F488116

General Info

Members Datasets Scaffolds Average Seq Length
1010 313 2020 139

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10442017|Ga0207692_104420172
Length 160
Sequence MQKLFPRSPYERLGGYVHLPRLIDKARLHRRGLLNGYNYKTVGFDKHLLAFLEVDPDAFEKAANEFDDQGVLDWIEQNAVAHSAAEIELWNEAMISRHPDTAAKKARFVHFLREAGGAGRTDLRTYFDLIEFDACRRSVLRRALRALGRGGRSAARGNRE

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
119 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
120 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
121 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.44
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 36.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10442017 3300025898 Unclassified 817
2 SwRhRL2b_contig_1671213 2162886007 Unclassified 3900
3 CNXas_1000026 3300000545 Bacteria 30702
4 JGI24035J26624_1000575 3300002126 Bacteria 3406
5 JGI25406J46586_10000033 3300003203 Bacteria 65430
6 JGI25404J52841_10015420 3300003659 Unclassified 1658
7 JGI25405J52794_10000663 3300003911 Bacteria 5187
8 JGI25405J52794_10009159 3300003911 Bacteria 1864
9 Ga0065703_1023538 3300005272 Bacteria 700
10 Ga0065714_10233837 3300005288 Unclassified 810
11 Ga0065704_10004677 3300005289 Bacteria 3669
12 Ga0065704_10018974 3300005289 Unclassified 1479
13 Ga0065704_10081455 3300005289 Bacteria 3758
14 Ga0065704_10328315 3300005289 Unclassified 842
15 Ga0065712_10001143 3300005290 Bacteria 7269
16 Ga0065712_10020601 3300005290 Bacteria 1677
17 Ga0065712_10044756 3300005290 Unclassified 716
18 Ga0065712_10084282 3300005290 Unclassified 2777
19 Ga0065712_10167829 3300005290 Bacteria 1246
20 Ga0065712_10185494 3300005290 Bacteria 1172
21 Ga0065712_10192000 3300005290 Bacteria 1139
22 Ga0065715_10005093 3300005293 Bacteria 3296
23 Ga0065715_10088969 3300005293 Bacteria 19221
24 Ga0065715_10241343 3300005293 Bacteria 1187
25 Ga0065715_10377202 3300005293 Bacteria 912
26 Ga0065715_10530284 3300005293 Unclassified 756
27 Ga0065715_10594046 3300005293 Bacteria 696
28 Ga0065715_10597891 3300005293 Unclassified 709
29 Ga0065707_10119741 3300005295 Bacteria 2152
30 Ga0065707_10206917 3300005295 Unclassified 1284
31 Ga0070658_10085451 3300005327 Bacteria 2595
32 Ga0070658_10324660 3300005327 Bacteria 1315
33 Ga0070676_10103370 3300005328 Unclassified 1763
34 Ga0070676_10282025 3300005328 Bacteria 1120
35 Ga0070676_10311117 3300005328 Unclassified 1071
36 Ga0070676_10467964 3300005328 Bacteria 889
37 Ga0070676_10494572 3300005328 Unclassified 867
38 Ga0070683_100004598 3300005329 Bacteria 11394
39 Ga0070683_100024766 3300005329 Bacteria 5380
40 Ga0070683_100033543 3300005329 Bacteria 4682
41 Ga0070683_100277797 3300005329 Bacteria 1593
42 Ga0070683_100492676 3300005329 Unclassified 1171
43 Ga0070690_100084117 3300005330 Bacteria 2085
44 Ga0070690_100121181 3300005330 Unclassified 1755
45 Ga0070670_100002008 3300005331 Bacteria 16638
46 Ga0070670_100047271 3300005331 Bacteria 3702
47 Ga0070670_100348529 3300005331 Unclassified 1300
48 Ga0070670_101857466 3300005331 Unclassified 555
49 Ga0068869_100081505 3300005334 Unclassified 2416
50 Ga0068869_100625198 3300005334 Bacteria 912
51 Ga0070666_10010260 3300005335 Bacteria 5855
52 Ga0070666_10029890 3300005335 Bacteria 3585
53 Ga0070666_10032209 3300005335 Bacteria 3462
54 Ga0070666_10160593 3300005335 Bacteria 1571
55 Ga0070666_10527848 3300005335 Unclassified 857
56 Ga0070682_100518364 3300005337 Unclassified 927
57 Ga0068868_100055927 3300005338 Bacteria 3115
58 Ga0068868_100085894 3300005338 Bacteria 2529
59 Ga0068868_100700845 3300005338 Bacteria 906
60 Ga0070660_100012566 3300005339 Bacteria 6048
61 Ga0070660_100128098 3300005339 Unclassified 2030
62 Ga0070689_100030546 3300005340 Bacteria 4090
63 Ga0070689_100102749 3300005340 Bacteria 2264
64 Ga0070689_100401152 3300005340 Bacteria 1159
65 Ga0070689_100546775 3300005340 Bacteria 997
66 Ga0070689_100636153 3300005340 Unclassified 927
67 Ga0070691_10272347 3300005341 Bacteria 915
68 Ga0070687_100046065 3300005343 Unclassified 2231
69 Ga0070687_100208600 3300005343 Unclassified 1189
70 Ga0070661_100073608 3300005344 Bacteria 2515
71 Ga0070661_100182351 3300005344 Unclassified 1598
72 Ga0070661_100424588 3300005344 Bacteria 1054
73 Ga0070692_10157834 3300005345 Bacteria 1297
74 Ga0070668_100058632 3300005347 Bacteria 2979
75 Ga0070668_100250019 3300005347 Bacteria 1471
76 Ga0070668_100290835 3300005347 Unclassified 1367
77 Ga0070669_100019703 3300005353 Bacteria 4820
78 Ga0070669_100032860 3300005353 Bacteria 3749
79 Ga0070669_100062604 3300005353 Bacteria 2736
80 Ga0070669_100109730 3300005353 Bacteria 2092
81 Ga0070669_100316780 3300005353 Bacteria 1259
82 Ga0070669_100334327 3300005353 Unclassified 1226
83 Ga0070669_100580661 3300005353 Unclassified 937
84 Ga0070669_100591723 3300005353 Bacteria 929
85 Ga0070669_100603217 3300005353 Bacteria 920
86 Ga0070675_100008423 3300005354 Bacteria 8002
87 Ga0070675_100017443 3300005354 Bacteria 5704
88 Ga0070675_100031538 3300005354 Bacteria 4285
89 Ga0070675_100037593 3300005354 Unclassified 3944
90 Ga0070675_100081868 3300005354 Bacteria 2692
91 Ga0070675_100110121 3300005354 Bacteria 2329
92 Ga0070675_100205800 3300005354 Unclassified 1709
93 Ga0070675_100244763 3300005354 Bacteria 1568
94 Ga0070675_100393225 3300005354 Bacteria 1236
95 Ga0070671_100014686 3300005355 Bacteria 6329
96 Ga0070671_100015360 3300005355 Bacteria 6185
97 Ga0070671_100023639 3300005355 Bacteria 5031
98 Ga0070671_100078361 3300005355 Bacteria 2762
99 Ga0070671_100148702 3300005355 Bacteria 1977
100 Ga0070671_100175834 3300005355 Bacteria 1811
101 Ga0070671_100204564 3300005355 Bacteria 1674
102 Ga0070671_100307270 3300005355 Bacteria 1350
103 Ga0070671_100406672 3300005355 Bacteria 1165
104 Ga0070671_100928570 3300005355 Unclassified 761
105 Ga0070671_101143972 3300005355 Bacteria 684
106 Ga0070674_100023977 3300005356 Bacteria 3956
107 Ga0070674_100189354 3300005356 Bacteria 1582
108 Ga0070674_100534079 3300005356 Unclassified 982
109 Ga0070674_100612379 3300005356 Unclassified 921
110 Ga0070673_100003285 3300005364 Bacteria 10035
111 Ga0070673_100008962 3300005364 Bacteria 6690
112 Ga0070673_100019856 3300005364 Bacteria 4833
113 Ga0070673_100044904 3300005364 Bacteria 3423
114 Ga0070673_102282280 3300005364 Bacteria 514
115 Ga0070673_102342563 3300005364 Unclassified 508
116 Ga0070688_100001026 3300005365 Bacteria 14013
117 Ga0070688_100005864 3300005365 Bacteria 6500
118 Ga0070688_100034024 3300005365 Bacteria 3083
119 Ga0070688_100592253 3300005365 Unclassified 848
120 Ga0070688_100713831 3300005365 Unclassified 777
121 Ga0070659_100081994 3300005366 Bacteria 2576
122 Ga0070659_100349702 3300005366 Bacteria 1240
123 Ga0070667_100022881 3300005367 Bacteria 5182
124 Ga0070667_100068243 3300005367 Bacteria 3025
125 Ga0070667_100183298 3300005367 Bacteria 1852
126 Ga0070667_100184333 3300005367 Bacteria 1847
127 Ga0070667_100199428 3300005367 Bacteria 1776
128 Ga0070667_100209082 3300005367 Bacteria 1734
129 Ga0070667_100473349 3300005367 Bacteria 1146
130 Ga0070667_100932877 3300005367 Unclassified 809
131 Ga0070667_101083637 3300005367 Unclassified 749
132 Ga0070703_10022618 3300005406 Unclassified 1846
133 Ga0070703_10049827 3300005406 Bacteria 1335
134 Ga0070709_10019660 3300005434 Bacteria 3908
135 Ga0070709_10066059 3300005434 Bacteria 2318
136 Ga0070714_100007154 3300005435 Bacteria 8657
137 Ga0070714_100036206 3300005435 Bacteria 4138
138 Ga0070714_100129332 3300005435 Bacteria 2255
139 Ga0070714_100387880 3300005435 Bacteria 1318
140 Ga0070714_101306509 3300005435 Unclassified 708
141 Ga0070713_100014508 3300005436 Bacteria 5856
142 Ga0070713_100023194 3300005436 Bacteria 4811
143 Ga0070713_100537601 3300005436 Bacteria 1106
144 Ga0070710_10010909 3300005437 Bacteria 4474
145 Ga0070710_10085815 3300005437 Bacteria 1847
146 Ga0070710_10132531 3300005437 Bacteria 1521
147 Ga0070710_10385729 3300005437 Unclassified 935
148 Ga0070701_10221684 3300005438 Unclassified 1128
149 Ga0070711_100002729 3300005439 Bacteria 10126
150 Ga0070711_100004590 3300005439 Bacteria 8175
151 Ga0070711_100125979 3300005439 Unclassified 1901
152 Ga0070711_101383042 3300005439 Unclassified 612
153 Ga0070705_100040869 3300005440 Bacteria 2640
154 Ga0070705_100076968 3300005440 Unclassified 2036
155 Ga0070705_100101970 3300005440 Unclassified 1814
156 Ga0070705_100720357 3300005440 Unclassified 786
157 Ga0070705_100990925 3300005440 Bacteria 681
158 Ga0070705_101418244 3300005440 Bacteria 579
159 Ga0070700_100082665 3300005441 Bacteria 2077
160 Ga0070694_100229178 3300005444 Unclassified 1397
161 Ga0070708_100003045 3300005445 Bacteria 13021
162 Ga0070708_100014233 3300005445 Bacteria 6536
163 Ga0070708_100018984 3300005445 Bacteria 5765
164 Ga0070708_100097314 3300005445 Bacteria 2690
165 Ga0070708_100239848 3300005445 Bacteria 1702
166 Ga0070708_100317401 3300005445 Bacteria 1468
167 Ga0070708_100458501 3300005445 Unclassified 1203
168 Ga0070708_100521241 3300005445 Bacteria 1121
169 Ga0070708_100529677 3300005445 Unclassified 1111
170 Ga0070708_100558249 3300005445 Unclassified 1080
171 Ga0070708_101424983 3300005445 Unclassified 646
172 Ga0070663_100559394 3300005455 Unclassified 957
173 Ga0070678_100020294 3300005456 Bacteria 4357
174 Ga0070678_100038821 3300005456 Unclassified 3355
175 Ga0070678_100064988 3300005456 Bacteria 2707
176 Ga0070678_100085436 3300005456 Bacteria 2405
177 Ga0070678_102188924 3300005456 Unclassified 524
178 Ga0070662_100001248 3300005457 Bacteria 15598
179 Ga0070662_100006768 3300005457 Bacteria 7410
180 Ga0070662_100057436 3300005457 Bacteria 2827
