F488138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1011 | 383 | 1011 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10942200|Ga0075433_109422002 |
| Length | 81 |
| Sequence | MRATVLVRPKPGILDPQGEAVESSLRQLGFAVEGARIGRVVDLELAEDGDPDQARAELERMCEQLLANPLIESYEITVSPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 235 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 236 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 237 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 240 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 241 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 242 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 243 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0 |
| Rhizoplane | 5.44 |
| Rhizosphere | 93.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10251041 | 3300003203 | Bacteria | 520 |
| 2 | JGI25407J50210_10002049 | 3300003373 | Bacteria | 4700 |
| 3 | JGI25407J50210_10008089 | 3300003373 | Bacteria | 2647 |
| 4 | JGI25407J50210_10021986 | 3300003373 | Bacteria | 1658 |
| 5 | Ga0070658_10041042 | 3300005327 | Bacteria | 3733 |
| 6 | Ga0070658_10071609 | 3300005327 | Bacteria | 2839 |
| 7 | Ga0070676_10147255 | 3300005328 | Bacteria | 1504 |
| 8 | Ga0070676_10199909 | 3300005328 | Bacteria | 1310 |
| 9 | Ga0070683_100032146 | 3300005329 | Bacteria | 4776 |
| 10 | Ga0070683_100134534 | 3300005329 | Bacteria | 2341 |
| 11 | Ga0070683_100232524 | 3300005329 | Bacteria | 1752 |
| 12 | Ga0070683_100642644 | 3300005329 | Bacteria | 1016 |
| 13 | Ga0070683_101246098 | 3300005329 | Bacteria | 715 |
| 14 | Ga0070690_100061860 | 3300005330 | Bacteria | 2413 |
| 15 | Ga0070690_100154933 | 3300005330 | Bacteria | 1566 |
| 16 | Ga0070670_100012063 | 3300005331 | Bacteria | 7394 |
| 17 | Ga0070677_10598854 | 3300005333 | Bacteria | 610 |
| 18 | Ga0070680_100372708 | 3300005336 | Bacteria | 1215 |
| 19 | Ga0070680_100422080 | 3300005336 | Bacteria | 1138 |
| 20 | Ga0068868_100009800 | 3300005338 | Bacteria | 6912 |
| 21 | Ga0068868_100199714 | 3300005338 | Bacteria | 1666 |
| 22 | Ga0070660_100036640 | 3300005339 | Bacteria | 3716 |
| 23 | Ga0070660_100089448 | 3300005339 | Bacteria | 2426 |
| 24 | Ga0070660_100099996 | 3300005339 | Bacteria | 2296 |
| 25 | Ga0070660_100105678 | 3300005339 | Bacteria | 2235 |
| 26 | Ga0070660_100105719 | 3300005339 | Bacteria | 2234 |
| 27 | Ga0070689_100086408 | 3300005340 | Bacteria | 2467 |
| 28 | Ga0070691_10112593 | 3300005341 | Bacteria | 1363 |
| 29 | Ga0070687_100837323 | 3300005343 | Bacteria | 655 |
| 30 | Ga0070687_100934801 | 3300005343 | Bacteria | 624 |
| 31 | Ga0070661_100073267 | 3300005344 | Bacteria | 2521 |
| 32 | Ga0070661_101279068 | 3300005344 | Bacteria | 615 |
| 33 | Ga0070692_10031854 | 3300005345 | Bacteria | 2646 |
| 34 | Ga0070692_10212574 | 3300005345 | Bacteria | 1139 |
| 35 | Ga0070668_100067168 | 3300005347 | Bacteria | 2785 |
| 36 | Ga0070668_100245341 | 3300005347 | Bacteria | 1485 |
| 37 | Ga0070668_100711714 | 3300005347 | Bacteria | 886 |
| 38 | Ga0070669_100140917 | 3300005353 | Bacteria | 1859 |
| 39 | Ga0070669_100190141 | 3300005353 | Bacteria | 1610 |
| 40 | Ga0070675_100036720 | 3300005354 | Bacteria | 3989 |
| 41 | Ga0070675_100218778 | 3300005354 | Bacteria | 1658 |
| 42 | Ga0070671_100024149 | 3300005355 | Bacteria | 4976 |
| 43 | Ga0070674_100052243 | 3300005356 | Bacteria | 2819 |
| 44 | Ga0070674_100063864 | 3300005356 | Bacteria | 2578 |
| 45 | Ga0070674_101424588 | 3300005356 | Bacteria | 621 |
| 46 | Ga0070673_100078689 | 3300005364 | Bacteria | 2668 |
| 47 | Ga0070673_100979575 | 3300005364 | Bacteria | 787 |
| 48 | Ga0070688_100038915 | 3300005365 | Bacteria | 2907 |
| 49 | Ga0070688_100501513 | 3300005365 | Bacteria | 915 |
| 50 | Ga0070659_100114457 | 3300005366 | Bacteria | 2179 |
| 51 | Ga0070659_100195315 | 3300005366 | Bacteria | 1664 |
| 52 | Ga0070659_101740276 | 3300005366 | Bacteria | 558 |
| 53 | Ga0070667_100094096 | 3300005367 | Bacteria | 2581 |
| 54 | Ga0070703_10479389 | 3300005406 | Bacteria | 556 |
| 55 | Ga0070714_101183168 | 3300005435 | Bacteria | 746 |
| 56 | Ga0070714_101580110 | 3300005435 | Bacteria | 641 |
| 57 | Ga0070714_101958207 | 3300005435 | Bacteria | 572 |
| 58 | Ga0070713_100908720 | 3300005436 | Bacteria | 847 |
| 59 | Ga0070701_10001787 | 3300005438 | Bacteria | 8122 |
| 60 | Ga0070701_10026825 | 3300005438 | Bacteria | 2814 |
| 61 | Ga0070711_100851545 | 3300005439 | Bacteria | 776 |
| 62 | Ga0070705_100068894 | 3300005440 | Bacteria | 2131 |
| 63 | Ga0070705_100383658 | 3300005440 | Bacteria | 1035 |
| 64 | Ga0070700_100040890 | 3300005441 | Bacteria | 2840 |
| 65 | Ga0070700_100075514 | 3300005441 | Bacteria | 2162 |
| 66 | Ga0070694_100030536 | 3300005444 | Bacteria | 3526 |
| 67 | Ga0070708_100366985 | 3300005445 | Bacteria | 1357 |
| 68 | Ga0070708_100478703 | 3300005445 | Bacteria | 1175 |
| 69 | Ga0070708_100797351 | 3300005445 | Bacteria | 888 |
| 70 | Ga0070708_101703692 | 3300005445 | Bacteria | 586 |
| 71 | Ga0070708_101764047 | 3300005445 | Bacteria | 575 |
| 72 | Ga0070663_100841179 | 3300005455 | Bacteria | 789 |
| 73 | Ga0070678_100005514 | 3300005456 | Bacteria | 7329 |
| 74 | Ga0070678_100092857 | 3300005456 | Bacteria | 2319 |
| 75 | Ga0070678_100852907 | 3300005456 | Bacteria | 830 |
| 76 | Ga0070662_100039085 | 3300005457 | Bacteria | 3374 |
| 77 | Ga0070662_100376434 | 3300005457 | Bacteria | 1168 |
| 78 | Ga0070662_100678086 | 3300005457 | Bacteria | 871 |
| 79 | Ga0070662_101065520 | 3300005457 | Bacteria | 693 |
| 80 | Ga0070662_101890230 | 3300005457 | Bacteria | 516 |
| 81 | Ga0070681_10025676 | 3300005458 | Bacteria | 5925 |
| 82 | Ga0070681_10123201 | 3300005458 | Bacteria | 2525 |
| 83 | Ga0068867_100131752 | 3300005459 | Bacteria | 1944 |
| 84 | Ga0068867_100379120 | 3300005459 | Bacteria | 1187 |
| 85 | Ga0068867_100818565 | 3300005459 | Bacteria | 832 |
| 86 | Ga0068867_102100627 | 3300005459 | Bacteria | 535 |
| 87 | Ga0070685_10226471 | 3300005466 | Bacteria | 1227 |
| 88 | Ga0070685_10415609 | 3300005466 | Bacteria | 935 |
| 89 | Ga0070706_100091147 | 3300005467 | Bacteria | 2827 |
| 90 | Ga0070706_100171522 | 3300005467 | Bacteria | 2026 |
| 91 | Ga0070706_100772320 | 3300005467 | Bacteria | 890 |
| 92 | Ga0070706_100840711 | 3300005467 | Bacteria | 849 |
| 93 | Ga0070706_101483282 | 3300005467 | Bacteria | 620 |
| 94 | Ga0070706_101527819 | 3300005467 | Bacteria | 610 |
| 95 | Ga0070707_100123638 | 3300005468 | Bacteria | 2513 |
| 96 | Ga0070707_100148135 | 3300005468 | Bacteria | 2285 |
| 97 | Ga0070707_100927155 | 3300005468 | Bacteria | 836 |
| 98 | Ga0070698_100095830 | 3300005471 | Bacteria | 2944 |
| 99 | Ga0070698_100154464 | 3300005471 | Bacteria | 2241 |
| 100 | Ga0070698_100263584 | 3300005471 | Bacteria | 1655 |
| 101 | Ga0070698_100484592 | 3300005471 | Bacteria | 1174 |
| 102 | Ga0070698_101774881 | 3300005471 | Bacteria | 570 |
| 103 | Ga0070699_100013074 | 3300005518 | Bacteria | 7153 |
| 104 | Ga0070699_100166587 | 3300005518 | Bacteria | 1952 |
| 105 | Ga0070699_100414704 | 3300005518 | Bacteria | 1218 |
| 106 | Ga0070679_100137802 | 3300005530 | Bacteria | 2421 |
| 107 | Ga0070679_101720338 | 3300005530 | Bacteria | 575 |
| 108 | Ga0070684_100006063 | 3300005535 | Bacteria | 9316 |
| 109 | Ga0070684_100025466 | 3300005535 | Bacteria | 4974 |
| 110 | Ga0070684_100562471 | 3300005535 | Bacteria | 1059 |
| 111 | Ga0068853_100476887 | 3300005539 | Bacteria | 1176 |
| 112 | Ga0068853_100507827 | 3300005539 | Bacteria | 1139 |
| 113 | Ga0068853_100856668 | 3300005539 | Bacteria | 872 |
| 114 | Ga0068853_102350427 | 3300005539 | Bacteria | 516 |
| 115 | Ga0070672_100108172 | 3300005543 | Bacteria | 2263 |
| 116 | Ga0070672_101562316 | 3300005543 | Bacteria | 592 |
| 117 | Ga0070686_100021879 | 3300005544 | Bacteria | 3805 |
| 118 | Ga0070686_100053536 | 3300005544 | Bacteria | 2577 |
| 119 | Ga0070695_100000253 | 3300005545 | Bacteria | 26811 |
| 120 | Ga0070695_100091853 | 3300005545 | Bacteria | 2028 |
| 121 | Ga0070696_100008304 | 3300005546 | Bacteria | 6948 |
| 122 | Ga0070696_100364690 | 3300005546 | Bacteria | 1122 |
| 123 | Ga0070693_100155242 | 3300005547 | Bacteria | 1453 |
| 124 | Ga0070693_100744076 | 3300005547 | Bacteria | 722 |
| 125 | Ga0070665_100097278 | 3300005548 | Bacteria | 2948 |
| 126 | Ga0070704_100819874 | 3300005549 | Bacteria | 832 |
| 127 | Ga0070704_101517744 | 3300005549 | Bacteria | 616 |
| 128 | Ga0070704_102015718 | 3300005549 | Bacteria | 536 |
| 129 | Ga0070704_102314717 | 3300005549 | Bacteria | 500 |
| 130 | Ga0068855_100052596 | 3300005563 | Bacteria | 4794 |
| 131 | Ga0068855_100379822 | 3300005563 | Bacteria | 1551 |
| 132 | Ga0068855_100967750 | 3300005563 | Bacteria | 896 |
| 133 | Ga0068855_101600124 | 3300005563 | Bacteria | 667 |
| 134 | Ga0070664_100016814 | 3300005564 | Bacteria | 6004 |
| 135 | Ga0070664_100953188 | 3300005564 | Bacteria | 805 |
| 136 | Ga0068857_100125983 | 3300005577 | Bacteria | 2308 |
| 137 | Ga0068857_100938262 | 3300005577 | Bacteria | 831 |
| 138 | Ga0068854_100024258 | 3300005578 | Bacteria | 4150 |
| 139 | Ga0068854_100314991 | 3300005578 | Bacteria | 1270 |
| 140 | Ga0068854_101470510 | 3300005578 | Bacteria | 618 |
| 141 | Ga0070702_100094117 | 3300005615 | Bacteria | 1823 |
| 142 | Ga0070702_100722147 | 3300005615 | Bacteria | 762 |
| 143 | Ga0070702_101770771 | 3300005615 | Bacteria | 515 |
| 144 | Ga0068864_100042736 | 3300005618 | Bacteria | 3878 |
| 145 | Ga0068866_10787703 | 3300005718 | Bacteria | 660 |
| 146 | Ga0068861_100071708 | 3300005719 | Bacteria | 2685 |
| 147 | Ga0068861_101253710 | 3300005719 | Bacteria | 719 |
| 148 | Ga0068870_10000204 | 3300005840 | Bacteria | 21239 |
| 149 | Ga0068870_10159381 | 3300005840 | Bacteria | 1337 |
| 150 | Ga0068870_11250083 | 3300005840 | Bacteria | 539 |
| 151 | Ga0068863_100732365 | 3300005841 | Bacteria | 984 |
| 152 | Ga0068860_102499418 | 3300005843 | Bacteria | 536 |
| 153 | Ga0068862_100103543 | 3300005844 | Bacteria | 2493 |
| 154 | Ga0068862_102355462 | 3300005844 | Bacteria | 544 |
| 155 | Ga0081455_10006997 | 3300005937 | Bacteria | 11986 |
| 156 | Ga0081455_10015572 | 3300005937 | Bacteria | 7381 |
| 157 | Ga0081455_10018033 | 3300005937 | Bacteria | 6741 |
| 158 | Ga0081455_10046898 | 3300005937 | Bacteria | 3745 |
| 159 | Ga0081455_10047704 | 3300005937 | Bacteria | 3707 |
| 160 | Ga0081455_10125053 | 3300005937 | Bacteria | 2020 |
| 161 | Ga0081455_10225344 | 3300005937 | Bacteria | 1387 |
| 162 | Ga0081455_10239546 | 3300005937 | Bacteria | 1334 |
| 163 | Ga0081455_10527867 | 3300005937 | Bacteria | 786 |
| 164 | Ga0081538_10000649 | 3300005981 | Bacteria | 38484 |
| 165 | Ga0081538_10000751 | 3300005981 | Bacteria | 35387 |
| 166 | Ga0081538_10005541 | 3300005981 | Bacteria | 11330 |
| 167 | Ga0081538_10005970 | 3300005981 | Bacteria | 10840 |
| 168 | Ga0081538_10033372 | 3300005981 | Bacteria | 3429 |
| 169 | Ga0081538_10049184 | 3300005981 | Bacteria | 2560 |
| 170 | Ga0081538_10101239 | 3300005981 | Bacteria | 1450 |
| 171 | Ga0081540_1007112 | 3300005983 | Bacteria | 8033 |
| 172 | Ga0081539_10003424 | 3300005985 | Bacteria | 19515 |
| 173 | Ga0081539_10173303 | 3300005985 | Bacteria | 1018 |
| 174 | Ga0081539_10377070 | 3300005985 | Bacteria | 592 |
| 175 | Ga0070717_10147034 | 3300006028 | Bacteria | 2036 |
| 176 | Ga0070717_11235431 | 3300006028 | Bacteria | 680 |
| 177 | Ga0075365_10044105 | 3300006038 | Bacteria | 2921 |
| 178 | Ga0075365_10750378 | 3300006038 | Bacteria | 689 |
| 179 | Ga0075365_10802682 | 3300006038 | Bacteria | 664 |
| 180 | Ga0075364_10123477 | 3300006051 | Bacteria | 1734 |
| 181 | Ga0075432_10022148 | 3300006058 | Bacteria | 2172 |
| 182 | Ga0070715_10934238 | 3300006163 | Unclassified | 536 |
| 183 | Ga0070716_100371430 | 3300006173 | Bacteria | 1019 |
| 184 | Ga0070712_100469060 | 3300006175 | Bacteria | 1051 |
| 185 | Ga0070712_100507330 | 3300006175 | Bacteria | 1012 |
| 186 | Ga0070712_101716432 | 3300006175 | Bacteria | 550 |
| 187 | Ga0097621_100847451 | 3300006237 | Bacteria | 849 |
| 188 | Ga0068871_100597677 | 3300006358 | Unclassified | 1003 |
| 189 | Ga0068871_101191219 | 3300006358 | Bacteria | 714 |
| 190 | Ga0075428_100004766 | 3300006844 | Bacteria | 15015 |
| 191 | Ga0075428_100530489 | 3300006844 | Bacteria | 1259 |
| 192 | Ga0075430_100460406 | 3300006846 | Bacteria | 1049 |
| 193 | Ga0075430_100643219 | 3300006846 | Bacteria | 875 |
| 194 | Ga0075430_100677560 | 3300006846 | Bacteria | 850 |
| 195 | Ga0075431_100096511 | 3300006847 | Bacteria | 3052 |
| 196 | Ga0075431_100257360 | 3300006847 | Bacteria | 1772 |
| 197 | Ga0075431_100453387 | 3300006847 | Bacteria | 1278 |
| 198 | Ga0075431_100843401 | 3300006847 | Bacteria | 888 |
| 199 | Ga0075431_101002397 | 3300006847 | Bacteria | 802 |
| 200 | Ga0075431_101602932 | 3300006847 | Bacteria | 609 |
| 201 | Ga0075433_10942200 | 3300006852 | Bacteria | 753 |
| 202 | Ga0075434_100369782 | 3300006871 | Bacteria | 1455 |
| 203 | Ga0075434_100377703 | 3300006871 | Bacteria | 1438 |
| 204 | Ga0075434_102031281 | 3300006871 | Bacteria | 580 |
| 205 | Ga0075429_100007732 | 3300006880 | Bacteria | 9330 |
| 206 | Ga0075429_100064851 | 3300006880 | Bacteria | 3180 |
| 207 | Ga0075429_100064970 | 3300006880 | Bacteria | 3177 |
| 208 | Ga0075429_100230780 | 3300006880 | Bacteria | 1621 |
| 209 | Ga0075429_100429062 | 3300006880 | Bacteria | 1158 |
| 210 | Ga0075429_101740763 | 3300006880 | Bacteria | 541 |
| 211 | Ga0068865_100087363 | 3300006881 | Bacteria | 2253 |
| 212 | Ga0068865_101019356 | 3300006881 | Bacteria | 726 |
| 213 | Ga0075436_101374645 | 3300006914 | Bacteria | 535 |
| 214 | Ga0075435_100225790 | 3300007076 | Bacteria | 1591 |
| 215 | Ga0075435_100692391 | 3300007076 | Bacteria | 886 |
| 216 | Ga0105240_10050080 | 3300009093 | Bacteria | 5268 |
| 217 | Ga0105240_10180280 | 3300009093 | Bacteria | 2493 |
| 218 | Ga0105240_10674117 | 3300009093 | Bacteria | 1131 |
| 219 | Ga0105240_12314404 | 3300009093 | Bacteria | 556 |
| 220 | Ga0111539_10307430 | 3300009094 | Bacteria | 1845 |
| 221 | Ga0111539_10569473 | 3300009094 | Bacteria | 1319 |
| 222 | Ga0111539_11562958 | 3300009094 | Bacteria | 765 |
| 223 | Ga0111539_12122661 | 3300009094 | Bacteria | 652 |
| 224 | Ga0111539_12238950 | 3300009094 | Unclassified | 634 |
| 225 | Ga0105245_10114118 | 3300009098 | Bacteria | 2516 |
| 226 | Ga0105245_10220112 | 3300009098 | Bacteria | 1831 |
| 227 | Ga0105245_10247935 | 3300009098 | Bacteria | 1729 |
| 228 | Ga0114129_10004963 | 3300009147 | Bacteria | 18757 |
| 229 | Ga0114129_10008112 | 3300009147 | Bacteria | 14966 |
| 230 | Ga0114129_10032178 | 3300009147 | Bacteria | 7415 |
| 231 | Ga0114129_10112786 | 3300009147 | Bacteria | 3750 |
| 232 | Ga0114129_10166093 | 3300009147 | Bacteria | 3012 |
| 233 | Ga0114129_10628569 | 3300009147 | Bacteria | 1388 |
| 234 | Ga0114129_10897394 | 3300009147 | Bacteria | 1123 |
| 235 | Ga0114129_11186749 | 3300009147 | Bacteria | 951 |
| 236 | Ga0114129_11531467 | 3300009147 | Bacteria | 818 |
| 237 | Ga0114129_11862922 | 3300009147 | Bacteria | 730 |
| 238 | Ga0114129_12088840 | 3300009147 | Bacteria | 684 |
| 239 | Ga0105243_10029447 | 3300009148 | Bacteria | 4222 |
| 240 | Ga0105243_10076784 | 3300009148 | Bacteria | 2715 |
| 241 | Ga0105243_10335752 | 3300009148 | Bacteria | 1382 |
| 242 | Ga0105243_11485376 | 3300009148 | Bacteria | 701 |
| 243 | Ga0105241_11631307 | 3300009174 | Bacteria | 625 |
| 244 | Ga0105242_10228821 | 3300009176 | Bacteria | 1665 |
| 245 | Ga0105242_10348470 | 3300009176 | Bacteria | 1367 |
| 246 | Ga0105242_11011832 | 3300009176 | Bacteria | 839 |
| 247 | Ga0105248_10265464 | 3300009177 | Bacteria | 1932 |
| 248 | Ga0105237_10172828 | 3300009545 | Bacteria | 2161 |
| 249 | Ga0105237_10220836 | 3300009545 | Bacteria | 1895 |
| 250 | Ga0105237_11558619 | 3300009545 | Bacteria | 667 |
| 251 | Ga0105238_10074304 | 3300009551 | Bacteria | 3392 |
| 252 | Ga0105238_12400477 | 3300009551 | Bacteria | 563 |
| 253 | Ga0105249_10100015 | 3300009553 | Bacteria | 2726 |
| 254 | Ga0105249_10198791 | 3300009553 | Bacteria | 1961 |
| 255 | Ga0105249_10960856 | 3300009553 | Bacteria | 922 |
| 256 | Ga0105239_10058288 | 3300010375 | Bacteria | 4237 |
| 257 | Ga0105239_10363417 | 3300010375 | Bacteria | 1635 |
| 258 | Ga0105239_10612142 | 3300010375 | Bacteria | 1243 |
| 259 | Ga0105246_10003846 | 3300011119 | Bacteria | 9105 |
| 260 | Ga0105246_10038443 | 3300011119 | Bacteria | 3217 |
| 261 | Ga0105246_10170195 | 3300011119 | Bacteria | 1668 |
| 262 | Ga0105246_10508562 | 3300011119 | Bacteria | 1024 |
| 263 | Ga0105246_10882669 | 3300011119 | Bacteria | 800 |
| 264 | Ga0105246_11838747 | 3300011119 | Bacteria | 580 |
| 265 | Ga0157345_1038507 | 3300012498 | Bacteria | 566 |
| 266 | Ga0157373_10256485 | 3300013100 | Bacteria | 1237 |
| 267 | Ga0157373_10326773 | 3300013100 | Bacteria | 1092 |
