395900_0879349 3300037418 Bacteria 820
502 Ga0395900_0892703 3300037418 Bacteria 812
503 Ga0395900_1792150 3300037418 Bacteria 524
504 Ga0395900_1844673 3300037418 Bacteria 515
505 Ga0395898_0002821 3300037466 Bacteria 19931
506 Ga0395898_0010400 3300037466 Bacteria 9730
507 Ga0395898_0014564 3300037466 Bacteria 8077
508 Ga0395898_0099324 3300037466 Bacteria 2795
509 Ga0395898_0129328 3300037466 Bacteria 2419
510 Ga0395898_0154541 3300037466 Bacteria 2195
511 Ga0395898_0318670 3300037466 Bacteria 1483
512 Ga0395898_0394951 3300037466 Bacteria 1319
513 Ga0395898_0399988 3300037466 Bacteria 1310
514 Ga0395898_0407864 3300037466 Bacteria 1295
515 Ga0395898_0955296 3300037466 Bacteria 794
516 Ga0395898_1905918 3300037466 Bacteria 514
517 Ga0395905_0002059 3300037471 Bacteria 22953
518 Ga0395905_0009197 3300037471 Bacteria 9674
519 Ga0395905_0011047 3300037471 Bacteria 8740
520 Ga0395905_0036527 3300037471 Bacteria 4615
521 Ga0395905_0067373 3300037471 Bacteria 3353
522 Ga0395905_0191151 3300037471 Bacteria 1920
523 Ga0395905_0252100 3300037471 Bacteria 1649
524 Ga0395905_0320176 3300037471 Bacteria 1440
525 Ga0395905_0486604 3300037471 Bacteria 1133
526 Ga0395905_0591049 3300037471 Bacteria 1012
527 Ga0395905_1157182 3300037471 Bacteria 677
528 Ga0395905_1657961 3300037471 Bacteria 544
529 Ga0395901_0000917 3300038443 Bacteria 32140
530 Ga0395901_0001352 3300038443 Bacteria 25731
531 Ga0395901_0003227 3300038443 Bacteria 16404
532 Ga0395901_0017126 3300038443 Bacteria 7389
533 Ga0395901_0026735 3300038443 Bacteria 5924
534 Ga0395901_0132577 3300038443 Bacteria 2618
535 Ga0395901_0286259 3300038443 Bacteria 1711
536 Ga0395901_0335911 3300038443 Bacteria 1561
537 Ga0395901_0344761 3300038443 Bacteria 1538
538 Ga0395901_0479780 3300038443 Bacteria 1268
539 Ga0395901_0565246 3300038443 Bacteria 1151
540 Ga0395901_0585281 3300038443 Bacteria 1127
541 Ga0395901_0752810 3300038443 Bacteria 967
542 Ga0395901_1122798 3300038443 Bacteria 755
543 Ga0395901_1313055 3300038443 Bacteria 685
544 Ga0395901_1602679 3300038443 Bacteria 604
545 Ga0436360_0132719 3300039438 Bacteria 835
546 Ga0436360_1015244 3300039438 Bacteria 6330
547 Ga0439466_0039600 3300041411 Bacteria 1579
548 Ga0451833_0239441 3300041491 Bacteria 556
549 Ga0451855_1798244 3300041511 Bacteria 826
550 Ga0451853_1791929 3300041512 Bacteria 558
551 Ga0439448_0078823 3300042005 Bacteria 1104
552 Ga0439448_0079437 3300042005 Bacteria 1100
553 Ga0439448_0277636 3300042005 Bacteria 593
554 Ga0439450_019679 3300042008 Bacteria 1433
555 Ga0439450_033584 3300042008 Bacteria 1164
556 Ga0439451_042763 3300042009 Bacteria 909
557 Ga0439454_090411 3300042011 Bacteria 565
558 Ga0439455_0098260 3300042012 Bacteria 807
559 Ga0439456_059429 3300042013 Bacteria 839
560 Ga0450920_047997 3300042122 Bacteria 854
561 Ga0450902_104102 3300042137 Bacteria 506
562 Ga0439464_0093202 3300042439 Bacteria 910
563 Ga0439460_0176041 3300042461 Bacteria 722
564 Ga0439460_0239623 3300042461 Bacteria 625
565 Ga0450918_040246 3300042531 Bacteria 838
566 Ga0466972_0016553 3300044658 Bacteria 3687
567 Ga0466965_0260221 3300044683 Bacteria 932
568 Ga0466961_0017573 3300044693 Bacteria 4596
569 Ga0466961_0077814 3300044693 Bacteria 2101
570 Ga0466963_0217597 3300044694 Bacteria 1337
571 Ga0466963_0329895 3300044694 Bacteria 1074
572 Ga0466963_0650234 3300044694 Bacteria 744
573 Ga0466963_0673814 3300044694 Bacteria 730
574 Ga0466964_0113947 3300044706 Bacteria 1210
575 Ga0466964_0245669 3300044706 Bacteria 880
576 Ga0466971_0081293 3300044719 Bacteria 1478
577 Ga0466971_0253084 3300044719 Bacteria 839
578 Ga0466970_0607957 3300044765 Bacteria 634
579 Ga0466957_0105165 3300044842 Bacteria 1784
580 Ga0466957_0176181 3300044842 Bacteria 1395
581 Ga0466957_0423699 3300044842 Bacteria 913
582 Ga0466959_0262391 3300045049 Bacteria 1189
583 Ga0466959_0350673 3300045049 Bacteria 1006
584 Ga0466958_0011964 3300045836 Bacteria 4903
585 Ga0466958_0610338 3300045836 Bacteria 710
586 Ga0466967_0009992 3300045976 Bacteria 7087
587 Ga0466967_0014130 3300045976 Bacteria 6204
588 Ga0466967_0064089 3300045976 Bacteria 3267
589 Ga0466967_0067528 3300045976 Bacteria 3189
590 Ga0466967_0118104 3300045976 Bacteria 2446
591 Ga0466967_0160582 3300045976 Bacteria 2109
592 Ga0466967_0306646 3300045976 Bacteria 1528
593 Ga0466967_1363259 3300045976 Bacteria 706
594 Ga0466967_1710466 3300045976 Bacteria 626
595 Ga0466967_1726495 3300045976 Bacteria 623
596 Ga0495592_0000089 3300046454 Bacteria 80990
597 Ga0495603_0869909 3300046455 Bacteria 513
598 Ga0495629_0308517 3300046459 Bacteria 1083
599 Ga0495651_0000057 3300046462 Bacteria 82943
600 Ga0495651_0030418 3300046462 Bacteria 4211
601 Ga0495651_0469952 3300046462 Bacteria 810
602 Ga0495651_0585080 3300046462 Bacteria 706
603 Ga0495653_0000641 3300046463 Bacteria 26637
604 Ga0495653_0012796 3300046463 Bacteria 6850
605 Ga0495653_0167405 3300046463 Bacteria 1520
606 Ga0495582_0216509 3300046473 Bacteria 1095
607 Ga0495582_0532195 3300046473 Bacteria 679
608 Ga0495605_0052282 3300046474 Bacteria 1986
609 Ga0495639_0475808 3300046475 Bacteria 636
610 Ga0495664_0210699 3300046477 Bacteria 1177
611 Ga0495664_0781379 3300046477 Bacteria 562
612 Ga0495584_0321237 3300046491 Bacteria 786
613 Ga0495585_0141647 3300046492 Bacteria 1259
614 Ga0495596_0135555 3300046500 Bacteria 956
615 Ga0495596_0318428 3300046500 Unclassified 605
616 Ga0495583_0237226 3300046506 Bacteria 734
617 Ga0495608_0002394 3300046511 Bacteria 13494
618 Ga0495608_0042314 3300046511 Bacteria 3046
619 Ga0495608_0193870 3300046511 Bacteria 1282
620 Ga0495616_0220076 3300046513 Bacteria 827
621 Ga0495618_0000832 3300046514 Bacteria 21414
622 Ga0495618_0088590 3300046514 Bacteria 1979
623 Ga0495628_0000066 3300046516 Bacteria 85699
624 Ga0495628_0282141 3300046516 Bacteria 1233
625 Ga0495630_0271871 3300046517 Bacteria 1295
626 Ga0495631_0108297 3300046518 Bacteria 1195
627 Ga0495631_0356589 3300046518 Bacteria 622
628 Ga0495644_0091267 3300046523 Bacteria 1150
629 Ga0495663_0024879 3300046525 Bacteria 1743
630 Ga0495663_0058484 3300046525 Bacteria 1208
631 Ga0495642_0021427 3300046528 Bacteria 2542
632 Ga0495642_0118521 3300046528 Bacteria 1135
633 Ga0495652_0000118 3300046529 Bacteria 85706
634 Ga0495652_0398270 3300046529 Bacteria 975
635 Ga0495586_0175031 3300046535 Bacteria 1213
636 Ga0495586_0920010 3300046535 Bacteria 504
637 Ga0495587_0001162 3300046536 Bacteria 17334
638 Ga0495587_0195143 3300046536 Bacteria 1146
639 Ga0495587_0398394 3300046536 Bacteria 765
640 Ga0495609_0079699 3300046538 Bacteria 1432
641 Ga0495645_0000052 3300046543 Bacteria 86470
642 Ga0495645_0357767 3300046543 Bacteria 939
643 Ga0495633_0549407 3300046558 Bacteria 520
644 Ga0495667_0043796 3300046559 Bacteria 2965
645 Ga0495667_0047887 3300046559 Bacteria 2823
646 Ga0495656_0070394 3300046615 Bacteria 1552
647 Ga0495668_0089129 3300046616 Bacteria 1691
648 Ga0495634_0009599 3300046642 Bacteria 7130
649 Ga0495634_0147655 3300046642 Bacteria 1489
650 Ga0495634_0234040 3300046642 Bacteria 1129
651 Ga0495634_0637879 3300046642 Bacteria 616
652 Ga0495635_0186492 3300046663 Bacteria 1409
653 Ga0495659_0056842 3300046664 Bacteria 1436
654 Ga0495661_0066017 3300046665 Bacteria 2131
655 Ga0495588_0164349 3300046674 Bacteria 1174
656 Ga0495657_0027126 3300046675 Bacteria 4047
657 Ga0495657_0414223 3300046675 Bacteria 792
658 Ga0495599_0000046 3300046678 Bacteria 85727
659 Ga0495599_0344502 3300046678 Bacteria 894
660 Ga0495623_0001356 3300046679 Bacteria 16592
661 Ga0495623_0250066 3300046679 Bacteria 997
662 Ga0495646_0002939 3300046680 Bacteria 10561
663 Ga0495647_0036699 3300046681 Bacteria 1846
664 Ga0495658_1057622 3300046683 Bacteria 518
665 Ga0495624_0124582 3300046690 Bacteria 1582
666 Ga0495624_0608806 3300046690 Bacteria 651
667 Ga0495671_0389918 3300046692 Bacteria 667
668 Ga0495589_0015657 3300046794 Bacteria 3899
669 Ga0495589_0245831 3300046794 Bacteria 837
670 Ga0495600_0154298 3300046809 Bacteria 1486
671 Ga0495600_0307726 3300046809 Bacteria 999
672 Ga0495581_0410793 3300047315 Bacteria 789
673 Ga0495604_0000075 3300047317 Bacteria 85370
674 Ga0495604_0166789 3300047317 Bacteria 1552
675 Ga0495636_0596863 3300047318 Bacteria 540
676 Ga0495674_0220969 3300047319 Bacteria 1566
677 Ga0495674_0252189 3300047319 Bacteria 1452
678 Ga0495674_0292541 3300047319 Bacteria 1332
679 Ga0495674_0350916 3300047319 Bacteria 1198
680 Ga0495674_0621157 3300047319 Bacteria 854
681 Ga0495676_0069121 3300047321 Bacteria 2726
682 Ga0495680_0007302 3300047322 Bacteria 10169
683 Ga0495680_0058384 3300047322 Bacteria 2981
684 Ga0495680_0903230 3300047322 Bacteria 570
685 Ga0495675_0000705 3300047444 Bacteria 20889
686 Ga0495675_0085883 3300047444 Bacteria 1978
687 Ga0495685_060342 3300047447 Bacteria 1279
688 Ga0495684_0036579 3300047471 Bacteria 3763
689 Ga0495684_0793246 3300047471 Bacteria 619
690 Ga0495593_0203457 3300047673 Bacteria 995
691 Ga0495602_0002990 3300048088 Bacteria 17334
692 Ga0495602_0538266 3300048088 Bacteria 811
693 Ga0496100_0622352 3300048903 Bacteria 839
694 Ga0496100_0787960 3300048903 Bacteria 744
695 Ga0496100_1172688 3300048903 Bacteria 606
696 Ga0496101_0201903 3300048904 Bacteria 1537
697 Ga0496101_0492969 3300048904 Bacteria 968
698 Ga0496101_0669947 3300048904 Bacteria 819
699 Ga0496101_1427724 3300048904 Bacteria 540
700 Ga0496102_0086584 3300048905 Bacteria 2894
701 Ga0496102_0181644 3300048905 Bacteria 1982
702 Ga0496103_0192875 3300048906 Bacteria 1310
703 Ga0496104_0192653 3300048907 Bacteria 1950
704 Ga0496104_0328289 3300048907 Bacteria 1443
705 Ga0496104_0423607 3300048907 Bacteria 1243
706 Ga0496104_0457095 3300048907 Bacteria 1188
707 Ga0496105_0084762 3300048908 Bacteria 2618
708 Ga0496105_0122540 3300048908 Bacteria 2143
709 Ga0496105_0400410 3300048908 Bacteria 1090
710 Ga0496106_0409389 3300048909 Bacteria 1090
711 Ga0496106_1077996 3300048909 Bacteria 630
712 Ga0496106_1539609 3300048909 Unclassified 511
713 Ga0496107_0309572 3300048910 Bacteria 1176
714 Ga0496107_0623275 3300048910 Bacteria 796
715 Ga0496107_0971406 3300048910 Bacteria 617
716 Ga0496107_1070092 3300048910 Unclassified 583
717 Ga0496108_0022352 3300048911 Bacteria 5200
718 Ga0496108_0059522 3300048911 Bacteria 3212
719 Ga0496108_0074390 3300048911 Bacteria 2868
720 Ga0496108_0138184 3300048911 Bacteria 2098
721 Ga0496108_0803076 3300048911 Bacteria 812
722 Ga0496108_1101042 3300048911 Bacteria 675
723 Ga0496109_0247909 3300048912 Bacteria 1677
724 Ga0496109_0263204 3300048912 Bacteria 1624
725 Ga0496109_0773130 3300048912 Bacteria 898
726 Ga0496109_0975109 3300048912 Bacteria 785
727 Ga0496109_1506816 3300048912 Bacteria 607
728 Ga0496110_0176158 3300048913 Bacteria 1941
729 Ga0496110_0248008 3300048913 Bacteria 1621
730 Ga0496110_0458235 3300048913 Bacteria 1162