181 Ga0070662_100201430 3300005457 Bacteria 1580
182 Ga0070662_100364650 3300005457 Unclassified 1186
183 Ga0070662_101098608 3300005457 Bacteria 682
184 Ga0070662_101566446 3300005457 Unclassified 568
185 Ga0070681_10075353 3300005458 Bacteria 3334
186 Ga0068867_100049988 3300005459 Bacteria 3079
187 Ga0068867_100214717 3300005459 Unclassified 1547
188 Ga0068867_100795541 3300005459 Bacteria 843
189 Ga0070685_10059947 3300005466 Bacteria 2223
190 Ga0070685_10312326 3300005466 Unclassified 1063
191 Ga0070706_100000973 3300005467 Bacteria 31247
192 Ga0070706_100001536 3300005467 Bacteria 24129
193 Ga0070706_100001644 3300005467 Bacteria 23271
194 Ga0070706_100033401 3300005467 Bacteria 4749
195 Ga0070706_100040011 3300005467 Unclassified 4327
196 Ga0070706_100086137 3300005467 Bacteria 2911
197 Ga0070706_100086348 3300005467 Unclassified 2907
198 Ga0070706_100107129 3300005467 Bacteria 2600
199 Ga0070706_100166588 3300005467 Bacteria 2058
200 Ga0070706_100220111 3300005467 Bacteria 1772
201 Ga0070706_100250669 3300005467 Bacteria 1653
202 Ga0070706_100273891 3300005467 Bacteria 1575
203 Ga0070706_100361697 3300005467 Unclassified 1352
204 Ga0070706_100408504 3300005467 Unclassified 1264
205 Ga0070706_100779036 3300005467 Bacteria 886
206 Ga0070706_101334934 3300005467 Unclassified 657
207 Ga0070707_100000417 3300005468 Bacteria 42073
208 Ga0070707_100004330 3300005468 Bacteria 13297
209 Ga0070707_100008826 3300005468 Bacteria 9347
210 Ga0070707_100021566 3300005468 Bacteria 6090
211 Ga0070707_100023820 3300005468 Bacteria 5791
212 Ga0070707_100064468 3300005468 Bacteria 3518
213 Ga0070707_100075891 3300005468 Bacteria 3243
214 Ga0070707_100147303 3300005468 Bacteria 2291
215 Ga0070707_100209315 3300005468 Unclassified 1901
216 Ga0070707_100287337 3300005468 Unclassified 1598
217 Ga0070707_100305317 3300005468 Bacteria 1546
218 Ga0070707_100318083 3300005468 Unclassified 1512
219 Ga0070707_100400921 3300005468 Bacteria 1332
220 Ga0070707_100407018 3300005468 Unclassified 1321
221 Ga0070707_100570287 3300005468 Unclassified 1094
222 Ga0070707_101676830 3300005468 Unclassified 603
223 Ga0070698_100001912 3300005471 Bacteria 23212
224 Ga0070698_100029103 3300005471 Bacteria 5732
225 Ga0070698_100078849 3300005471 Bacteria 3291
226 Ga0070698_100188921 3300005471 Bacteria 1998
227 Ga0070698_100236208 3300005471 Bacteria 1761
228 Ga0070698_100440158 3300005471 Bacteria 1239
229 Ga0070698_100854702 3300005471 Bacteria 855
230 Ga0070699_100151140 3300005518 Bacteria 2054
231 Ga0070699_100189486 3300005518 Bacteria 1827
232 Ga0070699_100208815 3300005518 Bacteria 1738
233 Ga0070699_100310078 3300005518 Bacteria 1417
234 Ga0070699_100381370 3300005518 Bacteria 1273
235 Ga0070699_100724764 3300005518 Bacteria 909
236 Ga0070679_100170634 3300005530 Unclassified 2148
237 Ga0070684_100009794 3300005535 Bacteria 7568
238 Ga0070684_100035854 3300005535 Unclassified 4248
239 Ga0070684_100084266 3300005535 Bacteria 2817
240 Ga0070684_100150877 3300005535 Unclassified 2105
241 Ga0070684_101286408 3300005535 Bacteria 688
242 Ga0070697_100005670 3300005536 Bacteria 9615
243 Ga0070697_100052012 3300005536 Bacteria 3329
244 Ga0070697_100059575 3300005536 Bacteria 3109
245 Ga0070697_100070961 3300005536 Unclassified 2856
246 Ga0070697_100084789 3300005536 Bacteria 2613
247 Ga0070697_100149876 3300005536 Bacteria 1966
248 Ga0070697_100198152 3300005536 Bacteria 1706
249 Ga0070697_100202648 3300005536 Unclassified 1687
250 Ga0070697_100220955 3300005536 Bacteria 1614
251 Ga0070697_100323836 3300005536 Unclassified 1328
252 Ga0070697_100336777 3300005536 Bacteria 1301
253 Ga0070697_100412395 3300005536 Bacteria 1173
254 Ga0070697_100494819 3300005536 Unclassified 1069
255 Ga0070697_100583572 3300005536 Bacteria 982
256 Ga0070697_100975550 3300005536 Bacteria 753
257 Ga0070697_101167844 3300005536 Bacteria 686
258 Ga0070697_101402799 3300005536 Bacteria 624
259 Ga0068853_101430434 3300005539 Unclassified 669
260 Ga0070672_100018459 3300005543 Bacteria 5043
261 Ga0070672_100031488 3300005543 Bacteria 3992
262 Ga0070672_100291863 3300005543 Bacteria 1381
263 Ga0070695_100025384 3300005545 Bacteria 3659
264 Ga0070696_100201562 3300005546 Bacteria 1486
265 Ga0070696_101407382 3300005546 Unclassified 595
266 Ga0070693_100270692 3300005547 Unclassified 1134
267 Ga0070665_100005367 3300005548 Bacteria 13234
268 Ga0070665_100051024 3300005548 Bacteria 4150
269 Ga0070665_100051452 3300005548 Bacteria 4131
270 Ga0070665_100059119 3300005548 Unclassified 3843
271 Ga0070665_100154346 3300005548 Unclassified 2298
272 Ga0070665_100279098 3300005548 Bacteria 1672
273 Ga0070704_100281204 3300005549 Bacteria 1379
274 Ga0070704_100438833 3300005549 Unclassified 1122
275 Ga0070704_101070427 3300005549 Unclassified 731
276 Ga0068855_100866624 3300005563 Unclassified 956
277 Ga0070664_100031763 3300005564 Bacteria 4415
278 Ga0070664_100084022 3300005564 Bacteria 2747
279 Ga0070664_100682311 3300005564 Unclassified 956
280 Ga0068857_100503564 3300005577 Bacteria 1137
281 Ga0068854_100991953 3300005578 Unclassified 743
282 Ga0068856_100097738 3300005614 Bacteria 2925
283 Ga0068856_100313712 3300005614 Bacteria 1586
284 Ga0070702_100967277 3300005615 Unclassified 671
285 Ga0068852_100261739 3300005616 Bacteria 1661
286 Ga0068852_101428386 3300005616 Unclassified 714
287 Ga0068859_100061813 3300005617 Bacteria 3774
288 Ga0068859_101956349 3300005617 Unclassified 647
289 Ga0068864_100461240 3300005618 Bacteria 1216
290 Ga0068864_100844676 3300005618 Unclassified 902
291 Ga0068864_100973056 3300005618 Bacteria 841
292 Ga0068864_102358926 3300005618 Unclassified 538
293 Ga0068866_10179843 3300005718 Unclassified 1248
294 Ga0068861_100177234 3300005719 Bacteria 1771
295 Ga0068861_100545271 3300005719 Bacteria 1056
296 Ga0068870_10328578 3300005840 Bacteria 974
297 Ga0068863_100053121 3300005841 Bacteria 3840
298 Ga0068863_100251730 3300005841 Bacteria 1706
299 Ga0068863_101394993 3300005841 Unclassified 708
300 Ga0068858_100233377 3300005842 Bacteria 1744
301 Ga0068858_101342866 3300005842 Unclassified 704
302 Ga0068860_100021532 3300005843 Bacteria 6242
303 Ga0068860_101112428 3300005843 Unclassified 809
304 Ga0068860_102322226 3300005843 Unclassified 557
305 Ga0068862_100115929 3300005844 Bacteria 2356
306 Ga0068862_100343238 3300005844 Bacteria 1383
307 Ga0068862_101764123 3300005844 Unclassified 628
308 Ga0081455_10000917 3300005937 Bacteria 37874
309 Ga0081455_10001114 3300005937 Bacteria 33709
310 Ga0081455_10004812 3300005937 Bacteria 14998
311 Ga0081455_10022784 3300005937 Bacteria 5843
312 Ga0081455_10097507 3300005937 Bacteria 2368
313 Ga0081455_10108041 3300005937 Bacteria 2217
314 Ga0081455_10144829 3300005937 Bacteria 1840
315 Ga0081540_1024135 3300005983 Bacteria 3535
316 Ga0081540_1032635 3300005983 Bacteria 2839
317 Ga0081539_10000138 3300005985 Bacteria 170633
318 Ga0081539_10000727 3300005985 Bacteria 66016
319 Ga0081539_10008457 3300005985 Bacteria 8957
320 Ga0081539_10015667 3300005985 Bacteria 5489
321 Ga0081539_10154711 3300005985 Bacteria 1100
322 Ga0070717_10000307 3300006028 Bacteria 32183
323 Ga0070717_10021189 3300006028 Bacteria 5122
324 Ga0070717_10041272 3300006028 Bacteria 3762
325 Ga0070717_10056508 3300006028 Bacteria 3242
326 Ga0070717_10129793 3300006028 Bacteria 2166
327 Ga0070717_10142422 3300006028 Bacteria 2069
328 Ga0070717_10345227 3300006028 Bacteria 1330
329 Ga0070717_10399400 3300006028 Bacteria 1235
330 Ga0070717_10462030 3300006028 Bacteria 1145
331 Ga0070717_10710225 3300006028 Unclassified 913
332 Ga0070717_10897786 3300006028 Unclassified 807
333 Ga0070715_10063175 3300006163 Bacteria 1631
334 Ga0070716_100005743 3300006173 Bacteria 6028
335 Ga0070716_100014888 3300006173 Bacteria 3989
336 Ga0070716_100066906 3300006173 Bacteria 2097
337 Ga0070716_100358297 3300006173 Bacteria 1035
338 Ga0070716_100459624 3300006173 Unclassified 930
339 Ga0070716_100584840 3300006173 Unclassified 837
340 Ga0070712_100011157 3300006175 Bacteria 5686
341 Ga0070712_100113940 3300006175 Bacteria 2023
342 Ga0070712_100116700 3300006175 Bacteria 2002
343 Ga0070712_100182703 3300006175 Bacteria 1635
344 Ga0070712_100196336 3300006175 Unclassified 1582
345 Ga0070712_100425138 3300006175 Bacteria 1102
346 Ga0070712_100546498 3300006175 Unclassified 976
347 Ga0070712_100556982 3300006175 Unclassified 966
348 Ga0097621_100030303 3300006237 Bacteria 4282
349 Ga0097621_100077409 3300006237 Bacteria 2761
350 Ga0097621_100517254 3300006237 Bacteria 1083
351 Ga0097621_101066649 3300006237 Unclassified 757
352 Ga0097621_101641319 3300006237 Unclassified 611
353 Ga0068871_100074807 3300006358 Unclassified 2795
354 Ga0068871_100121126 3300006358 Bacteria 2210
355 Ga0068871_100162494 3300006358 Unclassified 1910
356 Ga0068871_100194916 3300006358 Unclassified 1747
357 Ga0068871_100792046 3300006358 Bacteria 873
358 Ga0068871_101136230 3300006358 Unclassified 731
359 Ga0075428_100959126 3300006844 Unclassified 906
360 Ga0075428_101270889 3300006844 Unclassified 775
361 Ga0075433_10110059 3300006852 Bacteria 2444
362 Ga0075433_10361187 3300006852 Bacteria 1283
363 Ga0075433_10399325 3300006852 Bacteria 1213
364 Ga0075433_10411518 3300006852 Bacteria 1193
365 Ga0075433_10751759 3300006852 Bacteria 853
366 Ga0075434_100135895 3300006871 Bacteria 2478
367 Ga0075434_100228804 3300006871 Bacteria 1879
368 Ga0075434_101012563 3300006871 Unclassified 845
369 Ga0068865_100238706 3300006881 Unclassified 1429
370 Ga0068865_100288165 3300006881 Unclassified 1310
371 Ga0068865_100298274 3300006881 Unclassified 1289