| 268 | Ga0157371_10061637 | 3300013102 | Bacteria | 2659 |
| 269 | Ga0157371_10622663 | 3300013102 | Bacteria | 804 |
| 270 | Ga0157371_11236903 | 3300013102 | Bacteria | 576 |
| 271 | Ga0157370_10008749 | 3300013104 | Bacteria | 10886 |
| 272 | Ga0157370_10068398 | 3300013104 | Bacteria | 3356 |
| 273 | Ga0157369_10506115 | 3300013105 | Bacteria | 1249 |
| 274 | Ga0157369_10653808 | 3300013105 | Bacteria | 1084 |
| 275 | Ga0157369_11310104 | 3300013105 | Bacteria | 738 |
| 276 | Ga0157369_12199890 | 3300013105 | Bacteria | 559 |
| 277 | Ga0157369_12483550 | 3300013105 | Bacteria | 525 |
| 278 | Ga0157374_11879071 | 3300013296 | Bacteria | 624 |
| 279 | Ga0157374_12165817 | 3300013296 | Bacteria | 583 |
| 280 | Ga0157378_10042424 | 3300013297 | Bacteria | 4038 |
| 281 | Ga0163162_10057234 | 3300013306 | Bacteria | 3926 |
| 282 | Ga0157372_10232874 | 3300013307 | Bacteria | 2136 |
| 283 | Ga0157372_10688003 | 3300013307 | Bacteria | 1190 |
| 284 | Ga0157375_10015581 | 3300013308 | Bacteria | 6809 |
| 285 | Ga0157375_10099132 | 3300013308 | Bacteria | 2992 |
| 286 | Ga0163163_10012068 | 3300014325 | Bacteria | 7860 |
| 287 | Ga0163163_10689116 | 3300014325 | Bacteria | 1085 |
| 288 | Ga0157380_10089631 | 3300014326 | Bacteria | 2534 |
| 289 | Ga0157380_10149878 | 3300014326 | Bacteria | 2015 |
| 290 | Ga0182008_10542734 | 3300014497 | Bacteria | 645 |
| 291 | Ga0157377_10013668 | 3300014745 | Bacteria | 4114 |
| 292 | Ga0157377_10077913 | 3300014745 | Bacteria | 1931 |
| 293 | Ga0157379_10218843 | 3300014968 | Bacteria | 1725 |
| 294 | Ga0157376_10064073 | 3300014969 | Bacteria | 3098 |
| 295 | Ga0157376_10422785 | 3300014969 | Bacteria | 1294 |
| 296 | Ga0157376_10853195 | 3300014969 | Bacteria | 926 |
| 297 | Ga0157376_11049879 | 3300014969 | Bacteria | 839 |
| 298 | Ga0157376_11181067 | 3300014969 | Bacteria | 793 |
| 299 | Ga0182005_1092243 | 3300015265 | Bacteria | 843 |
| 300 | Ga0163161_10276093 | 3300017792 | Bacteria | 1317 |
| 301 | Ga0197907_11268269 | 3300020069 | Bacteria | 2854 |
| 302 | Ga0197907_11292483 | 3300020069 | Bacteria | 524 |
| 303 | Ga0197907_11347809 | 3300020069 | Bacteria | 894 |
| 304 | Ga0206356_11016126 | 3300020070 | Bacteria | 5157 |
| 305 | Ga0206355_1264501 | 3300020076 | Bacteria | 617 |
| 306 | Ga0206354_10206368 | 3300020081 | Bacteria | 1203 |
| 307 | Ga0206354_10970272 | 3300020081 | Bacteria | 584 |
| 308 | Ga0206353_10745444 | 3300020082 | Bacteria | 1608 |
| 309 | Ga0206353_10856979 | 3300020082 | Bacteria | 842 |
| 310 | Ga0213871_10125034 | 3300021441 | Bacteria | 769 |
| 311 | Ga0224712_10013163 | 3300022467 | Bacteria | 2625 |
| 312 | Ga0207697_10145439 | 3300025315 | Bacteria | 1030 |
| 313 | Ga0207692_10380809 | 3300025898 | Bacteria | 876 |
| 314 | Ga0207692_10959026 | 3300025898 | Bacteria | 564 |
| 315 | Ga0207688_10011254 | 3300025901 | Bacteria | 4869 |
| 316 | Ga0207688_10206413 | 3300025901 | Bacteria | 1179 |
| 317 | Ga0207688_10919792 | 3300025901 | Bacteria | 554 |
| 318 | Ga0207645_10109298 | 3300025907 | Bacteria | 1789 |
| 319 | Ga0207643_10011875 | 3300025908 | Bacteria | 4701 |
| 320 | Ga0207643_10053630 | 3300025908 | Bacteria | 2291 |
| 321 | Ga0207643_10455750 | 3300025908 | Bacteria | 814 |
| 322 | Ga0207705_10042289 | 3300025909 | Bacteria | 3272 |
| 323 | Ga0207705_10102409 | 3300025909 | Bacteria | 2108 |
| 324 | Ga0207684_10113392 | 3300025910 | Bacteria | 2320 |
| 325 | Ga0207707_10037726 | 3300025912 | Bacteria | 4222 |
| 326 | Ga0207707_10082086 | 3300025912 | Bacteria | 2814 |
| 327 | Ga0207695_10092078 | 3300025913 | Bacteria | 3043 |
| 328 | Ga0207695_10594520 | 3300025913 | Bacteria | 988 |
| 329 | Ga0207695_10847048 | 3300025913 | Bacteria | 794 |
| 330 | Ga0207695_11489717 | 3300025913 | Bacteria | 557 |
| 331 | Ga0207671_10083040 | 3300025914 | Bacteria | 2405 |
| 332 | Ga0207693_10188205 | 3300025915 | Bacteria | 1625 |
| 333 | Ga0207660_10158135 | 3300025917 | Bacteria | 1746 |
| 334 | Ga0207657_10001344 | 3300025919 | Bacteria | 26151 |
| 335 | Ga0207657_10269004 | 3300025919 | Bacteria | 1355 |
| 336 | Ga0207649_10829454 | 3300025920 | Bacteria | 723 |
| 337 | Ga0207652_11067171 | 3300025921 | Bacteria | 708 |
| 338 | Ga0207652_11449819 | 3300025921 | Bacteria | 590 |
| 339 | Ga0207652_11468098 | 3300025921 | Bacteria | 586 |
| 340 | Ga0207652_11468591 | 3300025921 | Unclassified | 586 |
| 341 | Ga0207646_10057680 | 3300025922 | Bacteria | 3469 |
| 342 | Ga0207646_10401860 | 3300025922 | Bacteria | 1237 |
| 343 | Ga0207646_10402168 | 3300025922 | Bacteria | 1237 |
| 344 | Ga0207646_10928253 | 3300025922 | Bacteria | 771 |
| 345 | Ga0207646_11408005 | 3300025922 | Bacteria | 606 |
| 346 | Ga0207681_10985284 | 3300025923 | Bacteria | 707 |
| 347 | Ga0207681_11307147 | 3300025923 | Bacteria | 609 |
| 348 | Ga0207694_11110951 | 3300025924 | Bacteria | 669 |
| 349 | Ga0207650_10087472 | 3300025925 | Bacteria | 2374 |
| 350 | Ga0207650_10089829 | 3300025925 | Bacteria | 2345 |
| 351 | Ga0207659_10380198 | 3300025926 | Bacteria | 1177 |
| 352 | Ga0207659_11304145 | 3300025926 | Bacteria | 623 |
| 353 | Ga0207687_10029710 | 3300025927 | Bacteria | 3678 |
| 354 | Ga0207700_10035417 | 3300025928 | Bacteria | 3595 |
| 355 | Ga0207664_10004888 | 3300025929 | Bacteria | 9110 |
| 356 | Ga0207664_10034890 | 3300025929 | Bacteria | 3877 |
| 357 | Ga0207664_10038111 | 3300025929 | Bacteria | 3725 |
| 358 | Ga0207664_10389263 | 3300025929 | Bacteria | 1238 |
| 359 | Ga0207664_10689026 | 3300025929 | Bacteria | 919 |
| 360 | Ga0207664_11195736 | 3300025929 | Bacteria | 678 |
| 361 | Ga0207664_11633991 | 3300025929 | Bacteria | 566 |
| 362 | Ga0207644_11031046 | 3300025931 | Bacteria | 691 |
| 363 | Ga0207690_10253058 | 3300025932 | Bacteria | 1361 |
| 364 | Ga0207706_10375900 | 3300025933 | Bacteria | 1233 |
| 365 | Ga0207706_10704815 | 3300025933 | Bacteria | 862 |
| 366 | Ga0207686_10663609 | 3300025934 | Bacteria | 826 |
| 367 | Ga0207709_10095324 | 3300025935 | Bacteria | 1955 |
| 368 | Ga0207709_10468139 | 3300025935 | Bacteria | 977 |
| 369 | Ga0207670_10032033 | 3300025936 | Bacteria | 3377 |
| 370 | Ga0207669_10234025 | 3300025937 | Bacteria | 1357 |
| 371 | Ga0207669_10490294 | 3300025937 | Bacteria | 981 |
| 372 | Ga0207669_11145176 | 3300025937 | Bacteria | 658 |
| 373 | Ga0207669_11219044 | 3300025937 | Bacteria | 638 |
| 374 | Ga0207669_11452963 | 3300025937 | Bacteria | 584 |
| 375 | Ga0207704_10233912 | 3300025938 | Bacteria | 1368 |
| 376 | Ga0207704_11123734 | 3300025938 | Bacteria | 668 |
| 377 | Ga0207691_10020777 | 3300025940 | Bacteria | 6206 |
| 378 | Ga0207691_10846008 | 3300025940 | Bacteria | 767 |
| 379 | Ga0207661_10027567 | 3300025944 | Bacteria | 4340 |
| 380 | Ga0207661_10137639 | 3300025944 | Bacteria | 2099 |
| 381 | Ga0207661_10220261 | 3300025944 | Bacteria | 1677 |
| 382 | Ga0207661_11062531 | 3300025944 | Bacteria | 746 |
| 383 | Ga0207661_11101831 | 3300025944 | Bacteria | 731 |
| 384 | Ga0207679_10078952 | 3300025945 | Bacteria | 2508 |
| 385 | Ga0207667_10193872 | 3300025949 | Bacteria | 2084 |
| 386 | Ga0207651_10407286 | 3300025960 | Bacteria | 1158 |
| 387 | Ga0207712_10349595 | 3300025961 | Bacteria | 1228 |
| 388 | Ga0207712_10413084 | 3300025961 | Bacteria | 1137 |
| 389 | Ga0207712_10592159 | 3300025961 | Bacteria | 958 |
| 390 | Ga0207712_10839038 | 3300025961 | Bacteria | 809 |
| 391 | Ga0207668_10588354 | 3300025972 | Bacteria | 968 |
| 392 | Ga0207640_10171865 | 3300025981 | Bacteria | 1616 |
| 393 | Ga0207677_10053614 | 3300026023 | Bacteria | 2746 |
| 394 | Ga0207677_10612805 | 3300026023 | Bacteria | 956 |
| 395 | Ga0207677_11235076 | 3300026023 | Bacteria | 685 |
| 396 | Ga0207703_11122240 | 3300026035 | Bacteria | 755 |
| 397 | Ga0207639_10295059 | 3300026041 | Bacteria | 1431 |
| 398 | Ga0207678_10336263 | 3300026067 | Bacteria | 1301 |
| 399 | Ga0207708_10017519 | 3300026075 | Bacteria | 5393 |
| 400 | Ga0207708_10829069 | 3300026075 | Bacteria | 797 |
| 401 | Ga0207641_11592549 | 3300026088 | Unclassified | 655 |
| 402 | Ga0207648_10270477 | 3300026089 | Bacteria | 1518 |
| 403 | Ga0207648_10730661 | 3300026089 | Bacteria | 919 |
| 404 | Ga0207648_10842126 | 3300026089 | Bacteria | 855 |
| 405 | Ga0207648_10933553 | 3300026089 | Bacteria | 811 |
| 406 | Ga0207676_10065149 | 3300026095 | Bacteria | 2901 |
| 407 | Ga0207674_10069899 | 3300026116 | Bacteria | 3530 |
| 408 | Ga0207674_10191379 | 3300026116 | Bacteria | 1996 |
| 409 | Ga0207674_10520143 | 3300026116 | Bacteria | 1149 |
| 410 | Ga0207674_11458198 | 3300026116 | Bacteria | 654 |
| 411 | Ga0207674_11895992 | 3300026116 | Bacteria | 562 |
| 412 | Ga0207675_100264743 | 3300026118 | Bacteria | 1667 |
| 413 | Ga0207675_101717202 | 3300026118 | Bacteria | 647 |
| 414 | Ga0207675_102388133 | 3300026118 | Bacteria | 541 |
| 415 | Ga0207683_10009294 | 3300026121 | Bacteria | 8376 |
| 416 | Ga0207683_10406718 | 3300026121 | Bacteria | 1252 |
| 417 | Ga0207428_10099754 | 3300027907 | Bacteria | 2245 |
| 418 | Ga0207428_10336080 | 3300027907 | Bacteria | 1113 |
| 419 | Ga0268266_10065478 | 3300028379 | Bacteria | 3142 |
| 420 | Ga0268265_10335497 | 3300028380 | Bacteria | 1375 |
| 421 | Ga0268265_11540367 | 3300028380 | Bacteria | 669 |
| 422 | Ga0265337_1094192 | 3300028556 | Bacteria | 816 |
| 423 | Ga0265326_10060792 | 3300028558 | Bacteria | 1069 |
| 424 | Ga0265319_1012507 | 3300028563 | Bacteria | 3428 |
| 425 | Ga0265334_10126677 | 3300028573 | Bacteria | 910 |
| 426 | Ga0265318_10026590 | 3300028577 | Bacteria | 2277 |
| 427 | Ga0265322_10097652 | 3300028654 | Bacteria | 836 |
| 428 | Ga0265336_10160360 | 3300028666 | Bacteria | 669 |
| 429 | Ga0265338_10008087 | 3300028800 | Bacteria | 12858 |
| 430 | Ga0265338_10023514 | 3300028800 | Bacteria | 6333 |
| 431 | Ga0265338_10026119 | 3300028800 | Bacteria | 5901 |
| 432 | Ga0265338_10112545 | 3300028800 | Bacteria | 2188 |
| 433 | Ga0265330_10039496 | 3300031235 | Bacteria | 2096 |
| 434 | Ga0265332_10008175 | 3300031238 | Bacteria | 4705 |
| 435 | Ga0265320_10024893 | 3300031240 | Bacteria | 3155 |
| 436 | Ga0265320_10497227 | 3300031240 | Bacteria | 539 |
| 437 | Ga0265325_10083827 | 3300031241 | Bacteria | 1580 |
| 438 | Ga0265329_10097310 | 3300031242 | Bacteria | 935 |
| 439 | Ga0265340_10011483 | 3300031247 | Bacteria | 4705 |
| 440 | Ga0265339_10034059 | 3300031249 | Bacteria | 2863 |
| 441 | Ga0265339_10138705 | 3300031249 | Bacteria | 1238 |
| 442 | Ga0265331_10022073 | 3300031250 | Bacteria | 3250 |
| 443 | Ga0265327_10009229 | 3300031251 | Bacteria | 7154 |
| 444 | Ga0265327_10032608 | 3300031251 | Bacteria | 2913 |
| 445 | Ga0265316_10246529 | 3300031344 | Bacteria | 1312 |
| 446 | Ga0307408_101505677 | 3300031548 | Bacteria | 636 |
| 447 | Ga0265313_10033372 | 3300031595 | Bacteria | 2616 |
| 448 | Ga0265313_10232256 | 3300031595 | Bacteria | 757 |
| 449 | Ga0265314_10053808 | 3300031711 | Bacteria | 2789 |
| 450 | Ga0265342_10112991 | 3300031712 | Bacteria | 1535 |
| 451 | Ga0307405_10601290 | 3300031731 | Bacteria | 897 |
| 452 | Ga0307407_11068487 | 3300031903 | Bacteria | 626 |
| 453 | Ga0307412_11086913 | 3300031911 | Bacteria | 711 |
| 454 | Ga0307409_101781581 | 3300031995 | Bacteria | 645 |
| 455 | Ga0307416_100224144 | 3300032002 | Bacteria | 1806 |
| 456 | Ga0307416_100291364 | 3300032002 | Bacteria | 1616 |
| 457 | Ga0307416_100987803 | 3300032002 | Bacteria | 944 |
| 458 | Ga0307415_100116744 | 3300032126 | Bacteria | 1992 |
| 459 | Ga0307415_101553420 | 3300032126 | Bacteria | 634 |
| 460 | Ga0307415_102351166 | 3300032126 | Bacteria | 523 |
| 461 | Ga0316583_10164784 | 3300032133 | Bacteria | 771 |
| 462 | Ga0373953_0237012 | 3300035117 | Bacteria | 792 |
| 463 | Ga0373954_0445572 | 3300035118 | Bacteria | 641 |
| 464 | Ga0373956_0035721 | 3300035119 | Bacteria | 2193 |
| 465 | Ga0373957_0432062 | 3300035120 | Bacteria | 569 |
| 466 | Ga0373960_0312332 | 3300035121 | Bacteria | 587 |
| 467 | Ga0373943_0433594 | 3300035170 | Bacteria | 762 |
| 468 | Ga0373955_0055386 | 3300035172 | Bacteria | 2172 |
| 469 | Ga0373962_0183850 | 3300035242 | Bacteria | 700 |
| 470 | Ga0373924_0103675 | 3300035410 | Bacteria | 1225 |
| 471 | Ga0373935_0583300 | 3300035692 | Bacteria | 817 |
| 472 | Ga0373933_0056141 | 3300035724 | Bacteria | 2363 |
| 473 | Ga0373933_0057624 | 3300035724 | Bacteria | 2335 |
| 474 | Ga0373947_0765657 | 3300035725 | Bacteria | 659 |
| 475 | Ga0373947_1192377 | 3300035725 | Bacteria | 519 |
| 476 | Ga0373937_0000107 | 3300036401 | Bacteria | 79333 |
| 477 | Ga0373937_0078927 | 3300036401 | Bacteria | 3042 |
| 478 | Ga0373925_1141343 | 3300037068 | Bacteria | 641 |
| 479 | Ga0395899_0000899 | 3300037312 | Bacteria | 28042 |
| 480 | Ga0395899_0033726 | 3300037312 | Bacteria | 3845 |
| 481 | Ga0395899_0039855 | 3300037312 | Bacteria | 3515 |
| 482 | Ga0395899_0065589 | 3300037312 | Bacteria | 2668 |
| 483 | Ga0395899_0074492 | 3300037312 | Bacteria | 2480 |
| 484 | Ga0395899_0088103 | 3300037312 | Bacteria | 2252 |
| 485 | Ga0395899_0224379 | 3300037312 | Bacteria | 1300 |
| 486 | Ga0395899_0305651 | 3300037312 | Bacteria | 1075 |
| 487 | Ga0395899_0343728 | 3300037312 | Bacteria | 1000 |
| 488 | Ga0395899_0649067 | 3300037312 | Bacteria | 667 |
| 489 | Ga0395900_0001819 | 3300037418 | Bacteria | 24397 |
| 490 | Ga0395900_0008064 | 3300037418 | Bacteria | 10840 |
| 491 | Ga0395900_0074115 | 3300037418 | Bacteria | 3500 |
| 492 | Ga0395900_0076426 | 3300037418 | Bacteria | 3442 |
| 493 | Ga0395900_0127255 | 3300037418 | Bacteria | 2612 |
| 494 | Ga0395900_0156628 | 3300037418 | Bacteria | 2326 |
| 495 | Ga0395900_0226912 | 3300037418 | Bacteria | 1880 |
| 496 | Ga0395900_0365508 | 3300037418 | Bacteria | 1413 |
| 497 | Ga0395900_0431182 | 3300037418 | Bacteria | 1277 |
| 498 | Ga0395900_0485120 | 3300037418 | Bacteria | 1188 |
| 499 | Ga0395900_0523272 | 3300037418 | Bacteria | 1133 |
| 500 | Ga0395900_0845139 | 3300037418 | Bacteria | 841 |
| 501 | Ga0395900_0879349 | 3300037418 | Bacteria | 820 |
| 502 | Ga0395900_0892703 | 3300037418 | Bacteria | 812 |
| 503 | Ga0395900_1792150 | 3300037418 | Bacteria | 524 |
| 504 | Ga0395900_1844673 | 3300037418 | Bacteria | 515 |
| 505 | Ga0395898_0002821 | 3300037466 | Bacteria | 19931 |
| 506 | Ga0395898_0010400 | 3300037466 | Bacteria | 9730 |
| 507 | Ga0395898_0014564 | 3300037466 | Bacteria | 8077 |
| 508 | Ga0395898_0099324 | 3300037466 | Bacteria | 2795 |
| 509 | Ga0395898_0129328 | 3300037466 | Bacteria | 2419 |
| 510 | Ga0395898_0154541 | 3300037466 | Bacteria | 2195 |
| 511 | Ga0395898_0318670 | 3300037466 | Bacteria | 1483 |
| 512 | Ga0395898_0394951 | 3300037466 | Bacteria | 1319 |
| 513 | Ga0395898_0399988 | 3300037466 | Bacteria | 1310 |
| 514 | Ga0395898_0407864 | 3300037466 | Bacteria | 1295 |
| 515 | Ga0395898_0955296 | 3300037466 | Bacteria | 794 |
| 516 | Ga0395898_1905918 | 3300037466 | Bacteria | 514 |
| 517 | Ga0395905_0002059 | 3300037471 | Bacteria | 22953 |
| 518 | Ga0395905_0009197 | 3300037471 | Bacteria | 9674 |
| 519 | Ga0395905_0011047 | 3300037471 | Bacteria | 8740 |
| 520 | Ga0395905_0036527 | 3300037471 | Bacteria | 4615 |
| 521 | Ga0395905_0067373 | 3300037471 | Bacteria | 3353 |
| 522 | Ga0395905_0191151 | 3300037471 | Bacteria | 1920 |
| 523 | Ga0395905_0252100 | 3300037471 | Bacteria | 1649 |
| 524 | Ga0395905_0320176 | 3300037471 | Bacteria | 1440 |
| 525 | Ga0395905_0486604 | 3300037471 | Bacteria | 1133 |
| 526 | Ga0395905_0591049 | 3300037471 | Bacteria | 1012 |
| 527 | Ga0395905_1157182 | 3300037471 | Bacteria | 677 |
| 528 | Ga0395905_1657961 | 3300037471 | Bacteria | 544 |
| 529 | Ga0395901_0000917 | 3300038443 | Bacteria | 32140 |
| 530 | Ga0395901_0001352 | 3300038443 | Bacteria | 25731 |
| 531 | Ga0395901_0003227 | 3300038443 | Bacteria | 16404 |
| 532 | Ga0395901_0017126 | 3300038443 | Bacteria | 7389 |
| 533 | Ga0395901_0026735 | 3300038443 | Bacteria | 5924 |
| 534 | Ga0395901_0132577 | 3300038443 | Bacteria | 2618 |
| 535 | Ga0395901_0286259 | 3300038443 | Bacteria | 1711 |
| 536 | Ga0395901_0335911 | 3300038443 | Bacteria | 1561 |
| 537 | Ga0395901_0344761 | 3300038443 | Bacteria | 1538 |
| 538 | Ga0395901_0479780 | 3300038443 | Bacteria | 1268 |
| 539 | Ga0395901_0565246 | 3300038443 | Bacteria | 1151 |
| 540 | Ga0395901_0585281 | 3300038443 | Bacteria | 1127 |
| 541 | Ga0395901_0752810 | 3300038443 | Bacteria | 967 |
| 542 | Ga0395901_1122798 | 3300038443 | Bacteria | 755 |
| 543 | Ga0395901_1313055 | 3300038443 | Bacteria | 685 |
| 544 | Ga0395901_1602679 | 3300038443 | Bacteria | 604 |
| 545 | Ga0436360_0132719 | 3300039438 | Bacteria | 835 |
| 546 | Ga0436360_1015244 | 3300039438 | Bacteria | 6330 |
| 547 | Ga0439466_0039600 | 3300041411 | Bacteria | 1579 |
| 548 | Ga0451833_0239441 | 3300041491 | Bacteria | 556 |
| 549 | Ga0451855_1798244 | 3300041511 | Bacteria | 826 |
| 550 | Ga0451853_1791929 | 3300041512 | Bacteria | 558 |
| 551 | Ga0439448_0078823 | 3300042005 | Bacteria | 1104 |