731 Ga0496110_0796333 3300048913 Bacteria 849
732 Ga0496110_0956589 3300048913 Bacteria 763
733 Ga0496110_0985052 3300048913 Bacteria 750
734 Ga0496110_1313119 3300048913 Bacteria 633
735 Ga0496111_0212914 3300048914 Bacteria 1435
736 Ga0496111_0332406 3300048914 Unclassified 1125
737 Ga0496111_0578302 3300048914 Bacteria 823
738 Ga0496112_0000293 3300048915 Bacteria 32490
739 Ga0496112_0790703 3300048915 Bacteria 874
740 Ga0496113_0243658 3300048916 Bacteria 1435
741 Ga0496113_0396456 3300048916 Bacteria 1108
742 Ga0496113_0416035 3300048916 Bacteria 1080
743 Ga0496113_0735353 3300048916 Bacteria 786
744 Ga0496114_0102177 3300048917 Bacteria 2449
745 Ga0496114_0295165 3300048917 Bacteria 1430
746 Ga0496114_0495863 3300048917 Bacteria 1080
747 Ga0496115_0191552 3300048918 Bacteria 1689
748 Ga0501031_0000336 3300049568 Bacteria 27217
749 Ga0501031_0003836 3300049568 Bacteria 9667
750 Ga0501031_0232168 3300049568 Bacteria 1200
751 Ga0501031_0336455 3300049568 Bacteria 977
752 Ga0501031_0786328 3300049568 Bacteria 610
753 Ga0501032_0002775 3300049569 Bacteria 13640
754 Ga0501032_0026680 3300049569 Bacteria 3971
755 Ga0501032_0155787 3300049569 Bacteria 1501
756 Ga0501033_0000239 3300049570 Bacteria 52812
757 Ga0501033_0037937 3300049570 Bacteria 3605
758 Ga0501033_0269747 3300049570 Bacteria 1203
759 Ga0501033_0423147 3300049570 Bacteria 927
760 Ga0501034_0050743 3300049571 Bacteria 4184
761 Ga0501034_0051397 3300049571 Bacteria 4156
762 Ga0501034_0356250 3300049571 Bacteria 1391
763 Ga0501034_1095400 3300049571 Bacteria 678
764 Ga0501036_0000107 3300049572 Bacteria 51071
765 Ga0501036_0003875 3300049572 Bacteria 11999
766 Ga0501036_0017006 3300049572 Bacteria 6077
767 Ga0501036_0810230 3300049572 Bacteria 771
768 Ga0501036_0835538 3300049572 Bacteria 757
769 Ga0501037_0002426 3300049573 Bacteria 13474
770 Ga0501037_0007718 3300049573 Bacteria 7875
771 Ga0501037_0298950 3300049573 Bacteria 1118
772 Ga0501038_0000367 3300049574 Bacteria 39046
773 Ga0501038_0020533 3300049574 Bacteria 5936
774 Ga0501038_0057518 3300049574 Bacteria 3338
775 Ga0501039_0001687 3300049575 Bacteria 16278
776 Ga0501039_0005193 3300049575 Bacteria 9854
777 Ga0501039_0204975 3300049575 Bacteria 1550
778 Ga0501039_0400736 3300049575 Bacteria 1078
779 Ga0501039_1111780 3300049575 Bacteria 612
780 Ga0501040_0002117 3300049576 Bacteria 12798
781 Ga0501040_0003511 3300049576 Bacteria 10129
782 Ga0501040_0009653 3300049576 Bacteria 6301
783 Ga0501040_0032657 3300049576 Bacteria 3523
784 Ga0501040_0038291 3300049576 Bacteria 3260
785 Ga0501040_0132277 3300049576 Bacteria 1755
786 Ga0501040_0279125 3300049576 Bacteria 1193
787 Ga0501040_0342477 3300049576 Bacteria 1070
788 Ga0501040_0378986 3300049576 Bacteria 1015
789 Ga0501040_0442439 3300049576 Bacteria 935
790 Ga0501040_0901522 3300049576 Bacteria 640
791 Ga0501041_0000011 3300049577 Bacteria 58729
792 Ga0501041_0018083 3300049577 Bacteria 4197
793 Ga0501041_0054200 3300049577 Bacteria 2446
794 Ga0501041_0064201 3300049577 Bacteria 2248
795 Ga0501041_0084635 3300049577 Bacteria 1954
796 Ga0501042_0000956 3300049578 Bacteria 16278
797 Ga0501042_0010432 3300049578 Bacteria 6230
798 Ga0501042_0011243 3300049578 Bacteria 6033
799 Ga0501042_0038064 3300049578 Bacteria 3415
800 Ga0501042_0448460 3300049578 Bacteria 936
801 Ga0501042_0549701 3300049578 Bacteria 839
802 Ga0501042_0606232 3300049578 Bacteria 796
803 Ga0501043_0000477 3300049579 Bacteria 35754
804 Ga0501043_0051175 3300049579 Bacteria 3246
805 Ga0501043_0070198 3300049579 Bacteria 2752
806 Ga0501043_0273761 3300049579 Bacteria 1295
807 Ga0501046_0001077 3300049580 Bacteria 26750
808 Ga0501046_0024131 3300049580 Bacteria 4994
809 Ga0501046_0025741 3300049580 Bacteria 4812
810 Ga0501046_0058485 3300049580 Bacteria 3021
811 Ga0501046_0070562 3300049580 Bacteria 2716
812 Ga0501046_0118241 3300049580 Bacteria 2019
813 Ga0501046_0588119 3300049580 Bacteria 791
814 Ga0501046_1108360 3300049580 Bacteria 546
815 Ga0501047_0000743 3300049581 Bacteria 33980
816 Ga0501047_0351479 3300049581 Bacteria 1311
817 Ga0501047_0506613 3300049581 Bacteria 1034
818 Ga0501048_0000339 3300049582 Bacteria 32273
819 Ga0501048_0017103 3300049582 Bacteria 5344
820 Ga0501048_0033807 3300049582 Bacteria 3692
821 Ga0501048_0394608 3300049582 Bacteria 989
822 Ga0501048_0822432 3300049582 Bacteria 667
823 Ga0501048_0976396 3300049582 Bacteria 609
824 Ga0501048_1409981 3300049582 Bacteria 501
825 Ga0501067_0042145 3300049583 Bacteria 2534
826 Ga0501067_0074363 3300049583 Bacteria 1883
827 Ga0501067_0099825 3300049583 Bacteria 1612
828 Ga0501068_0000241 3300049584 Bacteria 26764
829 Ga0501068_0035098 3300049584 Bacteria 2992
830 Ga0501068_0080064 3300049584 Bacteria 2003
831 Ga0501068_1175376 3300049584 Bacteria 508
832 Ga0501069_0001803 3300049585 Bacteria 10711
833 Ga0501069_0005142 3300049585 Bacteria 6793
834 Ga0501069_0040222 3300049585 Bacteria 2584
835 Ga0501069_0103813 3300049585 Bacteria 1615
836 Ga0501069_0382141 3300049585 Bacteria 832
837 Ga0501070_0002434 3300049586 Bacteria 16324
838 Ga0501070_0029175 3300049586 Bacteria 4627
839 Ga0501070_0168950 3300049586 Bacteria 1802
840 Ga0501070_0170893 3300049586 Bacteria 1790
841 Ga0501070_0442366 3300049586 Bacteria 1049
842 Ga0501070_0887159 3300049586 Bacteria 696
843 Ga0501071_0000208 3300049587 Bacteria 26807
844 Ga0501071_0013896 3300049587 Bacteria 5497
845 Ga0501071_0044818 3300049587 Bacteria 3173
846 Ga0501071_0137599 3300049587 Bacteria 1818
847 Ga0501071_0244787 3300049587 Bacteria 1352
848 Ga0501071_0416725 3300049587 Bacteria 1026
849 Ga0501071_0627605 3300049587 Bacteria 827
850 Ga0501071_1340349 3300049587 Bacteria 553
851 Ga0501072_0000561 3300049588 Bacteria 26764
852 Ga0501072_0005900 3300049588 Bacteria 9331
853 Ga0501072_0007361 3300049588 Bacteria 8352
854 Ga0501072_0036282 3300049588 Bacteria 3864
855 Ga0501072_0056996 3300049588 Bacteria 3078
856 Ga0501072_0108831 3300049588 Bacteria 2205
857 Ga0501072_0259981 3300049588 Bacteria 1382
858 Ga0501072_1543132 3300049588 Bacteria 512
859 Ga0501073_0004141 3300049589 Bacteria 10881
860 Ga0501073_0006396 3300049589 Bacteria 8770
861 Ga0501073_0015245 3300049589 Bacteria 5576
862 Ga0501073_1198392 3300049589 Bacteria 521
863 Ga0501074_0000158 3300049590 Bacteria 35682
864 Ga0501074_0010003 3300049590 Bacteria 6884
865 Ga0501074_0028216 3300049590 Bacteria 4067
866 Ga0501074_0044191 3300049590 Bacteria 3225
867 Ga0501074_0126067 3300049590 Bacteria 1831
868 Ga0501074_0145113 3300049590 Bacteria 1697
869 Ga0501074_0246021 3300049590 Bacteria 1272
870 Ga0501074_0450278 3300049590 Bacteria 913
871 Ga0501075_0000556 3300049591 Bacteria 22580
872 Ga0501075_0007488 3300049591 Bacteria 7570
873 Ga0501075_0008178 3300049591 Bacteria 7283
874 Ga0501075_0033340 3300049591 Bacteria 3831
875 Ga0501075_0099300 3300049591 Bacteria 2210
876 Ga0501075_0258764 3300049591 Bacteria 1326
877 Ga0501075_0323447 3300049591 Bacteria 1175
878 Ga0501075_0325181 3300049591 Bacteria 1172
879 Ga0501075_0341343 3300049591 Bacteria 1141
880 Ga0501075_0616422 3300049591 Bacteria 828
881 Ga0501075_1257106 3300049591 Bacteria 561
882 Ga0501076_0000289 3300049592 Bacteria 31371
883 Ga0501076_0004159 3300049592 Bacteria 10239
884 Ga0501076_0008407 3300049592 Bacteria 7563
885 Ga0501076_0009583 3300049592 Bacteria 7150
886 Ga0501076_0020823 3300049592 Bacteria 5022
887 Ga0501076_0186225 3300049592 Bacteria 1693
888 Ga0501076_0663088 3300049592 Bacteria 861
889 Ga0501076_0783056 3300049592 Bacteria 787
890 Ga0501076_0902275 3300049592 Bacteria 729
891 Ga0501077_0000371 3300049593 Bacteria 26807
892 Ga0501077_0003869 3300049593 Bacteria 9024
893 Ga0501077_0005270 3300049593 Bacteria 7854
894 Ga0501077_0011683 3300049593 Bacteria 5488
895 Ga0501077_0057129 3300049593 Bacteria 2478
896 Ga0501077_0484242 3300049593 Bacteria 793
897 Ga0501079_0000053 3300049741 Bacteria 51071
898 Ga0501079_0005980 3300049741 Bacteria 9110
899 Ga0501079_0032307 3300049741 Bacteria 4024
900 Ga0501079_0140223 3300049741 Bacteria 1883
901 Ga0501079_0144682 3300049741 Bacteria 1852
902 Ga0501079_0156699 3300049741 Bacteria 1775
903 Ga0501079_0171377 3300049741 Bacteria 1692
904 Ga0501079_0281079 3300049741 Bacteria 1301
905 Ga0501079_0882168 3300049741 Bacteria 704
906 Ga0501080_0000136 3300049742 Bacteria 52047
907 Ga0501080_0018701 3300049742 Bacteria 6412
908 Ga0501080_0039262 3300049742 Bacteria 4418
909 Ga0501080_0226816 3300049742 Bacteria 1708
910 Ga0501080_0252691 3300049742 Bacteria 1607
911 Ga0501080_0389757 3300049742 Bacteria 1254
912 Ga0501081_0000025 3300049743 Bacteria 54545
913 Ga0501081_0018256 3300049743 Bacteria 4656
914 Ga0501081_0018414 3300049743 Bacteria 4639
915 Ga0501081_0021016 3300049743 Bacteria 4356
916 Ga0501081_0021111 3300049743 Bacteria 4346
917 Ga0501081_0048245 3300049743 Bacteria 2931
918 Ga0501081_0081074 3300049743 Bacteria 2272
919 Ga0501081_0616417 3300049743 Bacteria 813
920 Ga0501081_0830194 3300049743 Bacteria 696
921 Ga0501081_1154503 3300049743 Bacteria 586
922 Ga0501083_0000234 3300049744 Bacteria 35676
923 Ga0501083_0023011 3300049744 Bacteria 4325
924 Ga0501083_0176130 3300049744 Bacteria 1397
925 Ga0501035_0002443 3300049822 Bacteria 18151
926 Ga0501035_0016946 3300049822 Bacteria 6715
927 Ga0501035_0047089 3300049822 Bacteria 3873
928 Ga0501035_0648188 3300049822 Bacteria 856
929 Ga0501035_0811104 3300049822 Bacteria 747
930 Ga0501044_0011199 3300049823 Bacteria 9725
931 Ga0501044_0192855 3300049823 Bacteria 1999
932 Ga0501044_0617968 3300049823 Bacteria 975
933 Ga0501044_0933045 3300049823 Bacteria 742
934 Ga0501045_0000035 3300049824 Bacteria 58729
935 Ga0501045_0006706 3300049824 Bacteria 7977
936 Ga0501045_0007494 3300049824 Bacteria 7580
937 Ga0501045_0028863 3300049824 Bacteria 4004
938 Ga0501045_0043998 3300049824 Bacteria 3252
939 Ga0501045_0052735 3300049824 Bacteria 2970
940 Ga0501045_0202700 3300049824 Bacteria 1478
941 Ga0501045_0268074 3300049824 Bacteria 1271
942 Ga0501045_1095392 3300049824 Bacteria 583
943 nmdc:mga03683_40278_c1 3300050489 Bacteria 1915
944 nmdc:mga00v17_76312_c2 3300050491 Bacteria 1037
945 nmdc:mga0yw44_494445_c1 3300050492 Bacteria 830
946 nmdc:mga0yw44_53232_c1 3300050492 Bacteria 2457
947 nmdc:mga0yw44_749166_c1 3300050492 Bacteria 663
948 nmdc:mga05p37_112379_c1 3300050507 Bacteria 3350
949 nmdc:mga05p37_312392_c1 3300050507 Bacteria 1080
950 nmdc:mga05p37_394911_c1 3300050507 Bacteria 1617
951 nmdc:mga05p37_458916_c1 3300050507 Bacteria 1473
952 nmdc:mga05p37_5244_c1 3300050507 Bacteria 15215
953 nmdc:mga05p37_607108_c1 3300050507 Bacteria 1234
954 nmdc:mga05p37_613465_c1 3300050507 Bacteria 1226
955 nmdc:mga05p37_7995_c1 3300050507 Bacteria 12483
956 nmdc:mga05p37_918245_c1 3300050507 Bacteria 941
957 nmdc:mga09592_352237_c1 3300050508 Bacteria 1274