372 Ga0068865_100308938 3300006881 Bacteria 1268
373 Ga0075436_100063155 3300006914 Bacteria 2560
374 Ga0075436_100322826 3300006914 Unclassified 1109
375 Ga0097620_100061812 3300006931 Bacteria 3774
376 Ga0097620_101956259 3300006931 Unclassified 647
377 Ga0075435_100256254 3300007076 Bacteria 1490
378 Ga0075435_101037901 3300007076 Unclassified 716
379 Ga0099794_10034040 3300007265 Bacteria 2398
380 Ga0099794_10102596 3300007265 Bacteria 1428
381 Ga0099794_10196488 3300007265 Unclassified 1032
382 Ga0099795_10032861 3300007788 Bacteria 1798
383 Ga0099795_10099107 3300007788 Bacteria 1141
384 Ga0099795_10201632 3300007788 Unclassified 839
385 Ga0099795_10469752 3300007788 Bacteria 582
386 Ga0105244_10206818 3300009036 Unclassified 924
387 Ga0105240_11344443 3300009093 Bacteria 752
388 Ga0105240_11807404 3300009093 Unclassified 637
389 Ga0111539_10154474 3300009094 Bacteria 2686
390 Ga0111539_10166473 3300009094 Bacteria 2577
391 Ga0111539_10630589 3300009094 Unclassified 1248
392 Ga0105245_10099858 3300009098 Unclassified 2684
393 Ga0105245_10387402 3300009098 Unclassified 1393
394 Ga0105245_10809460 3300009098 Unclassified 975
395 Ga0105245_10822417 3300009098 Unclassified 968
396 Ga0105245_11045162 3300009098 Unclassified 862
397 Ga0105247_10508748 3300009101 Bacteria 879
398 Ga0105247_10693997 3300009101 Unclassified 765
399 Ga0105247_10767747 3300009101 Bacteria 732
400 Ga0114129_10193325 3300009147 Bacteria 2761
401 Ga0114129_10309841 3300009147 Bacteria 2102
402 Ga0114129_10376077 3300009147 Unclassified 1877
403 Ga0114129_10834606 3300009147 Unclassified 1173
404 Ga0114129_11392988 3300009147 Unclassified 865
405 Ga0105241_10096165 3300009174 Bacteria 2346
406 Ga0105241_10465553 3300009174 Bacteria 1121
407 Ga0105242_10003071 3300009176 Bacteria 13040
408 Ga0105242_10144638 3300009176 Unclassified 2067
409 Ga0105242_11673086 3300009176 Unclassified 672
410 Ga0105248_10871670 3300009177 Unclassified 1016
411 Ga0105248_11088295 3300009177 Unclassified 903
412 Ga0105237_10403847 3300009545 Bacteria 1371
413 Ga0105237_10521047 3300009545 Unclassified 1195
414 Ga0105238_11146306 3300009551 Bacteria 801
415 Ga0105249_10006685 3300009553 Bacteria 10041
416 Ga0105249_10223648 3300009553 Bacteria 1853
417 Ga0105249_10470488 3300009553 Unclassified 1298
418 Ga0105249_10520645 3300009553 Unclassified 1236
419 Ga0105249_11845407 3300009553 Unclassified 677
420 Ga0099796_10021116 3300010159 Unclassified 2001
421 Ga0099796_10138854 3300010159 Unclassified 948
422 Ga0099796_10532861 3300010159 Unclassified 527
423 Ga0105239_10045207 3300010375 Bacteria 4826
424 Ga0105239_10247852 3300010375 Bacteria 2000
425 Ga0105239_10512425 3300010375 Unclassified 1364
426 Ga0105239_10698308 3300010375 Bacteria 1160
427 Ga0105239_11021591 3300010375 Unclassified 951
428 Ga0105239_11881702 3300010375 Unclassified 694
429 Ga0105246_10641075 3300011119 Unclassified 923
430 Ga0105246_10763501 3300011119 Unclassified 854
431 Ga0105246_11929361 3300011119 Unclassified 568
432 Ga0157329_1014665 3300012491 Unclassified 668
433 Ga0157313_1050927 3300012503 Unclassified 539
434 Ga0157342_1033568 3300012507 Unclassified 657
435 Ga0157327_1020759 3300012512 Bacteria 739
436 Ga0157373_10346328 3300013100 Unclassified 1060
437 Ga0157371_10071693 3300013102 Bacteria 2453
438 Ga0157371_10104294 3300013102 Bacteria 2012
439 Ga0157371_10129153 3300013102 Unclassified 1797
440 Ga0157371_10184713 3300013102 Unclassified 1492
441 Ga0157371_10240184 3300013102 Bacteria 1303
442 Ga0157370_10196344 3300013104 Unclassified 1873
443 Ga0157369_10061578 3300013105 Unclassified 4045
444 Ga0157374_10010486 3300013296 Bacteria 7972
445 Ga0157374_10013787 3300013296 Bacteria 7060
446 Ga0157374_10031906 3300013296 Bacteria 4792
447 Ga0157374_10034876 3300013296 Bacteria 4600
448 Ga0157374_10041582 3300013296 Bacteria 4237
449 Ga0157374_10050974 3300013296 Bacteria 3850
450 Ga0157374_10106786 3300013296 Bacteria 2690
451 Ga0157374_10147006 3300013296 Bacteria 2290
452 Ga0157374_10416909 3300013296 Unclassified 1341
453 Ga0157374_10495836 3300013296 Bacteria 1225
454 Ga0157374_10736823 3300013296 Unclassified 1000
455 Ga0157374_11520167 3300013296 Unclassified 693
456 Ga0157374_11584534 3300013296 Unclassified 679
457 Ga0157374_11860585 3300013296 Bacteria 627
458 Ga0157374_12774831 3300013296 Unclassified 517
459 Ga0157378_10011344 3300013297 Bacteria 7798
460 Ga0157378_10043703 3300013297 Bacteria 3978
461 Ga0157378_10048896 3300013297 Archaea 3761
462 Ga0157378_10076120 3300013297 Bacteria 3023
463 Ga0157378_10098627 3300013297 Bacteria 2664
464 Ga0157378_10200080 3300013297 Unclassified 1889
465 Ga0157378_10254865 3300013297 Unclassified 1681
466 Ga0157378_10255914 3300013297 Bacteria 1678
467 Ga0157378_10298284 3300013297 Bacteria 1559
468 Ga0157378_10346912 3300013297 Bacteria 1449
469 Ga0157378_10537659 3300013297 Unclassified 1172
470 Ga0157378_10784107 3300013297 Unclassified 978
471 Ga0157378_11039043 3300013297 Unclassified 855
472 Ga0157378_11067099 3300013297 Unclassified 844
473 Ga0157378_12712500 3300013297 Bacteria 548
474 Ga0163162_10003956 3300013306 Bacteria 14212
475 Ga0163162_10011424 3300013306 Bacteria 8659
476 Ga0163162_10032151 3300013306 Bacteria 5210
477 Ga0163162_10076949 3300013306 Bacteria 3399
478 Ga0163162_10224876 3300013306 Bacteria 2006
479 Ga0163162_10288276 3300013306 Bacteria 1774
480 Ga0163162_10503427 3300013306 Unclassified 1341
481 Ga0163162_10592892 3300013306 Unclassified 1235
482 Ga0157372_10025879 3300013307 Bacteria 6382
483 Ga0157372_10070226 3300013307 Unclassified 3940
484 Ga0157372_10072102 3300013307 Bacteria 3892
485 Ga0157372_10379542 3300013307 Bacteria 1647
486 Ga0157372_10482257 3300013307 Unclassified 1446
487 Ga0157372_10545716 3300013307 Bacteria 1351
488 Ga0157372_11758748 3300013307 Bacteria 713
489 Ga0157372_12510515 3300013307 Unclassified 592
490 Ga0157375_10003551 3300013308 Bacteria 13539
491 Ga0157375_10011315 3300013308 Bacteria 7879
492 Ga0157375_10019073 3300013308 Bacteria 6229
493 Ga0157375_10037238 3300013308 Bacteria 4659
494 Ga0157375_10045195 3300013308 Bacteria 4286
495 Ga0157375_10114005 3300013308 Bacteria 2805
496 Ga0157375_10421497 3300013308 Bacteria 1501
497 Ga0157375_10555537 3300013308 Unclassified 1309
498 Ga0157375_10702397 3300013308 Bacteria 1165
499 Ga0157375_11225859 3300013308 Bacteria 881
500 Ga0157375_12206379 3300013308 Unclassified 656
501 Ga0157375_12313346 3300013308 Unclassified 641
502 Ga0163163_10094500 3300014325 Unclassified 3008
503 Ga0163163_10181079 3300014325 Bacteria 2154
504 Ga0163163_10228960 3300014325 Bacteria 1908
505 Ga0163163_10361337 3300014325 Bacteria 1508
506 Ga0157380_12504131 3300014326 Unclassified 582
507 Ga0182008_10012262 3300014497 Bacteria 4526
508 Ga0157377_10018404 3300014745 Bacteria 3629
509 Ga0157377_10036435 3300014745 Bacteria 2706
510 Ga0157377_10288541 3300014745 Unclassified 1078
511 Ga0157377_10387647 3300014745 Unclassified 948
512 Ga0157377_11388629 3300014745 Unclassified 553
513 Ga0157379_10170489 3300014968 Bacteria 1965
514 Ga0157376_10004555 3300014969 Bacteria 9652
515 Ga0157376_10248868 3300014969 Unclassified 1659
516 Ga0157376_10599849 3300014969 Bacteria 1096
517 Ga0157376_10653567 3300014969 Unclassified 1052
518 Ga0157376_10658104 3300014969 Unclassified 1049
519 Ga0157376_11394554 3300014969 Unclassified 732
520 Ga0182005_1020527 3300015265 Unclassified 1817
521 Ga0163161_10086072 3300017792 Unclassified 2319
522 Ga0163161_10206690 3300017792 Bacteria 1515
523 Ga0213872_10001096 3300021361 Bacteria 18526
524 Ga0207666_1000260 3300025271 Bacteria 7739
525 Ga0207666_1001670 3300025271 Bacteria 2638
526 Ga0207673_1000464 3300025290 Bacteria 4211
527 Ga0207673_1008209 3300025290 Unclassified 1320
528 Ga0207697_10000568 3300025315 Bacteria 20956
529 Ga0207697_10000868 3300025315 Bacteria 17109
530 Ga0207697_10001518 3300025315 Bacteria 12598
531 Ga0207697_10005602 3300025315 Bacteria 5813
532 Ga0207697_10007623 3300025315 Bacteria 4807
533 Ga0207697_10008440 3300025315 Bacteria 4505
534 Ga0207697_10012518 3300025315 Bacteria 3556
535 Ga0207697_10051854 3300025315 Bacteria 1696
536 Ga0207697_10056676 3300025315 Bacteria 1626
537 Ga0207697_10078042 3300025315 Bacteria 1393
538 Ga0207697_10182806 3300025315 Unclassified 919
539 Ga0207682_10115839 3300025893 Unclassified 1184
540 Ga0207692_10016595 3300025898 Bacteria 3266
541 Ga0207692_10043802 3300025898 Bacteria 2229
542 Ga0207692_10044217 3300025898 Bacteria 2221
543 Ga0207692_10180478 3300025898 Bacteria 1229
544 Ga0207692_10259964 3300025898 Bacteria 1043
545 Ga0207692_10864619 3300025898 Bacteria 594
546 Ga0207642_10056813 3300025899 Bacteria 1797
547 Ga0207688_10021372 3300025901 Bacteria 3536
548 Ga0207688_10077543 3300025901 Bacteria 1894
549 Ga0207688_10189488 3300025901 Unclassified 1229
550 Ga0207688_10254252 3300025901 Bacteria 1065
551 Ga0207680_10007065 3300025903 Bacteria 5454
552 Ga0207680_10064532 3300025903 Unclassified 2245
553 Ga0207680_10153306 3300025903 Bacteria 1538
554 Ga0207647_10006064 3300025904 Bacteria 8811
555 Ga0207685_10027892 3300025905 Bacteria 1982
556 Ga0207699_10017528 3300025906 Bacteria 3772
557 Ga0207699_10092052 3300025906 Bacteria 1905
558 Ga0207699_10246953 3300025906 Unclassified 1228
559 Ga0207699_10279742 3300025906 Bacteria 1159
560 Ga0207645_10015838 3300025907 Bacteria 4996
561 Ga0207645_10024627 3300025907 Bacteria 3899
562 Ga0207645_10049566 3300025907 Bacteria 2681
563 Ga0207645_10124028 3300025907 Bacteria 1678
564 Ga0207645_10211413 3300025907 Bacteria 1278