| 552 | Ga0439448_0079437 | 3300042005 | Bacteria | 1100 |
| 553 | Ga0439448_0277636 | 3300042005 | Bacteria | 593 |
| 554 | Ga0439450_019679 | 3300042008 | Bacteria | 1433 |
| 555 | Ga0439450_033584 | 3300042008 | Bacteria | 1164 |
| 556 | Ga0439451_042763 | 3300042009 | Bacteria | 909 |
| 557 | Ga0439454_090411 | 3300042011 | Bacteria | 565 |
| 558 | Ga0439455_0098260 | 3300042012 | Bacteria | 807 |
| 559 | Ga0439456_059429 | 3300042013 | Bacteria | 839 |
| 560 | Ga0450920_047997 | 3300042122 | Bacteria | 854 |
| 561 | Ga0450902_104102 | 3300042137 | Bacteria | 506 |
| 562 | Ga0439464_0093202 | 3300042439 | Bacteria | 910 |
| 563 | Ga0439460_0176041 | 3300042461 | Bacteria | 722 |
| 564 | Ga0439460_0239623 | 3300042461 | Bacteria | 625 |
| 565 | Ga0450918_040246 | 3300042531 | Bacteria | 838 |
| 566 | Ga0466972_0016553 | 3300044658 | Bacteria | 3687 |
| 567 | Ga0466965_0260221 | 3300044683 | Bacteria | 932 |
| 568 | Ga0466961_0017573 | 3300044693 | Bacteria | 4596 |
| 569 | Ga0466961_0077814 | 3300044693 | Bacteria | 2101 |
| 570 | Ga0466963_0217597 | 3300044694 | Bacteria | 1337 |
| 571 | Ga0466963_0329895 | 3300044694 | Bacteria | 1074 |
| 572 | Ga0466963_0650234 | 3300044694 | Bacteria | 744 |
| 573 | Ga0466963_0673814 | 3300044694 | Bacteria | 730 |
| 574 | Ga0466964_0113947 | 3300044706 | Bacteria | 1210 |
| 575 | Ga0466964_0245669 | 3300044706 | Bacteria | 880 |
| 576 | Ga0466971_0081293 | 3300044719 | Bacteria | 1478 |
| 577 | Ga0466971_0253084 | 3300044719 | Bacteria | 839 |
| 578 | Ga0466970_0607957 | 3300044765 | Bacteria | 634 |
| 579 | Ga0466957_0105165 | 3300044842 | Bacteria | 1784 |
| 580 | Ga0466957_0176181 | 3300044842 | Bacteria | 1395 |
| 581 | Ga0466957_0423699 | 3300044842 | Bacteria | 913 |
| 582 | Ga0466959_0262391 | 3300045049 | Bacteria | 1189 |
| 583 | Ga0466959_0350673 | 3300045049 | Bacteria | 1006 |
| 584 | Ga0466958_0011964 | 3300045836 | Bacteria | 4903 |
| 585 | Ga0466958_0610338 | 3300045836 | Bacteria | 710 |
| 586 | Ga0466967_0009992 | 3300045976 | Bacteria | 7087 |
| 587 | Ga0466967_0014130 | 3300045976 | Bacteria | 6204 |
| 588 | Ga0466967_0064089 | 3300045976 | Bacteria | 3267 |
| 589 | Ga0466967_0067528 | 3300045976 | Bacteria | 3189 |
| 590 | Ga0466967_0118104 | 3300045976 | Bacteria | 2446 |
| 591 | Ga0466967_0160582 | 3300045976 | Bacteria | 2109 |
| 592 | Ga0466967_0306646 | 3300045976 | Bacteria | 1528 |
| 593 | Ga0466967_1363259 | 3300045976 | Bacteria | 706 |
| 594 | Ga0466967_1710466 | 3300045976 | Bacteria | 626 |
| 595 | Ga0466967_1726495 | 3300045976 | Bacteria | 623 |
| 596 | Ga0495592_0000089 | 3300046454 | Bacteria | 80990 |
| 597 | Ga0495603_0869909 | 3300046455 | Bacteria | 513 |
| 598 | Ga0495629_0308517 | 3300046459 | Bacteria | 1083 |
| 599 | Ga0495651_0000057 | 3300046462 | Bacteria | 82943 |
| 600 | Ga0495651_0030418 | 3300046462 | Bacteria | 4211 |
| 601 | Ga0495651_0469952 | 3300046462 | Bacteria | 810 |
| 602 | Ga0495651_0585080 | 3300046462 | Bacteria | 706 |
| 603 | Ga0495653_0000641 | 3300046463 | Bacteria | 26637 |
| 604 | Ga0495653_0012796 | 3300046463 | Bacteria | 6850 |
| 605 | Ga0495653_0167405 | 3300046463 | Bacteria | 1520 |
| 606 | Ga0495582_0216509 | 3300046473 | Bacteria | 1095 |
| 607 | Ga0495582_0532195 | 3300046473 | Bacteria | 679 |
| 608 | Ga0495605_0052282 | 3300046474 | Bacteria | 1986 |
| 609 | Ga0495639_0475808 | 3300046475 | Bacteria | 636 |
| 610 | Ga0495664_0210699 | 3300046477 | Bacteria | 1177 |
| 611 | Ga0495664_0781379 | 3300046477 | Bacteria | 562 |
| 612 | Ga0495584_0321237 | 3300046491 | Bacteria | 786 |
| 613 | Ga0495585_0141647 | 3300046492 | Bacteria | 1259 |
| 614 | Ga0495596_0135555 | 3300046500 | Bacteria | 956 |
| 615 | Ga0495596_0318428 | 3300046500 | Unclassified | 605 |
| 616 | Ga0495583_0237226 | 3300046506 | Bacteria | 734 |
| 617 | Ga0495608_0002394 | 3300046511 | Bacteria | 13494 |
| 618 | Ga0495608_0042314 | 3300046511 | Bacteria | 3046 |
| 619 | Ga0495608_0193870 | 3300046511 | Bacteria | 1282 |
| 620 | Ga0495616_0220076 | 3300046513 | Bacteria | 827 |
| 621 | Ga0495618_0000832 | 3300046514 | Bacteria | 21414 |
| 622 | Ga0495618_0088590 | 3300046514 | Bacteria | 1979 |
| 623 | Ga0495628_0000066 | 3300046516 | Bacteria | 85699 |
| 624 | Ga0495628_0282141 | 3300046516 | Bacteria | 1233 |
| 625 | Ga0495630_0271871 | 3300046517 | Bacteria | 1295 |
| 626 | Ga0495631_0108297 | 3300046518 | Bacteria | 1195 |
| 627 | Ga0495631_0356589 | 3300046518 | Bacteria | 622 |
| 628 | Ga0495644_0091267 | 3300046523 | Bacteria | 1150 |
| 629 | Ga0495663_0024879 | 3300046525 | Bacteria | 1743 |
| 630 | Ga0495663_0058484 | 3300046525 | Bacteria | 1208 |
| 631 | Ga0495642_0021427 | 3300046528 | Bacteria | 2542 |
| 632 | Ga0495642_0118521 | 3300046528 | Bacteria | 1135 |
| 633 | Ga0495652_0000118 | 3300046529 | Bacteria | 85706 |
| 634 | Ga0495652_0398270 | 3300046529 | Bacteria | 975 |
| 635 | Ga0495586_0175031 | 3300046535 | Bacteria | 1213 |
| 636 | Ga0495586_0920010 | 3300046535 | Bacteria | 504 |
| 637 | Ga0495587_0001162 | 3300046536 | Bacteria | 17334 |
| 638 | Ga0495587_0195143 | 3300046536 | Bacteria | 1146 |
| 639 | Ga0495587_0398394 | 3300046536 | Bacteria | 765 |
| 640 | Ga0495609_0079699 | 3300046538 | Bacteria | 1432 |
| 641 | Ga0495645_0000052 | 3300046543 | Bacteria | 86470 |
| 642 | Ga0495645_0357767 | 3300046543 | Bacteria | 939 |
| 643 | Ga0495633_0549407 | 3300046558 | Bacteria | 520 |
| 644 | Ga0495667_0043796 | 3300046559 | Bacteria | 2965 |
| 645 | Ga0495667_0047887 | 3300046559 | Bacteria | 2823 |
| 646 | Ga0495656_0070394 | 3300046615 | Bacteria | 1552 |
| 647 | Ga0495668_0089129 | 3300046616 | Bacteria | 1691 |
| 648 | Ga0495634_0009599 | 3300046642 | Bacteria | 7130 |
| 649 | Ga0495634_0147655 | 3300046642 | Bacteria | 1489 |
| 650 | Ga0495634_0234040 | 3300046642 | Bacteria | 1129 |
| 651 | Ga0495634_0637879 | 3300046642 | Bacteria | 616 |
| 652 | Ga0495635_0186492 | 3300046663 | Bacteria | 1409 |
| 653 | Ga0495659_0056842 | 3300046664 | Bacteria | 1436 |
| 654 | Ga0495661_0066017 | 3300046665 | Bacteria | 2131 |
| 655 | Ga0495588_0164349 | 3300046674 | Bacteria | 1174 |
| 656 | Ga0495657_0027126 | 3300046675 | Bacteria | 4047 |
| 657 | Ga0495657_0414223 | 3300046675 | Bacteria | 792 |
| 658 | Ga0495599_0000046 | 3300046678 | Bacteria | 85727 |
| 659 | Ga0495599_0344502 | 3300046678 | Bacteria | 894 |
| 660 | Ga0495623_0001356 | 3300046679 | Bacteria | 16592 |
| 661 | Ga0495623_0250066 | 3300046679 | Bacteria | 997 |
| 662 | Ga0495646_0002939 | 3300046680 | Bacteria | 10561 |
| 663 | Ga0495647_0036699 | 3300046681 | Bacteria | 1846 |
| 664 | Ga0495658_1057622 | 3300046683 | Bacteria | 518 |
| 665 | Ga0495624_0124582 | 3300046690 | Bacteria | 1582 |
| 666 | Ga0495624_0608806 | 3300046690 | Bacteria | 651 |
| 667 | Ga0495671_0389918 | 3300046692 | Bacteria | 667 |
| 668 | Ga0495589_0015657 | 3300046794 | Bacteria | 3899 |
| 669 | Ga0495589_0245831 | 3300046794 | Bacteria | 837 |
| 670 | Ga0495600_0154298 | 3300046809 | Bacteria | 1486 |
| 671 | Ga0495600_0307726 | 3300046809 | Bacteria | 999 |
| 672 | Ga0495581_0410793 | 3300047315 | Bacteria | 789 |
| 673 | Ga0495604_0000075 | 3300047317 | Bacteria | 85370 |
| 674 | Ga0495604_0166789 | 3300047317 | Bacteria | 1552 |
| 675 | Ga0495636_0596863 | 3300047318 | Bacteria | 540 |
| 676 | Ga0495674_0220969 | 3300047319 | Bacteria | 1566 |
| 677 | Ga0495674_0252189 | 3300047319 | Bacteria | 1452 |
| 678 | Ga0495674_0292541 | 3300047319 | Bacteria | 1332 |
| 679 | Ga0495674_0350916 | 3300047319 | Bacteria | 1198 |
| 680 | Ga0495674_0621157 | 3300047319 | Bacteria | 854 |
| 681 | Ga0495676_0069121 | 3300047321 | Bacteria | 2726 |
| 682 | Ga0495680_0007302 | 3300047322 | Bacteria | 10169 |
| 683 | Ga0495680_0058384 | 3300047322 | Bacteria | 2981 |
| 684 | Ga0495680_0903230 | 3300047322 | Bacteria | 570 |
| 685 | Ga0495675_0000705 | 3300047444 | Bacteria | 20889 |
| 686 | Ga0495675_0085883 | 3300047444 | Bacteria | 1978 |
| 687 | Ga0495685_060342 | 3300047447 | Bacteria | 1279 |
| 688 | Ga0495684_0036579 | 3300047471 | Bacteria | 3763 |
| 689 | Ga0495684_0793246 | 3300047471 | Bacteria | 619 |
| 690 | Ga0495593_0203457 | 3300047673 | Bacteria | 995 |
| 691 | Ga0495602_0002990 | 3300048088 | Bacteria | 17334 |
| 692 | Ga0495602_0538266 | 3300048088 | Bacteria | 811 |
| 693 | Ga0496100_0622352 | 3300048903 | Bacteria | 839 |
| 694 | Ga0496100_0787960 | 3300048903 | Bacteria | 744 |
| 695 | Ga0496100_1172688 | 3300048903 | Bacteria | 606 |
| 696 | Ga0496101_0201903 | 3300048904 | Bacteria | 1537 |
| 697 | Ga0496101_0492969 | 3300048904 | Bacteria | 968 |
| 698 | Ga0496101_0669947 | 3300048904 | Bacteria | 819 |
| 699 | Ga0496101_1427724 | 3300048904 | Bacteria | 540 |
| 700 | Ga0496102_0086584 | 3300048905 | Bacteria | 2894 |
| 701 | Ga0496102_0181644 | 3300048905 | Bacteria | 1982 |
| 702 | Ga0496103_0192875 | 3300048906 | Bacteria | 1310 |
| 703 | Ga0496104_0192653 | 3300048907 | Bacteria | 1950 |
| 704 | Ga0496104_0328289 | 3300048907 | Bacteria | 1443 |
| 705 | Ga0496104_0423607 | 3300048907 | Bacteria | 1243 |
| 706 | Ga0496104_0457095 | 3300048907 | Bacteria | 1188 |
| 707 | Ga0496105_0084762 | 3300048908 | Bacteria | 2618 |
| 708 | Ga0496105_0122540 | 3300048908 | Bacteria | 2143 |
| 709 | Ga0496105_0400410 | 3300048908 | Bacteria | 1090 |
| 710 | Ga0496106_0409389 | 3300048909 | Bacteria | 1090 |
| 711 | Ga0496106_1077996 | 3300048909 | Bacteria | 630 |
| 712 | Ga0496106_1539609 | 3300048909 | Unclassified | 511 |
| 713 | Ga0496107_0309572 | 3300048910 | Bacteria | 1176 |
| 714 | Ga0496107_0623275 | 3300048910 | Bacteria | 796 |
| 715 | Ga0496107_0971406 | 3300048910 | Bacteria | 617 |
| 716 | Ga0496107_1070092 | 3300048910 | Unclassified | 583 |
| 717 | Ga0496108_0022352 | 3300048911 | Bacteria | 5200 |
| 718 | Ga0496108_0059522 | 3300048911 | Bacteria | 3212 |
| 719 | Ga0496108_0074390 | 3300048911 | Bacteria | 2868 |
| 720 | Ga0496108_0138184 | 3300048911 | Bacteria | 2098 |
| 721 | Ga0496108_0803076 | 3300048911 | Bacteria | 812 |
| 722 | Ga0496108_1101042 | 3300048911 | Bacteria | 675 |
| 723 | Ga0496109_0247909 | 3300048912 | Bacteria | 1677 |
| 724 | Ga0496109_0263204 | 3300048912 | Bacteria | 1624 |
| 725 | Ga0496109_0773130 | 3300048912 | Bacteria | 898 |
| 726 | Ga0496109_0975109 | 3300048912 | Bacteria | 785 |
| 727 | Ga0496109_1506816 | 3300048912 | Bacteria | 607 |
| 728 | Ga0496110_0176158 | 3300048913 | Bacteria | 1941 |
| 729 | Ga0496110_0248008 | 3300048913 | Bacteria | 1621 |
| 730 | Ga0496110_0458235 | 3300048913 | Bacteria | 1162 |
| 731 | Ga0496110_0796333 | 3300048913 | Bacteria | 849 |
| 732 | Ga0496110_0956589 | 3300048913 | Bacteria | 763 |
| 733 | Ga0496110_0985052 | 3300048913 | Bacteria | 750 |
| 734 | Ga0496110_1313119 | 3300048913 | Bacteria | 633 |
| 735 | Ga0496111_0212914 | 3300048914 | Bacteria | 1435 |
| 736 | Ga0496111_0332406 | 3300048914 | Unclassified | 1125 |
| 737 | Ga0496111_0578302 | 3300048914 | Bacteria | 823 |
| 738 | Ga0496112_0000293 | 3300048915 | Bacteria | 32490 |
| 739 | Ga0496112_0790703 | 3300048915 | Bacteria | 874 |
| 740 | Ga0496113_0243658 | 3300048916 | Bacteria | 1435 |
| 741 | Ga0496113_0396456 | 3300048916 | Bacteria | 1108 |
| 742 | Ga0496113_0416035 | 3300048916 | Bacteria | 1080 |
| 743 | Ga0496113_0735353 | 3300048916 | Bacteria | 786 |
| 744 | Ga0496114_0102177 | 3300048917 | Bacteria | 2449 |
| 745 | Ga0496114_0295165 | 3300048917 | Bacteria | 1430 |
| 746 | Ga0496114_0495863 | 3300048917 | Bacteria | 1080 |
| 747 | Ga0496115_0191552 | 3300048918 | Bacteria | 1689 |
| 748 | Ga0501031_0000336 | 3300049568 | Bacteria | 27217 |
| 749 | Ga0501031_0003836 | 3300049568 | Bacteria | 9667 |
| 750 | Ga0501031_0232168 | 3300049568 | Bacteria | 1200 |
| 751 | Ga0501031_0336455 | 3300049568 | Bacteria | 977 |
| 752 | Ga0501031_0786328 | 3300049568 | Bacteria | 610 |
| 753 | Ga0501032_0002775 | 3300049569 | Bacteria | 13640 |
| 754 | Ga0501032_0026680 | 3300049569 | Bacteria | 3971 |
| 755 | Ga0501032_0155787 | 3300049569 | Bacteria | 1501 |
| 756 | Ga0501033_0000239 | 3300049570 | Bacteria | 52812 |
| 757 | Ga0501033_0037937 | 3300049570 | Bacteria | 3605 |
| 758 | Ga0501033_0269747 | 3300049570 | Bacteria | 1203 |
| 759 | Ga0501033_0423147 | 3300049570 | Bacteria | 927 |
| 760 | Ga0501034_0050743 | 3300049571 | Bacteria | 4184 |
| 761 | Ga0501034_0051397 | 3300049571 | Bacteria | 4156 |
| 762 | Ga0501034_0356250 | 3300049571 | Bacteria | 1391 |
| 763 | Ga0501034_1095400 | 3300049571 | Bacteria | 678 |
| 764 | Ga0501036_0000107 | 3300049572 | Bacteria | 51071 |
| 765 | Ga0501036_0003875 | 3300049572 | Bacteria | 11999 |
| 766 | Ga0501036_0017006 | 3300049572 | Bacteria | 6077 |
| 767 | Ga0501036_0810230 | 3300049572 | Bacteria | 771 |
| 768 | Ga0501036_0835538 | 3300049572 | Bacteria | 757 |
| 769 | Ga0501037_0002426 | 3300049573 | Bacteria | 13474 |
| 770 | Ga0501037_0007718 | 3300049573 | Bacteria | 7875 |
| 771 | Ga0501037_0298950 | 3300049573 | Bacteria | 1118 |
| 772 | Ga0501038_0000367 | 3300049574 | Bacteria | 39046 |
| 773 | Ga0501038_0020533 | 3300049574 | Bacteria | 5936 |
| 774 | Ga0501038_0057518 | 3300049574 | Bacteria | 3338 |
| 775 | Ga0501039_0001687 | 3300049575 | Bacteria | 16278 |
| 776 | Ga0501039_0005193 | 3300049575 | Bacteria | 9854 |
| 777 | Ga0501039_0204975 | 3300049575 | Bacteria | 1550 |
| 778 | Ga0501039_0400736 | 3300049575 | Bacteria | 1078 |
| 779 | Ga0501039_1111780 | 3300049575 | Bacteria | 612 |
| 780 | Ga0501040_0002117 | 3300049576 | Bacteria | 12798 |
| 781 | Ga0501040_0003511 | 3300049576 | Bacteria | 10129 |
| 782 | Ga0501040_0009653 | 3300049576 | Bacteria | 6301 |
| 783 | Ga0501040_0032657 | 3300049576 | Bacteria | 3523 |
| 784 | Ga0501040_0038291 | 3300049576 | Bacteria | 3260 |
| 785 | Ga0501040_0132277 | 3300049576 | Bacteria | 1755 |
| 786 | Ga0501040_0279125 | 3300049576 | Bacteria | 1193 |
| 787 | Ga0501040_0342477 | 3300049576 | Bacteria | 1070 |
| 788 | Ga0501040_0378986 | 3300049576 | Bacteria | 1015 |
| 789 | Ga0501040_0442439 | 3300049576 | Bacteria | 935 |
| 790 | Ga0501040_0901522 | 3300049576 | Bacteria | 640 |
| 791 | Ga0501041_0000011 | 3300049577 | Bacteria | 58729 |
| 792 | Ga0501041_0018083 | 3300049577 | Bacteria | 4197 |
| 793 | Ga0501041_0054200 | 3300049577 | Bacteria | 2446 |
| 794 | Ga0501041_0064201 | 3300049577 | Bacteria | 2248 |
| 795 | Ga0501041_0084635 | 3300049577 | Bacteria | 1954 |
| 796 | Ga0501042_0000956 | 3300049578 | Bacteria | 16278 |
| 797 | Ga0501042_0010432 | 3300049578 | Bacteria | 6230 |
| 798 | Ga0501042_0011243 | 3300049578 | Bacteria | 6033 |
| 799 | Ga0501042_0038064 | 3300049578 | Bacteria | 3415 |
| 800 | Ga0501042_0448460 | 3300049578 | Bacteria | 936 |
| 801 | Ga0501042_0549701 | 3300049578 | Bacteria | 839 |
| 802 | Ga0501042_0606232 | 3300049578 | Bacteria | 796 |
| 803 | Ga0501043_0000477 | 3300049579 | Bacteria | 35754 |
| 804 | Ga0501043_0051175 | 3300049579 | Bacteria | 3246 |
| 805 | Ga0501043_0070198 | 3300049579 | Bacteria | 2752 |
| 806 | Ga0501043_0273761 | 3300049579 | Bacteria | 1295 |
| 807 | Ga0501046_0001077 | 3300049580 | Bacteria | 26750 |
| 808 | Ga0501046_0024131 | 3300049580 | Bacteria | 4994 |
| 809 | Ga0501046_0025741 | 3300049580 | Bacteria | 4812 |
| 810 | Ga0501046_0058485 | 3300049580 | Bacteria | 3021 |
| 811 | Ga0501046_0070562 | 3300049580 | Bacteria | 2716 |
| 812 | Ga0501046_0118241 | 3300049580 | Bacteria | 2019 |
| 813 | Ga0501046_0588119 | 3300049580 | Bacteria | 791 |
| 814 | Ga0501046_1108360 | 3300049580 | Bacteria | 546 |
| 815 | Ga0501047_0000743 | 3300049581 | Bacteria | 33980 |
| 816 | Ga0501047_0351479 | 3300049581 | Bacteria | 1311 |
| 817 | Ga0501047_0506613 | 3300049581 | Bacteria | 1034 |
| 818 | Ga0501048_0000339 | 3300049582 | Bacteria | 32273 |
| 819 | Ga0501048_0017103 | 3300049582 | Bacteria | 5344 |
| 820 | Ga0501048_0033807 | 3300049582 | Bacteria | 3692 |
| 821 | Ga0501048_0394608 | 3300049582 | Bacteria | 989 |
| 822 | Ga0501048_0822432 | 3300049582 | Bacteria | 667 |
| 823 | Ga0501048_0976396 | 3300049582 | Bacteria | 609 |
| 824 | Ga0501048_1409981 | 3300049582 | Bacteria | 501 |
| 825 | Ga0501067_0042145 | 3300049583 | Bacteria | 2534 |
| 826 | Ga0501067_0074363 | 3300049583 | Bacteria | 1883 |
| 827 | Ga0501067_0099825 | 3300049583 | Bacteria | 1612 |
| 828 | Ga0501068_0000241 | 3300049584 | Bacteria | 26764 |
| 829 | Ga0501068_0035098 | 3300049584 | Bacteria | 2992 |
| 830 | Ga0501068_0080064 | 3300049584 | Bacteria | 2003 |
| 831 | Ga0501068_1175376 | 3300049584 | Bacteria | 508 |
| 832 | Ga0501069_0001803 | 3300049585 | Bacteria | 10711 |
| 833 | Ga0501069_0005142 | 3300049585 | Bacteria | 6793 |
| 834 | Ga0501069_0040222 | 3300049585 | Bacteria | 2584 |
| 835 | Ga0501069_0103813 | 3300049585 | Bacteria | 1615 |
| 836 | Ga0501069_0382141 | 3300049585 | Bacteria | 832 |
| 837 | Ga0501070_0002434 | 3300049586 | Bacteria | 16324 |