958 nmdc:mga09592_39609_c1 3300050508 Bacteria 3959
959 nmdc:mga09592_41989_c1 3300050508 Bacteria 3847
960 nmdc:mga09592_572036_c1 3300050508 Bacteria 970
961 nmdc:mga0qj67_1038301_c1 3300050509 Bacteria 642
962 nmdc:mga0qj67_127956_c1 3300050509 Bacteria 2056
963 nmdc:mga0qj67_134289_c1 3300050509 Bacteria 2005
964 nmdc:mga0qj67_619383_c1 3300050509 Bacteria 865
965 nmdc:mga06r32_118641_c1 3300050510 Bacteria 2608
966 nmdc:mga06r32_123940_c1 3300050510 Bacteria 2550
967 nmdc:mga06r32_330555_c1 3300050510 Bacteria 1509
968 nmdc:mga06r32_506676_c1 3300050510 Bacteria 1184
969 nmdc:mga06r32_81305_c1 3300050510 Bacteria 3155
970 nmdc:mga08y16_312921_c1 3300050511 Bacteria 1617
971 nmdc:mga08y16_857164_c1 3300050511 Bacteria 897
972 nmdc:mga0n895_131116_c1 3300050512 Bacteria 2531
973 nmdc:mga0rr50_798360_c1 3300050513 Bacteria 805
974 nmdc:mga0rr50_849212_c1 3300050513 Bacteria 779
975 nmdc:mga08x19_1144723_c1 3300050514 Bacteria 552
976 nmdc:mga08x19_282390_c1 3300050514 Bacteria 1150
977 nmdc:mga0a205_1291802_c1 3300050515 Bacteria 577
978 nmdc:mga0a205_577679_c1 3300050515 Bacteria 978
979 Ga0495601_0000486 3300053077 Bacteria 20884
980 Ga0495601_0661634 3300053077 Bacteria 668
981 Ga0495601_1009168 3300053077 Bacteria 523
982 Ga0495612_0040143 3300053078 Bacteria 1906
983 Ga0495595_0004782 3300053084 Bacteria 5456
984 Ga0495595_0246750 3300053084 Bacteria 894
985 Ga0495619_0000123 3300053085 Bacteria 57052
986 Ga0495619_0746576 3300053085 Bacteria 664
987 Ga0501084_0000336 3300054114 Bacteria 35754
988 Ga0501084_0009395 3300054114 Bacteria 8091
989 Ga0501084_0020135 3300054114 Bacteria 5562
990 Ga0501084_0084799 3300054114 Bacteria 2660
991 Ga0501084_0140611 3300054114 Bacteria 2032
992 Ga0501084_0410508 3300054114 Bacteria 1144
993 Ga0501084_1525387 3300054114 Bacteria 559
994 Ga0590071_007567 3300059421 Bacteria 2571
995 Ga0590074_008703 3300059423 Bacteria 1689
996 Ga0590075_024188 3300059424 Bacteria 1524
997 Ga0501082_0001222 3300060353 Bacteria 22580
998 Ga0501082_0004941 3300060353 Bacteria 11632
999 Ga0501082_0036548 3300060353 Bacteria 4231
1000 Ga0501082_0111071 3300060353 Bacteria 2372
1001 Ga0501082_0283114 3300060353 Bacteria 1443
1002 Ga0501082_0309957 3300060353 Bacteria 1374
1003 Ga0501082_0347620 3300060353 Bacteria 1293
1004 Ga0466962_0175215 3300061719 Bacteria 1045
1005 Ga0530510_0000445 3300061734 Bacteria 26717
1006 Ga0530510_0008684 3300061734 Bacteria 7102
1007 Ga0530510_0011273 3300061734 Bacteria 6272
1008 Ga0530510_0040426 3300061734 Bacteria 3365
1009 Ga0530510_0221034 3300061734 Bacteria 1408
1010 Ga0530510_0242848 3300061734 Bacteria 1341
1011 Ga0530510_1569658 3300061734 Bacteria 505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10199909 Ga0070676_101999093 64
2 3300005330 Ga0070690_100061860 Ga0070690_1000618604 64
3 3300005333 Ga0070677_10598854 Ga0070677_105988542 64
4 3300005336 Ga0070680_100372708 Ga0070680_1003727082 64
5 3300005338 Ga0068868_100199714 Ga0068868_1001997142 64
6 3300005339 Ga0070660_100105678 Ga0070660_1001056782 64
7 3300005341 Ga0070691_10112593 Ga0070691_101125932 64
8 3300005343 Ga0070687_100837323 Ga0070687_1008373232 64
9 3300005345 Ga0070692_10031854 Ga0070692_100318544 64
10 3300005347 Ga0070668_100245341 Ga0070668_1002453413 64
11 3300005353 Ga0070669_100140917 Ga0070669_1001409173 64
12 3300005356 Ga0070674_100052243 Ga0070674_1000522434 64
13 3300005364 Ga0070673_100979575 Ga0070673_1009795752 64
14 3300005366 Ga0070659_100114457 Ga0070659_1001144573 64
15 3300005438 Ga0070701_10001787 Ga0070701_100017874 64
16 3300005440 Ga0070705_100068894 Ga0070705_1000688942 64
17 3300005441 Ga0070700_100040890 Ga0070700_1000408903 64
18 3300005444 Ga0070694_100030536 Ga0070694_1000305365 64
19 3300005445 Ga0070708_100366985 Ga0070708_1003669853 64
20 3300005456 Ga0070678_100092857 Ga0070678_1000928571 64
21 3300005457 Ga0070662_100039085 Ga0070662_1000390855 64
22 3300005459 Ga0068867_100379120 Ga0068867_1003791202 64
23 3300005467 Ga0070706_100840711 Ga0070706_1008407112 64
24 3300005530 Ga0070679_100137802 Ga0070679_1001378023 64
25 3300005539 Ga0068853_100856668 Ga0068853_1008566682 64
26 3300005543 Ga0070672_101562316 Ga0070672_1015623162 64
27 3300005544 Ga0070686_100053536 Ga0070686_1000535364 64
28 3300005545 Ga0070695_100091853 Ga0070695_1000918533 64
29 3300005546 Ga0070696_100008304 Ga0070696_1000083045 64
30 3300005547 Ga0070693_100155242 Ga0070693_1001552422 64
31 3300005549 Ga0070704_101517744 Ga0070704_1015177441 64
32 3300005563 Ga0068855_100379822 Ga0068855_1003798223 64
33 3300005578 Ga0068854_100024258 Ga0068854_1000242584 64
34 3300005718 Ga0068866_10787703 Ga0068866_107877032 64
35 3300005719 Ga0068861_100071708 Ga0068861_1000717082 64
36 3300005843 Ga0068860_102499418 Ga0068860_1024994182 64
37 3300005844 Ga0068862_100103543 Ga0068862_1001035433 64
38 3300006175 Ga0070712_100469060 Ga0070712_1004690602 64
39 3300006881 Ga0068865_100087363 Ga0068865_1000873632 64
40 3300009098 Ga0105245_10247935 Ga0105245_102479352 64
41 3300009148 Ga0105243_10335752 Ga0105243_103357522 64
42 3300009174 Ga0105241_11631307 Ga0105241_116313072 64
43 3300009176 Ga0105242_10228821 Ga0105242_102288213 64
44 3300009545 Ga0105237_10220836 Ga0105237_102208362 64
45 3300009551 Ga0105238_12400477 Ga0105238_124004772 64
46 3300009553 Ga0105249_10100015 Ga0105249_101000153 64
47 3300010375 Ga0105239_10363417 Ga0105239_103634172 64
48 3300013102 Ga0157371_10061637 Ga0157371_100616375 64
49 3300013297 Ga0157378_10042424 Ga0157378_100424244 64
50 3300013306 Ga0163162_10057234 Ga0163162_100572342 64
51 3300013308 Ga0157375_10099132 Ga0157375_100991324 64
52 3300014326 Ga0157380_10149878 Ga0157380_101498782 64
53 3300014969 Ga0157376_11049879 Ga0157376_110498792 64
54 3300005563 Ga0068855_100052596 Ga0068855_1000525965 72
55 3300013100 Ga0157373_10326773 Ga0157373_103267733 72
56 3300013105 Ga0157369_11310104 Ga0157369_113101042 72
57 3300020069 Ga0197907_11268269 Ga0197907_112682692 72
58 3300025909 Ga0207705_10042289 Ga0207705_100422894 72
59 3300025912 Ga0207707_10037726 Ga0207707_100377262 72
60 3300025913 Ga0207695_10092078 Ga0207695_100920782 72
61 3300025920 Ga0207649_10829454 Ga0207649_108294542 72
62 3300025949 Ga0207667_10193872 Ga0207667_101938722 72
63 3300031240 Ga0265320_10497227 Ga0265320_104972271 72
64 3300046473 Ga0495582_0216509 Ga0495582_0216509_143_364 72
65 3300047321 Ga0495676_0069121 Ga0495676_0069121_2323_2544 72
66 3300048904 Ga0496101_0669947 Ga0496101_0669947_43_264 72
67 3300048907 Ga0496104_0192653 Ga0496104_0192653_429_650 72
68 3300048908 Ga0496105_0122540 Ga0496105_0122540_1648_1869 72
69 3300048910 Ga0496107_0623275 Ga0496107_0623275_216_437 72
70 3300048912 Ga0496109_0975109 Ga0496109_0975109_309_530 72
71 3300048917 Ga0496114_0295165 Ga0496114_0295165_720_941 72
72 3300048918 Ga0496115_0191552 Ga0496115_0191552_181_402 72
73 3300005457 Ga0070662_100678086 Ga0070662_1006780862 74
74 3300005467 Ga0070706_100091147 Ga0070706_1000911472 74
75 3300005467 Ga0070706_101527819 Ga0070706_1015278192 74
76 3300005471 Ga0070698_100154464 Ga0070698_1001544643 74
77 3300005937 Ga0081455_10047704 Ga0081455_100477042 74
78 3300005981 Ga0081538_10005970 Ga0081538_1000597010 74
79 3300005981 Ga0081538_10101239 Ga0081538_101012392 74
80 3300009147 Ga0114129_12088840 Ga0114129_120888401 74
81 3300020082 Ga0206353_10856979 Ga0206353_108569792 74
82 3300025901 Ga0207688_10919792 Ga0207688_109197922 74
83 3300025910 Ga0207684_10113392 Ga0207684_101133923 74
84 3300025933 Ga0207706_10704815 Ga0207706_107048152 74
85 3300025935 Ga0207709_10468139 Ga0207709_104681392 74
86 3300025937 Ga0207669_11219044 Ga0207669_112190442 74
87 3300025961 Ga0207712_10349595 Ga0207712_103495952 74
88 3300026089 Ga0207648_10933553 Ga0207648_109335532 74
89 3300037312 Ga0395899_0224379 Ga0395899_0224379_905_1129 74
90 3300037466 Ga0395898_1905918 Ga0395898_1905918_271_495 74
91 3300037471 Ga0395905_1157182 Ga0395905_1157182_153_386 74
92 3300041411 Ga0439466_0039600 Ga0439466_0039600_460_690 74
93 3300046558 Ga0495633_0549407 Ga0495633_0549407_49_282 74
94 3300048912 Ga0496109_1506816 Ga0496109_1506816_367_597 74
95 3300049575 Ga0501039_1111780 Ga0501039_1111780_252_488 74
96 3300049578 Ga0501042_0448460 Ga0501042_0448460_338_574 74
97 3300049582 Ga0501048_0976396 Ga0501048_0976396_331_567 74
98 3300049583 Ga0501067_0099825 Ga0501067_0099825_1359_1586 74
99 3300049585 Ga0501069_0103813 Ga0501069_0103813_758_985 74
100 3300049587 Ga0501071_0627605 Ga0501071_0627605_80_316 74
101 3300049588 Ga0501072_0108831 Ga0501072_0108831_518_754 74
102 3300049590 Ga0501074_0450278 Ga0501074_0450278_87_323 74
103 3300049591 Ga0501075_0341343 Ga0501075_0341343_54_290 74
104 3300049592 Ga0501076_0663088 Ga0501076_0663088_500_736 74
105 3300049741 Ga0501079_0140223 Ga0501079_0140223_1179_1415 74
106 3300049743 Ga0501081_0048245 Ga0501081_0048245_1225_1461 74
107 3300049823 Ga0501044_0933045 Ga0501044_0933045_293_529 74
108 3300049824 Ga0501045_0043998 Ga0501045_0043998_1016_1252 74
109 3300059421 Ga0590071_007567 Ga0590071_007567_2216_2449 74
110 3300050492 nmdc:mga0yw44_749166_c1 nmdc:mga0yw44_749166_c1_171_404 75
111 3300045976 Ga0466967_1726495 Ga0466967_1726495_332_565 76
112 3300003203 JGI25406J46586_10251041 JGI25406J46586_102510412 78
113 3300003373 JGI25407J50210_10002049 JGI25407J50210_100020491 78
114 3300003373 JGI25407J50210_10008089 JGI25407J50210_100080893 78
115 3300003373 JGI25407J50210_10021986 JGI25407J50210_100219861 78
116 3300005327 Ga0070658_10041042 Ga0070658_100410423 78
117 3300005327 Ga0070658_10071609 Ga0070658_100716092 78
118 3300005328 Ga0070676_10147255 Ga0070676_101472553 78
119 3300005329 Ga0070683_100032146 Ga0070683_1000321464 78
120 3300005329 Ga0070683_100134534 Ga0070683_1001345344 78
121 3300005329 Ga0070683_100232524 Ga0070683_1002325244 78
122 3300005329 Ga0070683_100642644 Ga0070683_1006426441 78
123 3300005329 Ga0070683_101246098 Ga0070683_1012460982 78
124 3300005330 Ga0070690_100154933 Ga0070690_1001549333 78
125 3300005331 Ga0070670_100012063 Ga0070670_1000120639 78
126 3300005336 Ga0070680_100422080 Ga0070680_1004220802 78
127 3300005338 Ga0068868_100009800 Ga0068868_1000098006 78
128 3300005339 Ga0070660_100036640 Ga0070660_1000366404 78
129 3300005339 Ga0070660_100089448 Ga0070660_1000894484 78
130 3300005339 Ga0070660_100099996 Ga0070660_1000999963 78
131 3300005339 Ga0070660_100105719 Ga0070660_1001057193 78
132 3300005340 Ga0070689_100086408 Ga0070689_1000864082 78
133 3300005343 Ga0070687_100934801 Ga0070687_1009348011 78
134 3300005344 Ga0070661_100073267 Ga0070661_1000732673 78
135 3300005344 Ga0070661_101279068 Ga0070661_1012790682 78
136 3300005345 Ga0070692_10212574 Ga0070692_102125742 78
137 3300005347 Ga0070668_100067168 Ga0070668_1000671682 78