565 Ga0207643_10259995 3300025908 Bacteria 1072
566 Ga0207684_10000086 3300025910 Bacteria 173807
567 Ga0207684_10000420 3300025910 Bacteria 56576
568 Ga0207684_10002005 3300025910 Bacteria 20962
569 Ga0207684_10010903 3300025910 Bacteria 7969
570 Ga0207684_10011801 3300025910 Bacteria 7619
571 Ga0207684_10040478 3300025910 Bacteria 3950
572 Ga0207684_10107671 3300025910 Bacteria 2385
573 Ga0207684_10107970 3300025910 Bacteria 2382
574 Ga0207684_10133099 3300025910 Bacteria 2134
575 Ga0207684_10332192 3300025910 Bacteria 1310
576 Ga0207684_10617136 3300025910 Unclassified 925
577 Ga0207684_10691744 3300025910 Bacteria 867
578 Ga0207684_10691778 3300025910 Bacteria 867
579 Ga0207684_10775972 3300025910 Bacteria 811
580 Ga0207684_11113825 3300025910 Unclassified 657
581 Ga0207654_10517284 3300025911 Unclassified 845
582 Ga0207707_10421670 3300025912 Bacteria 1144
583 Ga0207671_10161183 3300025914 Bacteria 1737
584 Ga0207671_10264391 3300025914 Unclassified 1354
585 Ga0207693_10002604 3300025915 Bacteria 15674
586 Ga0207693_10004447 3300025915 Bacteria 11844
587 Ga0207693_10014225 3300025915 Bacteria 6402
588 Ga0207693_10017311 3300025915 Bacteria 5748
589 Ga0207693_10030768 3300025915 Bacteria 4240
590 Ga0207693_10038374 3300025915 Bacteria 3773
591 Ga0207693_10044851 3300025915 Unclassified 3474
592 Ga0207693_10064667 3300025915 Bacteria 2865
593 Ga0207693_10119387 3300025915 Unclassified 2071
594 Ga0207693_10238448 3300025915 Unclassified 1428
595 Ga0207693_10673807 3300025915 Bacteria 802
596 Ga0207663_10004534 3300025916 Bacteria 6918
597 Ga0207663_10006188 3300025916 Bacteria 6100
598 Ga0207663_10043102 3300025916 Bacteria 2761
599 Ga0207663_10095743 3300025916 Bacteria 1981
600 Ga0207663_10481896 3300025916 Unclassified 961
601 Ga0207660_10054366 3300025917 Bacteria 2857
602 Ga0207662_10000089 3300025918 Bacteria 43194
603 Ga0207662_10040370 3300025918 Bacteria 2743
604 Ga0207662_10350579 3300025918 Bacteria 991
605 Ga0207662_10853663 3300025918 Unclassified 643
606 Ga0207657_10011863 3300025919 Bacteria 8626
607 Ga0207657_10502068 3300025919 Unclassified 950
608 Ga0207657_10657858 3300025919 Unclassified 815
609 Ga0207649_10544724 3300025920 Unclassified 887
610 Ga0207649_10685213 3300025920 Unclassified 794
611 Ga0207646_10003191 3300025922 Bacteria 18736
612 Ga0207646_10006143 3300025922 Bacteria 12495
613 Ga0207646_10016763 3300025922 Bacteria 6873
614 Ga0207646_10022613 3300025922 Bacteria 5789
615 Ga0207646_10057285 3300025922 Bacteria 3482
616 Ga0207646_10080202 3300025922 Unclassified 2918
617 Ga0207646_10156134 3300025922 Unclassified 2058
618 Ga0207646_10213769 3300025922 Bacteria 1741
619 Ga0207646_10238743 3300025922 Unclassified 1642
620 Ga0207646_10397861 3300025922 Bacteria 1244
621 Ga0207646_10406407 3300025922 Bacteria 1229
622 Ga0207646_10495126 3300025922 Bacteria 1101
623 Ga0207646_10625729 3300025922 Unclassified 965
624 Ga0207646_11177731 3300025922 Viruses 672
625 Ga0207646_11274875 3300025922 Unclassified 642
626 Ga0207646_11803858 3300025922 Unclassified 523
627 Ga0207681_10060386 3300025923 Bacteria 2602
628 Ga0207681_10131864 3300025923 Bacteria 1849
629 Ga0207681_10164049 3300025923 Bacteria 1678
630 Ga0207681_10262073 3300025923 Unclassified 1353
631 Ga0207681_10658863 3300025923 Bacteria 868
632 Ga0207681_11148164 3300025923 Unclassified 652
633 Ga0207650_10052226 3300025925 Unclassified 3027
634 Ga0207650_10088966 3300025925 Bacteria 2356
635 Ga0207650_10366412 3300025925 Unclassified 1188
636 Ga0207650_10456906 3300025925 Unclassified 1063
637 Ga0207650_10586519 3300025925 Unclassified 936
638 Ga0207659_10015580 3300025926 Unclassified 4930
639 Ga0207659_10021183 3300025926 Bacteria 4310
640 Ga0207659_10066124 3300025926 Bacteria 2622
641 Ga0207659_10126807 3300025926 Unclassified 1964
642 Ga0207659_10157362 3300025926 Bacteria 1780
643 Ga0207659_10197623 3300025926 Bacteria 1604
644 Ga0207659_10397215 3300025926 Unclassified 1152
645 Ga0207659_11275020 3300025926 Unclassified 631
646 Ga0207687_10987201 3300025927 Unclassified 722
647 Ga0207687_11318811 3300025927 Bacteria 620
648 Ga0207700_10017289 3300025928 Bacteria 4814
649 Ga0207700_10045160 3300025928 Bacteria 3249
650 Ga0207700_10085493 3300025928 Unclassified 2476
651 Ga0207700_10239441 3300025928 Bacteria 1546
652 Ga0207700_10285426 3300025928 Bacteria 1421
653 Ga0207664_10169372 3300025929 Unclassified 1868
654 Ga0207664_10208550 3300025929 Unclassified 1690
655 Ga0207664_10264388 3300025929 Bacteria 1505
656 Ga0207664_10307113 3300025929 Bacteria 1397
657 Ga0207664_10339238 3300025929 Bacteria 1328
658 Ga0207664_10661145 3300025929 Unclassified 939
659 Ga0207664_11675097 3300025929 Unclassified 558
660 Ga0207644_10011551 3300025931 Bacteria 5846
661 Ga0207644_10020106 3300025931 Bacteria 4536
662 Ga0207644_10034550 3300025931 Bacteria 3538
663 Ga0207644_10040767 3300025931 Bacteria 3282
664 Ga0207644_10041879 3300025931 Bacteria 3242
665 Ga0207644_10183117 3300025931 Bacteria 1643
666 Ga0207644_10193804 3300025931 Unclassified 1599
667 Ga0207644_10343387 3300025931 Unclassified 1211
668 Ga0207644_10466783 3300025931 Unclassified 1038
669 Ga0207644_10917386 3300025931 Bacteria 734
670 Ga0207690_10005749 3300025932 Bacteria 7331
671 Ga0207690_10238379 3300025932 Bacteria 1400
672 Ga0207706_10000188 3300025933 Bacteria 68890
673 Ga0207706_10010080 3300025933 Bacteria 8654
674 Ga0207706_10044328 3300025933 Unclassified 3942
675 Ga0207706_10059551 3300025933 Bacteria 3363
676 Ga0207706_10118939 3300025933 Bacteria 2323
677 Ga0207706_10151759 3300025933 Archaea 2038
678 Ga0207706_10189907 3300025933 Bacteria 1803
679 Ga0207706_10566386 3300025933 Bacteria 977
680 Ga0207706_10650048 3300025933 Unclassified 903
681 Ga0207686_10003060 3300025934 Bacteria 8999
682 Ga0207686_10703276 3300025934 Unclassified 803
683 Ga0207686_10842352 3300025934 Bacteria 737
684 Ga0207709_11095545 3300025935 Unclassified 654
685 Ga0207670_10047887 3300025936 Bacteria 2850
686 Ga0207670_10109325 3300025936 Bacteria 1989
687 Ga0207670_10300494 3300025936 Bacteria 1257
688 Ga0207670_10905249 3300025936 Bacteria 739
689 Ga0207669_10090693 3300025937 Bacteria 1988
690 Ga0207669_10193127 3300025937 Bacteria 1470
691 Ga0207669_10536477 3300025937 Unclassified 942
692 Ga0207704_10331020 3300025938 Bacteria 1179
693 Ga0207704_11109053 3300025938 Unclassified 672
694 Ga0207665_10022019 3300025939 Bacteria 4190
695 Ga0207665_10203684 3300025939 Unclassified 1443
696 Ga0207665_10269645 3300025939 Unclassified 1263
697 Ga0207665_10554646 3300025939 Unclassified 893
698 Ga0207665_10899554 3300025939 Unclassified 702
699 Ga0207665_11073247 3300025939 Unclassified 642
700 Ga0207691_10008869 3300025940 Bacteria 9654
701 Ga0207691_10088805 3300025940 Bacteria 2772
702 Ga0207691_10225101 3300025940 Bacteria 1625
703 Ga0207691_11526670 3300025940 Unclassified 545
704 Ga0207711_10583408 3300025941 Bacteria 1043
705 Ga0207689_10070895 3300025942 Bacteria 2862
706 Ga0207689_10373304 3300025942 Bacteria 1187
707 Ga0207661_10084032 3300025944 Bacteria 2636
708 Ga0207661_10209700 3300025944 Unclassified 1716
709 Ga0207661_10234492 3300025944 Bacteria 1626
710 Ga0207661_10354353 3300025944 Bacteria 1324
711 Ga0207661_10815376 3300025944 Unclassified 859
712 Ga0207667_10508714 3300025949 Bacteria 1221
713 Ga0207651_10055391 3300025960 Bacteria 2723
714 Ga0207651_10273474 3300025960 Unclassified 1392
715 Ga0207651_10308546 3300025960 Bacteria 1318
716 Ga0207651_10373713 3300025960 Bacteria 1206
717 Ga0207651_10393477 3300025960 Bacteria 1177
718 Ga0207651_10525186 3300025960 Unclassified 1026
719 Ga0207712_10033917 3300025961 Bacteria 3454
720 Ga0207668_10047253 3300025972 Bacteria 2946
721 Ga0207668_10158166 3300025972 Bacteria 1762
722 Ga0207668_10257155 3300025972 Bacteria 1421
723 Ga0207668_10353414 3300025972 Unclassified 1229
724 Ga0207658_10054081 3300025986 Bacteria 2969
725 Ga0207658_10055104 3300025986 Bacteria 2945
726 Ga0207658_10169671 3300025986 Bacteria 1796
727 Ga0207658_10209256 3300025986 Bacteria 1633
728 Ga0207658_10239954 3300025986 Bacteria 1535
729 Ga0207658_10550770 3300025986 Bacteria 1032
730 Ga0207658_10623411 3300025986 Unclassified 970
731 Ga0207658_10700286 3300025986 Unclassified 915
732 Ga0207658_10986638 3300025986 Unclassified 768
733 Ga0207677_10055340 3300026023 Bacteria 2712
734 Ga0207677_10089494 3300026023 Bacteria 2235
735 Ga0207677_10115658 3300026023 Unclassified 2007
736 Ga0207677_10438649 3300026023 Unclassified 1116
737 Ga0207677_10895214 3300026023 Unclassified 800
738 Ga0207677_11579088 3300026023 Bacteria 607
739 Ga0207703_10223540 3300026035 Unclassified 1685
740 Ga0207703_10334384 3300026035 Unclassified 1390
741 Ga0207703_10507542 3300026035 Unclassified 1133
742 Ga0207703_11084824 3300026035 Unclassified 769
743 Ga0207678_10016608 3300026067 Bacteria 6467
744 Ga0207678_11218149 3300026067 Unclassified 666
745 Ga0207708_10017596 3300026075 Bacteria 5381
746 Ga0207702_10067449 3300026078 Bacteria 3070
747 Ga0207702_10131820 3300026078 Bacteria 2250
748 Ga0207702_11139311 3300026078 Unclassified 774
749 Ga0207641_10194876 3300026088 Bacteria 1864
750 Ga0207641_10545080 3300026088 Unclassified 1131
751 Ga0207641_10549687 3300026088 Bacteria 1126
752 Ga0207641_11301147 3300026088 Unclassified 727
753 Ga0207648_10033297 3300026089 Bacteria 4546
754 Ga0207648_10256946 3300026089 Unclassified 1558
755 Ga0207648_10409229 3300026089 Bacteria 1230
756 Ga0207648_10524517 3300026089 Bacteria 1086
757 Ga0207648_10563402 3300026089 Bacteria 1047
758 Ga0207676_10266573 3300026095 Unclassified 1549