| 838 | Ga0501070_0029175 | 3300049586 | Bacteria | 4627 |
| 839 | Ga0501070_0168950 | 3300049586 | Bacteria | 1802 |
| 840 | Ga0501070_0170893 | 3300049586 | Bacteria | 1790 |
| 841 | Ga0501070_0442366 | 3300049586 | Bacteria | 1049 |
| 842 | Ga0501070_0887159 | 3300049586 | Bacteria | 696 |
| 843 | Ga0501071_0000208 | 3300049587 | Bacteria | 26807 |
| 844 | Ga0501071_0013896 | 3300049587 | Bacteria | 5497 |
| 845 | Ga0501071_0044818 | 3300049587 | Bacteria | 3173 |
| 846 | Ga0501071_0137599 | 3300049587 | Bacteria | 1818 |
| 847 | Ga0501071_0244787 | 3300049587 | Bacteria | 1352 |
| 848 | Ga0501071_0416725 | 3300049587 | Bacteria | 1026 |
| 849 | Ga0501071_0627605 | 3300049587 | Bacteria | 827 |
| 850 | Ga0501071_1340349 | 3300049587 | Bacteria | 553 |
| 851 | Ga0501072_0000561 | 3300049588 | Bacteria | 26764 |
| 852 | Ga0501072_0005900 | 3300049588 | Bacteria | 9331 |
| 853 | Ga0501072_0007361 | 3300049588 | Bacteria | 8352 |
| 854 | Ga0501072_0036282 | 3300049588 | Bacteria | 3864 |
| 855 | Ga0501072_0056996 | 3300049588 | Bacteria | 3078 |
| 856 | Ga0501072_0108831 | 3300049588 | Bacteria | 2205 |
| 857 | Ga0501072_0259981 | 3300049588 | Bacteria | 1382 |
| 858 | Ga0501072_1543132 | 3300049588 | Bacteria | 512 |
| 859 | Ga0501073_0004141 | 3300049589 | Bacteria | 10881 |
| 860 | Ga0501073_0006396 | 3300049589 | Bacteria | 8770 |
| 861 | Ga0501073_0015245 | 3300049589 | Bacteria | 5576 |
| 862 | Ga0501073_1198392 | 3300049589 | Bacteria | 521 |
| 863 | Ga0501074_0000158 | 3300049590 | Bacteria | 35682 |
| 864 | Ga0501074_0010003 | 3300049590 | Bacteria | 6884 |
| 865 | Ga0501074_0028216 | 3300049590 | Bacteria | 4067 |
| 866 | Ga0501074_0044191 | 3300049590 | Bacteria | 3225 |
| 867 | Ga0501074_0126067 | 3300049590 | Bacteria | 1831 |
| 868 | Ga0501074_0145113 | 3300049590 | Bacteria | 1697 |
| 869 | Ga0501074_0246021 | 3300049590 | Bacteria | 1272 |
| 870 | Ga0501074_0450278 | 3300049590 | Bacteria | 913 |
| 871 | Ga0501075_0000556 | 3300049591 | Bacteria | 22580 |
| 872 | Ga0501075_0007488 | 3300049591 | Bacteria | 7570 |
| 873 | Ga0501075_0008178 | 3300049591 | Bacteria | 7283 |
| 874 | Ga0501075_0033340 | 3300049591 | Bacteria | 3831 |
| 875 | Ga0501075_0099300 | 3300049591 | Bacteria | 2210 |
| 876 | Ga0501075_0258764 | 3300049591 | Bacteria | 1326 |
| 877 | Ga0501075_0323447 | 3300049591 | Bacteria | 1175 |
| 878 | Ga0501075_0325181 | 3300049591 | Bacteria | 1172 |
| 879 | Ga0501075_0341343 | 3300049591 | Bacteria | 1141 |
| 880 | Ga0501075_0616422 | 3300049591 | Bacteria | 828 |
| 881 | Ga0501075_1257106 | 3300049591 | Bacteria | 561 |
| 882 | Ga0501076_0000289 | 3300049592 | Bacteria | 31371 |
| 883 | Ga0501076_0004159 | 3300049592 | Bacteria | 10239 |
| 884 | Ga0501076_0008407 | 3300049592 | Bacteria | 7563 |
| 885 | Ga0501076_0009583 | 3300049592 | Bacteria | 7150 |
| 886 | Ga0501076_0020823 | 3300049592 | Bacteria | 5022 |
| 887 | Ga0501076_0186225 | 3300049592 | Bacteria | 1693 |
| 888 | Ga0501076_0663088 | 3300049592 | Bacteria | 861 |
| 889 | Ga0501076_0783056 | 3300049592 | Bacteria | 787 |
| 890 | Ga0501076_0902275 | 3300049592 | Bacteria | 729 |
| 891 | Ga0501077_0000371 | 3300049593 | Bacteria | 26807 |
| 892 | Ga0501077_0003869 | 3300049593 | Bacteria | 9024 |
| 893 | Ga0501077_0005270 | 3300049593 | Bacteria | 7854 |
| 894 | Ga0501077_0011683 | 3300049593 | Bacteria | 5488 |
| 895 | Ga0501077_0057129 | 3300049593 | Bacteria | 2478 |
| 896 | Ga0501077_0484242 | 3300049593 | Bacteria | 793 |
| 897 | Ga0501079_0000053 | 3300049741 | Bacteria | 51071 |
| 898 | Ga0501079_0005980 | 3300049741 | Bacteria | 9110 |
| 899 | Ga0501079_0032307 | 3300049741 | Bacteria | 4024 |
| 900 | Ga0501079_0140223 | 3300049741 | Bacteria | 1883 |
| 901 | Ga0501079_0144682 | 3300049741 | Bacteria | 1852 |
| 902 | Ga0501079_0156699 | 3300049741 | Bacteria | 1775 |
| 903 | Ga0501079_0171377 | 3300049741 | Bacteria | 1692 |
| 904 | Ga0501079_0281079 | 3300049741 | Bacteria | 1301 |
| 905 | Ga0501079_0882168 | 3300049741 | Bacteria | 704 |
| 906 | Ga0501080_0000136 | 3300049742 | Bacteria | 52047 |
| 907 | Ga0501080_0018701 | 3300049742 | Bacteria | 6412 |
| 908 | Ga0501080_0039262 | 3300049742 | Bacteria | 4418 |
| 909 | Ga0501080_0226816 | 3300049742 | Bacteria | 1708 |
| 910 | Ga0501080_0252691 | 3300049742 | Bacteria | 1607 |
| 911 | Ga0501080_0389757 | 3300049742 | Bacteria | 1254 |
| 912 | Ga0501081_0000025 | 3300049743 | Bacteria | 54545 |
| 913 | Ga0501081_0018256 | 3300049743 | Bacteria | 4656 |
| 914 | Ga0501081_0018414 | 3300049743 | Bacteria | 4639 |
| 915 | Ga0501081_0021016 | 3300049743 | Bacteria | 4356 |
| 916 | Ga0501081_0021111 | 3300049743 | Bacteria | 4346 |
| 917 | Ga0501081_0048245 | 3300049743 | Bacteria | 2931 |
| 918 | Ga0501081_0081074 | 3300049743 | Bacteria | 2272 |
| 919 | Ga0501081_0616417 | 3300049743 | Bacteria | 813 |
| 920 | Ga0501081_0830194 | 3300049743 | Bacteria | 696 |
| 921 | Ga0501081_1154503 | 3300049743 | Bacteria | 586 |
| 922 | Ga0501083_0000234 | 3300049744 | Bacteria | 35676 |
| 923 | Ga0501083_0023011 | 3300049744 | Bacteria | 4325 |
| 924 | Ga0501083_0176130 | 3300049744 | Bacteria | 1397 |
| 925 | Ga0501035_0002443 | 3300049822 | Bacteria | 18151 |
| 926 | Ga0501035_0016946 | 3300049822 | Bacteria | 6715 |
| 927 | Ga0501035_0047089 | 3300049822 | Bacteria | 3873 |
| 928 | Ga0501035_0648188 | 3300049822 | Bacteria | 856 |
| 929 | Ga0501035_0811104 | 3300049822 | Bacteria | 747 |
| 930 | Ga0501044_0011199 | 3300049823 | Bacteria | 9725 |
| 931 | Ga0501044_0192855 | 3300049823 | Bacteria | 1999 |
| 932 | Ga0501044_0617968 | 3300049823 | Bacteria | 975 |
| 933 | Ga0501044_0933045 | 3300049823 | Bacteria | 742 |
| 934 | Ga0501045_0000035 | 3300049824 | Bacteria | 58729 |
| 935 | Ga0501045_0006706 | 3300049824 | Bacteria | 7977 |
| 936 | Ga0501045_0007494 | 3300049824 | Bacteria | 7580 |
| 937 | Ga0501045_0028863 | 3300049824 | Bacteria | 4004 |
| 938 | Ga0501045_0043998 | 3300049824 | Bacteria | 3252 |
| 939 | Ga0501045_0052735 | 3300049824 | Bacteria | 2970 |
| 940 | Ga0501045_0202700 | 3300049824 | Bacteria | 1478 |
| 941 | Ga0501045_0268074 | 3300049824 | Bacteria | 1271 |
| 942 | Ga0501045_1095392 | 3300049824 | Bacteria | 583 |
| 943 | nmdc:mga03683_40278_c1 | 3300050489 | Bacteria | 1915 |
| 944 | nmdc:mga00v17_76312_c2 | 3300050491 | Bacteria | 1037 |
| 945 | nmdc:mga0yw44_494445_c1 | 3300050492 | Bacteria | 830 |
| 946 | nmdc:mga0yw44_53232_c1 | 3300050492 | Bacteria | 2457 |
| 947 | nmdc:mga0yw44_749166_c1 | 3300050492 | Bacteria | 663 |
| 948 | nmdc:mga05p37_112379_c1 | 3300050507 | Bacteria | 3350 |
| 949 | nmdc:mga05p37_312392_c1 | 3300050507 | Bacteria | 1080 |
| 950 | nmdc:mga05p37_394911_c1 | 3300050507 | Bacteria | 1617 |
| 951 | nmdc:mga05p37_458916_c1 | 3300050507 | Bacteria | 1473 |
| 952 | nmdc:mga05p37_5244_c1 | 3300050507 | Bacteria | 15215 |
| 953 | nmdc:mga05p37_607108_c1 | 3300050507 | Bacteria | 1234 |
| 954 | nmdc:mga05p37_613465_c1 | 3300050507 | Bacteria | 1226 |
| 955 | nmdc:mga05p37_7995_c1 | 3300050507 | Bacteria | 12483 |
| 956 | nmdc:mga05p37_918245_c1 | 3300050507 | Bacteria | 941 |
| 957 | nmdc:mga09592_352237_c1 | 3300050508 | Bacteria | 1274 |
| 958 | nmdc:mga09592_39609_c1 | 3300050508 | Bacteria | 3959 |
| 959 | nmdc:mga09592_41989_c1 | 3300050508 | Bacteria | 3847 |
| 960 | nmdc:mga09592_572036_c1 | 3300050508 | Bacteria | 970 |
| 961 | nmdc:mga0qj67_1038301_c1 | 3300050509 | Bacteria | 642 |
| 962 | nmdc:mga0qj67_127956_c1 | 3300050509 | Bacteria | 2056 |
| 963 | nmdc:mga0qj67_134289_c1 | 3300050509 | Bacteria | 2005 |
| 964 | nmdc:mga0qj67_619383_c1 | 3300050509 | Bacteria | 865 |
| 965 | nmdc:mga06r32_118641_c1 | 3300050510 | Bacteria | 2608 |
| 966 | nmdc:mga06r32_123940_c1 | 3300050510 | Bacteria | 2550 |
| 967 | nmdc:mga06r32_330555_c1 | 3300050510 | Bacteria | 1509 |
| 968 | nmdc:mga06r32_506676_c1 | 3300050510 | Bacteria | 1184 |
| 969 | nmdc:mga06r32_81305_c1 | 3300050510 | Bacteria | 3155 |
| 970 | nmdc:mga08y16_312921_c1 | 3300050511 | Bacteria | 1617 |
| 971 | nmdc:mga08y16_857164_c1 | 3300050511 | Bacteria | 897 |
| 972 | nmdc:mga0n895_131116_c1 | 3300050512 | Bacteria | 2531 |
| 973 | nmdc:mga0rr50_798360_c1 | 3300050513 | Bacteria | 805 |
| 974 | nmdc:mga0rr50_849212_c1 | 3300050513 | Bacteria | 779 |
| 975 | nmdc:mga08x19_1144723_c1 | 3300050514 | Bacteria | 552 |
| 976 | nmdc:mga08x19_282390_c1 | 3300050514 | Bacteria | 1150 |
| 977 | nmdc:mga0a205_1291802_c1 | 3300050515 | Bacteria | 577 |
| 978 | nmdc:mga0a205_577679_c1 | 3300050515 | Bacteria | 978 |
| 979 | Ga0495601_0000486 | 3300053077 | Bacteria | 20884 |
| 980 | Ga0495601_0661634 | 3300053077 | Bacteria | 668 |
| 981 | Ga0495601_1009168 | 3300053077 | Bacteria | 523 |
| 982 | Ga0495612_0040143 | 3300053078 | Bacteria | 1906 |
| 983 | Ga0495595_0004782 | 3300053084 | Bacteria | 5456 |
| 984 | Ga0495595_0246750 | 3300053084 | Bacteria | 894 |
| 985 | Ga0495619_0000123 | 3300053085 | Bacteria | 57052 |
| 986 | Ga0495619_0746576 | 3300053085 | Bacteria | 664 |
| 987 | Ga0501084_0000336 | 3300054114 | Bacteria | 35754 |
| 988 | Ga0501084_0009395 | 3300054114 | Bacteria | 8091 |
| 989 | Ga0501084_0020135 | 3300054114 | Bacteria | 5562 |
| 990 | Ga0501084_0084799 | 3300054114 | Bacteria | 2660 |
| 991 | Ga0501084_0140611 | 3300054114 | Bacteria | 2032 |
| 992 | Ga0501084_0410508 | 3300054114 | Bacteria | 1144 |
| 993 | Ga0501084_1525387 | 3300054114 | Bacteria | 559 |
| 994 | Ga0590071_007567 | 3300059421 | Bacteria | 2571 |
| 995 | Ga0590074_008703 | 3300059423 | Bacteria | 1689 |
| 996 | Ga0590075_024188 | 3300059424 | Bacteria | 1524 |
| 997 | Ga0501082_0001222 | 3300060353 | Bacteria | 22580 |
| 998 | Ga0501082_0004941 | 3300060353 | Bacteria | 11632 |
| 999 | Ga0501082_0036548 | 3300060353 | Bacteria | 4231 |
| 1000 | Ga0501082_0111071 | 3300060353 | Bacteria | 2372 |
| 1001 | Ga0501082_0283114 | 3300060353 | Bacteria | 1443 |
| 1002 | Ga0501082_0309957 | 3300060353 | Bacteria | 1374 |
| 1003 | Ga0501082_0347620 | 3300060353 | Bacteria | 1293 |
| 1004 | Ga0466962_0175215 | 3300061719 | Bacteria | 1045 |
| 1005 | Ga0530510_0000445 | 3300061734 | Bacteria | 26717 |
| 1006 | Ga0530510_0008684 | 3300061734 | Bacteria | 7102 |
| 1007 | Ga0530510_0011273 | 3300061734 | Bacteria | 6272 |
| 1008 | Ga0530510_0040426 | 3300061734 | Bacteria | 3365 |
| 1009 | Ga0530510_0221034 | 3300061734 | Bacteria | 1408 |
| 1010 | Ga0530510_0242848 | 3300061734 | Bacteria | 1341 |
| 1011 | Ga0530510_1569658 | 3300061734 | Bacteria | 505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10199909 | Ga0070676_101999093 | 64 |
| 2 | 3300005330 | Ga0070690_100061860 | Ga0070690_1000618604 | 64 |
| 3 | 3300005333 | Ga0070677_10598854 | Ga0070677_105988542 | 64 |
| 4 | 3300005336 | Ga0070680_100372708 | Ga0070680_1003727082 | 64 |
| 5 | 3300005338 | Ga0068868_100199714 | Ga0068868_1001997142 | 64 |
| 6 | 3300005339 | Ga0070660_100105678 | Ga0070660_1001056782 | 64 |
| 7 | 3300005341 | Ga0070691_10112593 | Ga0070691_101125932 | 64 |
| 8 | 3300005343 | Ga0070687_100837323 | Ga0070687_1008373232 | 64 |
| 9 | 3300005345 | Ga0070692_10031854 | Ga0070692_100318544 | 64 |
| 10 | 3300005347 | Ga0070668_100245341 | Ga0070668_1002453413 | 64 |
| 11 | 3300005353 | Ga0070669_100140917 | Ga0070669_1001409173 | 64 |
| 12 | 3300005356 | Ga0070674_100052243 | Ga0070674_1000522434 | 64 |
| 13 | 3300005364 | Ga0070673_100979575 | Ga0070673_1009795752 | 64 |
| 14 | 3300005366 | Ga0070659_100114457 | Ga0070659_1001144573 | 64 |
| 15 | 3300005438 | Ga0070701_10001787 | Ga0070701_100017874 | 64 |
| 16 | 3300005440 | Ga0070705_100068894 | Ga0070705_1000688942 | 64 |
| 17 | 3300005441 | Ga0070700_100040890 | Ga0070700_1000408903 | 64 |
| 18 | 3300005444 | Ga0070694_100030536 | Ga0070694_1000305365 | 64 |
| 19 | 3300005445 | Ga0070708_100366985 | Ga0070708_1003669853 | 64 |
| 20 | 3300005456 | Ga0070678_100092857 | Ga0070678_1000928571 | 64 |
| 21 | 3300005457 | Ga0070662_100039085 | Ga0070662_1000390855 | 64 |
| 22 | 3300005459 | Ga0068867_100379120 | Ga0068867_1003791202 | 64 |
| 23 | 3300005467 | Ga0070706_100840711 | Ga0070706_1008407112 | 64 |
| 24 | 3300005530 | Ga0070679_100137802 | Ga0070679_1001378023 | 64 |
| 25 | 3300005539 | Ga0068853_100856668 | Ga0068853_1008566682 | 64 |
| 26 | 3300005543 | Ga0070672_101562316 | Ga0070672_1015623162 | 64 |
| 27 | 3300005544 | Ga0070686_100053536 | Ga0070686_1000535364 | 64 |
| 28 | 3300005545 | Ga0070695_100091853 | Ga0070695_1000918533 | 64 |
| 29 | 3300005546 | Ga0070696_100008304 | Ga0070696_1000083045 | 64 |
| 30 | 3300005547 | Ga0070693_100155242 | Ga0070693_1001552422 | 64 |
| 31 | 3300005549 | Ga0070704_101517744 | Ga0070704_1015177441 | 64 |
| 32 | 3300005563 | Ga0068855_100379822 | Ga0068855_1003798223 | 64 |
| 33 | 3300005578 | Ga0068854_100024258 | Ga0068854_1000242584 | 64 |
| 34 | 3300005718 | Ga0068866_10787703 | Ga0068866_107877032 | 64 |
| 35 | 3300005719 | Ga0068861_100071708 | Ga0068861_1000717082 | 64 |
| 36 | 3300005843 | Ga0068860_102499418 | Ga0068860_1024994182 | 64 |
| 37 | 3300005844 | Ga0068862_100103543 | Ga0068862_1001035433 | 64 |
| 38 | 3300006175 | Ga0070712_100469060 | Ga0070712_1004690602 | 64 |
| 39 | 3300006881 | Ga0068865_100087363 | Ga0068865_1000873632 | 64 |
| 40 | 3300009098 | Ga0105245_10247935 | Ga0105245_102479352 | 64 |
| 41 | 3300009148 | Ga0105243_10335752 | Ga0105243_103357522 | 64 |
| 42 | 3300009174 | Ga0105241_11631307 | Ga0105241_116313072 | 64 |
| 43 | 3300009176 | Ga0105242_10228821 | Ga0105242_102288213 | 64 |
| 44 | 3300009545 | Ga0105237_10220836 | Ga0105237_102208362 | 64 |
| 45 | 3300009551 | Ga0105238_12400477 | Ga0105238_124004772 | 64 |
| 46 | 3300009553 | Ga0105249_10100015 | Ga0105249_101000153 | 64 |
| 47 | 3300010375 | Ga0105239_10363417 | Ga0105239_103634172 | 64 |
| 48 | 3300013102 | Ga0157371_10061637 | Ga0157371_100616375 | 64 |
| 49 | 3300013297 | Ga0157378_10042424 | Ga0157378_100424244 | 64 |
| 50 | 3300013306 | Ga0163162_10057234 | Ga0163162_100572342 | 64 |
| 51 | 3300013308 | Ga0157375_10099132 | Ga0157375_100991324 | 64 |
| 52 | 3300014326 | Ga0157380_10149878 | Ga0157380_101498782 | 64 |
| 53 | 3300014969 | Ga0157376_11049879 | Ga0157376_110498792 | 64 |
| 54 | 3300005563 | Ga0068855_100052596 | Ga0068855_1000525965 | 72 |
| 55 | 3300013100 | Ga0157373_10326773 | Ga0157373_103267733 | 72 |
| 56 | 3300013105 | Ga0157369_11310104 | Ga0157369_113101042 | 72 |
| 57 | 3300020069 | Ga0197907_11268269 | Ga0197907_112682692 | 72 |
| 58 | 3300025909 | Ga0207705_10042289 | Ga0207705_100422894 | 72 |
| 59 | 3300025912 | Ga0207707_10037726 | Ga0207707_100377262 | 72 |
| 60 | 3300025913 | Ga0207695_10092078 | Ga0207695_100920782 | 72 |
| 61 | 3300025920 | Ga0207649_10829454 | Ga0207649_108294542 | 72 |
| 62 | 3300025949 | Ga0207667_10193872 | Ga0207667_101938722 | 72 |
| 63 | 3300031240 | Ga0265320_10497227 | Ga0265320_104972271 | 72 |
| 64 | 3300046473 | Ga0495582_0216509 | Ga0495582_0216509_143_364 | 72 |
| 65 | 3300047321 | Ga0495676_0069121 | Ga0495676_0069121_2323_2544 | 72 |
| 66 | 3300048904 | Ga0496101_0669947 | Ga0496101_0669947_43_264 | 72 |
| 67 | 3300048907 | Ga0496104_0192653 | Ga0496104_0192653_429_650 | 72 |
| 68 | 3300048908 | Ga0496105_0122540 | Ga0496105_0122540_1648_1869 | 72 |
| 69 | 3300048910 | Ga0496107_0623275 | Ga0496107_0623275_216_437 | 72 |
| 70 | 3300048912 | Ga0496109_0975109 | Ga0496109_0975109_309_530 | 72 |
| 71 | 3300048917 | Ga0496114_0295165 | Ga0496114_0295165_720_941 | 72 |
| 72 | 3300048918 | Ga0496115_0191552 | Ga0496115_0191552_181_402 | 72 |
| 73 | 3300005457 | Ga0070662_100678086 | Ga0070662_1006780862 | 74 |
| 74 | 3300005467 | Ga0070706_100091147 | Ga0070706_1000911472 | 74 |
| 75 | 3300005467 | Ga0070706_101527819 | Ga0070706_1015278192 | 74 |
| 76 | 3300005471 | Ga0070698_100154464 | Ga0070698_1001544643 | 74 |
| 77 | 3300005937 | Ga0081455_10047704 | Ga0081455_100477042 | 74 |
| 78 | 3300005981 | Ga0081538_10005970 | Ga0081538_1000597010 | 74 |
| 79 | 3300005981 | Ga0081538_10101239 | Ga0081538_101012392 | 74 |
| 80 | 3300009147 | Ga0114129_12088840 | Ga0114129_120888401 | 74 |
| 81 | 3300020082 | Ga0206353_10856979 | Ga0206353_108569792 | 74 |
| 82 | 3300025901 | Ga0207688_10919792 | Ga0207688_109197922 | 74 |
| 83 | 3300025910 | Ga0207684_10113392 | Ga0207684_101133923 | 74 |
| 84 | 3300025933 | Ga0207706_10704815 | Ga0207706_107048152 | 74 |
| 85 | 3300025935 | Ga0207709_10468139 | Ga0207709_104681392 | 74 |
| 86 | 3300025937 | Ga0207669_11219044 | Ga0207669_112190442 | 74 |
| 87 | 3300025961 | Ga0207712_10349595 | Ga0207712_103495952 | 74 |
| 88 | 3300026089 | Ga0207648_10933553 | Ga0207648_109335532 | 74 |
| 89 | 3300037312 | Ga0395899_0224379 | Ga0395899_0224379_905_1129 | 74 |
| 90 | 3300037466 | Ga0395898_1905918 | Ga0395898_1905918_271_495 | 74 |
| 91 | 3300037471 | Ga0395905_1157182 | Ga0395905_1157182_153_386 | 74 |