138 3300005347 Ga0070668_100711714 Ga0070668_1007117142 78
139 3300005353 Ga0070669_100190141 Ga0070669_1001901411 78
140 3300005354 Ga0070675_100036720 Ga0070675_1000367201 78
141 3300005354 Ga0070675_100218778 Ga0070675_1002187782 78
142 3300005355 Ga0070671_100024149 Ga0070671_1000241492 78
143 3300005356 Ga0070674_100063864 Ga0070674_1000638644 78
144 3300005356 Ga0070674_101424588 Ga0070674_1014245882 78
145 3300005364 Ga0070673_100078689 Ga0070673_1000786893 78
146 3300005365 Ga0070688_100038915 Ga0070688_1000389152 78
147 3300005365 Ga0070688_100501513 Ga0070688_1005015131 78
148 3300005366 Ga0070659_100195315 Ga0070659_1001953153 78
149 3300005366 Ga0070659_101740276 Ga0070659_1017402761 78
150 3300005367 Ga0070667_100094096 Ga0070667_1000940963 78
151 3300005406 Ga0070703_10479389 Ga0070703_104793892 78
152 3300005435 Ga0070714_101183168 Ga0070714_1011831682 78
153 3300005435 Ga0070714_101580110 Ga0070714_1015801102 78
154 3300005435 Ga0070714_101958207 Ga0070714_1019582072 78
155 3300005436 Ga0070713_100908720 Ga0070713_1009087201 78
156 3300005438 Ga0070701_10026825 Ga0070701_100268252 78
157 3300005439 Ga0070711_100851545 Ga0070711_1008515451 78
158 3300005440 Ga0070705_100383658 Ga0070705_1003836582 78
159 3300005441 Ga0070700_100075514 Ga0070700_1000755143 78
160 3300005445 Ga0070708_100478703 Ga0070708_1004787032 78
161 3300005445 Ga0070708_100797351 Ga0070708_1007973512 78
162 3300005445 Ga0070708_101703692 Ga0070708_1017036921 78
163 3300005445 Ga0070708_101764047 Ga0070708_1017640471 78
164 3300005455 Ga0070663_100841179 Ga0070663_1008411792 78
165 3300005456 Ga0070678_100005514 Ga0070678_1000055143 78
166 3300005456 Ga0070678_100852907 Ga0070678_1008529072 78
167 3300005457 Ga0070662_100376434 Ga0070662_1003764342 78
168 3300005457 Ga0070662_101065520 Ga0070662_1010655202 78
169 3300005457 Ga0070662_101890230 Ga0070662_1018902302 78
170 3300005458 Ga0070681_10025676 Ga0070681_100256768 78
171 3300005458 Ga0070681_10123201 Ga0070681_101232014 78
172 3300005459 Ga0068867_100131752 Ga0068867_1001317522 78
173 3300005459 Ga0068867_100818565 Ga0068867_1008185652 78
174 3300005459 Ga0068867_102100627 Ga0068867_1021006271 78
175 3300005466 Ga0070685_10226471 Ga0070685_102264712 78
176 3300005466 Ga0070685_10415609 Ga0070685_104156092 78
177 3300005467 Ga0070706_100171522 Ga0070706_1001715223 78
178 3300005467 Ga0070706_100772320 Ga0070706_1007723202 78
179 3300005467 Ga0070706_101483282 Ga0070706_1014832822 78
180 3300005468 Ga0070707_100123638 Ga0070707_1001236381 78
181 3300005468 Ga0070707_100148135 Ga0070707_1001481353 78
182 3300005468 Ga0070707_100927155 Ga0070707_1009271552 78
183 3300005471 Ga0070698_100095830 Ga0070698_1000958303 78
184 3300005471 Ga0070698_100263584 Ga0070698_1002635841 78
185 3300005471 Ga0070698_100484592 Ga0070698_1004845922 78
186 3300005471 Ga0070698_101774881 Ga0070698_1017748812 78
187 3300005518 Ga0070699_100013074 Ga0070699_1000130748 78
188 3300005518 Ga0070699_100166587 Ga0070699_1001665871 78
189 3300005518 Ga0070699_100414704 Ga0070699_1004147041 78
190 3300005530 Ga0070679_101720338 Ga0070679_1017203382 78
191 3300005535 Ga0070684_100006063 Ga0070684_1000060639 78
192 3300005535 Ga0070684_100025466 Ga0070684_1000254663 78
193 3300005535 Ga0070684_100562471 Ga0070684_1005624712 78
194 3300005539 Ga0068853_100476887 Ga0068853_1004768872 78
195 3300005539 Ga0068853_100507827 Ga0068853_1005078272 78
196 3300005539 Ga0068853_102350427 Ga0068853_1023504272 78
197 3300005543 Ga0070672_100108172 Ga0070672_1001081723 78
198 3300005544 Ga0070686_100021879 Ga0070686_1000218792 78
199 3300005545 Ga0070695_100000253 Ga0070695_1000002538 78
200 3300005546 Ga0070696_100364690 Ga0070696_1003646902 78
201 3300005547 Ga0070693_100744076 Ga0070693_1007440762 78
202 3300005548 Ga0070665_100097278 Ga0070665_1000972782 78
203 3300005549 Ga0070704_100819874 Ga0070704_1008198741 78
204 3300005549 Ga0070704_102015718 Ga0070704_1020157182 78
205 3300005549 Ga0070704_102314717 Ga0070704_1023147171 78
206 3300005563 Ga0068855_100967750 Ga0068855_1009677502 78
207 3300005563 Ga0068855_101600124 Ga0068855_1016001242 78
208 3300005564 Ga0070664_100016814 Ga0070664_1000168145 78
209 3300005564 Ga0070664_100953188 Ga0070664_1009531882 78
210 3300005577 Ga0068857_100125983 Ga0068857_1001259833 78
211 3300005577 Ga0068857_100938262 Ga0068857_1009382622 78
212 3300005578 Ga0068854_100314991 Ga0068854_1003149912 78
213 3300005578 Ga0068854_101470510 Ga0068854_1014705102 78
214 3300005615 Ga0070702_100094117 Ga0070702_1000941173 78
215 3300005615 Ga0070702_100722147 Ga0070702_1007221472 78
216 3300005615 Ga0070702_101770771 Ga0070702_1017707711 78
217 3300005618 Ga0068864_100042736 Ga0068864_1000427363 78
218 3300005719 Ga0068861_101253710 Ga0068861_1012537102 78
219 3300005840 Ga0068870_10000204 Ga0068870_1000020417 78
220 3300005840 Ga0068870_10159381 Ga0068870_101593812 78
221 3300005840 Ga0068870_11250083 Ga0068870_112500832 78
222 3300005841 Ga0068863_100732365 Ga0068863_1007323652 78
223 3300005844 Ga0068862_102355462 Ga0068862_1023554622 78
224 3300005937 Ga0081455_10006997 Ga0081455_100069977 78
225 3300005937 Ga0081455_10015572 Ga0081455_100155728 78
226 3300005937 Ga0081455_10018033 Ga0081455_100180337 78
227 3300005937 Ga0081455_10046898 Ga0081455_100468984 78
228 3300005937 Ga0081455_10125053 Ga0081455_101250534 78
229 3300005937 Ga0081455_10225344 Ga0081455_102253442 78
230 3300005937 Ga0081455_10239546 Ga0081455_102395462 78
231 3300005937 Ga0081455_10527867 Ga0081455_105278672 78
232 3300005981 Ga0081538_10000649 Ga0081538_1000064926 78
233 3300005981 Ga0081538_10000751 Ga0081538_1000075130 78
234 3300005981 Ga0081538_10005541 Ga0081538_1000554113 78
235 3300005981 Ga0081538_10033372 Ga0081538_100333726 78
236 3300005981 Ga0081538_10049184 Ga0081538_100491842 78
237 3300005983 Ga0081540_1007112 Ga0081540_10071128 78
238 3300005985 Ga0081539_10003424 Ga0081539_100034249 78
239 3300005985 Ga0081539_10173303 Ga0081539_101733032 78
240 3300005985 Ga0081539_10377070 Ga0081539_103770701 78
241 3300006028 Ga0070717_10147034 Ga0070717_101470342 78
242 3300006028 Ga0070717_11235431 Ga0070717_112354312 78
243 3300006038 Ga0075365_10044105 Ga0075365_100441054 78
244 3300006038 Ga0075365_10750378 Ga0075365_107503781 78
245 3300006038 Ga0075365_10802682 Ga0075365_108026821 78
246 3300006051 Ga0075364_10123477 Ga0075364_101234773 78
247 3300006058 Ga0075432_10022148 Ga0075432_100221482 78
248 3300006163 Ga0070715_10934238 Ga0070715_109342382 78
249 3300006173 Ga0070716_100371430 Ga0070716_1003714302 78
250 3300006175 Ga0070712_100507330 Ga0070712_1005073302 78
251 3300006175 Ga0070712_101716432 Ga0070712_1017164322 78
252 3300006237 Ga0097621_100847451 Ga0097621_1008474512 78
253 3300006358 Ga0068871_100597677 Ga0068871_1005976772 78
254 3300006358 Ga0068871_101191219 Ga0068871_1011912192 78
255 3300006844 Ga0075428_100004766 Ga0075428_1000047665 78
256 3300006844 Ga0075428_100530489 Ga0075428_1005304892 78
257 3300006846 Ga0075430_100460406 Ga0075430_1004604062 78
258 3300006846 Ga0075430_100643219 Ga0075430_1006432192 78
259 3300006846 Ga0075430_100677560 Ga0075430_1006775602 78
260 3300006847 Ga0075431_100096511 Ga0075431_1000965113 78
261 3300006847 Ga0075431_100257360 Ga0075431_1002573603 78
262 3300006847 Ga0075431_100453387 Ga0075431_1004533871 78
263 3300006847 Ga0075431_100843401 Ga0075431_1008434012 78
264 3300006847 Ga0075431_101002397 Ga0075431_1010023972 78
265 3300006847 Ga0075431_101602932 Ga0075431_1016029322 78
266 3300006852 Ga0075433_10942200 Ga0075433_109422002 78
267 3300006871 Ga0075434_100369782 Ga0075434_1003697822 78
268 3300006871 Ga0075434_100377703 Ga0075434_1003777031 78
269 3300006871 Ga0075434_102031281 Ga0075434_1020312812 78
270 3300006880 Ga0075429_100007732 Ga0075429_1000077324 78
271 3300006880 Ga0075429_100064851 Ga0075429_1000648514 78
272 3300006880 Ga0075429_100064970 Ga0075429_1000649702 78
273 3300006880 Ga0075429_100230780 Ga0075429_1002307803 78
274 3300006880 Ga0075429_100429062 Ga0075429_1004290622 78
275 3300006880 Ga0075429_101740763 Ga0075429_1017407632 78
276 3300006881 Ga0068865_101019356 Ga0068865_1010193562 78
277 3300006914 Ga0075436_101374645 Ga0075436_1013746452 78
278 3300007076 Ga0075435_100225790 Ga0075435_1002257902 78
279 3300007076 Ga0075435_100692391 Ga0075435_1006923912 78
280 3300009093 Ga0105240_10050080 Ga0105240_100500805 78
281 3300009093 Ga0105240_10180280 Ga0105240_101802802 78
282 3300009093 Ga0105240_10674117 Ga0105240_106741172 78
283 3300009093 Ga0105240_12314404 Ga0105240_123144042 78
284 3300009094 Ga0111539_10307430 Ga0111539_103074302 78
285 3300009094 Ga0111539_10569473 Ga0111539_105694732 78
286 3300009094 Ga0111539_11562958 Ga0111539_115629582 78
287 3300009094 Ga0111539_12122661 Ga0111539_121226612 78
288 3300009094 Ga0111539_12238950 Ga0111539_122389502 78
289 3300009098 Ga0105245_10114118 Ga0105245_101141183 78
290 3300009098 Ga0105245_10220112 Ga0105245_102201122 78
291 3300009147 Ga0114129_10004963 Ga0114129_100049636 78
292 3300009147 Ga0114129_10008112 Ga0114129_1000811217 78
293 3300009147 Ga0114129_10032178 Ga0114129_100321789 78
294 3300009147 Ga0114129_10112786 Ga0114129_101127862 78
295 3300009147 Ga0114129_10166093 Ga0114129_101660933 78
296 3300009147 Ga0114129_10628569 Ga0114129_106285692 78
297 3300009147 Ga0114129_10897394 Ga0114129_108973942 78
298 3300009147 Ga0114129_11186749 Ga0114129_111867491 78
299 3300009147 Ga0114129_11531467 Ga0114129_115314672 78
300 3300009147 Ga0114129_11862922 Ga0114129_118629221 78
301 3300009148 Ga0105243_10029447 Ga0105243_100294474 78
302 3300009148 Ga0105243_10076784 Ga0105243_100767845 78
303 3300009148 Ga0105243_11485376 Ga0105243_114853762 78
304 3300009176 Ga0105242_10348470 Ga0105242_103484702 78
305 3300009176 Ga0105242_11011832 Ga0105242_110118322 78
306 3300009177 Ga0105248_10265464 Ga0105248_102654642 78
307 3300009545 Ga0105237_10172828 Ga0105237_101728282 78
308 3300009545 Ga0105237_11558619 Ga0105237_115586191 78
309 3300009551 Ga0105238_10074304 Ga0105238_100743046 78
310 3300009553 Ga0105249_10198791 Ga0105249_101987912 78
311 3300009553 Ga0105249_10960856 Ga0105249_109608562 78
312 3300010375 Ga0105239_10058288 Ga0105239_100582885 78
313 3300010375 Ga0105239_10612142 Ga0105239_106121421 78
314 3300011119 Ga0105246_10003846 Ga0105246_100038462 78
315 3300011119 Ga0105246_10038443 Ga0105246_100384432 78
316 3300011119 Ga0105246_10170195 Ga0105246_101701953 78
317 3300011119 Ga0105246_10508562 Ga0105246_105085622 78
318 3300011119 Ga0105246_10882669 Ga0105246_108826692 78
319 3300011119 Ga0105246_11838747 Ga0105246_118387472 78
320 3300012498 Ga0157345_1038507 Ga0157345_10385072 78
321 3300013100 Ga0157373_10256485 Ga0157373_102564852 78