759 Ga0207674_10181056 3300026116 Bacteria 2059
760 Ga0207675_100147175 3300026118 Bacteria 2240
761 Ga0207675_100191431 3300026118 Bacteria 1962
762 Ga0207675_100226766 3300026118 Bacteria 1801
763 Ga0207683_10009787 3300026121 Bacteria 8173
764 Ga0207683_10065759 3300026121 Bacteria 3197
765 Ga0207683_10113212 3300026121 Bacteria 2430
766 Ga0207683_10377554 3300026121 Bacteria 1303
767 Ga0207683_10634955 3300026121 Bacteria 989
768 Ga0207683_12015337 3300026121 Unclassified 526
769 Ga0209968_1041570 3300027526 Unclassified 787
770 Ga0209970_1022530 3300027614 Bacteria 1070
771 Ga0210002_1017781 3300027617 Bacteria 1133
772 Ga0209974_10117792 3300027876 Unclassified 939
773 Ga0268266_10029888 3300028379 Bacteria 4629
774 Ga0268266_10061954 3300028379 Unclassified 3227
775 Ga0268266_10177242 3300028379 Unclassified 1938
776 Ga0268266_10178840 3300028379 Bacteria 1930
777 Ga0268266_10314768 3300028379 Unclassified 1463
778 Ga0268266_10593835 3300028379 Bacteria 1063
779 Ga0268266_11233983 3300028379 Unclassified 723
780 Ga0268266_11375421 3300028379 Bacteria 681
781 Ga0268266_11823142 3300028379 Unclassified 583
782 Ga0268265_10095375 3300028380 Bacteria 2389
783 Ga0268265_10221479 3300028380 Bacteria 1656
784 Ga0268265_10365348 3300028380 Bacteria 1323
785 Ga0268264_10176400 3300028381 Bacteria 1937
786 Ga0268264_10570503 3300028381 Unclassified 1112
787 Ga0307513_10081866 3300031456 Bacteria 3325
788 Ga0373926_0071875 3300035083 Bacteria 1272
789 Ga0373934_0037529 3300035086 Bacteria 1908
790 Ga0373944_0041175 3300035089 Bacteria 1429
791 Ga0373951_0264004 3300035091 Unclassified 521
792 Ga0373936_0575435 3300035113 Unclassified 528
793 Ga0373939_0415510 3300035114 Unclassified 560
794 Ga0373945_0134076 3300035116 Unclassified 994
795 Ga0373945_0154255 3300035116 Unclassified 933
796 Ga0373953_0048245 3300035117 Bacteria 1715
797 Ga0373953_0107311 3300035117 Bacteria 1179
798 Ga0373954_0208424 3300035118 Unclassified 961
799 Ga0373956_0048478 3300035119 Bacteria 1903
800 Ga0373956_0183057 3300035119 Bacteria 991
801 Ga0373957_0047171 3300035120 Bacteria 1638
802 Ga0373960_0115317 3300035121 Bacteria 886
803 Ga0373943_0015104 3300035170 Bacteria 3505
804 Ga0373943_0042762 3300035170 Bacteria 2197
805 Ga0373943_0066888 3300035170 Bacteria 1811
806 Ga0373943_0095035 3300035170 Bacteria 1550
807 Ga0373943_0167533 3300035170 Bacteria 1200
808 Ga0373943_0424648 3300035170 Unclassified 770
809 Ga0373946_0082381 3300035171 Bacteria 1411
810 Ga0373946_0139137 3300035171 Bacteria 1124
811 Ga0373946_0476973 3300035171 Unclassified 638
812 Ga0373946_0697437 3300035171 Bacteria 531
813 Ga0373955_0509414 3300035172 Unclassified 735
814 Ga0373962_0177204 3300035242 Unclassified 711
815 Ga0373924_0110717 3300035410 Bacteria 1187
816 Ga0373931_0309196 3300035691 Bacteria 978
817 Ga0373931_0313080 3300035691 Unclassified 973
818 Ga0373931_0973648 3300035691 Unclassified 573
819 Ga0373935_0073904 3300035692 Bacteria 2203
820 Ga0373935_0128168 3300035692 Bacteria 1702
821 Ga0373935_0414408 3300035692 Unclassified 969
822 Ga0373935_0508149 3300035692 Bacteria 875
823 Ga0373935_1000535 3300035692 Bacteria 621
824 Ga0373927_0079047 3300035695 Bacteria 2131
825 Ga0373927_0329959 3300035695 Bacteria 1005
826 Ga0373927_0433919 3300035695 Unclassified 867
827 Ga0373947_0024953 3300035725 Bacteria 3486
828 Ga0373947_0959159 3300035725 Unclassified 583
829 Ga0373937_0189570 3300036401 Unclassified 1932
830 Ga0373937_0327932 3300036401 Unclassified 1449
831 Ga0373937_1485159 3300036401 Unclassified 625
832 Ga0373925_0185037 3300037068 Bacteria 1651
833 Ga0373925_0211021 3300037068 Bacteria 1547
834 Ga0373925_0353460 3300037068 Bacteria 1193
835 Ga0373925_1277245 3300037068 Bacteria 603
836 Ga0395900_0187968 3300037418 Bacteria 2096
837 Ga0395900_0328739 3300037418 Bacteria 1507
838 Ga0395900_0819172 3300037418 Bacteria 858
839 Ga0395898_0546663 3300037466 Bacteria 1100
840 Ga0395905_1144168 3300037471 Unclassified 682
841 Ga0395905_1404066 3300037471 Bacteria 602
842 Ga0436364_1300954 3300037853 Bacteria 1911
843 Ga0395901_0089419 3300038443 Bacteria 3223
844 Ga0395901_0634846 3300038443 Bacteria 1073
845 Ga0436361_0116159 3300039447 Bacteria 11207
846 Ga0436362_0661146 3300039453 Unclassified 915
847 Ga0451839_1517091 3300041496 Unclassified 557
848 Ga0451853_0163666 3300041512 Unclassified 678
849 Ga0451853_1432400 3300041512 Unclassified 808
850 Ga0451853_3799293 3300041512 Unclassified 758
851 Ga0439448_0041984 3300042005 Unclassified 1482
852 Ga0439451_026132 3300042009 Unclassified 1177
853 Ga0439455_0002794 3300042012 Bacteria 3238
854 Ga0439464_0005373 3300042439 Bacteria 3311
855 Ga0439440_0026978 3300042993 Unclassified 1332
856 Ga0466964_0365299 3300044706 Unclassified 745
857 Ga0466960_0706882 3300044901 Unclassified 605
858 Ga0451576_0128289 3300045051 Bacteria 2643
859 Ga0451576_1502492 3300045051 Unclassified 700
860 Ga0466967_0073846 3300045976 Bacteria 3061
861 Ga0495592_0030779 3300046454 Bacteria 4059
862 Ga0495641_0047470 3300046461 Bacteria 1971
863 Ga0495651_0036056 3300046462 Bacteria 3850
864 Ga0495580_0314573 3300046472 Bacteria 1065
865 Ga0495639_0162450 3300046475 Unclassified 1082
866 Ga0495662_0309643 3300046476 Unclassified 777
867 Ga0495664_0193556 3300046477 Unclassified 1233
868 Ga0495584_0107485 3300046491 Unclassified 1411
869 Ga0495585_0062846 3300046492 Bacteria 2039
870 Ga0495594_0192278 3300046499 Unclassified 1163
871 Ga0495594_0555068 3300046499 Unclassified 652
872 Ga0495608_0167904 3300046511 Unclassified 1393
873 Ga0495608_0566517 3300046511 Unclassified 684
874 Ga0495616_0411717 3300046513 Unclassified 554
875 Ga0495628_0075768 3300046516 Bacteria 2619
876 Ga0495628_0138960 3300046516 Bacteria 1855
877 Ga0495628_0940721 3300046516 Unclassified 598
878 Ga0495630_0042785 3300046517 Bacteria 3383
879 Ga0495630_1156304 3300046517 Unclassified 586
880 Ga0495652_0111830 3300046529 Bacteria 2195
881 Ga0495652_0511430 3300046529 Unclassified 831
882 Ga0495665_0279404 3300046531 Unclassified 857
883 Ga0495640_0655196 3300046533 Unclassified 632
884 Ga0495586_0104035 3300046535 Bacteria 1577
885 Ga0495645_0012204 3300046543 Bacteria 6050
886 Ga0495645_0108438 3300046543 Bacteria 1967
887 Ga0495633_0238967 3300046558 Bacteria 830
888 Ga0495667_0226375 3300046559 Unclassified 1193
889 Ga0495634_0555254 3300046642 Bacteria 669
890 Ga0495659_0179511 3300046664 Bacteria 862
891 Ga0495588_0103975 3300046674 Unclassified 1494
892 Ga0495657_0360909 3300046675 Bacteria 859
893 Ga0495657_0436421 3300046675 Unclassified 768
894 Ga0495599_0001261 3300046678 Bacteria 14359
895 Ga0495599_0045422 3300046678 Bacteria 2755
896 Ga0495623_0004789 3300046679 Bacteria 8894
897 Ga0495646_0028892 3300046680 Bacteria 3469
898 Ga0495646_0237755 3300046680 Unclassified 980
899 Ga0495647_0038968 3300046681 Bacteria 1799
900 Ga0495647_0054240 3300046681 Bacteria 1566
901 Ga0495647_0392040 3300046681 Unclassified 637
902 Ga0495658_0090337 3300046683 Unclassified 1813
903 Ga0495658_0096386 3300046683 Bacteria 1759
904 Ga0495669_0032580 3300046684 Bacteria 2291
905 Ga0495669_0045956 3300046684 Bacteria 1948
906 Ga0495669_0079548 3300046684 Bacteria 1503
907 Ga0495613_0584009 3300046689 Unclassified 745
908 Ga0495624_0181861 3300046690 Unclassified 1281
909 Ga0495624_0576803 3300046690 Unclassified 671
910 Ga0495670_0494467 3300046691 Unclassified 664
911 Ga0495660_0352436 3300046810 Bacteria 654
912 Ga0495674_0050277 3300047319 Bacteria 3679
913 Ga0495676_0225163 3300047321 Unclassified 1291
914 Ga0495680_0295362 3300047322 Unclassified 1139
915 Ga0495683_0305932 3300047323 Unclassified 682
916 Ga0495675_0039717 3300047444 Bacteria 2998
917 Ga0495681_0330264 3300047470 Unclassified 584
918 Ga0495684_0026060 3300047471 Bacteria 4494
919 Ga0495684_0188928 3300047471 Unclassified 1524
920 Ga0496100_0050137 3300048903 Bacteria 2703
921 Ga0496100_0141139 3300048903 Unclassified 1708
922 Ga0496100_0173756 3300048903 Bacteria 1554
923 Ga0496100_0393186 3300048903 Bacteria 1055
924 Ga0496100_0605693 3300048903 Unclassified 851
925 Ga0496101_0048881 3300048904 Bacteria 3041
926 Ga0496101_0094410 3300048904 Bacteria 2229
927 Ga0496101_0476990 3300048904 Unclassified 985
928 Ga0496102_0266591 3300048905 Unclassified 1615
929 Ga0496102_0276440 3300048905 Bacteria 1583
930 Ga0496102_0335715 3300048905 Bacteria 1423
931 Ga0496102_0372702 3300048905 Unclassified 1343
932 Ga0496102_0892295 3300048905 Bacteria 811
933 Ga0496104_0027669 3300048907 Bacteria 5250
934 Ga0496104_0130296 3300048907 Bacteria 2416
935 Ga0496104_0393095 3300048907 Bacteria 1299
936 Ga0496104_0393901 3300048907 Bacteria 1297
937 Ga0496104_0433303 3300048907 Bacteria 1227
938 Ga0496104_1394803 3300048907 Unclassified 604
939 Ga0496105_0027342 3300048908 Bacteria 4659
940 Ga0496105_0130926 3300048908 Bacteria 2068
941 Ga0496105_0260663 3300048908 Unclassified 1402
942 Ga0496105_0608303 3300048908 Bacteria 847
943 Ga0496106_0047246 3300048909 Bacteria 3239
944 Ga0496106_0160877 3300048909 Bacteria 1775
945 Ga0496106_0225288 3300048909 Bacteria 1496
946 Ga0496107_0037363 3300048910 Bacteria 3484
947 Ga0496107_0085001 3300048910 Unclassified 2309
948 Ga0496107_0646424 3300048910 Unclassified 780
949 Ga0496107_0664374 3300048910 Bacteria 768
950 Ga0496108_0203878 3300048911 Bacteria 1716
951 Ga0496108_0295108 3300048911 Unclassified 1412
952 Ga0496108_0896753 3300048911 Unclassified 761
953 Ga0496108_1033322 3300048911 Unclassified 701
954 Ga0496109_0013505 3300048912 Bacteria 7085
955 Ga0496109_0193187 3300048912 Unclassified 1913