| 92 | 3300041411 | Ga0439466_0039600 | Ga0439466_0039600_460_690 | 74 |
| 93 | 3300046558 | Ga0495633_0549407 | Ga0495633_0549407_49_282 | 74 |
| 94 | 3300048912 | Ga0496109_1506816 | Ga0496109_1506816_367_597 | 74 |
| 95 | 3300049575 | Ga0501039_1111780 | Ga0501039_1111780_252_488 | 74 |
| 96 | 3300049578 | Ga0501042_0448460 | Ga0501042_0448460_338_574 | 74 |
| 97 | 3300049582 | Ga0501048_0976396 | Ga0501048_0976396_331_567 | 74 |
| 98 | 3300049583 | Ga0501067_0099825 | Ga0501067_0099825_1359_1586 | 74 |
| 99 | 3300049585 | Ga0501069_0103813 | Ga0501069_0103813_758_985 | 74 |
| 100 | 3300049587 | Ga0501071_0627605 | Ga0501071_0627605_80_316 | 74 |
| 101 | 3300049588 | Ga0501072_0108831 | Ga0501072_0108831_518_754 | 74 |
| 102 | 3300049590 | Ga0501074_0450278 | Ga0501074_0450278_87_323 | 74 |
| 103 | 3300049591 | Ga0501075_0341343 | Ga0501075_0341343_54_290 | 74 |
| 104 | 3300049592 | Ga0501076_0663088 | Ga0501076_0663088_500_736 | 74 |
| 105 | 3300049741 | Ga0501079_0140223 | Ga0501079_0140223_1179_1415 | 74 |
| 106 | 3300049743 | Ga0501081_0048245 | Ga0501081_0048245_1225_1461 | 74 |
| 107 | 3300049823 | Ga0501044_0933045 | Ga0501044_0933045_293_529 | 74 |
| 108 | 3300049824 | Ga0501045_0043998 | Ga0501045_0043998_1016_1252 | 74 |
| 109 | 3300059421 | Ga0590071_007567 | Ga0590071_007567_2216_2449 | 74 |
| 110 | 3300050492 | nmdc:mga0yw44_749166_c1 | nmdc:mga0yw44_749166_c1_171_404 | 75 |
| 111 | 3300045976 | Ga0466967_1726495 | Ga0466967_1726495_332_565 | 76 |
| 112 | 3300003203 | JGI25406J46586_10251041 | JGI25406J46586_102510412 | 78 |
| 113 | 3300003373 | JGI25407J50210_10002049 | JGI25407J50210_100020491 | 78 |
| 114 | 3300003373 | JGI25407J50210_10008089 | JGI25407J50210_100080893 | 78 |
| 115 | 3300003373 | JGI25407J50210_10021986 | JGI25407J50210_100219861 | 78 |
| 116 | 3300005327 | Ga0070658_10041042 | Ga0070658_100410423 | 78 |
| 117 | 3300005327 | Ga0070658_10071609 | Ga0070658_100716092 | 78 |
| 118 | 3300005328 | Ga0070676_10147255 | Ga0070676_101472553 | 78 |
| 119 | 3300005329 | Ga0070683_100032146 | Ga0070683_1000321464 | 78 |
| 120 | 3300005329 | Ga0070683_100134534 | Ga0070683_1001345344 | 78 |
| 121 | 3300005329 | Ga0070683_100232524 | Ga0070683_1002325244 | 78 |
| 122 | 3300005329 | Ga0070683_100642644 | Ga0070683_1006426441 | 78 |
| 123 | 3300005329 | Ga0070683_101246098 | Ga0070683_1012460982 | 78 |
| 124 | 3300005330 | Ga0070690_100154933 | Ga0070690_1001549333 | 78 |
| 125 | 3300005331 | Ga0070670_100012063 | Ga0070670_1000120639 | 78 |
| 126 | 3300005336 | Ga0070680_100422080 | Ga0070680_1004220802 | 78 |
| 127 | 3300005338 | Ga0068868_100009800 | Ga0068868_1000098006 | 78 |
| 128 | 3300005339 | Ga0070660_100036640 | Ga0070660_1000366404 | 78 |
| 129 | 3300005339 | Ga0070660_100089448 | Ga0070660_1000894484 | 78 |
| 130 | 3300005339 | Ga0070660_100099996 | Ga0070660_1000999963 | 78 |
| 131 | 3300005339 | Ga0070660_100105719 | Ga0070660_1001057193 | 78 |
| 132 | 3300005340 | Ga0070689_100086408 | Ga0070689_1000864082 | 78 |
| 133 | 3300005343 | Ga0070687_100934801 | Ga0070687_1009348011 | 78 |
| 134 | 3300005344 | Ga0070661_100073267 | Ga0070661_1000732673 | 78 |
| 135 | 3300005344 | Ga0070661_101279068 | Ga0070661_1012790682 | 78 |
| 136 | 3300005345 | Ga0070692_10212574 | Ga0070692_102125742 | 78 |
| 137 | 3300005347 | Ga0070668_100067168 | Ga0070668_1000671682 | 78 |
| 138 | 3300005347 | Ga0070668_100711714 | Ga0070668_1007117142 | 78 |
| 139 | 3300005353 | Ga0070669_100190141 | Ga0070669_1001901411 | 78 |
| 140 | 3300005354 | Ga0070675_100036720 | Ga0070675_1000367201 | 78 |
| 141 | 3300005354 | Ga0070675_100218778 | Ga0070675_1002187782 | 78 |
| 142 | 3300005355 | Ga0070671_100024149 | Ga0070671_1000241492 | 78 |
| 143 | 3300005356 | Ga0070674_100063864 | Ga0070674_1000638644 | 78 |
| 144 | 3300005356 | Ga0070674_101424588 | Ga0070674_1014245882 | 78 |
| 145 | 3300005364 | Ga0070673_100078689 | Ga0070673_1000786893 | 78 |
| 146 | 3300005365 | Ga0070688_100038915 | Ga0070688_1000389152 | 78 |
| 147 | 3300005365 | Ga0070688_100501513 | Ga0070688_1005015131 | 78 |
| 148 | 3300005366 | Ga0070659_100195315 | Ga0070659_1001953153 | 78 |
| 149 | 3300005366 | Ga0070659_101740276 | Ga0070659_1017402761 | 78 |
| 150 | 3300005367 | Ga0070667_100094096 | Ga0070667_1000940963 | 78 |
| 151 | 3300005406 | Ga0070703_10479389 | Ga0070703_104793892 | 78 |
| 152 | 3300005435 | Ga0070714_101183168 | Ga0070714_1011831682 | 78 |
| 153 | 3300005435 | Ga0070714_101580110 | Ga0070714_1015801102 | 78 |
| 154 | 3300005435 | Ga0070714_101958207 | Ga0070714_1019582072 | 78 |
| 155 | 3300005436 | Ga0070713_100908720 | Ga0070713_1009087201 | 78 |
| 156 | 3300005438 | Ga0070701_10026825 | Ga0070701_100268252 | 78 |
| 157 | 3300005439 | Ga0070711_100851545 | Ga0070711_1008515451 | 78 |
| 158 | 3300005440 | Ga0070705_100383658 | Ga0070705_1003836582 | 78 |
| 159 | 3300005441 | Ga0070700_100075514 | Ga0070700_1000755143 | 78 |
| 160 | 3300005445 | Ga0070708_100478703 | Ga0070708_1004787032 | 78 |
| 161 | 3300005445 | Ga0070708_100797351 | Ga0070708_1007973512 | 78 |
| 162 | 3300005445 | Ga0070708_101703692 | Ga0070708_1017036921 | 78 |
| 163 | 3300005445 | Ga0070708_101764047 | Ga0070708_1017640471 | 78 |
| 164 | 3300005455 | Ga0070663_100841179 | Ga0070663_1008411792 | 78 |
| 165 | 3300005456 | Ga0070678_100005514 | Ga0070678_1000055143 | 78 |
| 166 | 3300005456 | Ga0070678_100852907 | Ga0070678_1008529072 | 78 |
| 167 | 3300005457 | Ga0070662_100376434 | Ga0070662_1003764342 | 78 |
| 168 | 3300005457 | Ga0070662_101065520 | Ga0070662_1010655202 | 78 |
| 169 | 3300005457 | Ga0070662_101890230 | Ga0070662_1018902302 | 78 |
| 170 | 3300005458 | Ga0070681_10025676 | Ga0070681_100256768 | 78 |
| 171 | 3300005458 | Ga0070681_10123201 | Ga0070681_101232014 | 78 |
| 172 | 3300005459 | Ga0068867_100131752 | Ga0068867_1001317522 | 78 |
| 173 | 3300005459 | Ga0068867_100818565 | Ga0068867_1008185652 | 78 |
| 174 | 3300005459 | Ga0068867_102100627 | Ga0068867_1021006271 | 78 |
| 175 | 3300005466 | Ga0070685_10226471 | Ga0070685_102264712 | 78 |
| 176 | 3300005466 | Ga0070685_10415609 | Ga0070685_104156092 | 78 |
| 177 | 3300005467 | Ga0070706_100171522 | Ga0070706_1001715223 | 78 |
| 178 | 3300005467 | Ga0070706_100772320 | Ga0070706_1007723202 | 78 |
| 179 | 3300005467 | Ga0070706_101483282 | Ga0070706_1014832822 | 78 |
| 180 | 3300005468 | Ga0070707_100123638 | Ga0070707_1001236381 | 78 |
| 181 | 3300005468 | Ga0070707_100148135 | Ga0070707_1001481353 | 78 |
| 182 | 3300005468 | Ga0070707_100927155 | Ga0070707_1009271552 | 78 |
| 183 | 3300005471 | Ga0070698_100095830 | Ga0070698_1000958303 | 78 |
| 184 | 3300005471 | Ga0070698_100263584 | Ga0070698_1002635841 | 78 |
| 185 | 3300005471 | Ga0070698_100484592 | Ga0070698_1004845922 | 78 |
| 186 | 3300005471 | Ga0070698_101774881 | Ga0070698_1017748812 | 78 |
| 187 | 3300005518 | Ga0070699_100013074 | Ga0070699_1000130748 | 78 |
| 188 | 3300005518 | Ga0070699_100166587 | Ga0070699_1001665871 | 78 |
| 189 | 3300005518 | Ga0070699_100414704 | Ga0070699_1004147041 | 78 |
| 190 | 3300005530 | Ga0070679_101720338 | Ga0070679_1017203382 | 78 |
| 191 | 3300005535 | Ga0070684_100006063 | Ga0070684_1000060639 | 78 |
| 192 | 3300005535 | Ga0070684_100025466 | Ga0070684_1000254663 | 78 |
| 193 | 3300005535 | Ga0070684_100562471 | Ga0070684_1005624712 | 78 |
| 194 | 3300005539 | Ga0068853_100476887 | Ga0068853_1004768872 | 78 |
| 195 | 3300005539 | Ga0068853_100507827 | Ga0068853_1005078272 | 78 |
| 196 | 3300005539 | Ga0068853_102350427 | Ga0068853_1023504272 | 78 |
| 197 | 3300005543 | Ga0070672_100108172 | Ga0070672_1001081723 | 78 |
| 198 | 3300005544 | Ga0070686_100021879 | Ga0070686_1000218792 | 78 |
| 199 | 3300005545 | Ga0070695_100000253 | Ga0070695_1000002538 | 78 |
| 200 | 3300005546 | Ga0070696_100364690 | Ga0070696_1003646902 | 78 |
| 201 | 3300005547 | Ga0070693_100744076 | Ga0070693_1007440762 | 78 |
| 202 | 3300005548 | Ga0070665_100097278 | Ga0070665_1000972782 | 78 |
| 203 | 3300005549 | Ga0070704_100819874 | Ga0070704_1008198741 | 78 |
| 204 | 3300005549 | Ga0070704_102015718 | Ga0070704_1020157182 | 78 |
| 205 | 3300005549 | Ga0070704_102314717 | Ga0070704_1023147171 | 78 |
| 206 | 3300005563 | Ga0068855_100967750 | Ga0068855_1009677502 | 78 |
| 207 | 3300005563 | Ga0068855_101600124 | Ga0068855_1016001242 | 78 |
| 208 | 3300005564 | Ga0070664_100016814 | Ga0070664_1000168145 | 78 |
| 209 | 3300005564 | Ga0070664_100953188 | Ga0070664_1009531882 | 78 |
| 210 | 3300005577 | Ga0068857_100125983 | Ga0068857_1001259833 | 78 |
| 211 | 3300005577 | Ga0068857_100938262 | Ga0068857_1009382622 | 78 |
| 212 | 3300005578 | Ga0068854_100314991 | Ga0068854_1003149912 | 78 |
| 213 | 3300005578 | Ga0068854_101470510 | Ga0068854_1014705102 | 78 |
| 214 | 3300005615 | Ga0070702_100094117 | Ga0070702_1000941173 | 78 |
| 215 | 3300005615 | Ga0070702_100722147 | Ga0070702_1007221472 | 78 |
| 216 | 3300005615 | Ga0070702_101770771 | Ga0070702_1017707711 | 78 |
| 217 | 3300005618 | Ga0068864_100042736 | Ga0068864_1000427363 | 78 |
| 218 | 3300005719 | Ga0068861_101253710 | Ga0068861_1012537102 | 78 |
| 219 | 3300005840 | Ga0068870_10000204 | Ga0068870_1000020417 | 78 |
| 220 | 3300005840 | Ga0068870_10159381 | Ga0068870_101593812 | 78 |
| 221 | 3300005840 | Ga0068870_11250083 | Ga0068870_112500832 | 78 |
| 222 | 3300005841 | Ga0068863_100732365 | Ga0068863_1007323652 | 78 |
| 223 | 3300005844 | Ga0068862_102355462 | Ga0068862_1023554622 | 78 |
| 224 | 3300005937 | Ga0081455_10006997 | Ga0081455_100069977 | 78 |
| 225 | 3300005937 | Ga0081455_10015572 | Ga0081455_100155728 | 78 |
| 226 | 3300005937 | Ga0081455_10018033 | Ga0081455_100180337 | 78 |
| 227 | 3300005937 | Ga0081455_10046898 | Ga0081455_100468984 | 78 |
| 228 | 3300005937 | Ga0081455_10125053 | Ga0081455_101250534 | 78 |
| 229 | 3300005937 | Ga0081455_10225344 | Ga0081455_102253442 | 78 |
| 230 | 3300005937 | Ga0081455_10239546 | Ga0081455_102395462 | 78 |
| 231 | 3300005937 | Ga0081455_10527867 | Ga0081455_105278672 | 78 |
| 232 | 3300005981 | Ga0081538_10000649 | Ga0081538_1000064926 | 78 |
| 233 | 3300005981 | Ga0081538_10000751 | Ga0081538_1000075130 | 78 |
| 234 | 3300005981 | Ga0081538_10005541 | Ga0081538_1000554113 | 78 |
| 235 | 3300005981 | Ga0081538_10033372 | Ga0081538_100333726 | 78 |
| 236 | 3300005981 | Ga0081538_10049184 | Ga0081538_100491842 | 78 |
| 237 | 3300005983 | Ga0081540_1007112 | Ga0081540_10071128 | 78 |
| 238 | 3300005985 | Ga0081539_10003424 | Ga0081539_100034249 | 78 |
| 239 | 3300005985 | Ga0081539_10173303 | Ga0081539_101733032 | 78 |
| 240 | 3300005985 | Ga0081539_10377070 | Ga0081539_103770701 | 78 |
| 241 | 3300006028 | Ga0070717_10147034 | Ga0070717_101470342 | 78 |
| 242 | 3300006028 | Ga0070717_11235431 | Ga0070717_112354312 | 78 |
| 243 | 3300006038 | Ga0075365_10044105 | Ga0075365_100441054 | 78 |
| 244 | 3300006038 | Ga0075365_10750378 | Ga0075365_107503781 | 78 |
| 245 | 3300006038 | Ga0075365_10802682 | Ga0075365_108026821 | 78 |
| 246 | 3300006051 | Ga0075364_10123477 | Ga0075364_101234773 | 78 |
| 247 | 3300006058 | Ga0075432_10022148 | Ga0075432_100221482 | 78 |
| 248 | 3300006163 | Ga0070715_10934238 | Ga0070715_109342382 | 78 |
| 249 | 3300006173 | Ga0070716_100371430 | Ga0070716_1003714302 | 78 |
| 250 | 3300006175 | Ga0070712_100507330 | Ga0070712_1005073302 | 78 |
| 251 | 3300006175 | Ga0070712_101716432 | Ga0070712_1017164322 | 78 |
| 252 | 3300006237 | Ga0097621_100847451 | Ga0097621_1008474512 | 78 |
| 253 | 3300006358 | Ga0068871_100597677 | Ga0068871_1005976772 | 78 |
| 254 | 3300006358 | Ga0068871_101191219 | Ga0068871_1011912192 | 78 |
| 255 | 3300006844 | Ga0075428_100004766 | Ga0075428_1000047665 | 78 |
| 256 | 3300006844 | Ga0075428_100530489 | Ga0075428_1005304892 | 78 |
| 257 | 3300006846 | Ga0075430_100460406 | Ga0075430_1004604062 | 78 |
| 258 | 3300006846 | Ga0075430_100643219 | Ga0075430_1006432192 | 78 |
| 259 | 3300006846 | Ga0075430_100677560 | Ga0075430_1006775602 | 78 |
| 260 | 3300006847 | Ga0075431_100096511 | Ga0075431_1000965113 | 78 |
| 261 | 3300006847 | Ga0075431_100257360 | Ga0075431_1002573603 | 78 |
| 262 | 3300006847 | Ga0075431_100453387 | Ga0075431_1004533871 | 78 |
| 263 | 3300006847 | Ga0075431_100843401 | Ga0075431_1008434012 | 78 |
| 264 | 3300006847 | Ga0075431_101002397 | Ga0075431_1010023972 | 78 |
| 265 | 3300006847 | Ga0075431_101602932 | Ga0075431_1016029322 | 78 |
| 266 | 3300006852 | Ga0075433_10942200 | Ga0075433_109422002 | 78 |
| 267 | 3300006871 | Ga0075434_100369782 | Ga0075434_1003697822 | 78 |
| 268 | 3300006871 | Ga0075434_100377703 | Ga0075434_1003777031 | 78 |
| 269 | 3300006871 | Ga0075434_102031281 | Ga0075434_1020312812 | 78 |
| 270 | 3300006880 | Ga0075429_100007732 | Ga0075429_1000077324 | 78 |
| 271 | 3300006880 | Ga0075429_100064851 | Ga0075429_1000648514 | 78 |
| 272 | 3300006880 | Ga0075429_100064970 | Ga0075429_1000649702 | 78 |
| 273 | 3300006880 | Ga0075429_100230780 | Ga0075429_1002307803 | 78 |
| 274 | 3300006880 | Ga0075429_100429062 | Ga0075429_1004290622 | 78 |
| 275 | 3300006880 | Ga0075429_101740763 | Ga0075429_1017407632 | 78 |
| 276 | 3300006881 | Ga0068865_101019356 | Ga0068865_1010193562 | 78 |
| 277 | 3300006914 | Ga0075436_101374645 | Ga0075436_1013746452 | 78 |
| 278 | 3300007076 | Ga0075435_100225790 | Ga0075435_1002257902 | 78 |
| 279 | 3300007076 | Ga0075435_100692391 | Ga0075435_1006923912 | 78 |
| 280 | 3300009093 | Ga0105240_10050080 | Ga0105240_100500805 | 78 |
| 281 | 3300009093 | Ga0105240_10180280 | Ga0105240_101802802 | 78 |
| 282 | 3300009093 | Ga0105240_10674117 | Ga0105240_106741172 | 78 |
| 283 | 3300009093 | Ga0105240_12314404 | Ga0105240_123144042 | 78 |
| 284 | 3300009094 | Ga0111539_10307430 | Ga0111539_103074302 | 78 |
| 285 | 3300009094 | Ga0111539_10569473 | Ga0111539_105694732 | 78 |
| 286 | 3300009094 | Ga0111539_11562958 | Ga0111539_115629582 | 78 |
| 287 | 3300009094 | Ga0111539_12122661 | Ga0111539_121226612 | 78 |
| 288 | 3300009094 | Ga0111539_12238950 | Ga0111539_122389502 | 78 |
| 289 | 3300009098 | Ga0105245_10114118 | Ga0105245_101141183 | 78 |
| 290 | 3300009098 | Ga0105245_10220112 | Ga0105245_102201122 | 78 |
| 291 | 3300009147 | Ga0114129_10004963 | Ga0114129_100049636 | 78 |
| 292 | 3300009147 | Ga0114129_10008112 | Ga0114129_1000811217 | 78 |
| 293 | 3300009147 | Ga0114129_10032178 | Ga0114129_100321789 | 78 |
| 294 | 3300009147 | Ga0114129_10112786 | Ga0114129_101127862 | 78 |
| 295 | 3300009147 | Ga0114129_10166093 | Ga0114129_101660933 | 78 |
| 296 | 3300009147 | Ga0114129_10628569 | Ga0114129_106285692 | 78 |
| 297 | 3300009147 | Ga0114129_10897394 | Ga0114129_108973942 | 78 |
| 298 | 3300009147 | Ga0114129_11186749 | Ga0114129_111867491 | 78 |
| 299 | 3300009147 | Ga0114129_11531467 | Ga0114129_115314672 | 78 |
| 300 | 3300009147 | Ga0114129_11862922 | Ga0114129_118629221 | 78 |
| 301 | 3300009148 | Ga0105243_10029447 | Ga0105243_100294474 | 78 |
| 302 | 3300009148 | Ga0105243_10076784 | Ga0105243_100767845 | 78 |
| 303 | 3300009148 | Ga0105243_11485376 | Ga0105243_114853762 | 78 |
| 304 | 3300009176 | Ga0105242_10348470 | Ga0105242_103484702 | 78 |
| 305 | 3300009176 | Ga0105242_11011832 | Ga0105242_110118322 | 78 |
| 306 | 3300009177 | Ga0105248_10265464 | Ga0105248_102654642 | 78 |
| 307 | 3300009545 | Ga0105237_10172828 | Ga0105237_101728282 | 78 |
| 308 | 3300009545 | Ga0105237_11558619 | Ga0105237_115586191 | 78 |
| 309 | 3300009551 | Ga0105238_10074304 | Ga0105238_100743046 | 78 |
| 310 | 3300009553 | Ga0105249_10198791 | Ga0105249_101987912 | 78 |
| 311 | 3300009553 | Ga0105249_10960856 | Ga0105249_109608562 | 78 |
| 312 | 3300010375 | Ga0105239_10058288 | Ga0105239_100582885 | 78 |
| 313 | 3300010375 | Ga0105239_10612142 | Ga0105239_106121421 | 78 |
| 314 | 3300011119 | Ga0105246_10003846 | Ga0105246_100038462 | 78 |
| 315 | 3300011119 | Ga0105246_10038443 | Ga0105246_100384432 | 78 |
| 316 | 3300011119 | Ga0105246_10170195 | Ga0105246_101701953 | 78 |
| 317 | 3300011119 | Ga0105246_10508562 | Ga0105246_105085622 | 78 |
| 318 | 3300011119 | Ga0105246_10882669 | Ga0105246_108826692 | 78 |
| 319 | 3300011119 | Ga0105246_11838747 | Ga0105246_118387472 | 78 |
| 320 | 3300012498 | Ga0157345_1038507 | Ga0157345_10385072 | 78 |
| 321 | 3300013100 | Ga0157373_10256485 | Ga0157373_102564852 | 78 |
| 322 | 3300013102 | Ga0157371_10622663 | Ga0157371_106226632 | 78 |
| 323 | 3300013102 | Ga0157371_11236903 | Ga0157371_112369032 | 78 |
| 324 | 3300013104 | Ga0157370_10008749 | Ga0157370_1000874912 | 78 |
| 325 | 3300013104 | Ga0157370_10068398 | Ga0157370_100683984 | 78 |
| 326 | 3300013105 | Ga0157369_10506115 | Ga0157369_105061152 | 78 |
| 327 | 3300013105 | Ga0157369_10653808 | Ga0157369_106538082 | 78 |
| 328 | 3300013105 | Ga0157369_12199890 | Ga0157369_121998902 | 78 |
| 329 | 3300013105 | Ga0157369_12483550 | Ga0157369_124835502 | 78 |
| 330 | 3300013296 | Ga0157374_11879071 | Ga0157374_118790712 | 78 |