322 3300013102 Ga0157371_10622663 Ga0157371_106226632 78
323 3300013102 Ga0157371_11236903 Ga0157371_112369032 78
324 3300013104 Ga0157370_10008749 Ga0157370_1000874912 78
325 3300013104 Ga0157370_10068398 Ga0157370_100683984 78
326 3300013105 Ga0157369_10506115 Ga0157369_105061152 78
327 3300013105 Ga0157369_10653808 Ga0157369_106538082 78
328 3300013105 Ga0157369_12199890 Ga0157369_121998902 78
329 3300013105 Ga0157369_12483550 Ga0157369_124835502 78
330 3300013296 Ga0157374_11879071 Ga0157374_118790712 78
331 3300013296 Ga0157374_12165817 Ga0157374_121658172 78
332 3300013307 Ga0157372_10232874 Ga0157372_102328744 78
333 3300013307 Ga0157372_10688003 Ga0157372_106880032 78
334 3300013308 Ga0157375_10015581 Ga0157375_100155814 78
335 3300014325 Ga0163163_10012068 Ga0163163_100120682 78
336 3300014325 Ga0163163_10689116 Ga0163163_106891162 78
337 3300014326 Ga0157380_10089631 Ga0157380_100896312 78
338 3300014497 Ga0182008_10542734 Ga0182008_105427342 78
339 3300014745 Ga0157377_10013668 Ga0157377_100136683 78
340 3300014745 Ga0157377_10077913 Ga0157377_100779132 78
341 3300014968 Ga0157379_10218843 Ga0157379_102188433 78
342 3300014969 Ga0157376_10064073 Ga0157376_100640736 78
343 3300014969 Ga0157376_10422785 Ga0157376_104227852 78
344 3300014969 Ga0157376_10853195 Ga0157376_108531952 78
345 3300014969 Ga0157376_11181067 Ga0157376_111810671 78
346 3300015265 Ga0182005_1092243 Ga0182005_10922432 78
347 3300017792 Ga0163161_10276093 Ga0163161_102760931 78
348 3300020069 Ga0197907_11292483 Ga0197907_112924832 78
349 3300020069 Ga0197907_11347809 Ga0197907_113478092 78
350 3300020070 Ga0206356_11016126 Ga0206356_110161265 78
351 3300020076 Ga0206355_1264501 Ga0206355_12645012 78
352 3300020081 Ga0206354_10206368 Ga0206354_102063682 78
353 3300020081 Ga0206354_10970272 Ga0206354_109702722 78
354 3300020082 Ga0206353_10745444 Ga0206353_107454442 78
355 3300021441 Ga0213871_10125034 Ga0213871_101250342 78
356 3300022467 Ga0224712_10013163 Ga0224712_100131632 78
357 3300025315 Ga0207697_10145439 Ga0207697_101454392 78
358 3300025898 Ga0207692_10380809 Ga0207692_103808092 78
359 3300025898 Ga0207692_10959026 Ga0207692_109590262 78
360 3300025901 Ga0207688_10011254 Ga0207688_100112545 78
361 3300025901 Ga0207688_10206413 Ga0207688_102064132 78
362 3300025907 Ga0207645_10109298 Ga0207645_101092982 78
363 3300025908 Ga0207643_10011875 Ga0207643_100118753 78
364 3300025908 Ga0207643_10053630 Ga0207643_100536302 78
365 3300025908 Ga0207643_10455750 Ga0207643_104557502 78
366 3300025909 Ga0207705_10102409 Ga0207705_101024093 78
367 3300025912 Ga0207707_10082086 Ga0207707_100820862 78
368 3300025913 Ga0207695_10594520 Ga0207695_105945202 78
369 3300025913 Ga0207695_10847048 Ga0207695_108470482 78
370 3300025913 Ga0207695_11489717 Ga0207695_114897172 78
371 3300025914 Ga0207671_10083040 Ga0207671_100830402 78
372 3300025915 Ga0207693_10188205 Ga0207693_101882052 78
373 3300025917 Ga0207660_10158135 Ga0207660_101581352 78
374 3300025919 Ga0207657_10001344 Ga0207657_1000134431 78
375 3300025919 Ga0207657_10269004 Ga0207657_102690042 78
376 3300025921 Ga0207652_11067171 Ga0207652_110671712 78
377 3300025921 Ga0207652_11449819 Ga0207652_114498192 78
378 3300025921 Ga0207652_11468098 Ga0207652_114680982 78
379 3300025921 Ga0207652_11468591 Ga0207652_114685912 78
380 3300025922 Ga0207646_10057680 Ga0207646_100576804 78
381 3300025922 Ga0207646_10401860 Ga0207646_104018602 78
382 3300025922 Ga0207646_10402168 Ga0207646_104021682 78
383 3300025922 Ga0207646_10928253 Ga0207646_109282532 78
384 3300025922 Ga0207646_11408005 Ga0207646_114080052 78
385 3300025923 Ga0207681_10985284 Ga0207681_109852842 78
386 3300025923 Ga0207681_11307147 Ga0207681_113071471 78
387 3300025924 Ga0207694_11110951 Ga0207694_111109512 78
388 3300025925 Ga0207650_10087472 Ga0207650_100874722 78
389 3300025925 Ga0207650_10089829 Ga0207650_100898293 78
390 3300025926 Ga0207659_10380198 Ga0207659_103801982 78
391 3300025926 Ga0207659_11304145 Ga0207659_113041452 78
392 3300025927 Ga0207687_10029710 Ga0207687_100297103 78
393 3300025928 Ga0207700_10035417 Ga0207700_100354174 78
394 3300025929 Ga0207664_10004888 Ga0207664_100048885 78
395 3300025929 Ga0207664_10034890 Ga0207664_100348904 78
396 3300025929 Ga0207664_10038111 Ga0207664_100381116 78
397 3300025929 Ga0207664_10389263 Ga0207664_103892632 78
398 3300025929 Ga0207664_10689026 Ga0207664_106890262 78
399 3300025929 Ga0207664_11195736 Ga0207664_111957362 78
400 3300025929 Ga0207664_11633991 Ga0207664_116339912 78
401 3300025931 Ga0207644_11031046 Ga0207644_110310462 78
402 3300025932 Ga0207690_10253058 Ga0207690_102530582 78
403 3300025933 Ga0207706_10375900 Ga0207706_103759002 78
404 3300025934 Ga0207686_10663609 Ga0207686_106636092 78
405 3300025935 Ga0207709_10095324 Ga0207709_100953242 78
406 3300025936 Ga0207670_10032033 Ga0207670_100320333 78
407 3300025937 Ga0207669_10234025 Ga0207669_102340252 78
408 3300025937 Ga0207669_10490294 Ga0207669_104902942 78
409 3300025937 Ga0207669_11145176 Ga0207669_111451762 78
410 3300025937 Ga0207669_11452963 Ga0207669_114529632 78
411 3300025938 Ga0207704_10233912 Ga0207704_102339122 78
412 3300025938 Ga0207704_11123734 Ga0207704_111237341 78
413 3300025940 Ga0207691_10020777 Ga0207691_100207772 78
414 3300025940 Ga0207691_10846008 Ga0207691_108460082 78
415 3300025944 Ga0207661_10027567 Ga0207661_100275672 78
416 3300025944 Ga0207661_10137639 Ga0207661_101376393 78
417 3300025944 Ga0207661_10220261 Ga0207661_102202614 78
418 3300025944 Ga0207661_11062531 Ga0207661_110625312 78
419 3300025944 Ga0207661_11101831 Ga0207661_111018312 78
420 3300025945 Ga0207679_10078952 Ga0207679_100789524 78
421 3300025960 Ga0207651_10407286 Ga0207651_104072862 78
422 3300025961 Ga0207712_10413084 Ga0207712_104130842 78
423 3300025961 Ga0207712_10592159 Ga0207712_105921592 78
424 3300025961 Ga0207712_10839038 Ga0207712_108390382 78
425 3300025972 Ga0207668_10588354 Ga0207668_105883542 78
426 3300025981 Ga0207640_10171865 Ga0207640_101718653 78
427 3300026023 Ga0207677_10053614 Ga0207677_100536144 78
428 3300026023 Ga0207677_10612805 Ga0207677_106128052 78
429 3300026023 Ga0207677_11235076 Ga0207677_112350762 78
430 3300026035 Ga0207703_11122240 Ga0207703_111222402 78
431 3300026041 Ga0207639_10295059 Ga0207639_102950592 78
432 3300026067 Ga0207678_10336263 Ga0207678_103362632 78
433 3300026075 Ga0207708_10017519 Ga0207708_100175193 78
434 3300026075 Ga0207708_10829069 Ga0207708_108290691 78
435 3300026088 Ga0207641_11592549 Ga0207641_115925492 78
436 3300026089 Ga0207648_10270477 Ga0207648_102704774 78
437 3300026089 Ga0207648_10730661 Ga0207648_107306612 78
438 3300026089 Ga0207648_10842126 Ga0207648_108421262 78
439 3300026095 Ga0207676_10065149 Ga0207676_100651492 78
440 3300026116 Ga0207674_10069899 Ga0207674_100698993 78
441 3300026116 Ga0207674_10191379 Ga0207674_101913792 78
442 3300026116 Ga0207674_10520143 Ga0207674_105201432 78
443 3300026116 Ga0207674_11458198 Ga0207674_114581982 78
444 3300026116 Ga0207674_11895992 Ga0207674_118959922 78
445 3300026118 Ga0207675_100264743 Ga0207675_1002647433 78
446 3300026118 Ga0207675_101717202 Ga0207675_1017172022 78
447 3300026118 Ga0207675_102388133 Ga0207675_1023881332 78
448 3300026121 Ga0207683_10009294 Ga0207683_100092944 78
449 3300026121 Ga0207683_10406718 Ga0207683_104067182 78
450 3300027907 Ga0207428_10099754 Ga0207428_100997544 78
451 3300027907 Ga0207428_10336080 Ga0207428_103360802 78
452 3300028379 Ga0268266_10065478 Ga0268266_100654783 78
453 3300028380 Ga0268265_10335497 Ga0268265_103354972 78
454 3300028380 Ga0268265_11540367 Ga0268265_115403672 78
455 3300028556 Ga0265337_1094192 Ga0265337_10941922 78
456 3300028558 Ga0265326_10060792 Ga0265326_100607922 78
457 3300028563 Ga0265319_1012507 Ga0265319_10125073 78
458 3300028573 Ga0265334_10126677 Ga0265334_101266772 78
459 3300028577 Ga0265318_10026590 Ga0265318_100265902 78
460 3300028654 Ga0265322_10097652 Ga0265322_100976522 78
461 3300028666 Ga0265336_10160360 Ga0265336_101603602 78
462 3300028800 Ga0265338_10008087 Ga0265338_100080871 78
463 3300028800 Ga0265338_10023514 Ga0265338_100235143 78
464 3300028800 Ga0265338_10026119 Ga0265338_100261193 78
465 3300028800 Ga0265338_10112545 Ga0265338_101125453 78
466 3300031235 Ga0265330_10039496 Ga0265330_100394962 78
467 3300031238 Ga0265332_10008175 Ga0265332_100081753 78
468 3300031240 Ga0265320_10024893 Ga0265320_100248933 78
469 3300031241 Ga0265325_10083827 Ga0265325_100838273 78
470 3300031242 Ga0265329_10097310 Ga0265329_100973101 78
471 3300031247 Ga0265340_10011483 Ga0265340_100114835 78
472 3300031249 Ga0265339_10034059 Ga0265339_100340593 78
473 3300031249 Ga0265339_10138705 Ga0265339_101387052 78
474 3300031250 Ga0265331_10022073 Ga0265331_100220734 78
475 3300031251 Ga0265327_10009229 Ga0265327_100092292 78
476 3300031251 Ga0265327_10032608 Ga0265327_100326083 78
477 3300031344 Ga0265316_10246529 Ga0265316_102465292 78
478 3300031548 Ga0307408_101505677 Ga0307408_1015056772 78
479 3300031595 Ga0265313_10033372 Ga0265313_100333722 78
480 3300031595 Ga0265313_10232256 Ga0265313_102322561 78
481 3300031711 Ga0265314_10053808 Ga0265314_100538083 78
482 3300031712 Ga0265342_10112991 Ga0265342_101129912 78
483 3300031731 Ga0307405_10601290 Ga0307405_106012902 78
484 3300031903 Ga0307407_11068487 Ga0307407_110684872 78
485 3300031911 Ga0307412_11086913 Ga0307412_110869132 78
486 3300031995 Ga0307409_101781581 Ga0307409_1017815812 78
487 3300032002 Ga0307416_100224144 Ga0307416_1002241442 78
488 3300032002 Ga0307416_100291364 Ga0307416_1002913643 78
489 3300032002 Ga0307416_100987803 Ga0307416_1009878032 78
490 3300032126 Ga0307415_100116744 Ga0307415_1001167443 78
491 3300032126 Ga0307415_101553420 Ga0307415_1015534202 78
492 3300032126 Ga0307415_102351166 Ga0307415_1023511662 78
493 3300032133 Ga0316583_10164784 Ga0316583_101647841 78
494 3300035117 Ga0373953_0237012 Ga0373953_0237012_197_436 78
495 3300035118 Ga0373954_0445572 Ga0373954_0445572_212_451 78
496 3300035119 Ga0373956_0035721 Ga0373956_0035721_339_578 78
497 3300035120 Ga0373957_0432062 Ga0373957_0432062_163_402 78
498 3300035121 Ga0373960_0312332 Ga0373960_0312332_76_318 78
499 3300035170 Ga0373943_0433594 Ga0373943_0433594_235_480 78
500 3300035172 Ga0373955_0055386 Ga0373955_0055386_1578_1817 78
501 3300035242 Ga0373962_0183850 Ga0373962_0183850_187_429 78
502 3300035410 Ga0373924_0103675 Ga0373924_0103675_351_590 78
503 3300035692 Ga0373935_0583300 Ga0373935_0583300_269_508 78
504 3300035724 Ga0373933_0056141 Ga0373933_0056141_1222_1461 78
505 3300035724 Ga0373933_0057624 Ga0373933_0057624_1027_1266 78
506 3300035725 Ga0373947_0765657 Ga0373947_0765657_68_313 78
507 3300035725 Ga0373947_1192377 Ga0373947_1192377_252_497 78
508 3300036401 Ga0373937_0000107 Ga0373937_0000107_64062_64301 78