956 Ga0496109_0218856 3300048912 Unclassified 1791
957 Ga0496109_0254018 3300048912 Bacteria 1655
958 Ga0496109_0265414 3300048912 Unclassified 1617
959 Ga0496109_0330676 3300048912 Unclassified 1439
960 Ga0496109_0507684 3300048912 Bacteria 1138
961 Ga0496109_1863980 3300048912 Unclassified 534
962 Ga0496110_0119170 3300048913 Bacteria 2377
963 Ga0496110_0119191 3300048913 Bacteria 2377
964 Ga0496110_0335389 3300048913 Unclassified 1378
965 Ga0496111_0107611 3300048914 Bacteria 2053
966 Ga0496111_0576379 3300048914 Bacteria 825
967 Ga0496111_0620842 3300048914 Unclassified 790
968 Ga0496111_1156060 3300048914 Unclassified 550
969 Ga0496112_0022444 3300048915 Bacteria 6015
970 Ga0496112_0025243 3300048915 Bacteria 5705
971 Ga0496112_0292925 3300048915 Unclassified 1573
972 Ga0496112_0373006 3300048915 Bacteria 1368
973 Ga0496112_0801237 3300048915 Bacteria 867
974 Ga0496113_0199609 3300048916 Bacteria 1590
975 Ga0496114_0009375 3300048917 Bacteria 7772
976 Ga0496114_0041374 3300048917 Bacteria 3819
977 Ga0496114_0046897 3300048917 Bacteria 3592
978 Ga0496114_0237013 3300048917 Bacteria 1604
979 Ga0496115_0005412 3300048918 Bacteria 9284
980 Ga0496115_0005523 3300048918 Bacteria 9202
981 Ga0496115_0083134 3300048918 Unclassified 2609
982 Ga0496115_0125245 3300048918 Bacteria 2116
983 Ga0496115_0757548 3300048918 Unclassified 759
984 Ga0496115_1042147 3300048918 Unclassified 623
985 nmdc:mga05p37_176863_c1 3300050507 Unclassified 2599
986 nmdc:mga05p37_217959_c1 3300050507 Bacteria 2304
987 nmdc:mga05p37_392650_c1 3300050507 Bacteria 1622
988 nmdc:mga08y16_1259552_c1 3300050511 Unclassified 708
989 nmdc:mga08y16_326661_c1 3300050511 Unclassified 1578
990 nmdc:mga08y16_688627_c1 3300050511 Unclassified 1023
991 nmdc:mga0n895_1091723_c1 3300050512 Unclassified 776
992 nmdc:mga0n895_129254_c1 3300050512 Bacteria 2550
993 nmdc:mga0n895_1365090_c1 3300050512 Bacteria 678
994 nmdc:mga0n895_339315_c1 3300050512 Unclassified 1522
995 nmdc:mga0n895_443577_c1 3300050512 Bacteria 1311
996 nmdc:mga0n895_685221_c1 3300050512 Bacteria 1022
997 nmdc:mga0n895_786013_c1 3300050512 Bacteria 943
998 nmdc:mga0rr50_550433_c1 3300050513 Bacteria 982
999 nmdc:mga0rr50_900818_c1 3300050513 Unclassified 754
1000 nmdc:mga08x19_290480_c1 3300050514 Unclassified 1134
1001 nmdc:mga0a205_146370_c2 3300050515 Bacteria 952
1002 nmdc:mga0a205_269020_c1 3300050515 Bacteria 1581
1003 nmdc:mga0a205_391479_c1 3300050515 Bacteria 1254
1004 nmdc:mga0a205_847300_c1 3300050515 Bacteria 761
1005 Ga0495601_0002282 3300053077 Bacteria 10822
1006 Ga0495601_0508381 3300053077 Bacteria 777
1007 Ga0495612_0031895 3300053078 Bacteria 2127
1008 Ga0495595_0419337 3300053084 Unclassified 679
1009 Ga0495619_0393072 3300053085 Unclassified 958
1010 Ga0495619_0537784 3300053085 Bacteria 802
1011 Ga0207692_10442017
1012 SwRhRL2b_contig_1671213
1013 CNXas_1000026
1014 JGI24035J26624_1000575
1015 JGI25406J46586_10000033
1016 JGI25404J52841_10015420
1017 JGI25405J52794_10000663
1018 JGI25405J52794_10009159
1019 Ga0065703_1023538
1020 Ga0065714_10233837
1021 Ga0065704_10004677
1022 Ga0065704_10018974
1023 Ga0065704_10081455
1024 Ga0065704_10328315
1025 Ga0065712_10001143
1026 Ga0065712_10020601
1027 Ga0065712_10044756
1028 Ga0065712_10084282
1029 Ga0065712_10167829
1030 Ga0065712_10185494
1031 Ga0065712_10192000
1032 Ga0065715_10005093
1033 Ga0065715_10088969
1034 Ga0065715_10241343
1035 Ga0065715_10377202
1036 Ga0065715_10530284
1037 Ga0065715_10594046
1038 Ga0065715_10597891
1039 Ga0065707_10119741
1040 Ga0065707_10206917
1041 Ga0070658_10085451
1042 Ga0070658_10324660
1043 Ga0070676_10103370
1044 Ga0070676_10282025
1045 Ga0070676_10311117
1046 Ga0070676_10467964
1047 Ga0070676_10494572
1048 Ga0070683_100004598
1049 Ga0070683_100024766
1050 Ga0070683_100033543
1051 Ga0070683_100277797
1052 Ga0070683_100492676
1053 Ga0070690_100084117
1054 Ga0070690_100121181
1055 Ga0070670_100002008
1056 Ga0070670_100047271
1057 Ga0070670_100348529
1058 Ga0070670_101857466
1059 Ga0068869_100081505
1060 Ga0068869_100625198
1061 Ga0070666_10010260
1062 Ga0070666_10029890
1063 Ga0070666_10032209
1064 Ga0070666_10160593
1065 Ga0070666_10527848
1066 Ga0070682_100518364
1067 Ga0068868_100055927
1068 Ga0068868_100085894
1069 Ga0068868_100700845
1070 Ga0070660_100012566
1071 Ga0070660_100128098
1072 Ga0070689_100030546
1073 Ga0070689_100102749
1074 Ga0070689_100401152
1075 Ga0070689_100546775
1076 Ga0070689_100636153
1077 Ga0070691_10272347
1078 Ga0070687_100046065
1079 Ga0070687_100208600
1080 Ga0070661_100073608
1081 Ga0070661_100182351
1082 Ga0070661_100424588
1083 Ga0070692_10157834
1084 Ga0070668_100058632
1085 Ga0070668_100250019
1086 Ga0070668_100290835
1087 Ga0070669_100019703
1088 Ga0070669_100032860
1089 Ga0070669_100062604
1090 Ga0070669_100109730
1091 Ga0070669_100316780
1092 Ga0070669_100334327
1093 Ga0070669_100580661
1094 Ga0070669_100591723
1095 Ga0070669_100603217
1096 Ga0070675_100008423
1097 Ga0070675_100017443
1098 Ga0070675_100031538
1099 Ga0070675_100037593
1100 Ga0070675_100081868
1101 Ga0070675_100110121
1102 Ga0070675_100205800
1103 Ga0070675_100244763
1104 Ga0070675_100393225
1105 Ga0070671_100014686
1106 Ga0070671_100015360
1107 Ga0070671_100023639
1108 Ga0070671_100078361
1109 Ga0070671_100148702
1110 Ga0070671_100175834
1111 Ga0070671_100204564
1112 Ga0070671_100307270
1113 Ga0070671_100406672
1114 Ga0070671_100928570
1115 Ga0070671_101143972
1116 Ga0070674_100023977
1117 Ga0070674_100189354
1118 Ga0070674_100534079
1119 Ga0070674_100612379
1120 Ga0070673_100003285
1121 Ga0070673_100008962
1122 Ga0070673_100019856
1123 Ga0070673_100044904
1124 Ga0070673_102282280
1125 Ga0070673_102342563
1126 Ga0070688_100001026
1127 Ga0070688_100005864
1128 Ga0070688_100034024
1129 Ga0070688_100592253
1130 Ga0070688_100713831
1131 Ga0070659_100081994
1132 Ga0070659_100349702
1133 Ga0070667_100022881
1134 Ga0070667_100068243
1135 Ga0070667_100183298
1136 Ga0070667_100184333
1137 Ga0070667_100199428
1138 Ga0070667_100209082
1139 Ga0070667_100473349
1140 Ga0070667_100932877
1141 Ga0070667_101083637
1142 Ga0070703_10022618
1143 Ga0070703_10049827
1144 Ga0070709_10019660
1145 Ga0070709_10066059
1146 Ga0070714_100007154
1147 Ga0070714_100036206
1148 Ga0070714_100129332
1149 Ga0070714_100387880
1150 Ga0070714_101306509
1151 Ga0070713_100014508
1152 Ga0070713_100023194
1153 Ga0070713_100537601
1154 Ga0070710_10010909
1155 Ga0070710_10085815
1156 Ga0070710_10132531
1157 Ga0070710_10385729
1158 Ga0070701_10221684
1159 Ga0070711_100002729
1160 Ga0070711_100004590
1161 Ga0070711_100125979
1162 Ga0070711_101383042
1163 Ga0070705_100040869
1164 Ga0070705_100076968
1165 Ga0070705_100101970
1166 Ga0070705_100720357
1167 Ga0070705_100990925
1168 Ga0070705_101418244
1169 Ga0070700_100082665
1170 Ga0070694_100229178
1171 Ga0070708_100003045
1172 Ga0070708_100014233
1173 Ga0070708_100018984
1174 Ga0070708_100097314
1175 Ga0070708_100239848
1176 Ga0070708_100317401
1177 Ga0070708_100458501
1178 Ga0070708_100521241
1179 Ga0070708_100529677
1180 Ga0070708_100558249
1181 Ga0070708_101424983
1182 Ga0070663_100559394
1183 Ga0070678_100020294
1184 Ga0070678_100038821
1185 Ga0070678_100064988
1186 Ga0070678_100085436
1187 Ga0070678_102188924
1188 Ga0070662_100001248
1189 Ga0070662_100006768
1190 Ga0070662_100057436
1191 Ga0070662_100201430
1192 Ga0070662_100364650
1193 Ga0070662_101098608
1194 Ga0070662_101566446
1195 Ga0070681_10075353
1196 Ga0068867_100049988
1197 Ga0068867_100214717
1198 Ga0068867_100795541
1199 Ga0070685_10059947
1200 Ga0070685_10312326
1201 Ga0070706_100000973
1202 Ga0070706_100001536
1203 Ga0070706_100001644
1204 Ga0070706_100033401
1205 Ga0070706_100040011
1206 Ga0070706_100086137
1207 Ga0070706_100086348
1208 Ga0070706_100107129
1209 Ga0070706_100166588
1210 Ga0070706_100220111
1211 Ga0070706_100250669
1212 Ga0070706_100273891
1213 Ga0070706_100361697
1214 Ga0070706_100408504
1215 Ga0070706_100779036
1216 Ga0070706_101334934
1217 Ga0070707_100000417
1218 Ga0070707_100004330
1219 Ga0070707_100008826
1220 Ga0070707_100021566
1221 Ga0070707_100023820
1222 Ga0070707_100064468
1223 Ga0070707_100075891
1224 Ga0070707_100147303
1225 Ga0070707_100209315
1226 Ga0070707_100287337
1227 Ga0070707_100305317
1228 Ga0070707_100318083
1229 Ga0070707_100400921
1230 Ga0070707_100407018
1231 Ga0070707_100570287
1232 Ga0070707_101676830
1233 Ga0070698_100001912
1234 Ga0070698_100029103
1235 Ga0070698_100078849
1236 Ga0070698_100188921
1237 Ga0070698_100236208
1238 Ga0070698_100440158
1239 Ga0070698_100854702
1240 Ga0070699_100151140
1241 Ga0070699_100189486
1242 Ga0070699_100208815
1243 Ga0070699_100310078
1244 Ga0070699_100381370
1245 Ga0070699_100724764
1246 Ga0070679_100170634
1247 Ga0070684_100009794
1248 Ga0070684_100035854
1249 Ga0070684_100084266
1250 Ga0070684_100150877
1251 Ga0070684_101286408
1252 Ga0070697_100005670
1253 Ga0070697_100052012
1254 Ga0070697_100059575
1255 Ga0070697_100070961
1256 Ga0070697_100084789
1257 Ga0070697_100149876
1258 Ga0070697_100198152
1259 Ga0070697_100202648
1260 Ga0070697_100220955
1261 Ga0070697_100323836
1262 Ga0070697_100336777
1263 Ga0070697_100412395
1264 Ga0070697_100494819
1265 Ga0070697_100583572
1266 Ga0070697_100975550
1267 Ga0070697_101167844
1268 Ga0070697_101402799
1269 Ga0068853_101430434
1270 Ga0070672_100018459
1271 Ga0070672_100031488
1272 Ga0070672_100291863
1273 Ga0070695_100025384
1274 Ga0070696_100201562
1275 Ga0070696_101407382
1276 Ga0070693_100270692
1277 Ga0070665_100005367
1278 Ga0070665_100051024
1279 Ga0070665_100051452
1280 Ga0070665_100059119
1281 Ga0070665_100154346