| 331 | 3300013296 | Ga0157374_12165817 | Ga0157374_121658172 | 78 |
| 332 | 3300013307 | Ga0157372_10232874 | Ga0157372_102328744 | 78 |
| 333 | 3300013307 | Ga0157372_10688003 | Ga0157372_106880032 | 78 |
| 334 | 3300013308 | Ga0157375_10015581 | Ga0157375_100155814 | 78 |
| 335 | 3300014325 | Ga0163163_10012068 | Ga0163163_100120682 | 78 |
| 336 | 3300014325 | Ga0163163_10689116 | Ga0163163_106891162 | 78 |
| 337 | 3300014326 | Ga0157380_10089631 | Ga0157380_100896312 | 78 |
| 338 | 3300014497 | Ga0182008_10542734 | Ga0182008_105427342 | 78 |
| 339 | 3300014745 | Ga0157377_10013668 | Ga0157377_100136683 | 78 |
| 340 | 3300014745 | Ga0157377_10077913 | Ga0157377_100779132 | 78 |
| 341 | 3300014968 | Ga0157379_10218843 | Ga0157379_102188433 | 78 |
| 342 | 3300014969 | Ga0157376_10064073 | Ga0157376_100640736 | 78 |
| 343 | 3300014969 | Ga0157376_10422785 | Ga0157376_104227852 | 78 |
| 344 | 3300014969 | Ga0157376_10853195 | Ga0157376_108531952 | 78 |
| 345 | 3300014969 | Ga0157376_11181067 | Ga0157376_111810671 | 78 |
| 346 | 3300015265 | Ga0182005_1092243 | Ga0182005_10922432 | 78 |
| 347 | 3300017792 | Ga0163161_10276093 | Ga0163161_102760931 | 78 |
| 348 | 3300020069 | Ga0197907_11292483 | Ga0197907_112924832 | 78 |
| 349 | 3300020069 | Ga0197907_11347809 | Ga0197907_113478092 | 78 |
| 350 | 3300020070 | Ga0206356_11016126 | Ga0206356_110161265 | 78 |
| 351 | 3300020076 | Ga0206355_1264501 | Ga0206355_12645012 | 78 |
| 352 | 3300020081 | Ga0206354_10206368 | Ga0206354_102063682 | 78 |
| 353 | 3300020081 | Ga0206354_10970272 | Ga0206354_109702722 | 78 |
| 354 | 3300020082 | Ga0206353_10745444 | Ga0206353_107454442 | 78 |
| 355 | 3300021441 | Ga0213871_10125034 | Ga0213871_101250342 | 78 |
| 356 | 3300022467 | Ga0224712_10013163 | Ga0224712_100131632 | 78 |
| 357 | 3300025315 | Ga0207697_10145439 | Ga0207697_101454392 | 78 |
| 358 | 3300025898 | Ga0207692_10380809 | Ga0207692_103808092 | 78 |
| 359 | 3300025898 | Ga0207692_10959026 | Ga0207692_109590262 | 78 |
| 360 | 3300025901 | Ga0207688_10011254 | Ga0207688_100112545 | 78 |
| 361 | 3300025901 | Ga0207688_10206413 | Ga0207688_102064132 | 78 |
| 362 | 3300025907 | Ga0207645_10109298 | Ga0207645_101092982 | 78 |
| 363 | 3300025908 | Ga0207643_10011875 | Ga0207643_100118753 | 78 |
| 364 | 3300025908 | Ga0207643_10053630 | Ga0207643_100536302 | 78 |
| 365 | 3300025908 | Ga0207643_10455750 | Ga0207643_104557502 | 78 |
| 366 | 3300025909 | Ga0207705_10102409 | Ga0207705_101024093 | 78 |
| 367 | 3300025912 | Ga0207707_10082086 | Ga0207707_100820862 | 78 |
| 368 | 3300025913 | Ga0207695_10594520 | Ga0207695_105945202 | 78 |
| 369 | 3300025913 | Ga0207695_10847048 | Ga0207695_108470482 | 78 |
| 370 | 3300025913 | Ga0207695_11489717 | Ga0207695_114897172 | 78 |
| 371 | 3300025914 | Ga0207671_10083040 | Ga0207671_100830402 | 78 |
| 372 | 3300025915 | Ga0207693_10188205 | Ga0207693_101882052 | 78 |
| 373 | 3300025917 | Ga0207660_10158135 | Ga0207660_101581352 | 78 |
| 374 | 3300025919 | Ga0207657_10001344 | Ga0207657_1000134431 | 78 |
| 375 | 3300025919 | Ga0207657_10269004 | Ga0207657_102690042 | 78 |
| 376 | 3300025921 | Ga0207652_11067171 | Ga0207652_110671712 | 78 |
| 377 | 3300025921 | Ga0207652_11449819 | Ga0207652_114498192 | 78 |
| 378 | 3300025921 | Ga0207652_11468098 | Ga0207652_114680982 | 78 |
| 379 | 3300025921 | Ga0207652_11468591 | Ga0207652_114685912 | 78 |
| 380 | 3300025922 | Ga0207646_10057680 | Ga0207646_100576804 | 78 |
| 381 | 3300025922 | Ga0207646_10401860 | Ga0207646_104018602 | 78 |
| 382 | 3300025922 | Ga0207646_10402168 | Ga0207646_104021682 | 78 |
| 383 | 3300025922 | Ga0207646_10928253 | Ga0207646_109282532 | 78 |
| 384 | 3300025922 | Ga0207646_11408005 | Ga0207646_114080052 | 78 |
| 385 | 3300025923 | Ga0207681_10985284 | Ga0207681_109852842 | 78 |
| 386 | 3300025923 | Ga0207681_11307147 | Ga0207681_113071471 | 78 |
| 387 | 3300025924 | Ga0207694_11110951 | Ga0207694_111109512 | 78 |
| 388 | 3300025925 | Ga0207650_10087472 | Ga0207650_100874722 | 78 |
| 389 | 3300025925 | Ga0207650_10089829 | Ga0207650_100898293 | 78 |
| 390 | 3300025926 | Ga0207659_10380198 | Ga0207659_103801982 | 78 |
| 391 | 3300025926 | Ga0207659_11304145 | Ga0207659_113041452 | 78 |
| 392 | 3300025927 | Ga0207687_10029710 | Ga0207687_100297103 | 78 |
| 393 | 3300025928 | Ga0207700_10035417 | Ga0207700_100354174 | 78 |
| 394 | 3300025929 | Ga0207664_10004888 | Ga0207664_100048885 | 78 |
| 395 | 3300025929 | Ga0207664_10034890 | Ga0207664_100348904 | 78 |
| 396 | 3300025929 | Ga0207664_10038111 | Ga0207664_100381116 | 78 |
| 397 | 3300025929 | Ga0207664_10389263 | Ga0207664_103892632 | 78 |
| 398 | 3300025929 | Ga0207664_10689026 | Ga0207664_106890262 | 78 |
| 399 | 3300025929 | Ga0207664_11195736 | Ga0207664_111957362 | 78 |
| 400 | 3300025929 | Ga0207664_11633991 | Ga0207664_116339912 | 78 |
| 401 | 3300025931 | Ga0207644_11031046 | Ga0207644_110310462 | 78 |
| 402 | 3300025932 | Ga0207690_10253058 | Ga0207690_102530582 | 78 |
| 403 | 3300025933 | Ga0207706_10375900 | Ga0207706_103759002 | 78 |
| 404 | 3300025934 | Ga0207686_10663609 | Ga0207686_106636092 | 78 |
| 405 | 3300025935 | Ga0207709_10095324 | Ga0207709_100953242 | 78 |
| 406 | 3300025936 | Ga0207670_10032033 | Ga0207670_100320333 | 78 |
| 407 | 3300025937 | Ga0207669_10234025 | Ga0207669_102340252 | 78 |
| 408 | 3300025937 | Ga0207669_10490294 | Ga0207669_104902942 | 78 |
| 409 | 3300025937 | Ga0207669_11145176 | Ga0207669_111451762 | 78 |
| 410 | 3300025937 | Ga0207669_11452963 | Ga0207669_114529632 | 78 |
| 411 | 3300025938 | Ga0207704_10233912 | Ga0207704_102339122 | 78 |
| 412 | 3300025938 | Ga0207704_11123734 | Ga0207704_111237341 | 78 |
| 413 | 3300025940 | Ga0207691_10020777 | Ga0207691_100207772 | 78 |
| 414 | 3300025940 | Ga0207691_10846008 | Ga0207691_108460082 | 78 |
| 415 | 3300025944 | Ga0207661_10027567 | Ga0207661_100275672 | 78 |
| 416 | 3300025944 | Ga0207661_10137639 | Ga0207661_101376393 | 78 |
| 417 | 3300025944 | Ga0207661_10220261 | Ga0207661_102202614 | 78 |
| 418 | 3300025944 | Ga0207661_11062531 | Ga0207661_110625312 | 78 |
| 419 | 3300025944 | Ga0207661_11101831 | Ga0207661_111018312 | 78 |
| 420 | 3300025945 | Ga0207679_10078952 | Ga0207679_100789524 | 78 |
| 421 | 3300025960 | Ga0207651_10407286 | Ga0207651_104072862 | 78 |
| 422 | 3300025961 | Ga0207712_10413084 | Ga0207712_104130842 | 78 |
| 423 | 3300025961 | Ga0207712_10592159 | Ga0207712_105921592 | 78 |
| 424 | 3300025961 | Ga0207712_10839038 | Ga0207712_108390382 | 78 |
| 425 | 3300025972 | Ga0207668_10588354 | Ga0207668_105883542 | 78 |
| 426 | 3300025981 | Ga0207640_10171865 | Ga0207640_101718653 | 78 |
| 427 | 3300026023 | Ga0207677_10053614 | Ga0207677_100536144 | 78 |
| 428 | 3300026023 | Ga0207677_10612805 | Ga0207677_106128052 | 78 |
| 429 | 3300026023 | Ga0207677_11235076 | Ga0207677_112350762 | 78 |
| 430 | 3300026035 | Ga0207703_11122240 | Ga0207703_111222402 | 78 |
| 431 | 3300026041 | Ga0207639_10295059 | Ga0207639_102950592 | 78 |
| 432 | 3300026067 | Ga0207678_10336263 | Ga0207678_103362632 | 78 |
| 433 | 3300026075 | Ga0207708_10017519 | Ga0207708_100175193 | 78 |
| 434 | 3300026075 | Ga0207708_10829069 | Ga0207708_108290691 | 78 |
| 435 | 3300026088 | Ga0207641_11592549 | Ga0207641_115925492 | 78 |
| 436 | 3300026089 | Ga0207648_10270477 | Ga0207648_102704774 | 78 |
| 437 | 3300026089 | Ga0207648_10730661 | Ga0207648_107306612 | 78 |
| 438 | 3300026089 | Ga0207648_10842126 | Ga0207648_108421262 | 78 |
| 439 | 3300026095 | Ga0207676_10065149 | Ga0207676_100651492 | 78 |
| 440 | 3300026116 | Ga0207674_10069899 | Ga0207674_100698993 | 78 |
| 441 | 3300026116 | Ga0207674_10191379 | Ga0207674_101913792 | 78 |
| 442 | 3300026116 | Ga0207674_10520143 | Ga0207674_105201432 | 78 |
| 443 | 3300026116 | Ga0207674_11458198 | Ga0207674_114581982 | 78 |
| 444 | 3300026116 | Ga0207674_11895992 | Ga0207674_118959922 | 78 |
| 445 | 3300026118 | Ga0207675_100264743 | Ga0207675_1002647433 | 78 |
| 446 | 3300026118 | Ga0207675_101717202 | Ga0207675_1017172022 | 78 |
| 447 | 3300026118 | Ga0207675_102388133 | Ga0207675_1023881332 | 78 |
| 448 | 3300026121 | Ga0207683_10009294 | Ga0207683_100092944 | 78 |
| 449 | 3300026121 | Ga0207683_10406718 | Ga0207683_104067182 | 78 |
| 450 | 3300027907 | Ga0207428_10099754 | Ga0207428_100997544 | 78 |
| 451 | 3300027907 | Ga0207428_10336080 | Ga0207428_103360802 | 78 |
| 452 | 3300028379 | Ga0268266_10065478 | Ga0268266_100654783 | 78 |
| 453 | 3300028380 | Ga0268265_10335497 | Ga0268265_103354972 | 78 |
| 454 | 3300028380 | Ga0268265_11540367 | Ga0268265_115403672 | 78 |
| 455 | 3300028556 | Ga0265337_1094192 | Ga0265337_10941922 | 78 |
| 456 | 3300028558 | Ga0265326_10060792 | Ga0265326_100607922 | 78 |
| 457 | 3300028563 | Ga0265319_1012507 | Ga0265319_10125073 | 78 |
| 458 | 3300028573 | Ga0265334_10126677 | Ga0265334_101266772 | 78 |
| 459 | 3300028577 | Ga0265318_10026590 | Ga0265318_100265902 | 78 |
| 460 | 3300028654 | Ga0265322_10097652 | Ga0265322_100976522 | 78 |
| 461 | 3300028666 | Ga0265336_10160360 | Ga0265336_101603602 | 78 |
| 462 | 3300028800 | Ga0265338_10008087 | Ga0265338_100080871 | 78 |
| 463 | 3300028800 | Ga0265338_10023514 | Ga0265338_100235143 | 78 |
| 464 | 3300028800 | Ga0265338_10026119 | Ga0265338_100261193 | 78 |
| 465 | 3300028800 | Ga0265338_10112545 | Ga0265338_101125453 | 78 |
| 466 | 3300031235 | Ga0265330_10039496 | Ga0265330_100394962 | 78 |
| 467 | 3300031238 | Ga0265332_10008175 | Ga0265332_100081753 | 78 |
| 468 | 3300031240 | Ga0265320_10024893 | Ga0265320_100248933 | 78 |
| 469 | 3300031241 | Ga0265325_10083827 | Ga0265325_100838273 | 78 |
| 470 | 3300031242 | Ga0265329_10097310 | Ga0265329_100973101 | 78 |
| 471 | 3300031247 | Ga0265340_10011483 | Ga0265340_100114835 | 78 |
| 472 | 3300031249 | Ga0265339_10034059 | Ga0265339_100340593 | 78 |
| 473 | 3300031249 | Ga0265339_10138705 | Ga0265339_101387052 | 78 |
| 474 | 3300031250 | Ga0265331_10022073 | Ga0265331_100220734 | 78 |
| 475 | 3300031251 | Ga0265327_10009229 | Ga0265327_100092292 | 78 |
| 476 | 3300031251 | Ga0265327_10032608 | Ga0265327_100326083 | 78 |
| 477 | 3300031344 | Ga0265316_10246529 | Ga0265316_102465292 | 78 |
| 478 | 3300031548 | Ga0307408_101505677 | Ga0307408_1015056772 | 78 |
| 479 | 3300031595 | Ga0265313_10033372 | Ga0265313_100333722 | 78 |
| 480 | 3300031595 | Ga0265313_10232256 | Ga0265313_102322561 | 78 |
| 481 | 3300031711 | Ga0265314_10053808 | Ga0265314_100538083 | 78 |
| 482 | 3300031712 | Ga0265342_10112991 | Ga0265342_101129912 | 78 |
| 483 | 3300031731 | Ga0307405_10601290 | Ga0307405_106012902 | 78 |
| 484 | 3300031903 | Ga0307407_11068487 | Ga0307407_110684872 | 78 |
| 485 | 3300031911 | Ga0307412_11086913 | Ga0307412_110869132 | 78 |
| 486 | 3300031995 | Ga0307409_101781581 | Ga0307409_1017815812 | 78 |
| 487 | 3300032002 | Ga0307416_100224144 | Ga0307416_1002241442 | 78 |
| 488 | 3300032002 | Ga0307416_100291364 | Ga0307416_1002913643 | 78 |
| 489 | 3300032002 | Ga0307416_100987803 | Ga0307416_1009878032 | 78 |
| 490 | 3300032126 | Ga0307415_100116744 | Ga0307415_1001167443 | 78 |
| 491 | 3300032126 | Ga0307415_101553420 | Ga0307415_1015534202 | 78 |
| 492 | 3300032126 | Ga0307415_102351166 | Ga0307415_1023511662 | 78 |
| 493 | 3300032133 | Ga0316583_10164784 | Ga0316583_101647841 | 78 |
| 494 | 3300035117 | Ga0373953_0237012 | Ga0373953_0237012_197_436 | 78 |
| 495 | 3300035118 | Ga0373954_0445572 | Ga0373954_0445572_212_451 | 78 |
| 496 | 3300035119 | Ga0373956_0035721 | Ga0373956_0035721_339_578 | 78 |
| 497 | 3300035120 | Ga0373957_0432062 | Ga0373957_0432062_163_402 | 78 |
| 498 | 3300035121 | Ga0373960_0312332 | Ga0373960_0312332_76_318 | 78 |
| 499 | 3300035170 | Ga0373943_0433594 | Ga0373943_0433594_235_480 | 78 |
| 500 | 3300035172 | Ga0373955_0055386 | Ga0373955_0055386_1578_1817 | 78 |
| 501 | 3300035242 | Ga0373962_0183850 | Ga0373962_0183850_187_429 | 78 |
| 502 | 3300035410 | Ga0373924_0103675 | Ga0373924_0103675_351_590 | 78 |
| 503 | 3300035692 | Ga0373935_0583300 | Ga0373935_0583300_269_508 | 78 |
| 504 | 3300035724 | Ga0373933_0056141 | Ga0373933_0056141_1222_1461 | 78 |
| 505 | 3300035724 | Ga0373933_0057624 | Ga0373933_0057624_1027_1266 | 78 |
| 506 | 3300035725 | Ga0373947_0765657 | Ga0373947_0765657_68_313 | 78 |
| 507 | 3300035725 | Ga0373947_1192377 | Ga0373947_1192377_252_497 | 78 |
| 508 | 3300036401 | Ga0373937_0000107 | Ga0373937_0000107_64062_64301 | 78 |
| 509 | 3300036401 | Ga0373937_0078927 | Ga0373937_0078927_833_1072 | 78 |
| 510 | 3300037068 | Ga0373925_1141343 | Ga0373925_1141343_296_541 | 78 |
| 511 | 3300037312 | Ga0395899_0000899 | Ga0395899_0000899_9653_9901 | 78 |
| 512 | 3300037312 | Ga0395899_0033726 | Ga0395899_0033726_3046_3288 | 78 |
| 513 | 3300037312 | Ga0395899_0039855 | Ga0395899_0039855_970_1218 | 78 |
| 514 | 3300037312 | Ga0395899_0065589 | Ga0395899_0065589_556_801 | 78 |
| 515 | 3300037312 | Ga0395899_0074492 | Ga0395899_0074492_1179_1424 | 78 |
| 516 | 3300037312 | Ga0395899_0088103 | Ga0395899_0088103_1667_1915 | 78 |
| 517 | 3300037312 | Ga0395899_0305651 | Ga0395899_0305651_622_870 | 78 |
| 518 | 3300037312 | Ga0395899_0343728 | Ga0395899_0343728_612_857 | 78 |
| 519 | 3300037312 | Ga0395899_0649067 | Ga0395899_0649067_58_303 | 78 |
| 520 | 3300037418 | Ga0395900_0001819 | Ga0395900_0001819_4785_5027 | 78 |
| 521 | 3300037418 | Ga0395900_0008064 | Ga0395900_0008064_7846_8094 | 78 |
| 522 | 3300037418 | Ga0395900_0074115 | Ga0395900_0074115_1467_1712 | 78 |
| 523 | 3300037418 | Ga0395900_0076426 | Ga0395900_0076426_2366_2605 | 78 |
| 524 | 3300037418 | Ga0395900_0127255 | Ga0395900_0127255_276_515 | 78 |
| 525 | 3300037418 | Ga0395900_0156628 | Ga0395900_0156628_26_274 | 78 |
| 526 | 3300037418 | Ga0395900_0226912 | Ga0395900_0226912_193_432 | 78 |
| 527 | 3300037418 | Ga0395900_0365508 | Ga0395900_0365508_928_1173 | 78 |
| 528 | 3300037418 | Ga0395900_0431182 | Ga0395900_0431182_279_524 | 78 |
| 529 | 3300037418 | Ga0395900_0485120 | Ga0395900_0485120_442_690 | 78 |
| 530 | 3300037418 | Ga0395900_0523272 | Ga0395900_0523272_338_586 | 78 |
| 531 | 3300037418 | Ga0395900_0845139 | Ga0395900_0845139_355_597 | 78 |
| 532 | 3300037418 | Ga0395900_0879349 | Ga0395900_0879349_168_410 | 78 |
| 533 | 3300037418 | Ga0395900_0892703 | Ga0395900_0892703_417_653 | 78 |
| 534 | 3300037418 | Ga0395900_1792150 | Ga0395900_1792150_243_488 | 78 |
| 535 | 3300037418 | Ga0395900_1844673 | Ga0395900_1844673_124_366 | 78 |
| 536 | 3300037466 | Ga0395898_0002821 | Ga0395898_0002821_344_592 | 78 |
| 537 | 3300037466 | Ga0395898_0010400 | Ga0395898_0010400_2006_2251 | 78 |
| 538 | 3300037466 | Ga0395898_0014564 | Ga0395898_0014564_5098_5340 | 78 |
| 539 | 3300037466 | Ga0395898_0099324 | Ga0395898_0099324_991_1236 | 78 |
| 540 | 3300037466 | Ga0395898_0129328 | Ga0395898_0129328_798_1046 | 78 |
| 541 | 3300037466 | Ga0395898_0154541 | Ga0395898_0154541_1550_1795 | 78 |
| 542 | 3300037466 | Ga0395898_0318670 | Ga0395898_0318670_516_758 | 78 |
| 543 | 3300037466 | Ga0395898_0394951 | Ga0395898_0394951_869_1108 | 78 |
| 544 | 3300037466 | Ga0395898_0399988 | Ga0395898_0399988_247_486 | 78 |
| 545 | 3300037466 | Ga0395898_0407864 | Ga0395898_0407864_267_515 | 78 |
| 546 | 3300037466 | Ga0395898_0955296 | Ga0395898_0955296_462_701 | 78 |
| 547 | 3300037471 | Ga0395905_0002059 | Ga0395905_0002059_2410_2658 | 78 |
| 548 | 3300037471 | Ga0395905_0009197 | Ga0395905_0009197_4729_4971 | 78 |
| 549 | 3300037471 | Ga0395905_0011047 | Ga0395905_0011047_2759_3004 | 78 |
| 550 | 3300037471 | Ga0395905_0036527 | Ga0395905_0036527_2460_2708 | 78 |
| 551 | 3300037471 | Ga0395905_0067373 | Ga0395905_0067373_598_846 | 78 |
| 552 | 3300037471 | Ga0395905_0191151 | Ga0395905_0191151_413_652 | 78 |
| 553 | 3300037471 | Ga0395905_0252100 | Ga0395905_0252100_492_734 | 78 |
| 554 | 3300037471 | Ga0395905_0320176 | Ga0395905_0320176_904_1140 | 78 |
| 555 | 3300037471 | Ga0395905_0486604 | Ga0395905_0486604_338_586 | 78 |
| 556 | 3300037471 | Ga0395905_0591049 | Ga0395905_0591049_36_275 | 78 |
| 557 | 3300037471 | Ga0395905_1657961 | Ga0395905_1657961_56_301 | 78 |
| 558 | 3300038443 | Ga0395901_0000917 | Ga0395901_0000917_2027_2269 | 78 |
| 559 | 3300038443 | Ga0395901_0001352 | Ga0395901_0001352_4698_4946 | 78 |
| 560 | 3300038443 | Ga0395901_0003227 | Ga0395901_0003227_8276_8521 | 78 |
| 561 | 3300038443 | Ga0395901_0017126 | Ga0395901_0017126_817_1056 | 78 |
| 562 | 3300038443 | Ga0395901_0026735 | Ga0395901_0026735_4490_4732 | 78 |
| 563 | 3300038443 | Ga0395901_0132577 | Ga0395901_0132577_585_830 | 78 |
| 564 | 3300038443 | Ga0395901_0286259 | Ga0395901_0286259_46_285 | 78 |
| 565 | 3300038443 | Ga0395901_0335911 | Ga0395901_0335911_792_1040 | 78 |
| 566 | 3300038443 | Ga0395901_0344761 | Ga0395901_0344761_1132_1380 | 78 |
| 567 | 3300038443 | Ga0395901_0479780 | Ga0395901_0479780_309_545 | 78 |