509 3300036401 Ga0373937_0078927 Ga0373937_0078927_833_1072 78
510 3300037068 Ga0373925_1141343 Ga0373925_1141343_296_541 78
511 3300037312 Ga0395899_0000899 Ga0395899_0000899_9653_9901 78
512 3300037312 Ga0395899_0033726 Ga0395899_0033726_3046_3288 78
513 3300037312 Ga0395899_0039855 Ga0395899_0039855_970_1218 78
514 3300037312 Ga0395899_0065589 Ga0395899_0065589_556_801 78
515 3300037312 Ga0395899_0074492 Ga0395899_0074492_1179_1424 78
516 3300037312 Ga0395899_0088103 Ga0395899_0088103_1667_1915 78
517 3300037312 Ga0395899_0305651 Ga0395899_0305651_622_870 78
518 3300037312 Ga0395899_0343728 Ga0395899_0343728_612_857 78
519 3300037312 Ga0395899_0649067 Ga0395899_0649067_58_303 78
520 3300037418 Ga0395900_0001819 Ga0395900_0001819_4785_5027 78
521 3300037418 Ga0395900_0008064 Ga0395900_0008064_7846_8094 78
522 3300037418 Ga0395900_0074115 Ga0395900_0074115_1467_1712 78
523 3300037418 Ga0395900_0076426 Ga0395900_0076426_2366_2605 78
524 3300037418 Ga0395900_0127255 Ga0395900_0127255_276_515 78
525 3300037418 Ga0395900_0156628 Ga0395900_0156628_26_274 78
526 3300037418 Ga0395900_0226912 Ga0395900_0226912_193_432 78
527 3300037418 Ga0395900_0365508 Ga0395900_0365508_928_1173 78
528 3300037418 Ga0395900_0431182 Ga0395900_0431182_279_524 78
529 3300037418 Ga0395900_0485120 Ga0395900_0485120_442_690 78
530 3300037418 Ga0395900_0523272 Ga0395900_0523272_338_586 78
531 3300037418 Ga0395900_0845139 Ga0395900_0845139_355_597 78
532 3300037418 Ga0395900_0879349 Ga0395900_0879349_168_410 78
533 3300037418 Ga0395900_0892703 Ga0395900_0892703_417_653 78
534 3300037418 Ga0395900_1792150 Ga0395900_1792150_243_488 78
535 3300037418 Ga0395900_1844673 Ga0395900_1844673_124_366 78
536 3300037466 Ga0395898_0002821 Ga0395898_0002821_344_592 78
537 3300037466 Ga0395898_0010400 Ga0395898_0010400_2006_2251 78
538 3300037466 Ga0395898_0014564 Ga0395898_0014564_5098_5340 78
539 3300037466 Ga0395898_0099324 Ga0395898_0099324_991_1236 78
540 3300037466 Ga0395898_0129328 Ga0395898_0129328_798_1046 78
541 3300037466 Ga0395898_0154541 Ga0395898_0154541_1550_1795 78
542 3300037466 Ga0395898_0318670 Ga0395898_0318670_516_758 78
543 3300037466 Ga0395898_0394951 Ga0395898_0394951_869_1108 78
544 3300037466 Ga0395898_0399988 Ga0395898_0399988_247_486 78
545 3300037466 Ga0395898_0407864 Ga0395898_0407864_267_515 78
546 3300037466 Ga0395898_0955296 Ga0395898_0955296_462_701 78
547 3300037471 Ga0395905_0002059 Ga0395905_0002059_2410_2658 78
548 3300037471 Ga0395905_0009197 Ga0395905_0009197_4729_4971 78
549 3300037471 Ga0395905_0011047 Ga0395905_0011047_2759_3004 78
550 3300037471 Ga0395905_0036527 Ga0395905_0036527_2460_2708 78
551 3300037471 Ga0395905_0067373 Ga0395905_0067373_598_846 78
552 3300037471 Ga0395905_0191151 Ga0395905_0191151_413_652 78
553 3300037471 Ga0395905_0252100 Ga0395905_0252100_492_734 78
554 3300037471 Ga0395905_0320176 Ga0395905_0320176_904_1140 78
555 3300037471 Ga0395905_0486604 Ga0395905_0486604_338_586 78
556 3300037471 Ga0395905_0591049 Ga0395905_0591049_36_275 78
557 3300037471 Ga0395905_1657961 Ga0395905_1657961_56_301 78
558 3300038443 Ga0395901_0000917 Ga0395901_0000917_2027_2269 78
559 3300038443 Ga0395901_0001352 Ga0395901_0001352_4698_4946 78
560 3300038443 Ga0395901_0003227 Ga0395901_0003227_8276_8521 78
561 3300038443 Ga0395901_0017126 Ga0395901_0017126_817_1056 78
562 3300038443 Ga0395901_0026735 Ga0395901_0026735_4490_4732 78
563 3300038443 Ga0395901_0132577 Ga0395901_0132577_585_830 78
564 3300038443 Ga0395901_0286259 Ga0395901_0286259_46_285 78
565 3300038443 Ga0395901_0335911 Ga0395901_0335911_792_1040 78
566 3300038443 Ga0395901_0344761 Ga0395901_0344761_1132_1380 78
567 3300038443 Ga0395901_0479780 Ga0395901_0479780_309_545 78
568 3300038443 Ga0395901_0565246 Ga0395901_0565246_240_485 78
569 3300038443 Ga0395901_0585281 Ga0395901_0585281_89_331 78
570 3300038443 Ga0395901_0752810 Ga0395901_0752810_632_871 78
571 3300038443 Ga0395901_1122798 Ga0395901_1122798_334_582 78
572 3300038443 Ga0395901_1313055 Ga0395901_1313055_352_591 78
573 3300038443 Ga0395901_1602679 Ga0395901_1602679_349_594 78
574 3300039438 Ga0436360_0132719 Ga0436360_0132719_104_343 78
575 3300039438 Ga0436360_1015244 Ga0436360_1015244_1764_2003 78
576 3300041491 Ga0451833_0239441 Ga0451833_0239441_170_412 78
577 3300041511 Ga0451855_1798244 Ga0451855_1798244_159_398 78
578 3300041512 Ga0451853_1791929 Ga0451853_1791929_65_310 78
579 3300042005 Ga0439448_0078823 Ga0439448_0078823_12_251 78
580 3300042005 Ga0439448_0079437 Ga0439448_0079437_321_560 78
581 3300042005 Ga0439448_0277636 Ga0439448_0277636_57_299 78
582 3300042008 Ga0439450_019679 Ga0439450_019679_844_1083 78
583 3300042008 Ga0439450_033584 Ga0439450_033584_254_499 78
584 3300042009 Ga0439451_042763 Ga0439451_042763_322_567 78
585 3300042011 Ga0439454_090411 Ga0439454_090411_292_537 78
586 3300042012 Ga0439455_0098260 Ga0439455_0098260_378_623 78
587 3300042013 Ga0439456_059429 Ga0439456_059429_165_413 78
588 3300042122 Ga0450920_047997 Ga0450920_047997_466_708 78
589 3300042137 Ga0450902_104102 Ga0450902_104102_220_462 78
590 3300042439 Ga0439464_0093202 Ga0439464_0093202_325_567 78
591 3300042461 Ga0439460_0176041 Ga0439460_0176041_163_402 78
592 3300042461 Ga0439460_0239623 Ga0439460_0239623_162_401 78
593 3300042531 Ga0450918_040246 Ga0450918_040246_279_521 78
594 3300044658 Ga0466972_0016553 Ga0466972_0016553_525_779 78
595 3300044683 Ga0466965_0260221 Ga0466965_0260221_653_907 78
596 3300044693 Ga0466961_0017573 Ga0466961_0017573_3164_3418 78
597 3300044693 Ga0466961_0077814 Ga0466961_0077814_154_393 78
598 3300044694 Ga0466963_0217597 Ga0466963_0217597_953_1207 78
599 3300044694 Ga0466963_0329895 Ga0466963_0329895_184_423 78
600 3300044694 Ga0466963_0650234 Ga0466963_0650234_174_413 78
601 3300044694 Ga0466963_0673814 Ga0466963_0673814_270_530 78
602 3300044706 Ga0466964_0113947 Ga0466964_0113947_326_580 78
603 3300044706 Ga0466964_0245669 Ga0466964_0245669_493_747 78
604 3300044719 Ga0466971_0081293 Ga0466971_0081293_718_957 78
605 3300044719 Ga0466971_0253084 Ga0466971_0253084_40_294 78
606 3300044765 Ga0466970_0607957 Ga0466970_0607957_166_420 78
607 3300044842 Ga0466957_0105165 Ga0466957_0105165_1349_1588 78
608 3300044842 Ga0466957_0176181 Ga0466957_0176181_998_1237 78
609 3300044842 Ga0466957_0423699 Ga0466957_0423699_277_513 78
610 3300045049 Ga0466959_0262391 Ga0466959_0262391_339_578 78
611 3300045049 Ga0466959_0350673 Ga0466959_0350673_166_420 78
612 3300045836 Ga0466958_0011964 Ga0466958_0011964_4020_4259 78
613 3300045836 Ga0466958_0610338 Ga0466958_0610338_226_465 78
614 3300045976 Ga0466967_0009992 Ga0466967_0009992_4977_5216 78
615 3300045976 Ga0466967_0014130 Ga0466967_0014130_663_923 78
616 3300045976 Ga0466967_0064089 Ga0466967_0064089_1191_1445 78
617 3300045976 Ga0466967_0067528 Ga0466967_0067528_2352_2591 78
618 3300045976 Ga0466967_0118104 Ga0466967_0118104_181_435 78
619 3300045976 Ga0466967_0160582 Ga0466967_0160582_802_1041 78
620 3300045976 Ga0466967_0306646 Ga0466967_0306646_519_773 78
621 3300045976 Ga0466967_1363259 Ga0466967_1363259_127_366 78
622 3300045976 Ga0466967_1710466 Ga0466967_1710466_289_528 78
623 3300046454 Ga0495592_0000089 Ga0495592_0000089_66291_66530 78
624 3300046455 Ga0495603_0869909 Ga0495603_0869909_147_395 78
625 3300046459 Ga0495629_0308517 Ga0495629_0308517_754_993 78
626 3300046462 Ga0495651_0000057 Ga0495651_0000057_68223_68462 78
627 3300046462 Ga0495651_0030418 Ga0495651_0030418_960_1199 78
628 3300046462 Ga0495651_0469952 Ga0495651_0469952_109_348 78
629 3300046462 Ga0495651_0585080 Ga0495651_0585080_170_409 78
630 3300046463 Ga0495653_0000641 Ga0495653_0000641_15402_15641 78
631 3300046463 Ga0495653_0012796 Ga0495653_0012796_1217_1456 78
632 3300046463 Ga0495653_0167405 Ga0495653_0167405_1102_1341 78
633 3300046473 Ga0495582_0532195 Ga0495582_0532195_111_353 78
634 3300046474 Ga0495605_0052282 Ga0495605_0052282_848_1096 78
635 3300046475 Ga0495639_0475808 Ga0495639_0475808_47_289 78
636 3300046477 Ga0495664_0210699 Ga0495664_0210699_613_852 78
637 3300046477 Ga0495664_0781379 Ga0495664_0781379_245_484 78
638 3300046491 Ga0495584_0321237 Ga0495584_0321237_333_581 78
639 3300046492 Ga0495585_0141647 Ga0495585_0141647_916_1164 78
640 3300046500 Ga0495596_0135555 Ga0495596_0135555_157_405 78
641 3300046500 Ga0495596_0318428 Ga0495596_0318428_296_544 78
642 3300046506 Ga0495583_0237226 Ga0495583_0237226_186_434 78
643 3300046511 Ga0495608_0002394 Ga0495608_0002394_3844_4083 78
644 3300046511 Ga0495608_0042314 Ga0495608_0042314_2011_2250 78
645 3300046511 Ga0495608_0193870 Ga0495608_0193870_174_413 78
646 3300046513 Ga0495616_0220076 Ga0495616_0220076_128_376 78
647 3300046514 Ga0495618_0000832 Ga0495618_0000832_20232_20471 78
648 3300046514 Ga0495618_0088590 Ga0495618_0088590_1589_1828 78
649 3300046516 Ga0495628_0000066 Ga0495628_0000066_14454_14693 78
650 3300046516 Ga0495628_0282141 Ga0495628_0282141_359_598 78
651 3300046517 Ga0495630_0271871 Ga0495630_0271871_217_456 78
652 3300046518 Ga0495631_0108297 Ga0495631_0108297_681_929 78
653 3300046518 Ga0495631_0356589 Ga0495631_0356589_180_428 78
654 3300046523 Ga0495644_0091267 Ga0495644_0091267_508_756 78
655 3300046525 Ga0495663_0024879 Ga0495663_0024879_1160_1408 78
656 3300046525 Ga0495663_0058484 Ga0495663_0058484_913_1161 78
657 3300046528 Ga0495642_0021427 Ga0495642_0021427_2063_2311 78
658 3300046528 Ga0495642_0118521 Ga0495642_0118521_32_280 78
659 3300046529 Ga0495652_0000118 Ga0495652_0000118_14461_14700 78
660 3300046529 Ga0495652_0398270 Ga0495652_0398270_237_476 78
661 3300046535 Ga0495586_0175031 Ga0495586_0175031_702_941 78
662 3300046535 Ga0495586_0920010 Ga0495586_0920010_223_465 78
663 3300046536 Ga0495587_0001162 Ga0495587_0001162_2614_2853 78
664 3300046536 Ga0495587_0195143 Ga0495587_0195143_85_324 78
665 3300046536 Ga0495587_0398394 Ga0495587_0398394_425_664 78
666 3300046538 Ga0495609_0079699 Ga0495609_0079699_521_769 78
667 3300046543 Ga0495645_0000052 Ga0495645_0000052_70902_71141 78
668 3300046543 Ga0495645_0357767 Ga0495645_0357767_194_433 78
669 3300046559 Ga0495667_0043796 Ga0495667_0043796_1478_1717 78
670 3300046559 Ga0495667_0047887 Ga0495667_0047887_834_1073 78
671 3300046615 Ga0495656_0070394 Ga0495656_0070394_691_939 78
672 3300046616 Ga0495668_0089129 Ga0495668_0089129_1238_1486 78
673 3300046642 Ga0495634_0009599 Ga0495634_0009599_1776_2015 78
674 3300046642 Ga0495634_0147655 Ga0495634_0147655_353_592 78
675 3300046642 Ga0495634_0234040 Ga0495634_0234040_128_370 78
676 3300046642 Ga0495634_0637879 Ga0495634_0637879_268_504 78
677 3300046663 Ga0495635_0186492 Ga0495635_0186492_337_576 78
678 3300046664 Ga0495659_0056842 Ga0495659_0056842_1012_1260 78
679 3300046665 Ga0495661_0066017 Ga0495661_0066017_992_1240 78