1282 Ga0070665_100279098
1283 Ga0070704_100281204
1284 Ga0070704_100438833
1285 Ga0070704_101070427
1286 Ga0068855_100866624
1287 Ga0070664_100031763
1288 Ga0070664_100084022
1289 Ga0070664_100682311
1290 Ga0068857_100503564
1291 Ga0068854_100991953
1292 Ga0068856_100097738
1293 Ga0068856_100313712
1294 Ga0070702_100967277
1295 Ga0068852_100261739
1296 Ga0068852_101428386
1297 Ga0068859_100061813
1298 Ga0068859_101956349
1299 Ga0068864_100461240
1300 Ga0068864_100844676
1301 Ga0068864_100973056
1302 Ga0068864_102358926
1303 Ga0068866_10179843
1304 Ga0068861_100177234
1305 Ga0068861_100545271
1306 Ga0068870_10328578
1307 Ga0068863_100053121
1308 Ga0068863_100251730
1309 Ga0068863_101394993
1310 Ga0068858_100233377
1311 Ga0068858_101342866
1312 Ga0068860_100021532
1313 Ga0068860_101112428
1314 Ga0068860_102322226
1315 Ga0068862_100115929
1316 Ga0068862_100343238
1317 Ga0068862_101764123
1318 Ga0081455_10000917
1319 Ga0081455_10001114
1320 Ga0081455_10004812
1321 Ga0081455_10022784
1322 Ga0081455_10097507
1323 Ga0081455_10108041
1324 Ga0081455_10144829
1325 Ga0081540_1024135
1326 Ga0081540_1032635
1327 Ga0081539_10000138
1328 Ga0081539_10000727
1329 Ga0081539_10008457
1330 Ga0081539_10015667
1331 Ga0081539_10154711
1332 Ga0070717_10000307
1333 Ga0070717_10021189
1334 Ga0070717_10041272
1335 Ga0070717_10056508
1336 Ga0070717_10129793
1337 Ga0070717_10142422
1338 Ga0070717_10345227
1339 Ga0070717_10399400
1340 Ga0070717_10462030
1341 Ga0070717_10710225
1342 Ga0070717_10897786
1343 Ga0070715_10063175
1344 Ga0070716_100005743
1345 Ga0070716_100014888
1346 Ga0070716_100066906
1347 Ga0070716_100358297
1348 Ga0070716_100459624
1349 Ga0070716_100584840
1350 Ga0070712_100011157
1351 Ga0070712_100113940
1352 Ga0070712_100116700
1353 Ga0070712_100182703
1354 Ga0070712_100196336
1355 Ga0070712_100425138
1356 Ga0070712_100546498
1357 Ga0070712_100556982
1358 Ga0097621_100030303
1359 Ga0097621_100077409
1360 Ga0097621_100517254
1361 Ga0097621_101066649
1362 Ga0097621_101641319
1363 Ga0068871_100074807
1364 Ga0068871_100121126
1365 Ga0068871_100162494
1366 Ga0068871_100194916
1367 Ga0068871_100792046
1368 Ga0068871_101136230
1369 Ga0075428_100959126
1370 Ga0075428_101270889
1371 Ga0075433_10110059
1372 Ga0075433_10361187
1373 Ga0075433_10399325
1374 Ga0075433_10411518
1375 Ga0075433_10751759
1376 Ga0075434_100135895
1377 Ga0075434_100228804
1378 Ga0075434_101012563
1379 Ga0068865_100238706
1380 Ga0068865_100288165
1381 Ga0068865_100298274
1382 Ga0068865_100308938
1383 Ga0075436_100063155
1384 Ga0075436_100322826
1385 Ga0097620_100061812
1386 Ga0097620_101956259
1387 Ga0075435_100256254
1388 Ga0075435_101037901
1389 Ga0099794_10034040
1390 Ga0099794_10102596
1391 Ga0099794_10196488
1392 Ga0099795_10032861
1393 Ga0099795_10099107
1394 Ga0099795_10201632
1395 Ga0099795_10469752
1396 Ga0105244_10206818
1397 Ga0105240_11344443
1398 Ga0105240_11807404
1399 Ga0111539_10154474
1400 Ga0111539_10166473
1401 Ga0111539_10630589
1402 Ga0105245_10099858
1403 Ga0105245_10387402
1404 Ga0105245_10809460
1405 Ga0105245_10822417
1406 Ga0105245_11045162
1407 Ga0105247_10508748
1408 Ga0105247_10693997
1409 Ga0105247_10767747
1410 Ga0114129_10193325
1411 Ga0114129_10309841
1412 Ga0114129_10376077
1413 Ga0114129_10834606
1414 Ga0114129_11392988
1415 Ga0105241_10096165
1416 Ga0105241_10465553
1417 Ga0105242_10003071
1418 Ga0105242_10144638
1419 Ga0105242_11673086
1420 Ga0105248_10871670
1421 Ga0105248_11088295
1422 Ga0105237_10403847
1423 Ga0105237_10521047
1424 Ga0105238_11146306
1425 Ga0105249_10006685
1426 Ga0105249_10223648
1427 Ga0105249_10470488
1428 Ga0105249_10520645
1429 Ga0105249_11845407
1430 Ga0099796_10021116
1431 Ga0099796_10138854
1432 Ga0099796_10532861
1433 Ga0105239_10045207
1434 Ga0105239_10247852
1435 Ga0105239_10512425
1436 Ga0105239_10698308
1437 Ga0105239_11021591
1438 Ga0105239_11881702
1439 Ga0105246_10641075
1440 Ga0105246_10763501
1441 Ga0105246_11929361
1442 Ga0157329_1014665
1443 Ga0157313_1050927
1444 Ga0157342_1033568
1445 Ga0157327_1020759
1446 Ga0157373_10346328
1447 Ga0157371_10071693
1448 Ga0157371_10104294
1449 Ga0157371_10129153
1450 Ga0157371_10184713
1451 Ga0157371_10240184
1452 Ga0157370_10196344
1453 Ga0157369_10061578
1454 Ga0157374_10010486
1455 Ga0157374_10013787
1456 Ga0157374_10031906
1457 Ga0157374_10034876
1458 Ga0157374_10041582
1459 Ga0157374_10050974
1460 Ga0157374_10106786
1461 Ga0157374_10147006
1462 Ga0157374_10416909
1463 Ga0157374_10495836
1464 Ga0157374_10736823
1465 Ga0157374_11520167
1466 Ga0157374_11584534
1467 Ga0157374_11860585
1468 Ga0157374_12774831
1469 Ga0157378_10011344
1470 Ga0157378_10043703
1471 Ga0157378_10048896
1472 Ga0157378_10076120
1473 Ga0157378_10098627
1474 Ga0157378_10200080
1475 Ga0157378_10254865
1476 Ga0157378_10255914
1477 Ga0157378_10298284
1478 Ga0157378_10346912
1479 Ga0157378_10537659
1480 Ga0157378_10784107
1481 Ga0157378_11039043
1482 Ga0157378_11067099
1483 Ga0157378_12712500
1484 Ga0163162_10003956
1485 Ga0163162_10011424
1486 Ga0163162_10032151
1487 Ga0163162_10076949
1488 Ga0163162_10224876
1489 Ga0163162_10288276
1490 Ga0163162_10503427
1491 Ga0163162_10592892
1492 Ga0157372_10025879
1493 Ga0157372_10070226
1494 Ga0157372_10072102
1495 Ga0157372_10379542
1496 Ga0157372_10482257
1497 Ga0157372_10545716
1498 Ga0157372_11758748
1499 Ga0157372_12510515
1500 Ga0157375_10003551
1501 Ga0157375_10011315
1502 Ga0157375_10019073
1503 Ga0157375_10037238
1504 Ga0157375_10045195
1505 Ga0157375_10114005
1506 Ga0157375_10421497
1507 Ga0157375_10555537
1508 Ga0157375_10702397
1509 Ga0157375_11225859
1510 Ga0157375_12206379
1511 Ga0157375_12313346
1512 Ga0163163_10094500
1513 Ga0163163_10181079
1514 Ga0163163_10228960
1515 Ga0163163_10361337
1516 Ga0157380_12504131
1517 Ga0182008_10012262
1518 Ga0157377_10018404
1519 Ga0157377_10036435
1520 Ga0157377_10288541
1521 Ga0157377_10387647
1522 Ga0157377_11388629
1523 Ga0157379_10170489
1524 Ga0157376_10004555
1525 Ga0157376_10248868
1526 Ga0157376_10599849
1527 Ga0157376_10653567
1528 Ga0157376_10658104
1529 Ga0157376_11394554
1530 Ga0182005_1020527
1531 Ga0163161_10086072
1532 Ga0163161_10206690
1533 Ga0213872_10001096
1534 Ga0207666_1000260
1535 Ga0207666_1001670
1536 Ga0207673_1000464
1537 Ga0207673_1008209
1538 Ga0207697_10000568
1539 Ga0207697_10000868
1540 Ga0207697_10001518
1541 Ga0207697_10005602
1542 Ga0207697_10007623
1543 Ga0207697_10008440
1544 Ga0207697_10012518
1545 Ga0207697_10051854
1546 Ga0207697_10056676
1547 Ga0207697_10078042
1548 Ga0207697_10182806
1549 Ga0207682_10115839
1550 Ga0207692_10016595
1551 Ga0207692_10043802
1552 Ga0207692_10044217
1553 Ga0207692_10180478
1554 Ga0207692_10259964
1555 Ga0207692_10864619
1556 Ga0207642_10056813
1557 Ga0207688_10021372
1558 Ga0207688_10077543
1559 Ga0207688_10189488
1560 Ga0207688_10254252
1561 Ga0207680_10007065
1562 Ga0207680_10064532
1563 Ga0207680_10153306
1564 Ga0207647_10006064
1565 Ga0207685_10027892
1566 Ga0207699_10017528
1567 Ga0207699_10092052
1568 Ga0207699_10246953
1569 Ga0207699_10279742
1570 Ga0207645_10015838
1571 Ga0207645_10024627
1572 Ga0207645_10049566
1573 Ga0207645_10124028
1574 Ga0207645_10211413
1575 Ga0207643_10259995
1576 Ga0207684_10000086
1577 Ga0207684_10000420
1578 Ga0207684_10002005
1579 Ga0207684_10010903
1580 Ga0207684_10011801
1581 Ga0207684_10040478
1582 Ga0207684_10107671
1583 Ga0207684_10107970
1584 Ga0207684_10133099
1585 Ga0207684_10332192
1586 Ga0207684_10617136
1587 Ga0207684_10691744
1588 Ga0207684_10691778
1589 Ga0207684_10775972
1590 Ga0207684_11113825
1591 Ga0207654_10517284
1592 Ga0207707_10421670
1593 Ga0207671_10161183
1594 Ga0207671_10264391
1595 Ga0207693_10002604
1596 Ga0207693_10004447
1597 Ga0207693_10014225
1598 Ga0207693_10017311
1599 Ga0207693_10030768
1600 Ga0207693_10038374
1601 Ga0207693_10044851
1602 Ga0207693_10064667
1603 Ga0207693_10119387
1604 Ga0207693_10238448
1605 Ga0207693_10673807
1606 Ga0207663_10004534
1607 Ga0207663_10006188
1608 Ga0207663_10043102
1609 Ga0207663_10095743
1610 Ga0207663_10481896
1611 Ga0207660_10054366
1612 Ga0207662_10000089
1613 Ga0207662_10040370
1614 Ga0207662_10350579
1615 Ga0207662_10853663
1616 Ga0207657_10011863
1617 Ga0207657_10502068
1618 Ga0207657_10657858
1619 Ga0207649_10544724
1620 Ga0207649_10685213
1621 Ga0207646_10003191
1622 Ga0207646_10006143
1623 Ga0207646_10016763
1624 Ga0207646_10022613
1625 Ga0207646_10057285
1626 Ga0207646_10080202
1627 Ga0207646_10156134
1628 Ga0207646_10213769
1629 Ga0207646_10238743
1630 Ga0207646_10397861
1631 Ga0207646_10406407
1632 Ga0207646_10495126
1633 Ga0207646_10625729
1634 Ga0207646_11177731
1635 Ga0207646_11274875
1636 Ga0207646_11803858
1637 Ga0207681_10060386
1638 Ga0207681_10131864
1639 Ga0207681_10164049
1640 Ga0207681_10262073
1641 Ga0207681_10658863
1642 Ga0207681_11148164
1643 Ga0207650_10052226
1644 Ga0207650_10088966
1645 Ga0207650_10366412
1646 Ga0207650_10456906
1647 Ga0207650_10586519
1648 Ga0207659_10015580
1649 Ga0207659_10021183
1650 Ga0207659_10066124
1651 Ga0207659_10126807
1652 Ga0207659_10157362
1653 Ga0207659_10197623
1654 Ga0207659_10397215
1655 Ga0207659_11275020
1656 Ga0207687_10987201
1657 Ga0207687_11318811
1658 Ga0207700_10017289
1659 Ga0207700_10045160
1660 Ga0207700_10085493
1661 Ga0207700_10239441
1662 Ga0207700_10285426
1663 Ga0207664_10169372
1664 Ga0207664_10208550
1665 Ga0207664_10264388
1666 Ga0207664_10307113
1667 Ga0207664_10339238
1668 Ga0207664_10661145
1669 Ga0207664_11675097
1670 Ga0207644_10011551
1671 Ga0207644_10020106
1672 Ga0207644_10034550
1673 Ga0207644_10040767
1674 Ga0207644_10041879
1675 Ga0207644_10183117
1676 Ga0207644_10193804
1677 Ga0207644_10343387
1678 Ga0207644_10466783
1679 Ga0207644_10917386
1680 Ga0207690_10005749
1681 Ga0207690_10238379
1682 Ga0207706_10000188
1683 Ga0207706_10010080
1684 Ga0207706_10044328
1685 Ga0207706_10059551
1686 Ga0207706_10118939
1687 Ga0207706_10151759
1688 Ga0207706_10189907
1689 Ga0207706_10566386
1690 Ga0207706_10650048
1691 Ga0207686_10003060
1692 Ga0207686_10703276
1693 Ga0207686_10842352
1694 Ga0207709_11095545
1695 Ga0207670_10047887
1696 Ga0207670_10109325
1697 Ga0207670_10300494
1698 Ga0207670_10905249
1699 Ga0207669_10090693
1700 Ga0207669_10193127
1701 Ga0207669_10536477
1702 Ga0207704_10331020
1703 Ga0207704_11109053
1704 Ga0207665_10022019
1705 Ga0207665_10203684
1706 Ga0207665_10269645
1707 Ga0207665_10554646
1708 Ga0207665_10899554
1709 Ga0207665_11073247
1710 Ga0207691_10008869
1711 Ga0207691_10088805
1712 Ga0207691_10225101
1713 Ga0207691_11526670
1714 Ga0207711_10583408
1715 Ga0207689_10070895
1716 Ga0207689_10373304
1717 Ga0207661_10084032
1718 Ga0207661_10209700
1719 Ga0207661_10234492
1720 Ga0207661_10354353
1721 Ga0207661_10815376
1722 Ga0207667_10508714
1723 Ga0207651_10055391
1724 Ga0207651_10273474
1725 Ga0207651_10308546
1726 Ga0207651_10373713
1727 Ga0207651_10393477
1728 Ga0207651_10525186
1729 Ga0207712_10033917
1730 Ga0207668_10047253
1731 Ga0207668_10158166
1732 Ga0207668_10257155
1733 Ga0207668_10353414
1734 Ga0207658_10054081
1735 Ga0207658_10055104
1736 Ga0207658_10169671
1737 Ga0207658_10209256
1738 Ga0207658_10239954
1739 Ga0207658_10550770
1740 Ga0207658_10623411
1741 Ga0207658_10700286
1742 Ga0207658_10986638
1743 Ga0207677_10055340
1744 Ga0207677_10089494
1745 Ga0207677_10115658
1746 Ga0207677_10438649
1747 Ga0207677_10895214
1748 Ga0207677_11579088
1749 Ga0207703_10223540
1750 Ga0207703_10334384
1751 Ga0207703_10507542
1752 Ga0207703_11084824
1753 Ga0207678_10016608
1754 Ga0207678_11218149
1755 Ga0207708_10017596
1756 Ga0207702_10067449
1757 Ga0207702_10131820
1758 Ga0207702_11139311
1759 Ga0207641_10194876
1760 Ga0207641_10545080
1761 Ga0207641_10549687
1762 Ga0207641_11301147
1763 Ga0207648_10033297
1764 Ga0207648_10256946
1765 Ga0207648_10409229
1766 Ga0207648_10524517
1767 Ga0207648_10563402
1768 Ga0207676_10266573
1769 Ga0207674_10181056
1770 Ga0207675_100147175
1771 Ga0207675_100191431
1772 Ga0207675_100226766
1773 Ga0207683_10009787
1774 Ga0207683_10065759
1775 Ga0207683_10113212
1776 Ga0207683_10377554
1777 Ga0207683_10634955
1778 Ga0207683_12015337
1779 Ga0209968_1041570
1780 Ga0209970_1022530
1781 Ga0210002_1017781
1782 Ga0209974_10117792
1783 Ga0268266_10029888
1784 Ga0268266_10061954
1785 Ga0268266_10177242
1786 Ga0268266_10178840
1787 Ga0268266_10314768
1788 Ga0268266_10593835
1789 Ga0268266_11233983
1790 Ga0268266_11375421
1791 Ga0268266_11823142
1792 Ga0268265_10095375
1793 Ga0268265_10221479
1794 Ga0268265_10365348
1795 Ga0268264_10176400
1796 Ga0268264_10570503
1797 Ga0307513_10081866
1798 Ga0373926_0071875
1799 Ga0373934_0037529
1800 Ga0373944_0041175
1801 Ga0373951_0264004
1802 Ga0373936_0575435
1803 Ga0373939_0415510
1804 Ga0373945_0134076
1805 Ga0373945_0154255
1806 Ga0373953_0048245
1807 Ga0373953_0107311
1808 Ga0373954_0208424
1809 Ga0373956_0048478
1810 Ga0373956_0183057
1811 Ga0373957_0047171
1812 Ga0373960_0115317
1813 Ga0373943_0015104
1814 Ga0373943_0042762
1815 Ga0373943_0066888
1816 Ga0373943_0095035
1817 Ga0373943_0167533
1818 Ga0373943_0424648
1819 Ga0373946_0082381
1820 Ga0373946_0139137
1821 Ga0373946_0476973
1822 Ga0373946_0697437
1823 Ga0373955_0509414
1824 Ga0373962_0177204
1825 Ga0373924_0110717
1826 Ga0373931_0309196
1827 Ga0373931_0313080
1828 Ga0373931_0973648
1829 Ga0373935_0073904
1830 Ga0373935_0128168
1831 Ga0373935_0414408
1832 Ga0373935_0508149
1833 Ga0373935_1000535
1834 Ga0373927_0079047
1835 Ga0373927_0329959
1836 Ga0373927_0433919
1837 Ga0373947_0024953
1838 Ga0373947_0959159
1839 Ga0373937_0189570
1840 Ga0373937_0327932
1841 Ga0373937_1485159
1842 Ga0373925_0185037
1843 Ga0373925_0211021
1844 Ga0373925_0353460
1845 Ga0373925_1277245
1846 Ga0395900_0187968
1847 Ga0395900_0328739
1848 Ga0395900_0819172
1849 Ga0395898_0546663
1850 Ga0395905_1144168
1851 Ga0395905_1404066
1852 Ga0436364_1300954
1853 Ga0395901_0089419
1854 Ga0395901_0634846
1855 Ga0436361_0116159
1856 Ga0436362_0661146
1857 Ga0451839_1517091
1858 Ga0451853_0163666
1859 Ga0451853_1432400
1860 Ga0451853_3799293
1861 Ga0439448_0041984
1862 Ga0439451_026132
1863 Ga0439455_0002794
1864 Ga0439464_0005373
1865 Ga0439440_0026978
1866 Ga0466964_0365299
1867 Ga0466960_0706882
1868 Ga0451576_0128289
1869 Ga0451576_1502492
1870 Ga0466967_0073846
1871 Ga0495592_0030779
1872 Ga0495641_0047470
1873 Ga0495651_0036056
1874 Ga0495580_0314573
1875 Ga0495639_0162450
1876 Ga0495662_0309643
1877 Ga0495664_0193556
1878 Ga0495584_0107485
1879 Ga0495585_0062846
1880 Ga0495594_0192278
1881 Ga0495594_0555068
1882 Ga0495608_0167904
1883 Ga0495608_0566517
1884 Ga0495616_0411717
1885 Ga0495628_0075768
1886 Ga0495628_0138960
1887 Ga0495628_0940721
1888 Ga0495630_0042785
1889 Ga0495630_1156304
1890 Ga0495652_0111830
1891 Ga0495652_0511430
1892 Ga0495665_0279404
1893 Ga0495640_0655196
1894 Ga0495586_0104035
1895 Ga0495645_0012204
1896 Ga0495645_0108438
1897 Ga0495633_0238967
1898 Ga0495667_0226375
1899 Ga0495634_0555254
1900 Ga0495659_0179511
1901 Ga0495588_0103975
1902 Ga0495657_0360909
1903 Ga0495657_0436421
1904 Ga0495599_0001261
1905 Ga0495599_0045422
1906 Ga0495623_0004789
1907 Ga0495646_0028892
1908 Ga0495646_0237755
1909 Ga0495647_0038968
1910 Ga0495647_0054240
1911 Ga0495647_0392040
1912 Ga0495658_0090337
1913 Ga0495658_0096386
1914 Ga0495669_0032580
1915 Ga0495669_0045956
1916 Ga0495669_0079548
1917 Ga0495613_0584009
1918 Ga0495624_0181861
1919 Ga0495624_0576803
1920 Ga0495670_0494467
1921 Ga0495660_0352436
1922 Ga0495674_0050277
1923 Ga0495676_0225163
1924 Ga0495680_0295362
1925 Ga0495683_0305932
1926 Ga0495675_0039717
1927 Ga0495681_0330264
1928 Ga0495684_0026060
1929 Ga0495684_0188928
1930 Ga0496100_0050137
1931 Ga0496100_0141139
1932 Ga0496100_0173756
1933 Ga0496100_0393186
1934 Ga0496100_0605693
1935 Ga0496101_0048881
1936 Ga0496101_0094410
1937 Ga0496101_0476990
1938 Ga0496102_0266591
1939 Ga0496102_0276440
1940 Ga0496102_0335715
1941 Ga0496102_0372702
1942 Ga0496102_0892295
1943 Ga0496104_0027669
1944 Ga0496104_0130296
1945 Ga0496104_0393095
1946 Ga0496104_0393901
1947 Ga0496104_0433303
1948 Ga0496104_1394803
1949 Ga0496105_0027342
1950 Ga0496105_0130926
1951 Ga0496105_0260663
1952 Ga0496105_0608303
1953 Ga0496106_0047246
1954 Ga0496106_0160877
1955 Ga0496106_0225288
1956 Ga0496107_0037363
1957 Ga0496107_0085001
1958 Ga0496107_0646424
1959 Ga0496107_0664374
1960 Ga0496108_0203878
1961 Ga0496108_0295108
1962 Ga0496108_0896753
1963 Ga0496108_1033322
1964 Ga0496109_0013505
1965 Ga0496109_0193187
1966 Ga0496109_0218856
1967 Ga0496109_0254018
1968 Ga0496109_0265414
1969 Ga0496109_0330676
1970 Ga0496109_0507684
1971 Ga0496109_1863980
1972 Ga0496110_0119170
1973 Ga0496110_0119191
1974 Ga0496110_0335389
1975 Ga0496111_0107611
1976 Ga0496111_0576379
1977 Ga0496111_0620842
1978 Ga0496111_1156060
1979 Ga0496112_0022444
1980 Ga0496112_0025243
1981 Ga0496112_0292925
1982 Ga0496112_0373006
1983 Ga0496112_0801237
1984 Ga0496113_0199609
1985 Ga0496114_0009375
1986 Ga0496114_0041374
1987 Ga0496114_0046897
1988 Ga0496114_0237013
1989 Ga0496115_0005412
1990 Ga0496115_0005523
1991 Ga0496115_0083134
1992 Ga0496115_0125245
1993 Ga0496115_0757548
1994 Ga0496115_1042147
1995 nmdc:mga05p37_176863_c1
1996 nmdc:mga05p37_217959_c1
1997 nmdc:mga05p37_392650_c1
1998 nmdc:mga08y16_1259552_c1
1999 nmdc:mga08y16_326661_c1
2000 nmdc:mga08y16_688627_c1
2001 nmdc:mga0n895_1091723_c1
2002 nmdc:mga0n895_129254_c1
2003 nmdc:mga0n895_1365090_c1
2004 nmdc:mga0n895_339315_c1
2005 nmdc:mga0n895_443577_c1
2006 nmdc:mga0n895_685221_c1
2007 nmdc:mga0n895_786013_c1
2008 nmdc:mga0rr50_550433_c1
2009 nmdc:mga0rr50_900818_c1
2010 nmdc:mga08x19_290480_c1
2011 nmdc:mga0a205_146370_c2
2012 nmdc:mga0a205_269020_c1
2013 nmdc:mga0a205_391479_c1
2014 nmdc:mga0a205_847300_c1
2015 Ga0495601_0002282
2016 Ga0495601_0508381
2017 Ga0495612_0031895
2018 Ga0495595_0419337
2019 Ga0495619_0393072
2020 Ga0495619_0537784

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16798

DUF5069

Domain of unknown function (DUF5069)

3

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.8812 2 139
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.8363 2 139
7a24-assembly1.cif.gz_R assembly intermediate of the plant mitochondrial complex i 0.2968 7 97
7a23-assembly1.cif.gz_R plant mitochondrial respiratory complex i 0.2968 7 97
7a24-assembly1.cif.gz_R assembly intermediate of the plant mitochondrial complex i 0.2306 7 97
ID Description Score Start End Superfamily
af_A0A0P0XUB7_219_455_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7863 100 121 3.30.420.10
af_A4I2W2_84_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5456 96 135 3.40.50.300
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3971 25 93 1.10.10.630
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3458 25 93 1.10.10.630
af_A4IDS9_54_182_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.2969 75 141 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V6J3J6-F1-model_v4 DUF5069 domain-containing protein 0.9924 52 139
AF-A0A2V5Y6S1-F1-model_v4 DUF5069 domain-containing protein 0.9865 2 139
AF-A0A2V5XS02-F1-model_v4 DUF5069 domain-containing protein 0.9847 1 139
AF-A0A2V6FWD7-F1-model_v4 DUF5069 domain-containing protein 0.9844 2 139
AF-A0A2V5YNY3-F1-model_v4 DUF5069 domain-containing protein 0.983 1 139

Map