| 568 | 3300038443 | Ga0395901_0565246 | Ga0395901_0565246_240_485 | 78 |
| 569 | 3300038443 | Ga0395901_0585281 | Ga0395901_0585281_89_331 | 78 |
| 570 | 3300038443 | Ga0395901_0752810 | Ga0395901_0752810_632_871 | 78 |
| 571 | 3300038443 | Ga0395901_1122798 | Ga0395901_1122798_334_582 | 78 |
| 572 | 3300038443 | Ga0395901_1313055 | Ga0395901_1313055_352_591 | 78 |
| 573 | 3300038443 | Ga0395901_1602679 | Ga0395901_1602679_349_594 | 78 |
| 574 | 3300039438 | Ga0436360_0132719 | Ga0436360_0132719_104_343 | 78 |
| 575 | 3300039438 | Ga0436360_1015244 | Ga0436360_1015244_1764_2003 | 78 |
| 576 | 3300041491 | Ga0451833_0239441 | Ga0451833_0239441_170_412 | 78 |
| 577 | 3300041511 | Ga0451855_1798244 | Ga0451855_1798244_159_398 | 78 |
| 578 | 3300041512 | Ga0451853_1791929 | Ga0451853_1791929_65_310 | 78 |
| 579 | 3300042005 | Ga0439448_0078823 | Ga0439448_0078823_12_251 | 78 |
| 580 | 3300042005 | Ga0439448_0079437 | Ga0439448_0079437_321_560 | 78 |
| 581 | 3300042005 | Ga0439448_0277636 | Ga0439448_0277636_57_299 | 78 |
| 582 | 3300042008 | Ga0439450_019679 | Ga0439450_019679_844_1083 | 78 |
| 583 | 3300042008 | Ga0439450_033584 | Ga0439450_033584_254_499 | 78 |
| 584 | 3300042009 | Ga0439451_042763 | Ga0439451_042763_322_567 | 78 |
| 585 | 3300042011 | Ga0439454_090411 | Ga0439454_090411_292_537 | 78 |
| 586 | 3300042012 | Ga0439455_0098260 | Ga0439455_0098260_378_623 | 78 |
| 587 | 3300042013 | Ga0439456_059429 | Ga0439456_059429_165_413 | 78 |
| 588 | 3300042122 | Ga0450920_047997 | Ga0450920_047997_466_708 | 78 |
| 589 | 3300042137 | Ga0450902_104102 | Ga0450902_104102_220_462 | 78 |
| 590 | 3300042439 | Ga0439464_0093202 | Ga0439464_0093202_325_567 | 78 |
| 591 | 3300042461 | Ga0439460_0176041 | Ga0439460_0176041_163_402 | 78 |
| 592 | 3300042461 | Ga0439460_0239623 | Ga0439460_0239623_162_401 | 78 |
| 593 | 3300042531 | Ga0450918_040246 | Ga0450918_040246_279_521 | 78 |
| 594 | 3300044658 | Ga0466972_0016553 | Ga0466972_0016553_525_779 | 78 |
| 595 | 3300044683 | Ga0466965_0260221 | Ga0466965_0260221_653_907 | 78 |
| 596 | 3300044693 | Ga0466961_0017573 | Ga0466961_0017573_3164_3418 | 78 |
| 597 | 3300044693 | Ga0466961_0077814 | Ga0466961_0077814_154_393 | 78 |
| 598 | 3300044694 | Ga0466963_0217597 | Ga0466963_0217597_953_1207 | 78 |
| 599 | 3300044694 | Ga0466963_0329895 | Ga0466963_0329895_184_423 | 78 |
| 600 | 3300044694 | Ga0466963_0650234 | Ga0466963_0650234_174_413 | 78 |
| 601 | 3300044694 | Ga0466963_0673814 | Ga0466963_0673814_270_530 | 78 |
| 602 | 3300044706 | Ga0466964_0113947 | Ga0466964_0113947_326_580 | 78 |
| 603 | 3300044706 | Ga0466964_0245669 | Ga0466964_0245669_493_747 | 78 |
| 604 | 3300044719 | Ga0466971_0081293 | Ga0466971_0081293_718_957 | 78 |
| 605 | 3300044719 | Ga0466971_0253084 | Ga0466971_0253084_40_294 | 78 |
| 606 | 3300044765 | Ga0466970_0607957 | Ga0466970_0607957_166_420 | 78 |
| 607 | 3300044842 | Ga0466957_0105165 | Ga0466957_0105165_1349_1588 | 78 |
| 608 | 3300044842 | Ga0466957_0176181 | Ga0466957_0176181_998_1237 | 78 |
| 609 | 3300044842 | Ga0466957_0423699 | Ga0466957_0423699_277_513 | 78 |
| 610 | 3300045049 | Ga0466959_0262391 | Ga0466959_0262391_339_578 | 78 |
| 611 | 3300045049 | Ga0466959_0350673 | Ga0466959_0350673_166_420 | 78 |
| 612 | 3300045836 | Ga0466958_0011964 | Ga0466958_0011964_4020_4259 | 78 |
| 613 | 3300045836 | Ga0466958_0610338 | Ga0466958_0610338_226_465 | 78 |
| 614 | 3300045976 | Ga0466967_0009992 | Ga0466967_0009992_4977_5216 | 78 |
| 615 | 3300045976 | Ga0466967_0014130 | Ga0466967_0014130_663_923 | 78 |
| 616 | 3300045976 | Ga0466967_0064089 | Ga0466967_0064089_1191_1445 | 78 |
| 617 | 3300045976 | Ga0466967_0067528 | Ga0466967_0067528_2352_2591 | 78 |
| 618 | 3300045976 | Ga0466967_0118104 | Ga0466967_0118104_181_435 | 78 |
| 619 | 3300045976 | Ga0466967_0160582 | Ga0466967_0160582_802_1041 | 78 |
| 620 | 3300045976 | Ga0466967_0306646 | Ga0466967_0306646_519_773 | 78 |
| 621 | 3300045976 | Ga0466967_1363259 | Ga0466967_1363259_127_366 | 78 |
| 622 | 3300045976 | Ga0466967_1710466 | Ga0466967_1710466_289_528 | 78 |
| 623 | 3300046454 | Ga0495592_0000089 | Ga0495592_0000089_66291_66530 | 78 |
| 624 | 3300046455 | Ga0495603_0869909 | Ga0495603_0869909_147_395 | 78 |
| 625 | 3300046459 | Ga0495629_0308517 | Ga0495629_0308517_754_993 | 78 |
| 626 | 3300046462 | Ga0495651_0000057 | Ga0495651_0000057_68223_68462 | 78 |
| 627 | 3300046462 | Ga0495651_0030418 | Ga0495651_0030418_960_1199 | 78 |
| 628 | 3300046462 | Ga0495651_0469952 | Ga0495651_0469952_109_348 | 78 |
| 629 | 3300046462 | Ga0495651_0585080 | Ga0495651_0585080_170_409 | 78 |
| 630 | 3300046463 | Ga0495653_0000641 | Ga0495653_0000641_15402_15641 | 78 |
| 631 | 3300046463 | Ga0495653_0012796 | Ga0495653_0012796_1217_1456 | 78 |
| 632 | 3300046463 | Ga0495653_0167405 | Ga0495653_0167405_1102_1341 | 78 |
| 633 | 3300046473 | Ga0495582_0532195 | Ga0495582_0532195_111_353 | 78 |
| 634 | 3300046474 | Ga0495605_0052282 | Ga0495605_0052282_848_1096 | 78 |
| 635 | 3300046475 | Ga0495639_0475808 | Ga0495639_0475808_47_289 | 78 |
| 636 | 3300046477 | Ga0495664_0210699 | Ga0495664_0210699_613_852 | 78 |
| 637 | 3300046477 | Ga0495664_0781379 | Ga0495664_0781379_245_484 | 78 |
| 638 | 3300046491 | Ga0495584_0321237 | Ga0495584_0321237_333_581 | 78 |
| 639 | 3300046492 | Ga0495585_0141647 | Ga0495585_0141647_916_1164 | 78 |
| 640 | 3300046500 | Ga0495596_0135555 | Ga0495596_0135555_157_405 | 78 |
| 641 | 3300046500 | Ga0495596_0318428 | Ga0495596_0318428_296_544 | 78 |
| 642 | 3300046506 | Ga0495583_0237226 | Ga0495583_0237226_186_434 | 78 |
| 643 | 3300046511 | Ga0495608_0002394 | Ga0495608_0002394_3844_4083 | 78 |
| 644 | 3300046511 | Ga0495608_0042314 | Ga0495608_0042314_2011_2250 | 78 |
| 645 | 3300046511 | Ga0495608_0193870 | Ga0495608_0193870_174_413 | 78 |
| 646 | 3300046513 | Ga0495616_0220076 | Ga0495616_0220076_128_376 | 78 |
| 647 | 3300046514 | Ga0495618_0000832 | Ga0495618_0000832_20232_20471 | 78 |
| 648 | 3300046514 | Ga0495618_0088590 | Ga0495618_0088590_1589_1828 | 78 |
| 649 | 3300046516 | Ga0495628_0000066 | Ga0495628_0000066_14454_14693 | 78 |
| 650 | 3300046516 | Ga0495628_0282141 | Ga0495628_0282141_359_598 | 78 |
| 651 | 3300046517 | Ga0495630_0271871 | Ga0495630_0271871_217_456 | 78 |
| 652 | 3300046518 | Ga0495631_0108297 | Ga0495631_0108297_681_929 | 78 |
| 653 | 3300046518 | Ga0495631_0356589 | Ga0495631_0356589_180_428 | 78 |
| 654 | 3300046523 | Ga0495644_0091267 | Ga0495644_0091267_508_756 | 78 |
| 655 | 3300046525 | Ga0495663_0024879 | Ga0495663_0024879_1160_1408 | 78 |
| 656 | 3300046525 | Ga0495663_0058484 | Ga0495663_0058484_913_1161 | 78 |
| 657 | 3300046528 | Ga0495642_0021427 | Ga0495642_0021427_2063_2311 | 78 |
| 658 | 3300046528 | Ga0495642_0118521 | Ga0495642_0118521_32_280 | 78 |
| 659 | 3300046529 | Ga0495652_0000118 | Ga0495652_0000118_14461_14700 | 78 |
| 660 | 3300046529 | Ga0495652_0398270 | Ga0495652_0398270_237_476 | 78 |
| 661 | 3300046535 | Ga0495586_0175031 | Ga0495586_0175031_702_941 | 78 |
| 662 | 3300046535 | Ga0495586_0920010 | Ga0495586_0920010_223_465 | 78 |
| 663 | 3300046536 | Ga0495587_0001162 | Ga0495587_0001162_2614_2853 | 78 |
| 664 | 3300046536 | Ga0495587_0195143 | Ga0495587_0195143_85_324 | 78 |
| 665 | 3300046536 | Ga0495587_0398394 | Ga0495587_0398394_425_664 | 78 |
| 666 | 3300046538 | Ga0495609_0079699 | Ga0495609_0079699_521_769 | 78 |
| 667 | 3300046543 | Ga0495645_0000052 | Ga0495645_0000052_70902_71141 | 78 |
| 668 | 3300046543 | Ga0495645_0357767 | Ga0495645_0357767_194_433 | 78 |
| 669 | 3300046559 | Ga0495667_0043796 | Ga0495667_0043796_1478_1717 | 78 |
| 670 | 3300046559 | Ga0495667_0047887 | Ga0495667_0047887_834_1073 | 78 |
| 671 | 3300046615 | Ga0495656_0070394 | Ga0495656_0070394_691_939 | 78 |
| 672 | 3300046616 | Ga0495668_0089129 | Ga0495668_0089129_1238_1486 | 78 |
| 673 | 3300046642 | Ga0495634_0009599 | Ga0495634_0009599_1776_2015 | 78 |
| 674 | 3300046642 | Ga0495634_0147655 | Ga0495634_0147655_353_592 | 78 |
| 675 | 3300046642 | Ga0495634_0234040 | Ga0495634_0234040_128_370 | 78 |
| 676 | 3300046642 | Ga0495634_0637879 | Ga0495634_0637879_268_504 | 78 |
| 677 | 3300046663 | Ga0495635_0186492 | Ga0495635_0186492_337_576 | 78 |
| 678 | 3300046664 | Ga0495659_0056842 | Ga0495659_0056842_1012_1260 | 78 |
| 679 | 3300046665 | Ga0495661_0066017 | Ga0495661_0066017_992_1240 | 78 |
| 680 | 3300046674 | Ga0495588_0164349 | Ga0495588_0164349_808_1056 | 78 |
| 681 | 3300046675 | Ga0495657_0027126 | Ga0495657_0027126_2740_2979 | 78 |
| 682 | 3300046675 | Ga0495657_0414223 | Ga0495657_0414223_161_400 | 78 |
| 683 | 3300046678 | Ga0495599_0000046 | Ga0495599_0000046_71007_71246 | 78 |
| 684 | 3300046678 | Ga0495599_0344502 | Ga0495599_0344502_549_788 | 78 |
| 685 | 3300046679 | Ga0495623_0001356 | Ga0495623_0001356_14462_14701 | 78 |
| 686 | 3300046679 | Ga0495623_0250066 | Ga0495623_0250066_58_297 | 78 |
| 687 | 3300046680 | Ga0495646_0002939 | Ga0495646_0002939_3823_4062 | 78 |
| 688 | 3300046681 | Ga0495647_0036699 | Ga0495647_0036699_361_603 | 78 |
| 689 | 3300046683 | Ga0495658_1057622 | Ga0495658_1057622_177_419 | 78 |
| 690 | 3300046690 | Ga0495624_0124582 | Ga0495624_0124582_785_1024 | 78 |
| 691 | 3300046690 | Ga0495624_0608806 | Ga0495624_0608806_218_457 | 78 |
| 692 | 3300046692 | Ga0495671_0389918 | Ga0495671_0389918_393_641 | 78 |
| 693 | 3300046794 | Ga0495589_0015657 | Ga0495589_0015657_2620_2868 | 78 |
| 694 | 3300046794 | Ga0495589_0245831 | Ga0495589_0245831_197_439 | 78 |
| 695 | 3300046809 | Ga0495600_0154298 | Ga0495600_0154298_980_1219 | 78 |
| 696 | 3300046809 | Ga0495600_0307726 | Ga0495600_0307726_518_757 | 78 |
| 697 | 3300047315 | Ga0495581_0410793 | Ga0495581_0410793_134_376 | 78 |
| 698 | 3300047317 | Ga0495604_0000075 | Ga0495604_0000075_70650_70889 | 78 |
| 699 | 3300047317 | Ga0495604_0166789 | Ga0495604_0166789_1265_1504 | 78 |
| 700 | 3300047318 | Ga0495636_0596863 | Ga0495636_0596863_96_344 | 78 |
| 701 | 3300047319 | Ga0495674_0220969 | Ga0495674_0220969_77_316 | 78 |
| 702 | 3300047319 | Ga0495674_0252189 | Ga0495674_0252189_509_748 | 78 |
| 703 | 3300047319 | Ga0495674_0292541 | Ga0495674_0292541_291_530 | 78 |
| 704 | 3300047319 | Ga0495674_0350916 | Ga0495674_0350916_427_666 | 78 |
| 705 | 3300047319 | Ga0495674_0621157 | Ga0495674_0621157_491_730 | 78 |
| 706 | 3300047322 | Ga0495680_0007302 | Ga0495680_0007302_8978_9217 | 78 |
| 707 | 3300047322 | Ga0495680_0058384 | Ga0495680_0058384_2121_2360 | 78 |
| 708 | 3300047322 | Ga0495680_0903230 | Ga0495680_0903230_202_441 | 78 |
| 709 | 3300047444 | Ga0495675_0000705 | Ga0495675_0000705_14486_14725 | 78 |
| 710 | 3300047444 | Ga0495675_0085883 | Ga0495675_0085883_816_1055 | 78 |
| 711 | 3300047447 | Ga0495685_060342 | Ga0495685_060342_378_626 | 78 |
| 712 | 3300047471 | Ga0495684_0036579 | Ga0495684_0036579_2854_3093 | 78 |
| 713 | 3300047471 | Ga0495684_0793246 | Ga0495684_0793246_214_453 | 78 |
| 714 | 3300047673 | Ga0495593_0203457 | Ga0495593_0203457_665_904 | 78 |
| 715 | 3300048088 | Ga0495602_0002990 | Ga0495602_0002990_14482_14721 | 78 |
| 716 | 3300048088 | Ga0495602_0538266 | Ga0495602_0538266_138_374 | 78 |
| 717 | 3300048903 | Ga0496100_0622352 | Ga0496100_0622352_337_582 | 78 |
| 718 | 3300048903 | Ga0496100_0787960 | Ga0496100_0787960_30_269 | 78 |
| 719 | 3300048903 | Ga0496100_1172688 | Ga0496100_1172688_132_377 | 78 |
| 720 | 3300048904 | Ga0496101_0201903 | Ga0496101_0201903_202_447 | 78 |
| 721 | 3300048904 | Ga0496101_0492969 | Ga0496101_0492969_555_794 | 78 |
| 722 | 3300048904 | Ga0496101_1427724 | Ga0496101_1427724_247_489 | 78 |
| 723 | 3300048905 | Ga0496102_0086584 | Ga0496102_0086584_621_872 | 78 |
| 724 | 3300048905 | Ga0496102_0181644 | Ga0496102_0181644_33_287 | 78 |
| 725 | 3300048906 | Ga0496103_0192875 | Ga0496103_0192875_199_453 | 78 |
| 726 | 3300048907 | Ga0496104_0328289 | Ga0496104_0328289_933_1178 | 78 |
| 727 | 3300048907 | Ga0496104_0423607 | Ga0496104_0423607_196_438 | 78 |
| 728 | 3300048907 | Ga0496104_0457095 | Ga0496104_0457095_329_568 | 78 |
| 729 | 3300048908 | Ga0496105_0084762 | Ga0496105_0084762_387_629 | 78 |
| 730 | 3300048908 | Ga0496105_0400410 | Ga0496105_0400410_53_298 | 78 |
| 731 | 3300048909 | Ga0496106_0409389 | Ga0496106_0409389_709_954 | 78 |
| 732 | 3300048909 | Ga0496106_1077996 | Ga0496106_1077996_310_555 | 78 |
| 733 | 3300048909 | Ga0496106_1539609 | Ga0496106_1539609_36_278 | 78 |
| 734 | 3300048910 | Ga0496107_0309572 | Ga0496107_0309572_710_952 | 78 |
| 735 | 3300048910 | Ga0496107_0971406 | Ga0496107_0971406_193_435 | 78 |
| 736 | 3300048910 | Ga0496107_1070092 | Ga0496107_1070092_295_540 | 78 |
| 737 | 3300048911 | Ga0496108_0022352 | Ga0496108_0022352_2504_2743 | 78 |
| 738 | 3300048911 | Ga0496108_0059522 | Ga0496108_0059522_702_947 | 78 |
| 739 | 3300048911 | Ga0496108_0074390 | Ga0496108_0074390_12_254 | 78 |
| 740 | 3300048911 | Ga0496108_0138184 | Ga0496108_0138184_1555_1800 | 78 |
| 741 | 3300048911 | Ga0496108_0803076 | Ga0496108_0803076_388_630 | 78 |
| 742 | 3300048911 | Ga0496108_1101042 | Ga0496108_1101042_60_299 | 78 |
| 743 | 3300048912 | Ga0496109_0247909 | Ga0496109_0247909_216_461 | 78 |
| 744 | 3300048912 | Ga0496109_0263204 | Ga0496109_0263204_776_1018 | 78 |
| 745 | 3300048912 | Ga0496109_0773130 | Ga0496109_0773130_140_379 | 78 |
| 746 | 3300048913 | Ga0496110_0176158 | Ga0496110_0176158_43_288 | 78 |
| 747 | 3300048913 | Ga0496110_0248008 | Ga0496110_0248008_408_650 | 78 |
| 748 | 3300048913 | Ga0496110_0458235 | Ga0496110_0458235_283_525 | 78 |
| 749 | 3300048913 | Ga0496110_0796333 | Ga0496110_0796333_400_645 | 78 |
| 750 | 3300048913 | Ga0496110_0956589 | Ga0496110_0956589_265_513 | 78 |
| 751 | 3300048913 | Ga0496110_0985052 | Ga0496110_0985052_302_547 | 78 |
| 752 | 3300048913 | Ga0496110_1313119 | Ga0496110_1313119_258_506 | 78 |
| 753 | 3300048914 | Ga0496111_0212914 | Ga0496111_0212914_876_1121 | 78 |
| 754 | 3300048914 | Ga0496111_0332406 | Ga0496111_0332406_231_473 | 78 |
| 755 | 3300048914 | Ga0496111_0578302 | Ga0496111_0578302_359_598 | 78 |
| 756 | 3300048915 | Ga0496112_0000293 | Ga0496112_0000293_18180_18422 | 78 |
| 757 | 3300048915 | Ga0496112_0790703 | Ga0496112_0790703_339_584 | 78 |
| 758 | 3300048916 | Ga0496113_0243658 | Ga0496113_0243658_874_1119 | 78 |
| 759 | 3300048916 | Ga0496113_0396456 | Ga0496113_0396456_779_1021 | 78 |
| 760 | 3300048916 | Ga0496113_0416035 | Ga0496113_0416035_295_540 | 78 |
| 761 | 3300048916 | Ga0496113_0735353 | Ga0496113_0735353_498_737 | 78 |
| 762 | 3300048917 | Ga0496114_0102177 | Ga0496114_0102177_1872_2111 | 78 |
| 763 | 3300048917 | Ga0496114_0495863 | Ga0496114_0495863_118_360 | 78 |
| 764 | 3300049568 | Ga0501031_0000336 | Ga0501031_0000336_18173_18421 | 78 |
| 765 | 3300049568 | Ga0501031_0003836 | Ga0501031_0003836_7487_7729 | 78 |
| 766 | 3300049568 | Ga0501031_0232168 | Ga0501031_0232168_586_834 | 78 |
| 767 | 3300049568 | Ga0501031_0336455 | Ga0501031_0336455_400_648 | 78 |
| 768 | 3300049568 | Ga0501031_0786328 | Ga0501031_0786328_47_292 | 78 |
| 769 | 3300049569 | Ga0501032_0002775 | Ga0501032_0002775_4596_4844 | 78 |
| 770 | 3300049569 | Ga0501032_0026680 | Ga0501032_0026680_1462_1704 | 78 |
| 771 | 3300049569 | Ga0501032_0155787 | Ga0501032_0155787_441_689 | 78 |
| 772 | 3300049570 | Ga0501033_0000239 | Ga0501033_0000239_43785_44033 | 78 |
| 773 | 3300049570 | Ga0501033_0037937 | Ga0501033_0037937_1521_1763 | 78 |
| 774 | 3300049570 | Ga0501033_0269747 | Ga0501033_0269747_54_302 | 78 |
| 775 | 3300049570 | Ga0501033_0423147 | Ga0501033_0423147_327_575 | 78 |
| 776 | 3300049571 | Ga0501034_0050743 | Ga0501034_0050743_255_494 | 78 |
| 777 | 3300049571 | Ga0501034_0051397 | Ga0501034_0051397_1622_1870 | 78 |
| 778 | 3300049571 | Ga0501034_0356250 | Ga0501034_0356250_655_897 | 78 |
| 779 | 3300049571 | Ga0501034_1095400 | Ga0501034_1095400_190_438 | 78 |
| 780 | 3300049572 | Ga0501036_0000107 | Ga0501036_0000107_8797_9045 | 78 |
| 781 | 3300049572 | Ga0501036_0003875 | Ga0501036_0003875_5859_6107 | 78 |
| 782 | 3300049572 | Ga0501036_0017006 | Ga0501036_0017006_2690_2932 | 78 |
| 783 | 3300049572 | Ga0501036_0810230 | Ga0501036_0810230_59_295 | 78 |
| 784 | 3300049572 | Ga0501036_0835538 | Ga0501036_0835538_164_412 | 78 |
| 785 | 3300049573 | Ga0501037_0002426 | Ga0501037_0002426_8156_8404 | 78 |
| 786 | 3300049573 | Ga0501037_0007718 | Ga0501037_0007718_6089_6331 | 78 |
| 787 | 3300049573 | Ga0501037_0298950 | Ga0501037_0298950_359_607 | 78 |
| 788 | 3300049574 | Ga0501038_0000367 | Ga0501038_0000367_34314_34562 | 78 |
| 789 | 3300049574 | Ga0501038_0020533 | Ga0501038_0020533_3010_3252 | 78 |
| 790 | 3300049574 | Ga0501038_0057518 | Ga0501038_0057518_1814_2062 | 78 |
| 791 | 3300049575 | Ga0501039_0001687 | Ga0501039_0001687_7234_7482 | 78 |
| 792 | 3300049575 | Ga0501039_0005193 | Ga0501039_0005193_6783_7025 | 78 |
| 793 | 3300049575 | Ga0501039_0204975 | Ga0501039_0204975_801_1049 | 78 |