680 3300046674 Ga0495588_0164349 Ga0495588_0164349_808_1056 78
681 3300046675 Ga0495657_0027126 Ga0495657_0027126_2740_2979 78
682 3300046675 Ga0495657_0414223 Ga0495657_0414223_161_400 78
683 3300046678 Ga0495599_0000046 Ga0495599_0000046_71007_71246 78
684 3300046678 Ga0495599_0344502 Ga0495599_0344502_549_788 78
685 3300046679 Ga0495623_0001356 Ga0495623_0001356_14462_14701 78
686 3300046679 Ga0495623_0250066 Ga0495623_0250066_58_297 78
687 3300046680 Ga0495646_0002939 Ga0495646_0002939_3823_4062 78
688 3300046681 Ga0495647_0036699 Ga0495647_0036699_361_603 78
689 3300046683 Ga0495658_1057622 Ga0495658_1057622_177_419 78
690 3300046690 Ga0495624_0124582 Ga0495624_0124582_785_1024 78
691 3300046690 Ga0495624_0608806 Ga0495624_0608806_218_457 78
692 3300046692 Ga0495671_0389918 Ga0495671_0389918_393_641 78
693 3300046794 Ga0495589_0015657 Ga0495589_0015657_2620_2868 78
694 3300046794 Ga0495589_0245831 Ga0495589_0245831_197_439 78
695 3300046809 Ga0495600_0154298 Ga0495600_0154298_980_1219 78
696 3300046809 Ga0495600_0307726 Ga0495600_0307726_518_757 78
697 3300047315 Ga0495581_0410793 Ga0495581_0410793_134_376 78
698 3300047317 Ga0495604_0000075 Ga0495604_0000075_70650_70889 78
699 3300047317 Ga0495604_0166789 Ga0495604_0166789_1265_1504 78
700 3300047318 Ga0495636_0596863 Ga0495636_0596863_96_344 78
701 3300047319 Ga0495674_0220969 Ga0495674_0220969_77_316 78
702 3300047319 Ga0495674_0252189 Ga0495674_0252189_509_748 78
703 3300047319 Ga0495674_0292541 Ga0495674_0292541_291_530 78
704 3300047319 Ga0495674_0350916 Ga0495674_0350916_427_666 78
705 3300047319 Ga0495674_0621157 Ga0495674_0621157_491_730 78
706 3300047322 Ga0495680_0007302 Ga0495680_0007302_8978_9217 78
707 3300047322 Ga0495680_0058384 Ga0495680_0058384_2121_2360 78
708 3300047322 Ga0495680_0903230 Ga0495680_0903230_202_441 78
709 3300047444 Ga0495675_0000705 Ga0495675_0000705_14486_14725 78
710 3300047444 Ga0495675_0085883 Ga0495675_0085883_816_1055 78
711 3300047447 Ga0495685_060342 Ga0495685_060342_378_626 78
712 3300047471 Ga0495684_0036579 Ga0495684_0036579_2854_3093 78
713 3300047471 Ga0495684_0793246 Ga0495684_0793246_214_453 78
714 3300047673 Ga0495593_0203457 Ga0495593_0203457_665_904 78
715 3300048088 Ga0495602_0002990 Ga0495602_0002990_14482_14721 78
716 3300048088 Ga0495602_0538266 Ga0495602_0538266_138_374 78
717 3300048903 Ga0496100_0622352 Ga0496100_0622352_337_582 78
718 3300048903 Ga0496100_0787960 Ga0496100_0787960_30_269 78
719 3300048903 Ga0496100_1172688 Ga0496100_1172688_132_377 78
720 3300048904 Ga0496101_0201903 Ga0496101_0201903_202_447 78
721 3300048904 Ga0496101_0492969 Ga0496101_0492969_555_794 78
722 3300048904 Ga0496101_1427724 Ga0496101_1427724_247_489 78
723 3300048905 Ga0496102_0086584 Ga0496102_0086584_621_872 78
724 3300048905 Ga0496102_0181644 Ga0496102_0181644_33_287 78
725 3300048906 Ga0496103_0192875 Ga0496103_0192875_199_453 78
726 3300048907 Ga0496104_0328289 Ga0496104_0328289_933_1178 78
727 3300048907 Ga0496104_0423607 Ga0496104_0423607_196_438 78
728 3300048907 Ga0496104_0457095 Ga0496104_0457095_329_568 78
729 3300048908 Ga0496105_0084762 Ga0496105_0084762_387_629 78
730 3300048908 Ga0496105_0400410 Ga0496105_0400410_53_298 78
731 3300048909 Ga0496106_0409389 Ga0496106_0409389_709_954 78
732 3300048909 Ga0496106_1077996 Ga0496106_1077996_310_555 78
733 3300048909 Ga0496106_1539609 Ga0496106_1539609_36_278 78
734 3300048910 Ga0496107_0309572 Ga0496107_0309572_710_952 78
735 3300048910 Ga0496107_0971406 Ga0496107_0971406_193_435 78
736 3300048910 Ga0496107_1070092 Ga0496107_1070092_295_540 78
737 3300048911 Ga0496108_0022352 Ga0496108_0022352_2504_2743 78
738 3300048911 Ga0496108_0059522 Ga0496108_0059522_702_947 78
739 3300048911 Ga0496108_0074390 Ga0496108_0074390_12_254 78
740 3300048911 Ga0496108_0138184 Ga0496108_0138184_1555_1800 78
741 3300048911 Ga0496108_0803076 Ga0496108_0803076_388_630 78
742 3300048911 Ga0496108_1101042 Ga0496108_1101042_60_299 78
743 3300048912 Ga0496109_0247909 Ga0496109_0247909_216_461 78
744 3300048912 Ga0496109_0263204 Ga0496109_0263204_776_1018 78
745 3300048912 Ga0496109_0773130 Ga0496109_0773130_140_379 78
746 3300048913 Ga0496110_0176158 Ga0496110_0176158_43_288 78
747 3300048913 Ga0496110_0248008 Ga0496110_0248008_408_650 78
748 3300048913 Ga0496110_0458235 Ga0496110_0458235_283_525 78
749 3300048913 Ga0496110_0796333 Ga0496110_0796333_400_645 78
750 3300048913 Ga0496110_0956589 Ga0496110_0956589_265_513 78
751 3300048913 Ga0496110_0985052 Ga0496110_0985052_302_547 78
752 3300048913 Ga0496110_1313119 Ga0496110_1313119_258_506 78
753 3300048914 Ga0496111_0212914 Ga0496111_0212914_876_1121 78
754 3300048914 Ga0496111_0332406 Ga0496111_0332406_231_473 78
755 3300048914 Ga0496111_0578302 Ga0496111_0578302_359_598 78
756 3300048915 Ga0496112_0000293 Ga0496112_0000293_18180_18422 78
757 3300048915 Ga0496112_0790703 Ga0496112_0790703_339_584 78
758 3300048916 Ga0496113_0243658 Ga0496113_0243658_874_1119 78
759 3300048916 Ga0496113_0396456 Ga0496113_0396456_779_1021 78
760 3300048916 Ga0496113_0416035 Ga0496113_0416035_295_540 78
761 3300048916 Ga0496113_0735353 Ga0496113_0735353_498_737 78
762 3300048917 Ga0496114_0102177 Ga0496114_0102177_1872_2111 78
763 3300048917 Ga0496114_0495863 Ga0496114_0495863_118_360 78
764 3300049568 Ga0501031_0000336 Ga0501031_0000336_18173_18421 78
765 3300049568 Ga0501031_0003836 Ga0501031_0003836_7487_7729 78
766 3300049568 Ga0501031_0232168 Ga0501031_0232168_586_834 78
767 3300049568 Ga0501031_0336455 Ga0501031_0336455_400_648 78
768 3300049568 Ga0501031_0786328 Ga0501031_0786328_47_292 78
769 3300049569 Ga0501032_0002775 Ga0501032_0002775_4596_4844 78
770 3300049569 Ga0501032_0026680 Ga0501032_0026680_1462_1704 78
771 3300049569 Ga0501032_0155787 Ga0501032_0155787_441_689 78
772 3300049570 Ga0501033_0000239 Ga0501033_0000239_43785_44033 78
773 3300049570 Ga0501033_0037937 Ga0501033_0037937_1521_1763 78
774 3300049570 Ga0501033_0269747 Ga0501033_0269747_54_302 78
775 3300049570 Ga0501033_0423147 Ga0501033_0423147_327_575 78
776 3300049571 Ga0501034_0050743 Ga0501034_0050743_255_494 78
777 3300049571 Ga0501034_0051397 Ga0501034_0051397_1622_1870 78
778 3300049571 Ga0501034_0356250 Ga0501034_0356250_655_897 78
779 3300049571 Ga0501034_1095400 Ga0501034_1095400_190_438 78
780 3300049572 Ga0501036_0000107 Ga0501036_0000107_8797_9045 78
781 3300049572 Ga0501036_0003875 Ga0501036_0003875_5859_6107 78
782 3300049572 Ga0501036_0017006 Ga0501036_0017006_2690_2932 78
783 3300049572 Ga0501036_0810230 Ga0501036_0810230_59_295 78
784 3300049572 Ga0501036_0835538 Ga0501036_0835538_164_412 78
785 3300049573 Ga0501037_0002426 Ga0501037_0002426_8156_8404 78
786 3300049573 Ga0501037_0007718 Ga0501037_0007718_6089_6331 78
787 3300049573 Ga0501037_0298950 Ga0501037_0298950_359_607 78
788 3300049574 Ga0501038_0000367 Ga0501038_0000367_34314_34562 78
789 3300049574 Ga0501038_0020533 Ga0501038_0020533_3010_3252 78
790 3300049574 Ga0501038_0057518 Ga0501038_0057518_1814_2062 78
791 3300049575 Ga0501039_0001687 Ga0501039_0001687_7234_7482 78
792 3300049575 Ga0501039_0005193 Ga0501039_0005193_6783_7025 78
793 3300049575 Ga0501039_0204975 Ga0501039_0204975_801_1049 78
794 3300049575 Ga0501039_0400736 Ga0501039_0400736_16_264 78
795 3300049576 Ga0501040_0002117 Ga0501040_0002117_3754_4002 78
796 3300049576 Ga0501040_0003511 Ga0501040_0003511_4203_4451 78
797 3300049576 Ga0501040_0009653 Ga0501040_0009653_3509_3757 78
798 3300049576 Ga0501040_0032657 Ga0501040_0032657_1160_1408 78
799 3300049576 Ga0501040_0038291 Ga0501040_0038291_794_1036 78
800 3300049576 Ga0501040_0132277 Ga0501040_0132277_753_1001 78
801 3300049576 Ga0501040_0279125 Ga0501040_0279125_258_494 78
802 3300049576 Ga0501040_0342477 Ga0501040_0342477_646_888 78
803 3300049576 Ga0501040_0378986 Ga0501040_0378986_240_491 78
804 3300049576 Ga0501040_0442439 Ga0501040_0442439_56_304 78
805 3300049576 Ga0501040_0901522 Ga0501040_0901522_153_395 78
806 3300049577 Ga0501041_0000011 Ga0501041_0000011_49685_49933 78
807 3300049577 Ga0501041_0018083 Ga0501041_0018083_1680_1922 78
808 3300049577 Ga0501041_0054200 Ga0501041_0054200_1893_2141 78
809 3300049577 Ga0501041_0064201 Ga0501041_0064201_212_460 78
810 3300049577 Ga0501041_0084635 Ga0501041_0084635_711_959 78
811 3300049578 Ga0501042_0000956 Ga0501042_0000956_8797_9045 78
812 3300049578 Ga0501042_0010432 Ga0501042_0010432_4274_4522 78
813 3300049578 Ga0501042_0011243 Ga0501042_0011243_4138_4380 78
814 3300049578 Ga0501042_0038064 Ga0501042_0038064_2724_2972 78
815 3300049578 Ga0501042_0549701 Ga0501042_0549701_227_463 78
816 3300049578 Ga0501042_0606232 Ga0501042_0606232_55_300 78
817 3300049579 Ga0501043_0000477 Ga0501043_0000477_8797_9045 78
818 3300049579 Ga0501043_0051175 Ga0501043_0051175_1453_1695 78
819 3300049579 Ga0501043_0070198 Ga0501043_0070198_2026_2274 78
820 3300049579 Ga0501043_0273761 Ga0501043_0273761_729_977 78
821 3300049580 Ga0501046_0001077 Ga0501046_0001077_8797_9045 78
822 3300049580 Ga0501046_0024131 Ga0501046_0024131_4241_4483 78
823 3300049580 Ga0501046_0025741 Ga0501046_0025741_2078_2326 78
824 3300049580 Ga0501046_0058485 Ga0501046_0058485_789_1037 78
825 3300049580 Ga0501046_0070562 Ga0501046_0070562_536_778 78
826 3300049580 Ga0501046_0118241 Ga0501046_0118241_790_1026 78
827 3300049580 Ga0501046_0588119 Ga0501046_0588119_407_667 78
828 3300049580 Ga0501046_1108360 Ga0501046_1108360_190_438 78
829 3300049581 Ga0501047_0000743 Ga0501047_0000743_24964_25212 78
830 3300049581 Ga0501047_0351479 Ga0501047_0351479_1017_1256 78
831 3300049581 Ga0501047_0506613 Ga0501047_0506613_234_476 78
832 3300049582 Ga0501048_0000339 Ga0501048_0000339_23241_23489 78
833 3300049582 Ga0501048_0017103 Ga0501048_0017103_2319_2561 78
834 3300049582 Ga0501048_0033807 Ga0501048_0033807_3184_3432 78
835 3300049582 Ga0501048_0394608 Ga0501048_0394608_35_283 78
836 3300049582 Ga0501048_0822432 Ga0501048_0822432_243_491 78
837 3300049582 Ga0501048_1409981 Ga0501048_1409981_146_394 78
838 3300049583 Ga0501067_0042145 Ga0501067_0042145_263_517 78
839 3300049583 Ga0501067_0074363 Ga0501067_0074363_1366_1605 78
840 3300049584 Ga0501068_0000241 Ga0501068_0000241_17720_17968 78
841 3300049584 Ga0501068_0035098 Ga0501068_0035098_58_300 78
842 3300049584 Ga0501068_0080064 Ga0501068_0080064_1547_1795 78
843 3300049584 Ga0501068_1175376 Ga0501068_1175376_112_354 78
844 3300049585 Ga0501069_0001803 Ga0501069_0001803_8797_9045 78
845 3300049585 Ga0501069_0005142 Ga0501069_0005142_1195_1449 78
846 3300049585 Ga0501069_0040222 Ga0501069_0040222_2109_2369 78
847 3300049585 Ga0501069_0382141 Ga0501069_0382141_348_596 78
848 3300049586 Ga0501070_0002434 Ga0501070_0002434_8911_9159 78
849 3300049586 Ga0501070_0029175 Ga0501070_0029175_1570_1812 78
850 3300049586 Ga0501070_0168950 Ga0501070_0168950_508_756 78
851 3300049586 Ga0501070_0170893 Ga0501070_0170893_929_1168 78
852 3300049586 Ga0501070_0442366 Ga0501070_0442366_604_864 78
853 3300049586 Ga0501070_0887159 Ga0501070_0887159_93_347 78
854 3300049587 Ga0501071_0000208 Ga0501071_0000208_8797_9045 78
855 3300049587 Ga0501071_0013896 Ga0501071_0013896_973_1221 78
856 3300049587 Ga0501071_0044818 Ga0501071_0044818_2803_3045 78
857 3300049587 Ga0501071_0137599 Ga0501071_0137599_1469_1714 78
858 3300049587 Ga0501071_0244787 Ga0501071_0244787_94_342 78
859 3300049587 Ga0501071_0416725 Ga0501071_0416725_750_992 78
860 3300049587 Ga0501071_1340349 Ga0501071_1340349_53_301 78
861 3300049588 Ga0501072_0000561 Ga0501072_0000561_8797_9045 78
862 3300049588 Ga0501072_0005900 Ga0501072_0005900_8870_9118 78
863 3300049588 Ga0501072_0007361 Ga0501072_0007361_2088_2330 78
864 3300049588 Ga0501072_0036282 Ga0501072_0036282_1473_1721 78
865 3300049588 Ga0501072_0056996 Ga0501072_0056996_867_1115 78
866 3300049588 Ga0501072_0259981 Ga0501072_0259981_144_392 78
867 3300049588 Ga0501072_1543132 Ga0501072_1543132_18_263 78
868 3300049589 Ga0501073_0004141 Ga0501073_0004141_3400_3648 78
869 3300049589 Ga0501073_0006396 Ga0501073_0006396_6565_6804 78
870 3300049589 Ga0501073_0015245 Ga0501073_0015245_4784_5026 78
871 3300049589 Ga0501073_1198392 Ga0501073_1198392_262_510 78
872 3300049590 Ga0501074_0000158 Ga0501074_0000158_8797_9045 78
873 3300049590 Ga0501074_0010003 Ga0501074_0010003_2585_2827 78
874 3300049590 Ga0501074_0028216 Ga0501074_0028216_94_342 78
875 3300049590 Ga0501074_0044191 Ga0501074_0044191_1444_1683 78
876 3300049590 Ga0501074_0126067 Ga0501074_0126067_391_639 78
877 3300049590 Ga0501074_0145113 Ga0501074_0145113_489_731 78
878 3300049590 Ga0501074_0246021 Ga0501074_0246021_267_527 78
879 3300049591 Ga0501075_0000556 Ga0501075_0000556_4613_4861 78
880 3300049591 Ga0501075_0007488 Ga0501075_0007488_4858_5106 78
881 3300049591 Ga0501075_0008178 Ga0501075_0008178_257_499 78
882 3300049591 Ga0501075_0033340 Ga0501075_0033340_1357_1605 78
883 3300049591 Ga0501075_0099300 Ga0501075_0099300_1677_1925 78
884 3300049591 Ga0501075_0258764 Ga0501075_0258764_516_758 78
885 3300049591 Ga0501075_0323447 Ga0501075_0323447_235_483 78
886 3300049591 Ga0501075_0325181 Ga0501075_0325181_443_688 78
887 3300049591 Ga0501075_0616422 Ga0501075_0616422_187_435 78
888 3300049591 Ga0501075_1257106 Ga0501075_1257106_60_296 78
889 3300049592 Ga0501076_0000289 Ga0501076_0000289_26639_26887 78
890 3300049592 Ga0501076_0004159 Ga0501076_0004159_9002_9250 78
891 3300049592 Ga0501076_0008407 Ga0501076_0008407_5590_5838 78
892 3300049592 Ga0501076_0009583 Ga0501076_0009583_4241_4483 78
893 3300049592 Ga0501076_0020823 Ga0501076_0020823_544_792 78
894 3300049592 Ga0501076_0186225 Ga0501076_0186225_1272_1520 78
895 3300049592 Ga0501076_0783056 Ga0501076_0783056_485_730 78
896 3300049592 Ga0501076_0902275 Ga0501076_0902275_369_614 78
897 3300049593 Ga0501077_0000371 Ga0501077_0000371_17763_18011 78
898 3300049593 Ga0501077_0003869 Ga0501077_0003869_134_379 78
899 3300049593 Ga0501077_0005270 Ga0501077_0005270_5418_5666 78
900 3300049593 Ga0501077_0011683 Ga0501077_0011683_4144_4386 78
901 3300049593 Ga0501077_0057129 Ga0501077_0057129_1858_2106 78
902 3300049593 Ga0501077_0484242 Ga0501077_0484242_303_542 78
903 3300049741 Ga0501079_0000053 Ga0501079_0000053_42027_42275 78
904 3300049741 Ga0501079_0005980 Ga0501079_0005980_4758_5006 78
905 3300049741 Ga0501079_0032307 Ga0501079_0032307_2839_3081 78
906 3300049741 Ga0501079_0144682 Ga0501079_0144682_1163_1411 78
907 3300049741 Ga0501079_0156699 Ga0501079_0156699_378_614 78
908 3300049741 Ga0501079_0171377 Ga0501079_0171377_1276_1524 78
909 3300049741 Ga0501079_0281079 Ga0501079_0281079_49_291 78
910 3300049741 Ga0501079_0882168 Ga0501079_0882168_261_500 78
911 3300049742 Ga0501080_0000136 Ga0501080_0000136_8796_9044 78
912 3300049742 Ga0501080_0018701 Ga0501080_0018701_2558_2797 78
913 3300049742 Ga0501080_0039262 Ga0501080_0039262_4142_4384 78
914 3300049742 Ga0501080_0226816 Ga0501080_0226816_732_980 78
915 3300049742 Ga0501080_0252691 Ga0501080_0252691_1308_1556 78
916 3300049742 Ga0501080_0389757 Ga0501080_0389757_598_849 78
917 3300049743 Ga0501081_0000025 Ga0501081_0000025_49685_49933 78
918 3300049743 Ga0501081_0018256 Ga0501081_0018256_1008_1256 78
919 3300049743 Ga0501081_0018414 Ga0501081_0018414_236_478 78
920 3300049743 Ga0501081_0021016 Ga0501081_0021016_1889_2137 78
921 3300049743 Ga0501081_0021111 Ga0501081_0021111_1217_1459 78
922 3300049743 Ga0501081_0081074 Ga0501081_0081074_1914_2162 78
923 3300049743 Ga0501081_0616417 Ga0501081_0616417_501_743 78
924 3300049743 Ga0501081_0830194 Ga0501081_0830194_103_348 78
925 3300049743 Ga0501081_1154503 Ga0501081_1154503_282_518 78
926 3300049744 Ga0501083_0000234 Ga0501083_0000234_26639_26887 78
927 3300049744 Ga0501083_0023011 Ga0501083_0023011_2540_2782 78
928 3300049744 Ga0501083_0176130 Ga0501083_0176130_736_984 78
929 3300049822 Ga0501035_0002443 Ga0501035_0002443_7234_7482 78
930 3300049822 Ga0501035_0016946 Ga0501035_0016946_1510_1752 78
931 3300049822 Ga0501035_0047089 Ga0501035_0047089_196_444 78
932 3300049822 Ga0501035_0648188 Ga0501035_0648188_431_679 78
933 3300049822 Ga0501035_0811104 Ga0501035_0811104_229_489 78
934 3300049823 Ga0501044_0011199 Ga0501044_0011199_7154_7402 78
935 3300049823 Ga0501044_0192855 Ga0501044_0192855_1576_1818 78
936 3300049823 Ga0501044_0617968 Ga0501044_0617968_348_596 78
937 3300049824 Ga0501045_0000035 Ga0501045_0000035_49685_49933 78
938 3300049824 Ga0501045_0006706 Ga0501045_0006706_5532_5780 78
939 3300049824 Ga0501045_0007494 Ga0501045_0007494_2568_2816 78
940 3300049824 Ga0501045_0028863 Ga0501045_0028863_2454_2702 78
941 3300049824 Ga0501045_0052735 Ga0501045_0052735_35_277 78
942 3300049824 Ga0501045_0202700 Ga0501045_0202700_124_372 78
943 3300049824 Ga0501045_0268074 Ga0501045_0268074_380_622 78
944 3300049824 Ga0501045_1095392 Ga0501045_1095392_48_293 78
945 3300050489 nmdc:mga03683_40278_c1 nmdc:mga03683_40278_c1_1520_1765 78
946 3300050491 nmdc:mga00v17_76312_c2 nmdc:mga00v17_76312_c2_122_367 78
947 3300050492 nmdc:mga0yw44_494445_c1 nmdc:mga0yw44_494445_c1_548_793 78
948 3300050492 nmdc:mga0yw44_53232_c1 nmdc:mga0yw44_53232_c1_1915_2160 78
949 3300050507 nmdc:mga05p37_112379_c1 nmdc:mga05p37_112379_c1_1671_1913 78
950 3300050507 nmdc:mga05p37_312392_c1 nmdc:mga05p37_312392_c1_23_268 78
951 3300050507 nmdc:mga05p37_394911_c1 nmdc:mga05p37_394911_c1_376_621 78
952 3300050507 nmdc:mga05p37_458916_c1 nmdc:mga05p37_458916_c1_574_810 78
953 3300050507 nmdc:mga05p37_5244_c1 nmdc:mga05p37_5244_c1_2608_2850 78
954 3300050507 nmdc:mga05p37_607108_c1 nmdc:mga05p37_607108_c1_36_287 78
955 3300050507 nmdc:mga05p37_613465_c1 nmdc:mga05p37_613465_c1_932_1177 78
956 3300050507 nmdc:mga05p37_7995_c1 nmdc:mga05p37_7995_c1_11099_11347 78
957 3300050507 nmdc:mga05p37_918245_c1 nmdc:mga05p37_918245_c1_411_659 78
958 3300050508 nmdc:mga09592_352237_c1 nmdc:mga09592_352237_c1_296_538 78
959 3300050508 nmdc:mga09592_39609_c1 nmdc:mga09592_39609_c1_867_1115 78
960 3300050508 nmdc:mga09592_41989_c1 nmdc:mga09592_41989_c1_2226_2471 78
961 3300050508 nmdc:mga09592_572036_c1 nmdc:mga09592_572036_c1_478_723 78
962 3300050509 nmdc:mga0qj67_1038301_c1 nmdc:mga0qj67_1038301_c1_281_523 78
963 3300050509 nmdc:mga0qj67_127956_c1 nmdc:mga0qj67_127956_c1_1661_1906 78
964 3300050509 nmdc:mga0qj67_134289_c1 nmdc:mga0qj67_134289_c1_1140_1388 78
965 3300050509 nmdc:mga0qj67_619383_c1 nmdc:mga0qj67_619383_c1_518_763 78
966 3300050510 nmdc:mga06r32_118641_c1 nmdc:mga06r32_118641_c1_2076_2324 78
967 3300050510 nmdc:mga06r32_123940_c1 nmdc:mga06r32_123940_c1_1933_2175 78
968 3300050510 nmdc:mga06r32_330555_c1 nmdc:mga06r32_330555_c1_237_482 78
969 3300050510 nmdc:mga06r32_506676_c1 nmdc:mga06r32_506676_c1_78_323 78
970 3300050510 nmdc:mga06r32_81305_c1 nmdc:mga06r32_81305_c1_2100_2351 78
971 3300050511 nmdc:mga08y16_312921_c1 nmdc:mga08y16_312921_c1_685_930 78
972 3300050511 nmdc:mga08y16_857164_c1 nmdc:mga08y16_857164_c1_577_828 78
973 3300050512 nmdc:mga0n895_131116_c1 nmdc:mga0n895_131116_c1_2246_2491 78
974 3300050513 nmdc:mga0rr50_798360_c1 nmdc:mga0rr50_798360_c1_363_605 78
975 3300050513 nmdc:mga0rr50_849212_c1 nmdc:mga0rr50_849212_c1_140_385 78
976 3300050514 nmdc:mga08x19_1144723_c1 nmdc:mga08x19_1144723_c1_254_508 78
977 3300050514 nmdc:mga08x19_282390_c1 nmdc:mga08x19_282390_c1_13_258 78
978 3300050515 nmdc:mga0a205_1291802_c1 nmdc:mga0a205_1291802_c1_223_468 78
979 3300050515 nmdc:mga0a205_577679_c1 nmdc:mga0a205_577679_c1_186_428 78
980 3300053077 Ga0495601_0000486 Ga0495601_0000486_14482_14721 78
981 3300053077 Ga0495601_0661634 Ga0495601_0661634_34_273 78
982 3300053077 Ga0495601_1009168 Ga0495601_1009168_55_294 78
983 3300053078 Ga0495612_0040143 Ga0495612_0040143_159_398 78
984 3300053084 Ga0495595_0004782 Ga0495595_0004782_2219_2458 78
985 3300053084 Ga0495595_0246750 Ga0495595_0246750_140_379 78
986 3300053085 Ga0495619_0000123 Ga0495619_0000123_25873_26112 78
987 3300053085 Ga0495619_0746576 Ga0495619_0746576_111_350 78
988 3300054114 Ga0501084_0000336 Ga0501084_0000336_8797_9045 78
989 3300054114 Ga0501084_0009395 Ga0501084_0009395_3087_3335 78
990 3300054114 Ga0501084_0020135 Ga0501084_0020135_1782_2030 78
991 3300054114 Ga0501084_0084799 Ga0501084_0084799_1443_1679 78
992 3300054114 Ga0501084_0140611 Ga0501084_0140611_234_476 78
993 3300054114 Ga0501084_0410508 Ga0501084_0410508_43_291 78
994 3300054114 Ga0501084_1525387 Ga0501084_1525387_43_294 78
995 3300059423 Ga0590074_008703 Ga0590074_008703_1013_1258 78
996 3300059424 Ga0590075_024188 Ga0590075_024188_973_1218 78
997 3300060353 Ga0501082_0001222 Ga0501082_0001222_17720_17968 78
998 3300060353 Ga0501082_0004941 Ga0501082_0004941_9235_9477 78
999 3300060353 Ga0501082_0036548 Ga0501082_0036548_3939_4187 78
1000 3300060353 Ga0501082_0111071 Ga0501082_0111071_1408_1656 78
1001 3300060353 Ga0501082_0283114 Ga0501082_0283114_984_1226 78
1002 3300060353 Ga0501082_0309957 Ga0501082_0309957_139_387 78
1003 3300060353 Ga0501082_0347620 Ga0501082_0347620_798_1043 78
1004 3300061719 Ga0466962_0175215 Ga0466962_0175215_134_388 78
1005 3300061734 Ga0530510_0000445 Ga0530510_0000445_8797_9045 78
1006 3300061734 Ga0530510_0008684 Ga0530510_0008684_4144_4386 78
1007 3300061734 Ga0530510_0011273 Ga0530510_0011273_3823_4071 78
1008 3300061734 Ga0530510_0040426 Ga0530510_0040426_2313_2561 78
1009 3300061734 Ga0530510_0221034 Ga0530510_0221034_642_884 78
1010 3300061734 Ga0530510_0242848 Ga0530510_0242848_1066_1317 78
1011 3300061734 Ga0530510_1569658 Ga0530510_1569658_208_444 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

78

0.98

Feature Viewer

pLDDT pTM Quality
80.41 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map