| 794 | 3300049575 | Ga0501039_0400736 | Ga0501039_0400736_16_264 | 78 |
| 795 | 3300049576 | Ga0501040_0002117 | Ga0501040_0002117_3754_4002 | 78 |
| 796 | 3300049576 | Ga0501040_0003511 | Ga0501040_0003511_4203_4451 | 78 |
| 797 | 3300049576 | Ga0501040_0009653 | Ga0501040_0009653_3509_3757 | 78 |
| 798 | 3300049576 | Ga0501040_0032657 | Ga0501040_0032657_1160_1408 | 78 |
| 799 | 3300049576 | Ga0501040_0038291 | Ga0501040_0038291_794_1036 | 78 |
| 800 | 3300049576 | Ga0501040_0132277 | Ga0501040_0132277_753_1001 | 78 |
| 801 | 3300049576 | Ga0501040_0279125 | Ga0501040_0279125_258_494 | 78 |
| 802 | 3300049576 | Ga0501040_0342477 | Ga0501040_0342477_646_888 | 78 |
| 803 | 3300049576 | Ga0501040_0378986 | Ga0501040_0378986_240_491 | 78 |
| 804 | 3300049576 | Ga0501040_0442439 | Ga0501040_0442439_56_304 | 78 |
| 805 | 3300049576 | Ga0501040_0901522 | Ga0501040_0901522_153_395 | 78 |
| 806 | 3300049577 | Ga0501041_0000011 | Ga0501041_0000011_49685_49933 | 78 |
| 807 | 3300049577 | Ga0501041_0018083 | Ga0501041_0018083_1680_1922 | 78 |
| 808 | 3300049577 | Ga0501041_0054200 | Ga0501041_0054200_1893_2141 | 78 |
| 809 | 3300049577 | Ga0501041_0064201 | Ga0501041_0064201_212_460 | 78 |
| 810 | 3300049577 | Ga0501041_0084635 | Ga0501041_0084635_711_959 | 78 |
| 811 | 3300049578 | Ga0501042_0000956 | Ga0501042_0000956_8797_9045 | 78 |
| 812 | 3300049578 | Ga0501042_0010432 | Ga0501042_0010432_4274_4522 | 78 |
| 813 | 3300049578 | Ga0501042_0011243 | Ga0501042_0011243_4138_4380 | 78 |
| 814 | 3300049578 | Ga0501042_0038064 | Ga0501042_0038064_2724_2972 | 78 |
| 815 | 3300049578 | Ga0501042_0549701 | Ga0501042_0549701_227_463 | 78 |
| 816 | 3300049578 | Ga0501042_0606232 | Ga0501042_0606232_55_300 | 78 |
| 817 | 3300049579 | Ga0501043_0000477 | Ga0501043_0000477_8797_9045 | 78 |
| 818 | 3300049579 | Ga0501043_0051175 | Ga0501043_0051175_1453_1695 | 78 |
| 819 | 3300049579 | Ga0501043_0070198 | Ga0501043_0070198_2026_2274 | 78 |
| 820 | 3300049579 | Ga0501043_0273761 | Ga0501043_0273761_729_977 | 78 |
| 821 | 3300049580 | Ga0501046_0001077 | Ga0501046_0001077_8797_9045 | 78 |
| 822 | 3300049580 | Ga0501046_0024131 | Ga0501046_0024131_4241_4483 | 78 |
| 823 | 3300049580 | Ga0501046_0025741 | Ga0501046_0025741_2078_2326 | 78 |
| 824 | 3300049580 | Ga0501046_0058485 | Ga0501046_0058485_789_1037 | 78 |
| 825 | 3300049580 | Ga0501046_0070562 | Ga0501046_0070562_536_778 | 78 |
| 826 | 3300049580 | Ga0501046_0118241 | Ga0501046_0118241_790_1026 | 78 |
| 827 | 3300049580 | Ga0501046_0588119 | Ga0501046_0588119_407_667 | 78 |
| 828 | 3300049580 | Ga0501046_1108360 | Ga0501046_1108360_190_438 | 78 |
| 829 | 3300049581 | Ga0501047_0000743 | Ga0501047_0000743_24964_25212 | 78 |
| 830 | 3300049581 | Ga0501047_0351479 | Ga0501047_0351479_1017_1256 | 78 |
| 831 | 3300049581 | Ga0501047_0506613 | Ga0501047_0506613_234_476 | 78 |
| 832 | 3300049582 | Ga0501048_0000339 | Ga0501048_0000339_23241_23489 | 78 |
| 833 | 3300049582 | Ga0501048_0017103 | Ga0501048_0017103_2319_2561 | 78 |
| 834 | 3300049582 | Ga0501048_0033807 | Ga0501048_0033807_3184_3432 | 78 |
| 835 | 3300049582 | Ga0501048_0394608 | Ga0501048_0394608_35_283 | 78 |
| 836 | 3300049582 | Ga0501048_0822432 | Ga0501048_0822432_243_491 | 78 |
| 837 | 3300049582 | Ga0501048_1409981 | Ga0501048_1409981_146_394 | 78 |
| 838 | 3300049583 | Ga0501067_0042145 | Ga0501067_0042145_263_517 | 78 |
| 839 | 3300049583 | Ga0501067_0074363 | Ga0501067_0074363_1366_1605 | 78 |
| 840 | 3300049584 | Ga0501068_0000241 | Ga0501068_0000241_17720_17968 | 78 |
| 841 | 3300049584 | Ga0501068_0035098 | Ga0501068_0035098_58_300 | 78 |
| 842 | 3300049584 | Ga0501068_0080064 | Ga0501068_0080064_1547_1795 | 78 |
| 843 | 3300049584 | Ga0501068_1175376 | Ga0501068_1175376_112_354 | 78 |
| 844 | 3300049585 | Ga0501069_0001803 | Ga0501069_0001803_8797_9045 | 78 |
| 845 | 3300049585 | Ga0501069_0005142 | Ga0501069_0005142_1195_1449 | 78 |
| 846 | 3300049585 | Ga0501069_0040222 | Ga0501069_0040222_2109_2369 | 78 |
| 847 | 3300049585 | Ga0501069_0382141 | Ga0501069_0382141_348_596 | 78 |
| 848 | 3300049586 | Ga0501070_0002434 | Ga0501070_0002434_8911_9159 | 78 |
| 849 | 3300049586 | Ga0501070_0029175 | Ga0501070_0029175_1570_1812 | 78 |
| 850 | 3300049586 | Ga0501070_0168950 | Ga0501070_0168950_508_756 | 78 |
| 851 | 3300049586 | Ga0501070_0170893 | Ga0501070_0170893_929_1168 | 78 |
| 852 | 3300049586 | Ga0501070_0442366 | Ga0501070_0442366_604_864 | 78 |
| 853 | 3300049586 | Ga0501070_0887159 | Ga0501070_0887159_93_347 | 78 |
| 854 | 3300049587 | Ga0501071_0000208 | Ga0501071_0000208_8797_9045 | 78 |
| 855 | 3300049587 | Ga0501071_0013896 | Ga0501071_0013896_973_1221 | 78 |
| 856 | 3300049587 | Ga0501071_0044818 | Ga0501071_0044818_2803_3045 | 78 |
| 857 | 3300049587 | Ga0501071_0137599 | Ga0501071_0137599_1469_1714 | 78 |
| 858 | 3300049587 | Ga0501071_0244787 | Ga0501071_0244787_94_342 | 78 |
| 859 | 3300049587 | Ga0501071_0416725 | Ga0501071_0416725_750_992 | 78 |
| 860 | 3300049587 | Ga0501071_1340349 | Ga0501071_1340349_53_301 | 78 |
| 861 | 3300049588 | Ga0501072_0000561 | Ga0501072_0000561_8797_9045 | 78 |
| 862 | 3300049588 | Ga0501072_0005900 | Ga0501072_0005900_8870_9118 | 78 |
| 863 | 3300049588 | Ga0501072_0007361 | Ga0501072_0007361_2088_2330 | 78 |
| 864 | 3300049588 | Ga0501072_0036282 | Ga0501072_0036282_1473_1721 | 78 |
| 865 | 3300049588 | Ga0501072_0056996 | Ga0501072_0056996_867_1115 | 78 |
| 866 | 3300049588 | Ga0501072_0259981 | Ga0501072_0259981_144_392 | 78 |
| 867 | 3300049588 | Ga0501072_1543132 | Ga0501072_1543132_18_263 | 78 |
| 868 | 3300049589 | Ga0501073_0004141 | Ga0501073_0004141_3400_3648 | 78 |
| 869 | 3300049589 | Ga0501073_0006396 | Ga0501073_0006396_6565_6804 | 78 |
| 870 | 3300049589 | Ga0501073_0015245 | Ga0501073_0015245_4784_5026 | 78 |
| 871 | 3300049589 | Ga0501073_1198392 | Ga0501073_1198392_262_510 | 78 |
| 872 | 3300049590 | Ga0501074_0000158 | Ga0501074_0000158_8797_9045 | 78 |
| 873 | 3300049590 | Ga0501074_0010003 | Ga0501074_0010003_2585_2827 | 78 |
| 874 | 3300049590 | Ga0501074_0028216 | Ga0501074_0028216_94_342 | 78 |
| 875 | 3300049590 | Ga0501074_0044191 | Ga0501074_0044191_1444_1683 | 78 |
| 876 | 3300049590 | Ga0501074_0126067 | Ga0501074_0126067_391_639 | 78 |
| 877 | 3300049590 | Ga0501074_0145113 | Ga0501074_0145113_489_731 | 78 |
| 878 | 3300049590 | Ga0501074_0246021 | Ga0501074_0246021_267_527 | 78 |
| 879 | 3300049591 | Ga0501075_0000556 | Ga0501075_0000556_4613_4861 | 78 |
| 880 | 3300049591 | Ga0501075_0007488 | Ga0501075_0007488_4858_5106 | 78 |
| 881 | 3300049591 | Ga0501075_0008178 | Ga0501075_0008178_257_499 | 78 |
| 882 | 3300049591 | Ga0501075_0033340 | Ga0501075_0033340_1357_1605 | 78 |
| 883 | 3300049591 | Ga0501075_0099300 | Ga0501075_0099300_1677_1925 | 78 |
| 884 | 3300049591 | Ga0501075_0258764 | Ga0501075_0258764_516_758 | 78 |
| 885 | 3300049591 | Ga0501075_0323447 | Ga0501075_0323447_235_483 | 78 |
| 886 | 3300049591 | Ga0501075_0325181 | Ga0501075_0325181_443_688 | 78 |
| 887 | 3300049591 | Ga0501075_0616422 | Ga0501075_0616422_187_435 | 78 |
| 888 | 3300049591 | Ga0501075_1257106 | Ga0501075_1257106_60_296 | 78 |
| 889 | 3300049592 | Ga0501076_0000289 | Ga0501076_0000289_26639_26887 | 78 |
| 890 | 3300049592 | Ga0501076_0004159 | Ga0501076_0004159_9002_9250 | 78 |
| 891 | 3300049592 | Ga0501076_0008407 | Ga0501076_0008407_5590_5838 | 78 |
| 892 | 3300049592 | Ga0501076_0009583 | Ga0501076_0009583_4241_4483 | 78 |
| 893 | 3300049592 | Ga0501076_0020823 | Ga0501076_0020823_544_792 | 78 |
| 894 | 3300049592 | Ga0501076_0186225 | Ga0501076_0186225_1272_1520 | 78 |
| 895 | 3300049592 | Ga0501076_0783056 | Ga0501076_0783056_485_730 | 78 |
| 896 | 3300049592 | Ga0501076_0902275 | Ga0501076_0902275_369_614 | 78 |
| 897 | 3300049593 | Ga0501077_0000371 | Ga0501077_0000371_17763_18011 | 78 |
| 898 | 3300049593 | Ga0501077_0003869 | Ga0501077_0003869_134_379 | 78 |
| 899 | 3300049593 | Ga0501077_0005270 | Ga0501077_0005270_5418_5666 | 78 |
| 900 | 3300049593 | Ga0501077_0011683 | Ga0501077_0011683_4144_4386 | 78 |
| 901 | 3300049593 | Ga0501077_0057129 | Ga0501077_0057129_1858_2106 | 78 |
| 902 | 3300049593 | Ga0501077_0484242 | Ga0501077_0484242_303_542 | 78 |
| 903 | 3300049741 | Ga0501079_0000053 | Ga0501079_0000053_42027_42275 | 78 |
| 904 | 3300049741 | Ga0501079_0005980 | Ga0501079_0005980_4758_5006 | 78 |
| 905 | 3300049741 | Ga0501079_0032307 | Ga0501079_0032307_2839_3081 | 78 |
| 906 | 3300049741 | Ga0501079_0144682 | Ga0501079_0144682_1163_1411 | 78 |
| 907 | 3300049741 | Ga0501079_0156699 | Ga0501079_0156699_378_614 | 78 |
| 908 | 3300049741 | Ga0501079_0171377 | Ga0501079_0171377_1276_1524 | 78 |
| 909 | 3300049741 | Ga0501079_0281079 | Ga0501079_0281079_49_291 | 78 |
| 910 | 3300049741 | Ga0501079_0882168 | Ga0501079_0882168_261_500 | 78 |
| 911 | 3300049742 | Ga0501080_0000136 | Ga0501080_0000136_8796_9044 | 78 |
| 912 | 3300049742 | Ga0501080_0018701 | Ga0501080_0018701_2558_2797 | 78 |
| 913 | 3300049742 | Ga0501080_0039262 | Ga0501080_0039262_4142_4384 | 78 |
| 914 | 3300049742 | Ga0501080_0226816 | Ga0501080_0226816_732_980 | 78 |
| 915 | 3300049742 | Ga0501080_0252691 | Ga0501080_0252691_1308_1556 | 78 |
| 916 | 3300049742 | Ga0501080_0389757 | Ga0501080_0389757_598_849 | 78 |
| 917 | 3300049743 | Ga0501081_0000025 | Ga0501081_0000025_49685_49933 | 78 |
| 918 | 3300049743 | Ga0501081_0018256 | Ga0501081_0018256_1008_1256 | 78 |
| 919 | 3300049743 | Ga0501081_0018414 | Ga0501081_0018414_236_478 | 78 |
| 920 | 3300049743 | Ga0501081_0021016 | Ga0501081_0021016_1889_2137 | 78 |
| 921 | 3300049743 | Ga0501081_0021111 | Ga0501081_0021111_1217_1459 | 78 |
| 922 | 3300049743 | Ga0501081_0081074 | Ga0501081_0081074_1914_2162 | 78 |
| 923 | 3300049743 | Ga0501081_0616417 | Ga0501081_0616417_501_743 | 78 |
| 924 | 3300049743 | Ga0501081_0830194 | Ga0501081_0830194_103_348 | 78 |
| 925 | 3300049743 | Ga0501081_1154503 | Ga0501081_1154503_282_518 | 78 |
| 926 | 3300049744 | Ga0501083_0000234 | Ga0501083_0000234_26639_26887 | 78 |
| 927 | 3300049744 | Ga0501083_0023011 | Ga0501083_0023011_2540_2782 | 78 |
| 928 | 3300049744 | Ga0501083_0176130 | Ga0501083_0176130_736_984 | 78 |
| 929 | 3300049822 | Ga0501035_0002443 | Ga0501035_0002443_7234_7482 | 78 |
| 930 | 3300049822 | Ga0501035_0016946 | Ga0501035_0016946_1510_1752 | 78 |
| 931 | 3300049822 | Ga0501035_0047089 | Ga0501035_0047089_196_444 | 78 |
| 932 | 3300049822 | Ga0501035_0648188 | Ga0501035_0648188_431_679 | 78 |
| 933 | 3300049822 | Ga0501035_0811104 | Ga0501035_0811104_229_489 | 78 |
| 934 | 3300049823 | Ga0501044_0011199 | Ga0501044_0011199_7154_7402 | 78 |
| 935 | 3300049823 | Ga0501044_0192855 | Ga0501044_0192855_1576_1818 | 78 |
| 936 | 3300049823 | Ga0501044_0617968 | Ga0501044_0617968_348_596 | 78 |
| 937 | 3300049824 | Ga0501045_0000035 | Ga0501045_0000035_49685_49933 | 78 |
| 938 | 3300049824 | Ga0501045_0006706 | Ga0501045_0006706_5532_5780 | 78 |
| 939 | 3300049824 | Ga0501045_0007494 | Ga0501045_0007494_2568_2816 | 78 |
| 940 | 3300049824 | Ga0501045_0028863 | Ga0501045_0028863_2454_2702 | 78 |
| 941 | 3300049824 | Ga0501045_0052735 | Ga0501045_0052735_35_277 | 78 |
| 942 | 3300049824 | Ga0501045_0202700 | Ga0501045_0202700_124_372 | 78 |
| 943 | 3300049824 | Ga0501045_0268074 | Ga0501045_0268074_380_622 | 78 |
| 944 | 3300049824 | Ga0501045_1095392 | Ga0501045_1095392_48_293 | 78 |
| 945 | 3300050489 | nmdc:mga03683_40278_c1 | nmdc:mga03683_40278_c1_1520_1765 | 78 |
| 946 | 3300050491 | nmdc:mga00v17_76312_c2 | nmdc:mga00v17_76312_c2_122_367 | 78 |
| 947 | 3300050492 | nmdc:mga0yw44_494445_c1 | nmdc:mga0yw44_494445_c1_548_793 | 78 |
| 948 | 3300050492 | nmdc:mga0yw44_53232_c1 | nmdc:mga0yw44_53232_c1_1915_2160 | 78 |
| 949 | 3300050507 | nmdc:mga05p37_112379_c1 | nmdc:mga05p37_112379_c1_1671_1913 | 78 |
| 950 | 3300050507 | nmdc:mga05p37_312392_c1 | nmdc:mga05p37_312392_c1_23_268 | 78 |
| 951 | 3300050507 | nmdc:mga05p37_394911_c1 | nmdc:mga05p37_394911_c1_376_621 | 78 |
| 952 | 3300050507 | nmdc:mga05p37_458916_c1 | nmdc:mga05p37_458916_c1_574_810 | 78 |
| 953 | 3300050507 | nmdc:mga05p37_5244_c1 | nmdc:mga05p37_5244_c1_2608_2850 | 78 |
| 954 | 3300050507 | nmdc:mga05p37_607108_c1 | nmdc:mga05p37_607108_c1_36_287 | 78 |
| 955 | 3300050507 | nmdc:mga05p37_613465_c1 | nmdc:mga05p37_613465_c1_932_1177 | 78 |
| 956 | 3300050507 | nmdc:mga05p37_7995_c1 | nmdc:mga05p37_7995_c1_11099_11347 | 78 |
| 957 | 3300050507 | nmdc:mga05p37_918245_c1 | nmdc:mga05p37_918245_c1_411_659 | 78 |
| 958 | 3300050508 | nmdc:mga09592_352237_c1 | nmdc:mga09592_352237_c1_296_538 | 78 |
| 959 | 3300050508 | nmdc:mga09592_39609_c1 | nmdc:mga09592_39609_c1_867_1115 | 78 |
| 960 | 3300050508 | nmdc:mga09592_41989_c1 | nmdc:mga09592_41989_c1_2226_2471 | 78 |
| 961 | 3300050508 | nmdc:mga09592_572036_c1 | nmdc:mga09592_572036_c1_478_723 | 78 |
| 962 | 3300050509 | nmdc:mga0qj67_1038301_c1 | nmdc:mga0qj67_1038301_c1_281_523 | 78 |
| 963 | 3300050509 | nmdc:mga0qj67_127956_c1 | nmdc:mga0qj67_127956_c1_1661_1906 | 78 |
| 964 | 3300050509 | nmdc:mga0qj67_134289_c1 | nmdc:mga0qj67_134289_c1_1140_1388 | 78 |
| 965 | 3300050509 | nmdc:mga0qj67_619383_c1 | nmdc:mga0qj67_619383_c1_518_763 | 78 |
| 966 | 3300050510 | nmdc:mga06r32_118641_c1 | nmdc:mga06r32_118641_c1_2076_2324 | 78 |
| 967 | 3300050510 | nmdc:mga06r32_123940_c1 | nmdc:mga06r32_123940_c1_1933_2175 | 78 |
| 968 | 3300050510 | nmdc:mga06r32_330555_c1 | nmdc:mga06r32_330555_c1_237_482 | 78 |
| 969 | 3300050510 | nmdc:mga06r32_506676_c1 | nmdc:mga06r32_506676_c1_78_323 | 78 |
| 970 | 3300050510 | nmdc:mga06r32_81305_c1 | nmdc:mga06r32_81305_c1_2100_2351 | 78 |
| 971 | 3300050511 | nmdc:mga08y16_312921_c1 | nmdc:mga08y16_312921_c1_685_930 | 78 |
| 972 | 3300050511 | nmdc:mga08y16_857164_c1 | nmdc:mga08y16_857164_c1_577_828 | 78 |
| 973 | 3300050512 | nmdc:mga0n895_131116_c1 | nmdc:mga0n895_131116_c1_2246_2491 | 78 |
| 974 | 3300050513 | nmdc:mga0rr50_798360_c1 | nmdc:mga0rr50_798360_c1_363_605 | 78 |
| 975 | 3300050513 | nmdc:mga0rr50_849212_c1 | nmdc:mga0rr50_849212_c1_140_385 | 78 |
| 976 | 3300050514 | nmdc:mga08x19_1144723_c1 | nmdc:mga08x19_1144723_c1_254_508 | 78 |
| 977 | 3300050514 | nmdc:mga08x19_282390_c1 | nmdc:mga08x19_282390_c1_13_258 | 78 |
| 978 | 3300050515 | nmdc:mga0a205_1291802_c1 | nmdc:mga0a205_1291802_c1_223_468 | 78 |
| 979 | 3300050515 | nmdc:mga0a205_577679_c1 | nmdc:mga0a205_577679_c1_186_428 | 78 |
| 980 | 3300053077 | Ga0495601_0000486 | Ga0495601_0000486_14482_14721 | 78 |
| 981 | 3300053077 | Ga0495601_0661634 | Ga0495601_0661634_34_273 | 78 |
| 982 | 3300053077 | Ga0495601_1009168 | Ga0495601_1009168_55_294 | 78 |
| 983 | 3300053078 | Ga0495612_0040143 | Ga0495612_0040143_159_398 | 78 |
| 984 | 3300053084 | Ga0495595_0004782 | Ga0495595_0004782_2219_2458 | 78 |
| 985 | 3300053084 | Ga0495595_0246750 | Ga0495595_0246750_140_379 | 78 |
| 986 | 3300053085 | Ga0495619_0000123 | Ga0495619_0000123_25873_26112 | 78 |
| 987 | 3300053085 | Ga0495619_0746576 | Ga0495619_0746576_111_350 | 78 |
| 988 | 3300054114 | Ga0501084_0000336 | Ga0501084_0000336_8797_9045 | 78 |
| 989 | 3300054114 | Ga0501084_0009395 | Ga0501084_0009395_3087_3335 | 78 |
| 990 | 3300054114 | Ga0501084_0020135 | Ga0501084_0020135_1782_2030 | 78 |
| 991 | 3300054114 | Ga0501084_0084799 | Ga0501084_0084799_1443_1679 | 78 |
| 992 | 3300054114 | Ga0501084_0140611 | Ga0501084_0140611_234_476 | 78 |
| 993 | 3300054114 | Ga0501084_0410508 | Ga0501084_0410508_43_291 | 78 |
| 994 | 3300054114 | Ga0501084_1525387 | Ga0501084_1525387_43_294 | 78 |
| 995 | 3300059423 | Ga0590074_008703 | Ga0590074_008703_1013_1258 | 78 |
| 996 | 3300059424 | Ga0590075_024188 | Ga0590075_024188_973_1218 | 78 |
| 997 | 3300060353 | Ga0501082_0001222 | Ga0501082_0001222_17720_17968 | 78 |
| 998 | 3300060353 | Ga0501082_0004941 | Ga0501082_0004941_9235_9477 | 78 |
| 999 | 3300060353 | Ga0501082_0036548 | Ga0501082_0036548_3939_4187 | 78 |
| 1000 | 3300060353 | Ga0501082_0111071 | Ga0501082_0111071_1408_1656 | 78 |
| 1001 | 3300060353 | Ga0501082_0283114 | Ga0501082_0283114_984_1226 | 78 |
| 1002 | 3300060353 | Ga0501082_0309957 | Ga0501082_0309957_139_387 | 78 |
| 1003 | 3300060353 | Ga0501082_0347620 | Ga0501082_0347620_798_1043 | 78 |
| 1004 | 3300061719 | Ga0466962_0175215 | Ga0466962_0175215_134_388 | 78 |
| 1005 | 3300061734 | Ga0530510_0000445 | Ga0530510_0000445_8797_9045 | 78 |
| 1006 | 3300061734 | Ga0530510_0008684 | Ga0530510_0008684_4144_4386 | 78 |
| 1007 | 3300061734 | Ga0530510_0011273 | Ga0530510_0011273_3823_4071 | 78 |
| 1008 | 3300061734 | Ga0530510_0040426 | Ga0530510_0040426_2313_2561 | 78 |
| 1009 | 3300061734 | Ga0530510_0221034 | Ga0530510_0221034_642_884 | 78 |
| 1010 | 3300061734 | Ga0530510_0242848 | Ga0530510_0242848_1066_1317 | 78 |
| 1011 | 3300061734 | Ga0530510_1569658 | Ga0530510_1569658_208_444 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar