F488116
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1010 | 313 | 2020 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300025898|Ga0207692_10442017|Ga0207692_104420172 |
| Length | 160 |
| Sequence | MQKLFPRSPYERLGGYVHLPRLIDKARLHRRGLLNGYNYKTVGFDKHLLAFLEVDPDAFEKAANEFDDQGVLDWIEQNAVAHSAAEIELWNEAMISRHPDTAAKKARFVHFLREAGGAGRTDLRTYFDLIEFDACRRSVLRRALRALGRGGRSAARGNRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 120 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 121 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 240 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 241 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 242 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 243 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.44 |
| Rhizosphere | 92.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207692_10442017 | 3300025898 | Unclassified | 817 |
| 2 | SwRhRL2b_contig_1671213 | 2162886007 | Unclassified | 3900 |
| 3 | CNXas_1000026 | 3300000545 | Bacteria | 30702 |
| 4 | JGI24035J26624_1000575 | 3300002126 | Bacteria | 3406 |
| 5 | JGI25406J46586_10000033 | 3300003203 | Bacteria | 65430 |
| 6 | JGI25404J52841_10015420 | 3300003659 | Unclassified | 1658 |
| 7 | JGI25405J52794_10000663 | 3300003911 | Bacteria | 5187 |
| 8 | JGI25405J52794_10009159 | 3300003911 | Bacteria | 1864 |
| 9 | Ga0065703_1023538 | 3300005272 | Bacteria | 700 |
| 10 | Ga0065714_10233837 | 3300005288 | Unclassified | 810 |
| 11 | Ga0065704_10004677 | 3300005289 | Bacteria | 3669 |
| 12 | Ga0065704_10018974 | 3300005289 | Unclassified | 1479 |
| 13 | Ga0065704_10081455 | 3300005289 | Bacteria | 3758 |
| 14 | Ga0065704_10328315 | 3300005289 | Unclassified | 842 |
| 15 | Ga0065712_10001143 | 3300005290 | Bacteria | 7269 |
| 16 | Ga0065712_10020601 | 3300005290 | Bacteria | 1677 |
| 17 | Ga0065712_10044756 | 3300005290 | Unclassified | 716 |
| 18 | Ga0065712_10084282 | 3300005290 | Unclassified | 2777 |
| 19 | Ga0065712_10167829 | 3300005290 | Bacteria | 1246 |
| 20 | Ga0065712_10185494 | 3300005290 | Bacteria | 1172 |
| 21 | Ga0065712_10192000 | 3300005290 | Bacteria | 1139 |
| 22 | Ga0065715_10005093 | 3300005293 | Bacteria | 3296 |
| 23 | Ga0065715_10088969 | 3300005293 | Bacteria | 19221 |
| 24 | Ga0065715_10241343 | 3300005293 | Bacteria | 1187 |
| 25 | Ga0065715_10377202 | 3300005293 | Bacteria | 912 |
| 26 | Ga0065715_10530284 | 3300005293 | Unclassified | 756 |
| 27 | Ga0065715_10594046 | 3300005293 | Bacteria | 696 |
| 28 | Ga0065715_10597891 | 3300005293 | Unclassified | 709 |
| 29 | Ga0065707_10119741 | 3300005295 | Bacteria | 2152 |
| 30 | Ga0065707_10206917 | 3300005295 | Unclassified | 1284 |
| 31 | Ga0070658_10085451 | 3300005327 | Bacteria | 2595 |
| 32 | Ga0070658_10324660 | 3300005327 | Bacteria | 1315 |
| 33 | Ga0070676_10103370 | 3300005328 | Unclassified | 1763 |
| 34 | Ga0070676_10282025 | 3300005328 | Bacteria | 1120 |
| 35 | Ga0070676_10311117 | 3300005328 | Unclassified | 1071 |
| 36 | Ga0070676_10467964 | 3300005328 | Bacteria | 889 |
| 37 | Ga0070676_10494572 | 3300005328 | Unclassified | 867 |
| 38 | Ga0070683_100004598 | 3300005329 | Bacteria | 11394 |
| 39 | Ga0070683_100024766 | 3300005329 | Bacteria | 5380 |
| 40 | Ga0070683_100033543 | 3300005329 | Bacteria | 4682 |
| 41 | Ga0070683_100277797 | 3300005329 | Bacteria | 1593 |
| 42 | Ga0070683_100492676 | 3300005329 | Unclassified | 1171 |
| 43 | Ga0070690_100084117 | 3300005330 | Bacteria | 2085 |
| 44 | Ga0070690_100121181 | 3300005330 | Unclassified | 1755 |
| 45 | Ga0070670_100002008 | 3300005331 | Bacteria | 16638 |
| 46 | Ga0070670_100047271 | 3300005331 | Bacteria | 3702 |
| 47 | Ga0070670_100348529 | 3300005331 | Unclassified | 1300 |
| 48 | Ga0070670_101857466 | 3300005331 | Unclassified | 555 |
| 49 | Ga0068869_100081505 | 3300005334 | Unclassified | 2416 |
| 50 | Ga0068869_100625198 | 3300005334 | Bacteria | 912 |
| 51 | Ga0070666_10010260 | 3300005335 | Bacteria | 5855 |
| 52 | Ga0070666_10029890 | 3300005335 | Bacteria | 3585 |
| 53 | Ga0070666_10032209 | 3300005335 | Bacteria | 3462 |
| 54 | Ga0070666_10160593 | 3300005335 | Bacteria | 1571 |
| 55 | Ga0070666_10527848 | 3300005335 | Unclassified | 857 |
| 56 | Ga0070682_100518364 | 3300005337 | Unclassified | 927 |
| 57 | Ga0068868_100055927 | 3300005338 | Bacteria | 3115 |
| 58 | Ga0068868_100085894 | 3300005338 | Bacteria | 2529 |
| 59 | Ga0068868_100700845 | 3300005338 | Bacteria | 906 |
| 60 | Ga0070660_100012566 | 3300005339 | Bacteria | 6048 |
| 61 | Ga0070660_100128098 | 3300005339 | Unclassified | 2030 |
| 62 | Ga0070689_100030546 | 3300005340 | Bacteria | 4090 |
| 63 | Ga0070689_100102749 | 3300005340 | Bacteria | 2264 |
| 64 | Ga0070689_100401152 | 3300005340 | Bacteria | 1159 |
| 65 | Ga0070689_100546775 | 3300005340 | Bacteria | 997 |
| 66 | Ga0070689_100636153 | 3300005340 | Unclassified | 927 |
| 67 | Ga0070691_10272347 | 3300005341 | Bacteria | 915 |
| 68 | Ga0070687_100046065 | 3300005343 | Unclassified | 2231 |
| 69 | Ga0070687_100208600 | 3300005343 | Unclassified | 1189 |
| 70 | Ga0070661_100073608 | 3300005344 | Bacteria | 2515 |
| 71 | Ga0070661_100182351 | 3300005344 | Unclassified | 1598 |
| 72 | Ga0070661_100424588 | 3300005344 | Bacteria | 1054 |
| 73 | Ga0070692_10157834 | 3300005345 | Bacteria | 1297 |
| 74 | Ga0070668_100058632 | 3300005347 | Bacteria | 2979 |
| 75 | Ga0070668_100250019 | 3300005347 | Bacteria | 1471 |
| 76 | Ga0070668_100290835 | 3300005347 | Unclassified | 1367 |
| 77 | Ga0070669_100019703 | 3300005353 | Bacteria | 4820 |
| 78 | Ga0070669_100032860 | 3300005353 | Bacteria | 3749 |
| 79 | Ga0070669_100062604 | 3300005353 | Bacteria | 2736 |
| 80 | Ga0070669_100109730 | 3300005353 | Bacteria | 2092 |
| 81 | Ga0070669_100316780 | 3300005353 | Bacteria | 1259 |
| 82 | Ga0070669_100334327 | 3300005353 | Unclassified | 1226 |
| 83 | Ga0070669_100580661 | 3300005353 | Unclassified | 937 |
| 84 | Ga0070669_100591723 | 3300005353 | Bacteria | 929 |
| 85 | Ga0070669_100603217 | 3300005353 | Bacteria | 920 |
| 86 | Ga0070675_100008423 | 3300005354 | Bacteria | 8002 |
| 87 | Ga0070675_100017443 | 3300005354 | Bacteria | 5704 |
| 88 | Ga0070675_100031538 | 3300005354 | Bacteria | 4285 |
| 89 | Ga0070675_100037593 | 3300005354 | Unclassified | 3944 |
| 90 | Ga0070675_100081868 | 3300005354 | Bacteria | 2692 |
| 91 | Ga0070675_100110121 | 3300005354 | Bacteria | 2329 |
| 92 | Ga0070675_100205800 | 3300005354 | Unclassified | 1709 |
| 93 | Ga0070675_100244763 | 3300005354 | Bacteria | 1568 |
| 94 | Ga0070675_100393225 | 3300005354 | Bacteria | 1236 |
| 95 | Ga0070671_100014686 | 3300005355 | Bacteria | 6329 |
| 96 | Ga0070671_100015360 | 3300005355 | Bacteria | 6185 |
| 97 | Ga0070671_100023639 | 3300005355 | Bacteria | 5031 |
| 98 | Ga0070671_100078361 | 3300005355 | Bacteria | 2762 |
| 99 | Ga0070671_100148702 | 3300005355 | Bacteria | 1977 |
| 100 | Ga0070671_100175834 | 3300005355 | Bacteria | 1811 |
| 101 | Ga0070671_100204564 | 3300005355 | Bacteria | 1674 |
| 102 | Ga0070671_100307270 | 3300005355 | Bacteria | 1350 |
| 103 | Ga0070671_100406672 | 3300005355 | Bacteria | 1165 |
| 104 | Ga0070671_100928570 | 3300005355 | Unclassified | 761 |
| 105 | Ga0070671_101143972 | 3300005355 | Bacteria | 684 |
| 106 | Ga0070674_100023977 | 3300005356 | Bacteria | 3956 |
| 107 | Ga0070674_100189354 | 3300005356 | Bacteria | 1582 |
| 108 | Ga0070674_100534079 | 3300005356 | Unclassified | 982 |
| 109 | Ga0070674_100612379 | 3300005356 | Unclassified | 921 |
| 110 | Ga0070673_100003285 | 3300005364 | Bacteria | 10035 |
| 111 | Ga0070673_100008962 | 3300005364 | Bacteria | 6690 |
| 112 | Ga0070673_100019856 | 3300005364 | Bacteria | 4833 |
| 113 | Ga0070673_100044904 | 3300005364 | Bacteria | 3423 |
| 114 | Ga0070673_102282280 | 3300005364 | Bacteria | 514 |
| 115 | Ga0070673_102342563 | 3300005364 | Unclassified | 508 |
| 116 | Ga0070688_100001026 | 3300005365 | Bacteria | 14013 |
| 117 | Ga0070688_100005864 | 3300005365 | Bacteria | 6500 |
| 118 | Ga0070688_100034024 | 3300005365 | Bacteria | 3083 |
| 119 | Ga0070688_100592253 | 3300005365 | Unclassified | 848 |
| 120 | Ga0070688_100713831 | 3300005365 | Unclassified | 777 |
| 121 | Ga0070659_100081994 | 3300005366 | Bacteria | 2576 |
| 122 | Ga0070659_100349702 | 3300005366 | Bacteria | 1240 |
| 123 | Ga0070667_100022881 | 3300005367 | Bacteria | 5182 |
| 124 | Ga0070667_100068243 | 3300005367 | Bacteria | 3025 |
| 125 | Ga0070667_100183298 | 3300005367 | Bacteria | 1852 |
| 126 | Ga0070667_100184333 | 3300005367 | Bacteria | 1847 |
| 127 | Ga0070667_100199428 | 3300005367 | Bacteria | 1776 |
| 128 | Ga0070667_100209082 | 3300005367 | Bacteria | 1734 |
| 129 | Ga0070667_100473349 | 3300005367 | Bacteria | 1146 |
| 130 | Ga0070667_100932877 | 3300005367 | Unclassified | 809 |
| 131 | Ga0070667_101083637 | 3300005367 | Unclassified | 749 |
| 132 | Ga0070703_10022618 | 3300005406 | Unclassified | 1846 |
| 133 | Ga0070703_10049827 | 3300005406 | Bacteria | 1335 |
| 134 | Ga0070709_10019660 | 3300005434 | Bacteria | 3908 |
| 135 | Ga0070709_10066059 | 3300005434 | Bacteria | 2318 |
| 136 | Ga0070714_100007154 | 3300005435 | Bacteria | 8657 |
| 137 | Ga0070714_100036206 | 3300005435 | Bacteria | 4138 |
| 138 | Ga0070714_100129332 | 3300005435 | Bacteria | 2255 |
| 139 | Ga0070714_100387880 | 3300005435 | Bacteria | 1318 |
| 140 | Ga0070714_101306509 | 3300005435 | Unclassified | 708 |
| 141 | Ga0070713_100014508 | 3300005436 | Bacteria | 5856 |
| 142 | Ga0070713_100023194 | 3300005436 | Bacteria | 4811 |
| 143 | Ga0070713_100537601 | 3300005436 | Bacteria | 1106 |
| 144 | Ga0070710_10010909 | 3300005437 | Bacteria | 4474 |
| 145 | Ga0070710_10085815 | 3300005437 | Bacteria | 1847 |
| 146 | Ga0070710_10132531 | 3300005437 | Bacteria | 1521 |
| 147 | Ga0070710_10385729 | 3300005437 | Unclassified | 935 |
| 148 | Ga0070701_10221684 | 3300005438 | Unclassified | 1128 |
| 149 | Ga0070711_100002729 | 3300005439 | Bacteria | 10126 |
| 150 | Ga0070711_100004590 | 3300005439 | Bacteria | 8175 |
| 151 | Ga0070711_100125979 | 3300005439 | Unclassified | 1901 |
| 152 | Ga0070711_101383042 | 3300005439 | Unclassified | 612 |
| 153 | Ga0070705_100040869 | 3300005440 | Bacteria | 2640 |
| 154 | Ga0070705_100076968 | 3300005440 | Unclassified | 2036 |
| 155 | Ga0070705_100101970 | 3300005440 | Unclassified | 1814 |
| 156 | Ga0070705_100720357 | 3300005440 | Unclassified | 786 |
| 157 | Ga0070705_100990925 | 3300005440 | Bacteria | 681 |
| 158 | Ga0070705_101418244 | 3300005440 | Bacteria | 579 |
| 159 | Ga0070700_100082665 | 3300005441 | Bacteria | 2077 |
| 160 | Ga0070694_100229178 | 3300005444 | Unclassified | 1397 |
| 161 | Ga0070708_100003045 | 3300005445 | Bacteria | 13021 |
| 162 | Ga0070708_100014233 | 3300005445 | Bacteria | 6536 |
| 163 | Ga0070708_100018984 | 3300005445 | Bacteria | 5765 |
| 164 | Ga0070708_100097314 | 3300005445 | Bacteria | 2690 |
| 165 | Ga0070708_100239848 | 3300005445 | Bacteria | 1702 |
| 166 | Ga0070708_100317401 | 3300005445 | Bacteria | 1468 |
| 167 | Ga0070708_100458501 | 3300005445 | Unclassified | 1203 |
| 168 | Ga0070708_100521241 | 3300005445 | Bacteria | 1121 |
| 169 | Ga0070708_100529677 | 3300005445 | Unclassified | 1111 |
| 170 | Ga0070708_100558249 | 3300005445 | Unclassified | 1080 |
| 171 | Ga0070708_101424983 | 3300005445 | Unclassified | 646 |
| 172 | Ga0070663_100559394 | 3300005455 | Unclassified | 957 |
| 173 | Ga0070678_100020294 | 3300005456 | Bacteria | 4357 |
| 174 | Ga0070678_100038821 | 3300005456 | Unclassified | 3355 |
| 175 | Ga0070678_100064988 | 3300005456 | Bacteria | 2707 |
| 176 | Ga0070678_100085436 | 3300005456 | Bacteria | 2405 |
| 177 | Ga0070678_102188924 | 3300005456 | Unclassified | 524 |
| 178 | Ga0070662_100001248 | 3300005457 | Bacteria | 15598 |
| 179 | Ga0070662_100006768 | 3300005457 | Bacteria | 7410 |
| 180 | Ga0070662_100057436 | 3300005457 | Bacteria | 2827 |
| 181 | Ga0070662_100201430 | 3300005457 | Bacteria | 1580 |
| 182 | Ga0070662_100364650 | 3300005457 | Unclassified | 1186 |
| 183 | Ga0070662_101098608 | 3300005457 | Bacteria | 682 |
| 184 | Ga0070662_101566446 | 3300005457 | Unclassified | 568 |
| 185 | Ga0070681_10075353 | 3300005458 | Bacteria | 3334 |
| 186 | Ga0068867_100049988 | 3300005459 | Bacteria | 3079 |
| 187 | Ga0068867_100214717 | 3300005459 | Unclassified | 1547 |
| 188 | Ga0068867_100795541 | 3300005459 | Bacteria | 843 |
| 189 | Ga0070685_10059947 | 3300005466 | Bacteria | 2223 |
| 190 | Ga0070685_10312326 | 3300005466 | Unclassified | 1063 |
| 191 | Ga0070706_100000973 | 3300005467 | Bacteria | 31247 |
| 192 | Ga0070706_100001536 | 3300005467 | Bacteria | 24129 |
| 193 | Ga0070706_100001644 | 3300005467 | Bacteria | 23271 |
| 194 | Ga0070706_100033401 | 3300005467 | Bacteria | 4749 |
| 195 | Ga0070706_100040011 | 3300005467 | Unclassified | 4327 |
| 196 | Ga0070706_100086137 | 3300005467 | Bacteria | 2911 |
| 197 | Ga0070706_100086348 | 3300005467 | Unclassified | 2907 |
| 198 | Ga0070706_100107129 | 3300005467 | Bacteria | 2600 |
| 199 | Ga0070706_100166588 | 3300005467 | Bacteria | 2058 |
| 200 | Ga0070706_100220111 | 3300005467 | Bacteria | 1772 |
| 201 | Ga0070706_100250669 | 3300005467 | Bacteria | 1653 |
| 202 | Ga0070706_100273891 | 3300005467 | Bacteria | 1575 |
| 203 | Ga0070706_100361697 | 3300005467 | Unclassified | 1352 |
| 204 | Ga0070706_100408504 | 3300005467 | Unclassified | 1264 |
| 205 | Ga0070706_100779036 | 3300005467 | Bacteria | 886 |
| 206 | Ga0070706_101334934 | 3300005467 | Unclassified | 657 |
| 207 | Ga0070707_100000417 | 3300005468 | Bacteria | 42073 |
| 208 | Ga0070707_100004330 | 3300005468 | Bacteria | 13297 |
| 209 | Ga0070707_100008826 | 3300005468 | Bacteria | 9347 |
| 210 | Ga0070707_100021566 | 3300005468 | Bacteria | 6090 |
| 211 | Ga0070707_100023820 | 3300005468 | Bacteria | 5791 |
| 212 | Ga0070707_100064468 | 3300005468 | Bacteria | 3518 |
| 213 | Ga0070707_100075891 | 3300005468 | Bacteria | 3243 |
| 214 | Ga0070707_100147303 | 3300005468 | Bacteria | 2291 |
| 215 | Ga0070707_100209315 | 3300005468 | Unclassified | 1901 |
| 216 | Ga0070707_100287337 | 3300005468 | Unclassified | 1598 |
| 217 | Ga0070707_100305317 | 3300005468 | Bacteria | 1546 |
| 218 | Ga0070707_100318083 | 3300005468 | Unclassified | 1512 |
| 219 | Ga0070707_100400921 | 3300005468 | Bacteria | 1332 |
| 220 | Ga0070707_100407018 | 3300005468 | Unclassified | 1321 |
| 221 | Ga0070707_100570287 | 3300005468 | Unclassified | 1094 |
| 222 | Ga0070707_101676830 | 3300005468 | Unclassified | 603 |
| 223 | Ga0070698_100001912 | 3300005471 | Bacteria | 23212 |
| 224 | Ga0070698_100029103 | 3300005471 | Bacteria | 5732 |
| 225 | Ga0070698_100078849 | 3300005471 | Bacteria | 3291 |
| 226 | Ga0070698_100188921 | 3300005471 | Bacteria | 1998 |
| 227 | Ga0070698_100236208 | 3300005471 | Bacteria | 1761 |
| 228 | Ga0070698_100440158 | 3300005471 | Bacteria | 1239 |
| 229 | Ga0070698_100854702 | 3300005471 | Bacteria | 855 |
| 230 | Ga0070699_100151140 | 3300005518 | Bacteria | 2054 |
| 231 | Ga0070699_100189486 | 3300005518 | Bacteria | 1827 |
| 232 | Ga0070699_100208815 | 3300005518 | Bacteria | 1738 |
| 233 | Ga0070699_100310078 | 3300005518 | Bacteria | 1417 |
| 234 | Ga0070699_100381370 | 3300005518 | Bacteria | 1273 |
| 235 | Ga0070699_100724764 | 3300005518 | Bacteria | 909 |
| 236 | Ga0070679_100170634 | 3300005530 | Unclassified | 2148 |
| 237 | Ga0070684_100009794 | 3300005535 | Bacteria | 7568 |
| 238 | Ga0070684_100035854 | 3300005535 | Unclassified | 4248 |
| 239 | Ga0070684_100084266 | 3300005535 | Bacteria | 2817 |
| 240 | Ga0070684_100150877 | 3300005535 | Unclassified | 2105 |
| 241 | Ga0070684_101286408 | 3300005535 | Bacteria | 688 |
| 242 | Ga0070697_100005670 | 3300005536 | Bacteria | 9615 |
| 243 | Ga0070697_100052012 | 3300005536 | Bacteria | 3329 |
| 244 | Ga0070697_100059575 | 3300005536 | Bacteria | 3109 |
| 245 | Ga0070697_100070961 | 3300005536 | Unclassified | 2856 |
| 246 | Ga0070697_100084789 | 3300005536 | Bacteria | 2613 |
| 247 | Ga0070697_100149876 | 3300005536 | Bacteria | 1966 |
| 248 | Ga0070697_100198152 | 3300005536 | Bacteria | 1706 |
| 249 | Ga0070697_100202648 | 3300005536 | Unclassified | 1687 |
| 250 | Ga0070697_100220955 | 3300005536 | Bacteria | 1614 |
| 251 | Ga0070697_100323836 | 3300005536 | Unclassified | 1328 |
| 252 | Ga0070697_100336777 | 3300005536 | Bacteria | 1301 |
| 253 | Ga0070697_100412395 | 3300005536 | Bacteria | 1173 |
| 254 | Ga0070697_100494819 | 3300005536 | Unclassified | 1069 |
| 255 | Ga0070697_100583572 | 3300005536 | Bacteria | 982 |
| 256 | Ga0070697_100975550 | 3300005536 | Bacteria | 753 |
| 257 | Ga0070697_101167844 | 3300005536 | Bacteria | 686 |
| 258 | Ga0070697_101402799 | 3300005536 | Bacteria | 624 |
| 259 | Ga0068853_101430434 | 3300005539 | Unclassified | 669 |
| 260 | Ga0070672_100018459 | 3300005543 | Bacteria | 5043 |
| 261 | Ga0070672_100031488 | 3300005543 | Bacteria | 3992 |
| 262 | Ga0070672_100291863 | 3300005543 | Bacteria | 1381 |
| 263 | Ga0070695_100025384 | 3300005545 | Bacteria | 3659 |
| 264 | Ga0070696_100201562 | 3300005546 | Bacteria | 1486 |
| 265 | Ga0070696_101407382 | 3300005546 | Unclassified | 595 |
| 266 | Ga0070693_100270692 | 3300005547 | Unclassified | 1134 |
| 267 | Ga0070665_100005367 | 3300005548 | Bacteria | 13234 |
| 268 | Ga0070665_100051024 | 3300005548 | Bacteria | 4150 |
| 269 | Ga0070665_100051452 | 3300005548 | Bacteria | 4131 |
| 270 | Ga0070665_100059119 | 3300005548 | Unclassified | 3843 |
| 271 | Ga0070665_100154346 | 3300005548 | Unclassified | 2298 |
| 272 | Ga0070665_100279098 | 3300005548 | Bacteria | 1672 |
| 273 | Ga0070704_100281204 | 3300005549 | Bacteria | 1379 |
| 274 | Ga0070704_100438833 | 3300005549 | Unclassified | 1122 |
| 275 | Ga0070704_101070427 | 3300005549 | Unclassified | 731 |
| 276 | Ga0068855_100866624 | 3300005563 | Unclassified | 956 |
| 277 | Ga0070664_100031763 | 3300005564 | Bacteria | 4415 |
| 278 | Ga0070664_100084022 | 3300005564 | Bacteria | 2747 |
| 279 | Ga0070664_100682311 | 3300005564 | Unclassified | 956 |
| 280 | Ga0068857_100503564 | 3300005577 | Bacteria | 1137 |
| 281 | Ga0068854_100991953 | 3300005578 | Unclassified | 743 |
| 282 | Ga0068856_100097738 | 3300005614 | Bacteria | 2925 |
| 283 | Ga0068856_100313712 | 3300005614 | Bacteria | 1586 |
| 284 | Ga0070702_100967277 | 3300005615 | Unclassified | 671 |
| 285 | Ga0068852_100261739 | 3300005616 | Bacteria | 1661 |
| 286 | Ga0068852_101428386 | 3300005616 | Unclassified | 714 |
| 287 | Ga0068859_100061813 | 3300005617 | Bacteria | 3774 |
| 288 | Ga0068859_101956349 | 3300005617 | Unclassified | 647 |
| 289 | Ga0068864_100461240 | 3300005618 | Bacteria | 1216 |
| 290 | Ga0068864_100844676 | 3300005618 | Unclassified | 902 |
| 291 | Ga0068864_100973056 | 3300005618 | Bacteria | 841 |
| 292 | Ga0068864_102358926 | 3300005618 | Unclassified | 538 |
| 293 | Ga0068866_10179843 | 3300005718 | Unclassified | 1248 |
| 294 | Ga0068861_100177234 | 3300005719 | Bacteria | 1771 |
| 295 | Ga0068861_100545271 | 3300005719 | Bacteria | 1056 |
| 296 | Ga0068870_10328578 | 3300005840 | Bacteria | 974 |
| 297 | Ga0068863_100053121 | 3300005841 | Bacteria | 3840 |
| 298 | Ga0068863_100251730 | 3300005841 | Bacteria | 1706 |
| 299 | Ga0068863_101394993 | 3300005841 | Unclassified | 708 |
| 300 | Ga0068858_100233377 | 3300005842 | Bacteria | 1744 |
| 301 | Ga0068858_101342866 | 3300005842 | Unclassified | 704 |
| 302 | Ga0068860_100021532 | 3300005843 | Bacteria | 6242 |
| 303 | Ga0068860_101112428 | 3300005843 | Unclassified | 809 |
| 304 | Ga0068860_102322226 | 3300005843 | Unclassified | 557 |
| 305 | Ga0068862_100115929 | 3300005844 | Bacteria | 2356 |
| 306 | Ga0068862_100343238 | 3300005844 | Bacteria | 1383 |
| 307 | Ga0068862_101764123 | 3300005844 | Unclassified | 628 |
| 308 | Ga0081455_10000917 | 3300005937 | Bacteria | 37874 |
| 309 | Ga0081455_10001114 | 3300005937 | Bacteria | 33709 |
| 310 | Ga0081455_10004812 | 3300005937 | Bacteria | 14998 |
| 311 | Ga0081455_10022784 | 3300005937 | Bacteria | 5843 |
| 312 | Ga0081455_10097507 | 3300005937 | Bacteria | 2368 |
| 313 | Ga0081455_10108041 | 3300005937 | Bacteria | 2217 |
| 314 | Ga0081455_10144829 | 3300005937 | Bacteria | 1840 |
| 315 | Ga0081540_1024135 | 3300005983 | Bacteria | 3535 |
| 316 | Ga0081540_1032635 | 3300005983 | Bacteria | 2839 |
| 317 | Ga0081539_10000138 | 3300005985 | Bacteria | 170633 |
| 318 | Ga0081539_10000727 | 3300005985 | Bacteria | 66016 |
| 319 | Ga0081539_10008457 | 3300005985 | Bacteria | 8957 |
| 320 | Ga0081539_10015667 | 3300005985 | Bacteria | 5489 |
| 321 | Ga0081539_10154711 | 3300005985 | Bacteria | 1100 |
| 322 | Ga0070717_10000307 | 3300006028 | Bacteria | 32183 |
| 323 | Ga0070717_10021189 | 3300006028 | Bacteria | 5122 |
| 324 | Ga0070717_10041272 | 3300006028 | Bacteria | 3762 |
| 325 | Ga0070717_10056508 | 3300006028 | Bacteria | 3242 |
| 326 | Ga0070717_10129793 | 3300006028 | Bacteria | 2166 |
| 327 | Ga0070717_10142422 | 3300006028 | Bacteria | 2069 |
| 328 | Ga0070717_10345227 | 3300006028 | Bacteria | 1330 |
| 329 | Ga0070717_10399400 | 3300006028 | Bacteria | 1235 |
| 330 | Ga0070717_10462030 | 3300006028 | Bacteria | 1145 |
| 331 | Ga0070717_10710225 | 3300006028 | Unclassified | 913 |
| 332 | Ga0070717_10897786 | 3300006028 | Unclassified | 807 |
| 333 | Ga0070715_10063175 | 3300006163 | Bacteria | 1631 |
| 334 | Ga0070716_100005743 | 3300006173 | Bacteria | 6028 |
| 335 | Ga0070716_100014888 | 3300006173 | Bacteria | 3989 |
| 336 | Ga0070716_100066906 | 3300006173 | Bacteria | 2097 |
| 337 | Ga0070716_100358297 | 3300006173 | Bacteria | 1035 |
| 338 | Ga0070716_100459624 | 3300006173 | Unclassified | 930 |
| 339 | Ga0070716_100584840 | 3300006173 | Unclassified | 837 |
| 340 | Ga0070712_100011157 | 3300006175 | Bacteria | 5686 |
| 341 | Ga0070712_100113940 | 3300006175 | Bacteria | 2023 |
| 342 | Ga0070712_100116700 | 3300006175 | Bacteria | 2002 |
| 343 | Ga0070712_100182703 | 3300006175 | Bacteria | 1635 |
| 344 | Ga0070712_100196336 | 3300006175 | Unclassified | 1582 |
| 345 | Ga0070712_100425138 | 3300006175 | Bacteria | 1102 |
| 346 | Ga0070712_100546498 | 3300006175 | Unclassified | 976 |
| 347 | Ga0070712_100556982 | 3300006175 | Unclassified | 966 |
| 348 | Ga0097621_100030303 | 3300006237 | Bacteria | 4282 |
| 349 | Ga0097621_100077409 | 3300006237 | Bacteria | 2761 |
| 350 | Ga0097621_100517254 | 3300006237 | Bacteria | 1083 |
| 351 | Ga0097621_101066649 | 3300006237 | Unclassified | 757 |
| 352 | Ga0097621_101641319 | 3300006237 | Unclassified | 611 |
| 353 | Ga0068871_100074807 | 3300006358 | Unclassified | 2795 |
| 354 | Ga0068871_100121126 | 3300006358 | Bacteria | 2210 |
| 355 | Ga0068871_100162494 | 3300006358 | Unclassified | 1910 |
| 356 | Ga0068871_100194916 | 3300006358 | Unclassified | 1747 |
| 357 | Ga0068871_100792046 | 3300006358 | Bacteria | 873 |
| 358 | Ga0068871_101136230 | 3300006358 | Unclassified | 731 |
| 359 | Ga0075428_100959126 | 3300006844 | Unclassified | 906 |
| 360 | Ga0075428_101270889 | 3300006844 | Unclassified | 775 |
| 361 | Ga0075433_10110059 | 3300006852 | Bacteria | 2444 |
| 362 | Ga0075433_10361187 | 3300006852 | Bacteria | 1283 |
| 363 | Ga0075433_10399325 | 3300006852 | Bacteria | 1213 |
| 364 | Ga0075433_10411518 | 3300006852 | Bacteria | 1193 |
| 365 | Ga0075433_10751759 | 3300006852 | Bacteria | 853 |
| 366 | Ga0075434_100135895 | 3300006871 | Bacteria | 2478 |
| 367 | Ga0075434_100228804 | 3300006871 | Bacteria | 1879 |
| 368 | Ga0075434_101012563 | 3300006871 | Unclassified | 845 |
| 369 | Ga0068865_100238706 | 3300006881 | Unclassified | 1429 |
| 370 | Ga0068865_100288165 | 3300006881 | Unclassified | 1310 |
| 371 | Ga0068865_100298274 | 3300006881 | Unclassified | 1289 |
| 372 | Ga0068865_100308938 | 3300006881 | Bacteria | 1268 |
| 373 | Ga0075436_100063155 | 3300006914 | Bacteria | 2560 |
| 374 | Ga0075436_100322826 | 3300006914 | Unclassified | 1109 |
| 375 | Ga0097620_100061812 | 3300006931 | Bacteria | 3774 |
| 376 | Ga0097620_101956259 | 3300006931 | Unclassified | 647 |
| 377 | Ga0075435_100256254 | 3300007076 | Bacteria | 1490 |
| 378 | Ga0075435_101037901 | 3300007076 | Unclassified | 716 |
| 379 | Ga0099794_10034040 | 3300007265 | Bacteria | 2398 |
| 380 | Ga0099794_10102596 | 3300007265 | Bacteria | 1428 |
| 381 | Ga0099794_10196488 | 3300007265 | Unclassified | 1032 |
| 382 | Ga0099795_10032861 | 3300007788 | Bacteria | 1798 |
| 383 | Ga0099795_10099107 | 3300007788 | Bacteria | 1141 |
| 384 | Ga0099795_10201632 | 3300007788 | Unclassified | 839 |
| 385 | Ga0099795_10469752 | 3300007788 | Bacteria | 582 |
| 386 | Ga0105244_10206818 | 3300009036 | Unclassified | 924 |
| 387 | Ga0105240_11344443 | 3300009093 | Bacteria | 752 |
| 388 | Ga0105240_11807404 | 3300009093 | Unclassified | 637 |
| 389 | Ga0111539_10154474 | 3300009094 | Bacteria | 2686 |
| 390 | Ga0111539_10166473 | 3300009094 | Bacteria | 2577 |
| 391 | Ga0111539_10630589 | 3300009094 | Unclassified | 1248 |
| 392 | Ga0105245_10099858 | 3300009098 | Unclassified | 2684 |
| 393 | Ga0105245_10387402 | 3300009098 | Unclassified | 1393 |
| 394 | Ga0105245_10809460 | 3300009098 | Unclassified | 975 |
| 395 | Ga0105245_10822417 | 3300009098 | Unclassified | 968 |
| 396 | Ga0105245_11045162 | 3300009098 | Unclassified | 862 |
| 397 | Ga0105247_10508748 | 3300009101 | Bacteria | 879 |
| 398 | Ga0105247_10693997 | 3300009101 | Unclassified | 765 |
| 399 | Ga0105247_10767747 | 3300009101 | Bacteria | 732 |
| 400 | Ga0114129_10193325 | 3300009147 | Bacteria | 2761 |
| 401 | Ga0114129_10309841 | 3300009147 | Bacteria | 2102 |
| 402 | Ga0114129_10376077 | 3300009147 | Unclassified | 1877 |
| 403 | Ga0114129_10834606 | 3300009147 | Unclassified | 1173 |
| 404 | Ga0114129_11392988 | 3300009147 | Unclassified | 865 |
| 405 | Ga0105241_10096165 | 3300009174 | Bacteria | 2346 |
| 406 | Ga0105241_10465553 | 3300009174 | Bacteria | 1121 |
| 407 | Ga0105242_10003071 | 3300009176 | Bacteria | 13040 |
| 408 | Ga0105242_10144638 | 3300009176 | Unclassified | 2067 |
| 409 | Ga0105242_11673086 | 3300009176 | Unclassified | 672 |
| 410 | Ga0105248_10871670 | 3300009177 | Unclassified | 1016 |
| 411 | Ga0105248_11088295 | 3300009177 | Unclassified | 903 |
| 412 | Ga0105237_10403847 | 3300009545 | Bacteria | 1371 |
| 413 | Ga0105237_10521047 | 3300009545 | Unclassified | 1195 |
| 414 | Ga0105238_11146306 | 3300009551 | Bacteria | 801 |
| 415 | Ga0105249_10006685 | 3300009553 | Bacteria | 10041 |
| 416 | Ga0105249_10223648 | 3300009553 | Bacteria | 1853 |
| 417 | Ga0105249_10470488 | 3300009553 | Unclassified | 1298 |
| 418 | Ga0105249_10520645 | 3300009553 | Unclassified | 1236 |
| 419 | Ga0105249_11845407 | 3300009553 | Unclassified | 677 |
| 420 | Ga0099796_10021116 | 3300010159 | Unclassified | 2001 |
| 421 | Ga0099796_10138854 | 3300010159 | Unclassified | 948 |
| 422 | Ga0099796_10532861 | 3300010159 | Unclassified | 527 |
| 423 | Ga0105239_10045207 | 3300010375 | Bacteria | 4826 |
| 424 | Ga0105239_10247852 | 3300010375 | Bacteria | 2000 |
| 425 | Ga0105239_10512425 | 3300010375 | Unclassified | 1364 |
| 426 | Ga0105239_10698308 | 3300010375 | Bacteria | 1160 |
| 427 | Ga0105239_11021591 | 3300010375 | Unclassified | 951 |
| 428 | Ga0105239_11881702 | 3300010375 | Unclassified | 694 |
| 429 | Ga0105246_10641075 | 3300011119 | Unclassified | 923 |
| 430 | Ga0105246_10763501 | 3300011119 | Unclassified | 854 |
| 431 | Ga0105246_11929361 | 3300011119 | Unclassified | 568 |
| 432 | Ga0157329_1014665 | 3300012491 | Unclassified | 668 |
| 433 | Ga0157313_1050927 | 3300012503 | Unclassified | 539 |
| 434 | Ga0157342_1033568 | 3300012507 | Unclassified | 657 |
| 435 | Ga0157327_1020759 | 3300012512 | Bacteria | 739 |
| 436 | Ga0157373_10346328 | 3300013100 | Unclassified | 1060 |
| 437 | Ga0157371_10071693 | 3300013102 | Bacteria | 2453 |
| 438 | Ga0157371_10104294 | 3300013102 | Bacteria | 2012 |
| 439 | Ga0157371_10129153 | 3300013102 | Unclassified | 1797 |
| 440 | Ga0157371_10184713 | 3300013102 | Unclassified | 1492 |
| 441 | Ga0157371_10240184 | 3300013102 | Bacteria | 1303 |
| 442 | Ga0157370_10196344 | 3300013104 | Unclassified | 1873 |
| 443 | Ga0157369_10061578 | 3300013105 | Unclassified | 4045 |
| 444 | Ga0157374_10010486 | 3300013296 | Bacteria | 7972 |
| 445 | Ga0157374_10013787 | 3300013296 | Bacteria | 7060 |
| 446 | Ga0157374_10031906 | 3300013296 | Bacteria | 4792 |
| 447 | Ga0157374_10034876 | 3300013296 | Bacteria | 4600 |
| 448 | Ga0157374_10041582 | 3300013296 | Bacteria | 4237 |
| 449 | Ga0157374_10050974 | 3300013296 | Bacteria | 3850 |
| 450 | Ga0157374_10106786 | 3300013296 | Bacteria | 2690 |
| 451 | Ga0157374_10147006 | 3300013296 | Bacteria | 2290 |
| 452 | Ga0157374_10416909 | 3300013296 | Unclassified | 1341 |
| 453 | Ga0157374_10495836 | 3300013296 | Bacteria | 1225 |
| 454 | Ga0157374_10736823 | 3300013296 | Unclassified | 1000 |
| 455 | Ga0157374_11520167 | 3300013296 | Unclassified | 693 |
| 456 | Ga0157374_11584534 | 3300013296 | Unclassified | 679 |
| 457 | Ga0157374_11860585 | 3300013296 | Bacteria | 627 |
| 458 | Ga0157374_12774831 | 3300013296 | Unclassified | 517 |
| 459 | Ga0157378_10011344 | 3300013297 | Bacteria | 7798 |
| 460 | Ga0157378_10043703 | 3300013297 | Bacteria | 3978 |
| 461 | Ga0157378_10048896 | 3300013297 | Archaea | 3761 |
| 462 | Ga0157378_10076120 | 3300013297 | Bacteria | 3023 |
| 463 | Ga0157378_10098627 | 3300013297 | Bacteria | 2664 |
| 464 | Ga0157378_10200080 | 3300013297 | Unclassified | 1889 |
| 465 | Ga0157378_10254865 | 3300013297 | Unclassified | 1681 |
| 466 | Ga0157378_10255914 | 3300013297 | Bacteria | 1678 |
| 467 | Ga0157378_10298284 | 3300013297 | Bacteria | 1559 |
| 468 | Ga0157378_10346912 | 3300013297 | Bacteria | 1449 |
| 469 | Ga0157378_10537659 | 3300013297 | Unclassified | 1172 |
| 470 | Ga0157378_10784107 | 3300013297 | Unclassified | 978 |
| 471 | Ga0157378_11039043 | 3300013297 | Unclassified | 855 |
| 472 | Ga0157378_11067099 | 3300013297 | Unclassified | 844 |
| 473 | Ga0157378_12712500 | 3300013297 | Bacteria | 548 |
| 474 | Ga0163162_10003956 | 3300013306 | Bacteria | 14212 |
| 475 | Ga0163162_10011424 | 3300013306 | Bacteria | 8659 |
| 476 | Ga0163162_10032151 | 3300013306 | Bacteria | 5210 |
| 477 | Ga0163162_10076949 | 3300013306 | Bacteria | 3399 |
| 478 | Ga0163162_10224876 | 3300013306 | Bacteria | 2006 |
| 479 | Ga0163162_10288276 | 3300013306 | Bacteria | 1774 |
| 480 | Ga0163162_10503427 | 3300013306 | Unclassified | 1341 |
| 481 | Ga0163162_10592892 | 3300013306 | Unclassified | 1235 |
| 482 | Ga0157372_10025879 | 3300013307 | Bacteria | 6382 |
| 483 | Ga0157372_10070226 | 3300013307 | Unclassified | 3940 |
| 484 | Ga0157372_10072102 | 3300013307 | Bacteria | 3892 |
| 485 | Ga0157372_10379542 | 3300013307 | Bacteria | 1647 |
| 486 | Ga0157372_10482257 | 3300013307 | Unclassified | 1446 |
| 487 | Ga0157372_10545716 | 3300013307 | Bacteria | 1351 |
| 488 | Ga0157372_11758748 | 3300013307 | Bacteria | 713 |
| 489 | Ga0157372_12510515 | 3300013307 | Unclassified | 592 |
| 490 | Ga0157375_10003551 | 3300013308 | Bacteria | 13539 |
| 491 | Ga0157375_10011315 | 3300013308 | Bacteria | 7879 |
| 492 | Ga0157375_10019073 | 3300013308 | Bacteria | 6229 |
| 493 | Ga0157375_10037238 | 3300013308 | Bacteria | 4659 |
| 494 | Ga0157375_10045195 | 3300013308 | Bacteria | 4286 |
| 495 | Ga0157375_10114005 | 3300013308 | Bacteria | 2805 |
| 496 | Ga0157375_10421497 | 3300013308 | Bacteria | 1501 |
| 497 | Ga0157375_10555537 | 3300013308 | Unclassified | 1309 |
| 498 | Ga0157375_10702397 | 3300013308 | Bacteria | 1165 |
| 499 | Ga0157375_11225859 | 3300013308 | Bacteria | 881 |
| 500 | Ga0157375_12206379 | 3300013308 | Unclassified | 656 |
| 501 | Ga0157375_12313346 | 3300013308 | Unclassified | 641 |
| 502 | Ga0163163_10094500 | 3300014325 | Unclassified | 3008 |
| 503 | Ga0163163_10181079 | 3300014325 | Bacteria | 2154 |
| 504 | Ga0163163_10228960 | 3300014325 | Bacteria | 1908 |
| 505 | Ga0163163_10361337 | 3300014325 | Bacteria | 1508 |
| 506 | Ga0157380_12504131 | 3300014326 | Unclassified | 582 |
| 507 | Ga0182008_10012262 | 3300014497 | Bacteria | 4526 |
| 508 | Ga0157377_10018404 | 3300014745 | Bacteria | 3629 |
| 509 | Ga0157377_10036435 | 3300014745 | Bacteria | 2706 |
| 510 | Ga0157377_10288541 | 3300014745 | Unclassified | 1078 |
| 511 | Ga0157377_10387647 | 3300014745 | Unclassified | 948 |
| 512 | Ga0157377_11388629 | 3300014745 | Unclassified | 553 |
| 513 | Ga0157379_10170489 | 3300014968 | Bacteria | 1965 |
| 514 | Ga0157376_10004555 | 3300014969 | Bacteria | 9652 |
| 515 | Ga0157376_10248868 | 3300014969 | Unclassified | 1659 |
| 516 | Ga0157376_10599849 | 3300014969 | Bacteria | 1096 |
| 517 | Ga0157376_10653567 | 3300014969 | Unclassified | 1052 |
| 518 | Ga0157376_10658104 | 3300014969 | Unclassified | 1049 |
| 519 | Ga0157376_11394554 | 3300014969 | Unclassified | 732 |
| 520 | Ga0182005_1020527 | 3300015265 | Unclassified | 1817 |
| 521 | Ga0163161_10086072 | 3300017792 | Unclassified | 2319 |
| 522 | Ga0163161_10206690 | 3300017792 | Bacteria | 1515 |
| 523 | Ga0213872_10001096 | 3300021361 | Bacteria | 18526 |
| 524 | Ga0207666_1000260 | 3300025271 | Bacteria | 7739 |
| 525 | Ga0207666_1001670 | 3300025271 | Bacteria | 2638 |
| 526 | Ga0207673_1000464 | 3300025290 | Bacteria | 4211 |
| 527 | Ga0207673_1008209 | 3300025290 | Unclassified | 1320 |
| 528 | Ga0207697_10000568 | 3300025315 | Bacteria | 20956 |
| 529 | Ga0207697_10000868 | 3300025315 | Bacteria | 17109 |
| 530 | Ga0207697_10001518 | 3300025315 | Bacteria | 12598 |
| 531 | Ga0207697_10005602 | 3300025315 | Bacteria | 5813 |
| 532 | Ga0207697_10007623 | 3300025315 | Bacteria | 4807 |
| 533 | Ga0207697_10008440 | 3300025315 | Bacteria | 4505 |
| 534 | Ga0207697_10012518 | 3300025315 | Bacteria | 3556 |
| 535 | Ga0207697_10051854 | 3300025315 | Bacteria | 1696 |
| 536 | Ga0207697_10056676 | 3300025315 | Bacteria | 1626 |
| 537 | Ga0207697_10078042 | 3300025315 | Bacteria | 1393 |
| 538 | Ga0207697_10182806 | 3300025315 | Unclassified | 919 |
| 539 | Ga0207682_10115839 | 3300025893 | Unclassified | 1184 |
| 540 | Ga0207692_10016595 | 3300025898 | Bacteria | 3266 |
| 541 | Ga0207692_10043802 | 3300025898 | Bacteria | 2229 |
| 542 | Ga0207692_10044217 | 3300025898 | Bacteria | 2221 |
| 543 | Ga0207692_10180478 | 3300025898 | Bacteria | 1229 |
| 544 | Ga0207692_10259964 | 3300025898 | Bacteria | 1043 |
| 545 | Ga0207692_10864619 | 3300025898 | Bacteria | 594 |
| 546 | Ga0207642_10056813 | 3300025899 | Bacteria | 1797 |
| 547 | Ga0207688_10021372 | 3300025901 | Bacteria | 3536 |
| 548 | Ga0207688_10077543 | 3300025901 | Bacteria | 1894 |
| 549 | Ga0207688_10189488 | 3300025901 | Unclassified | 1229 |
| 550 | Ga0207688_10254252 | 3300025901 | Bacteria | 1065 |
| 551 | Ga0207680_10007065 | 3300025903 | Bacteria | 5454 |
| 552 | Ga0207680_10064532 | 3300025903 | Unclassified | 2245 |
| 553 | Ga0207680_10153306 | 3300025903 | Bacteria | 1538 |
| 554 | Ga0207647_10006064 | 3300025904 | Bacteria | 8811 |
| 555 | Ga0207685_10027892 | 3300025905 | Bacteria | 1982 |
| 556 | Ga0207699_10017528 | 3300025906 | Bacteria | 3772 |
| 557 | Ga0207699_10092052 | 3300025906 | Bacteria | 1905 |
| 558 | Ga0207699_10246953 | 3300025906 | Unclassified | 1228 |
| 559 | Ga0207699_10279742 | 3300025906 | Bacteria | 1159 |
| 560 | Ga0207645_10015838 | 3300025907 | Bacteria | 4996 |
| 561 | Ga0207645_10024627 | 3300025907 | Bacteria | 3899 |
| 562 | Ga0207645_10049566 | 3300025907 | Bacteria | 2681 |
| 563 | Ga0207645_10124028 | 3300025907 | Bacteria | 1678 |
| 564 | Ga0207645_10211413 | 3300025907 | Bacteria | 1278 |
| 565 | Ga0207643_10259995 | 3300025908 | Bacteria | 1072 |
| 566 | Ga0207684_10000086 | 3300025910 | Bacteria | 173807 |
| 567 | Ga0207684_10000420 | 3300025910 | Bacteria | 56576 |
| 568 | Ga0207684_10002005 | 3300025910 | Bacteria | 20962 |
| 569 | Ga0207684_10010903 | 3300025910 | Bacteria | 7969 |
| 570 | Ga0207684_10011801 | 3300025910 | Bacteria | 7619 |
| 571 | Ga0207684_10040478 | 3300025910 | Bacteria | 3950 |
| 572 | Ga0207684_10107671 | 3300025910 | Bacteria | 2385 |
| 573 | Ga0207684_10107970 | 3300025910 | Bacteria | 2382 |
| 574 | Ga0207684_10133099 | 3300025910 | Bacteria | 2134 |
| 575 | Ga0207684_10332192 | 3300025910 | Bacteria | 1310 |
| 576 | Ga0207684_10617136 | 3300025910 | Unclassified | 925 |
| 577 | Ga0207684_10691744 | 3300025910 | Bacteria | 867 |
| 578 | Ga0207684_10691778 | 3300025910 | Bacteria | 867 |
| 579 | Ga0207684_10775972 | 3300025910 | Bacteria | 811 |
| 580 | Ga0207684_11113825 | 3300025910 | Unclassified | 657 |
| 581 | Ga0207654_10517284 | 3300025911 | Unclassified | 845 |
| 582 | Ga0207707_10421670 | 3300025912 | Bacteria | 1144 |
| 583 | Ga0207671_10161183 | 3300025914 | Bacteria | 1737 |
| 584 | Ga0207671_10264391 | 3300025914 | Unclassified | 1354 |
| 585 | Ga0207693_10002604 | 3300025915 | Bacteria | 15674 |
| 586 | Ga0207693_10004447 | 3300025915 | Bacteria | 11844 |
| 587 | Ga0207693_10014225 | 3300025915 | Bacteria | 6402 |
| 588 | Ga0207693_10017311 | 3300025915 | Bacteria | 5748 |
| 589 | Ga0207693_10030768 | 3300025915 | Bacteria | 4240 |
| 590 | Ga0207693_10038374 | 3300025915 | Bacteria | 3773 |
| 591 | Ga0207693_10044851 | 3300025915 | Unclassified | 3474 |
| 592 | Ga0207693_10064667 | 3300025915 | Bacteria | 2865 |
| 593 | Ga0207693_10119387 | 3300025915 | Unclassified | 2071 |
| 594 | Ga0207693_10238448 | 3300025915 | Unclassified | 1428 |
| 595 | Ga0207693_10673807 | 3300025915 | Bacteria | 802 |
| 596 | Ga0207663_10004534 | 3300025916 | Bacteria | 6918 |
| 597 | Ga0207663_10006188 | 3300025916 | Bacteria | 6100 |
| 598 | Ga0207663_10043102 | 3300025916 | Bacteria | 2761 |
| 599 | Ga0207663_10095743 | 3300025916 | Bacteria | 1981 |
| 600 | Ga0207663_10481896 | 3300025916 | Unclassified | 961 |
| 601 | Ga0207660_10054366 | 3300025917 | Bacteria | 2857 |
| 602 | Ga0207662_10000089 | 3300025918 | Bacteria | 43194 |
| 603 | Ga0207662_10040370 | 3300025918 | Bacteria | 2743 |
| 604 | Ga0207662_10350579 | 3300025918 | Bacteria | 991 |
| 605 | Ga0207662_10853663 | 3300025918 | Unclassified | 643 |
| 606 | Ga0207657_10011863 | 3300025919 | Bacteria | 8626 |
| 607 | Ga0207657_10502068 | 3300025919 | Unclassified | 950 |
| 608 | Ga0207657_10657858 | 3300025919 | Unclassified | 815 |
| 609 | Ga0207649_10544724 | 3300025920 | Unclassified | 887 |
| 610 | Ga0207649_10685213 | 3300025920 | Unclassified | 794 |
| 611 | Ga0207646_10003191 | 3300025922 | Bacteria | 18736 |
| 612 | Ga0207646_10006143 | 3300025922 | Bacteria | 12495 |
| 613 | Ga0207646_10016763 | 3300025922 | Bacteria | 6873 |
| 614 | Ga0207646_10022613 | 3300025922 | Bacteria | 5789 |
| 615 | Ga0207646_10057285 | 3300025922 | Bacteria | 3482 |
| 616 | Ga0207646_10080202 | 3300025922 | Unclassified | 2918 |
| 617 | Ga0207646_10156134 | 3300025922 | Unclassified | 2058 |
| 618 | Ga0207646_10213769 | 3300025922 | Bacteria | 1741 |
| 619 | Ga0207646_10238743 | 3300025922 | Unclassified | 1642 |
| 620 | Ga0207646_10397861 | 3300025922 | Bacteria | 1244 |
| 621 | Ga0207646_10406407 | 3300025922 | Bacteria | 1229 |
| 622 | Ga0207646_10495126 | 3300025922 | Bacteria | 1101 |
| 623 | Ga0207646_10625729 | 3300025922 | Unclassified | 965 |
| 624 | Ga0207646_11177731 | 3300025922 | Viruses | 672 |
| 625 | Ga0207646_11274875 | 3300025922 | Unclassified | 642 |
| 626 | Ga0207646_11803858 | 3300025922 | Unclassified | 523 |
| 627 | Ga0207681_10060386 | 3300025923 | Bacteria | 2602 |
| 628 | Ga0207681_10131864 | 3300025923 | Bacteria | 1849 |
| 629 | Ga0207681_10164049 | 3300025923 | Bacteria | 1678 |
| 630 | Ga0207681_10262073 | 3300025923 | Unclassified | 1353 |
| 631 | Ga0207681_10658863 | 3300025923 | Bacteria | 868 |
| 632 | Ga0207681_11148164 | 3300025923 | Unclassified | 652 |
| 633 | Ga0207650_10052226 | 3300025925 | Unclassified | 3027 |
| 634 | Ga0207650_10088966 | 3300025925 | Bacteria | 2356 |
| 635 | Ga0207650_10366412 | 3300025925 | Unclassified | 1188 |
| 636 | Ga0207650_10456906 | 3300025925 | Unclassified | 1063 |
| 637 | Ga0207650_10586519 | 3300025925 | Unclassified | 936 |
| 638 | Ga0207659_10015580 | 3300025926 | Unclassified | 4930 |
| 639 | Ga0207659_10021183 | 3300025926 | Bacteria | 4310 |
| 640 | Ga0207659_10066124 | 3300025926 | Bacteria | 2622 |
| 641 | Ga0207659_10126807 | 3300025926 | Unclassified | 1964 |
| 642 | Ga0207659_10157362 | 3300025926 | Bacteria | 1780 |
| 643 | Ga0207659_10197623 | 3300025926 | Bacteria | 1604 |
| 644 | Ga0207659_10397215 | 3300025926 | Unclassified | 1152 |
| 645 | Ga0207659_11275020 | 3300025926 | Unclassified | 631 |
| 646 | Ga0207687_10987201 | 3300025927 | Unclassified | 722 |
| 647 | Ga0207687_11318811 | 3300025927 | Bacteria | 620 |
| 648 | Ga0207700_10017289 | 3300025928 | Bacteria | 4814 |
| 649 | Ga0207700_10045160 | 3300025928 | Bacteria | 3249 |
| 650 | Ga0207700_10085493 | 3300025928 | Unclassified | 2476 |
| 651 | Ga0207700_10239441 | 3300025928 | Bacteria | 1546 |
| 652 | Ga0207700_10285426 | 3300025928 | Bacteria | 1421 |
| 653 | Ga0207664_10169372 | 3300025929 | Unclassified | 1868 |
| 654 | Ga0207664_10208550 | 3300025929 | Unclassified | 1690 |
| 655 | Ga0207664_10264388 | 3300025929 | Bacteria | 1505 |
| 656 | Ga0207664_10307113 | 3300025929 | Bacteria | 1397 |
| 657 | Ga0207664_10339238 | 3300025929 | Bacteria | 1328 |
| 658 | Ga0207664_10661145 | 3300025929 | Unclassified | 939 |
| 659 | Ga0207664_11675097 | 3300025929 | Unclassified | 558 |
| 660 | Ga0207644_10011551 | 3300025931 | Bacteria | 5846 |
| 661 | Ga0207644_10020106 | 3300025931 | Bacteria | 4536 |
| 662 | Ga0207644_10034550 | 3300025931 | Bacteria | 3538 |
| 663 | Ga0207644_10040767 | 3300025931 | Bacteria | 3282 |
| 664 | Ga0207644_10041879 | 3300025931 | Bacteria | 3242 |
| 665 | Ga0207644_10183117 | 3300025931 | Bacteria | 1643 |
| 666 | Ga0207644_10193804 | 3300025931 | Unclassified | 1599 |
| 667 | Ga0207644_10343387 | 3300025931 | Unclassified | 1211 |
| 668 | Ga0207644_10466783 | 3300025931 | Unclassified | 1038 |
| 669 | Ga0207644_10917386 | 3300025931 | Bacteria | 734 |
| 670 | Ga0207690_10005749 | 3300025932 | Bacteria | 7331 |
| 671 | Ga0207690_10238379 | 3300025932 | Bacteria | 1400 |
| 672 | Ga0207706_10000188 | 3300025933 | Bacteria | 68890 |
| 673 | Ga0207706_10010080 | 3300025933 | Bacteria | 8654 |
| 674 | Ga0207706_10044328 | 3300025933 | Unclassified | 3942 |
| 675 | Ga0207706_10059551 | 3300025933 | Bacteria | 3363 |
| 676 | Ga0207706_10118939 | 3300025933 | Bacteria | 2323 |
| 677 | Ga0207706_10151759 | 3300025933 | Archaea | 2038 |
| 678 | Ga0207706_10189907 | 3300025933 | Bacteria | 1803 |
| 679 | Ga0207706_10566386 | 3300025933 | Bacteria | 977 |
| 680 | Ga0207706_10650048 | 3300025933 | Unclassified | 903 |
| 681 | Ga0207686_10003060 | 3300025934 | Bacteria | 8999 |
| 682 | Ga0207686_10703276 | 3300025934 | Unclassified | 803 |
| 683 | Ga0207686_10842352 | 3300025934 | Bacteria | 737 |
| 684 | Ga0207709_11095545 | 3300025935 | Unclassified | 654 |
| 685 | Ga0207670_10047887 | 3300025936 | Bacteria | 2850 |
| 686 | Ga0207670_10109325 | 3300025936 | Bacteria | 1989 |
| 687 | Ga0207670_10300494 | 3300025936 | Bacteria | 1257 |
| 688 | Ga0207670_10905249 | 3300025936 | Bacteria | 739 |
| 689 | Ga0207669_10090693 | 3300025937 | Bacteria | 1988 |
| 690 | Ga0207669_10193127 | 3300025937 | Bacteria | 1470 |
| 691 | Ga0207669_10536477 | 3300025937 | Unclassified | 942 |
| 692 | Ga0207704_10331020 | 3300025938 | Bacteria | 1179 |
| 693 | Ga0207704_11109053 | 3300025938 | Unclassified | 672 |
| 694 | Ga0207665_10022019 | 3300025939 | Bacteria | 4190 |
| 695 | Ga0207665_10203684 | 3300025939 | Unclassified | 1443 |
| 696 | Ga0207665_10269645 | 3300025939 | Unclassified | 1263 |
| 697 | Ga0207665_10554646 | 3300025939 | Unclassified | 893 |
| 698 | Ga0207665_10899554 | 3300025939 | Unclassified | 702 |
| 699 | Ga0207665_11073247 | 3300025939 | Unclassified | 642 |
| 700 | Ga0207691_10008869 | 3300025940 | Bacteria | 9654 |
| 701 | Ga0207691_10088805 | 3300025940 | Bacteria | 2772 |
| 702 | Ga0207691_10225101 | 3300025940 | Bacteria | 1625 |
| 703 | Ga0207691_11526670 | 3300025940 | Unclassified | 545 |
| 704 | Ga0207711_10583408 | 3300025941 | Bacteria | 1043 |
| 705 | Ga0207689_10070895 | 3300025942 | Bacteria | 2862 |
| 706 | Ga0207689_10373304 | 3300025942 | Bacteria | 1187 |
| 707 | Ga0207661_10084032 | 3300025944 | Bacteria | 2636 |
| 708 | Ga0207661_10209700 | 3300025944 | Unclassified | 1716 |
| 709 | Ga0207661_10234492 | 3300025944 | Bacteria | 1626 |
| 710 | Ga0207661_10354353 | 3300025944 | Bacteria | 1324 |
| 711 | Ga0207661_10815376 | 3300025944 | Unclassified | 859 |
| 712 | Ga0207667_10508714 | 3300025949 | Bacteria | 1221 |
| 713 | Ga0207651_10055391 | 3300025960 | Bacteria | 2723 |
| 714 | Ga0207651_10273474 | 3300025960 | Unclassified | 1392 |
| 715 | Ga0207651_10308546 | 3300025960 | Bacteria | 1318 |
| 716 | Ga0207651_10373713 | 3300025960 | Bacteria | 1206 |
| 717 | Ga0207651_10393477 | 3300025960 | Bacteria | 1177 |
| 718 | Ga0207651_10525186 | 3300025960 | Unclassified | 1026 |
| 719 | Ga0207712_10033917 | 3300025961 | Bacteria | 3454 |
| 720 | Ga0207668_10047253 | 3300025972 | Bacteria | 2946 |
| 721 | Ga0207668_10158166 | 3300025972 | Bacteria | 1762 |
| 722 | Ga0207668_10257155 | 3300025972 | Bacteria | 1421 |
| 723 | Ga0207668_10353414 | 3300025972 | Unclassified | 1229 |
| 724 | Ga0207658_10054081 | 3300025986 | Bacteria | 2969 |
| 725 | Ga0207658_10055104 | 3300025986 | Bacteria | 2945 |
| 726 | Ga0207658_10169671 | 3300025986 | Bacteria | 1796 |
| 727 | Ga0207658_10209256 | 3300025986 | Bacteria | 1633 |
| 728 | Ga0207658_10239954 | 3300025986 | Bacteria | 1535 |
| 729 | Ga0207658_10550770 | 3300025986 | Bacteria | 1032 |
| 730 | Ga0207658_10623411 | 3300025986 | Unclassified | 970 |
| 731 | Ga0207658_10700286 | 3300025986 | Unclassified | 915 |
| 732 | Ga0207658_10986638 | 3300025986 | Unclassified | 768 |
| 733 | Ga0207677_10055340 | 3300026023 | Bacteria | 2712 |
| 734 | Ga0207677_10089494 | 3300026023 | Bacteria | 2235 |
| 735 | Ga0207677_10115658 | 3300026023 | Unclassified | 2007 |
| 736 | Ga0207677_10438649 | 3300026023 | Unclassified | 1116 |
| 737 | Ga0207677_10895214 | 3300026023 | Unclassified | 800 |
| 738 | Ga0207677_11579088 | 3300026023 | Bacteria | 607 |
| 739 | Ga0207703_10223540 | 3300026035 | Unclassified | 1685 |
| 740 | Ga0207703_10334384 | 3300026035 | Unclassified | 1390 |
| 741 | Ga0207703_10507542 | 3300026035 | Unclassified | 1133 |
| 742 | Ga0207703_11084824 | 3300026035 | Unclassified | 769 |
| 743 | Ga0207678_10016608 | 3300026067 | Bacteria | 6467 |
| 744 | Ga0207678_11218149 | 3300026067 | Unclassified | 666 |
| 745 | Ga0207708_10017596 | 3300026075 | Bacteria | 5381 |
| 746 | Ga0207702_10067449 | 3300026078 | Bacteria | 3070 |
| 747 | Ga0207702_10131820 | 3300026078 | Bacteria | 2250 |
| 748 | Ga0207702_11139311 | 3300026078 | Unclassified | 774 |
| 749 | Ga0207641_10194876 | 3300026088 | Bacteria | 1864 |
| 750 | Ga0207641_10545080 | 3300026088 | Unclassified | 1131 |
| 751 | Ga0207641_10549687 | 3300026088 | Bacteria | 1126 |
| 752 | Ga0207641_11301147 | 3300026088 | Unclassified | 727 |
| 753 | Ga0207648_10033297 | 3300026089 | Bacteria | 4546 |
| 754 | Ga0207648_10256946 | 3300026089 | Unclassified | 1558 |
| 755 | Ga0207648_10409229 | 3300026089 | Bacteria | 1230 |
| 756 | Ga0207648_10524517 | 3300026089 | Bacteria | 1086 |
| 757 | Ga0207648_10563402 | 3300026089 | Bacteria | 1047 |
| 758 | Ga0207676_10266573 | 3300026095 | Unclassified | 1549 |
| 759 | Ga0207674_10181056 | 3300026116 | Bacteria | 2059 |
| 760 | Ga0207675_100147175 | 3300026118 | Bacteria | 2240 |
| 761 | Ga0207675_100191431 | 3300026118 | Bacteria | 1962 |
| 762 | Ga0207675_100226766 | 3300026118 | Bacteria | 1801 |
| 763 | Ga0207683_10009787 | 3300026121 | Bacteria | 8173 |
| 764 | Ga0207683_10065759 | 3300026121 | Bacteria | 3197 |
| 765 | Ga0207683_10113212 | 3300026121 | Bacteria | 2430 |
| 766 | Ga0207683_10377554 | 3300026121 | Bacteria | 1303 |
| 767 | Ga0207683_10634955 | 3300026121 | Bacteria | 989 |
| 768 | Ga0207683_12015337 | 3300026121 | Unclassified | 526 |
| 769 | Ga0209968_1041570 | 3300027526 | Unclassified | 787 |
| 770 | Ga0209970_1022530 | 3300027614 | Bacteria | 1070 |
| 771 | Ga0210002_1017781 | 3300027617 | Bacteria | 1133 |
| 772 | Ga0209974_10117792 | 3300027876 | Unclassified | 939 |
| 773 | Ga0268266_10029888 | 3300028379 | Bacteria | 4629 |
| 774 | Ga0268266_10061954 | 3300028379 | Unclassified | 3227 |
| 775 | Ga0268266_10177242 | 3300028379 | Unclassified | 1938 |
| 776 | Ga0268266_10178840 | 3300028379 | Bacteria | 1930 |
| 777 | Ga0268266_10314768 | 3300028379 | Unclassified | 1463 |
| 778 | Ga0268266_10593835 | 3300028379 | Bacteria | 1063 |
| 779 | Ga0268266_11233983 | 3300028379 | Unclassified | 723 |
| 780 | Ga0268266_11375421 | 3300028379 | Bacteria | 681 |
| 781 | Ga0268266_11823142 | 3300028379 | Unclassified | 583 |
| 782 | Ga0268265_10095375 | 3300028380 | Bacteria | 2389 |
| 783 | Ga0268265_10221479 | 3300028380 | Bacteria | 1656 |
| 784 | Ga0268265_10365348 | 3300028380 | Bacteria | 1323 |
| 785 | Ga0268264_10176400 | 3300028381 | Bacteria | 1937 |
| 786 | Ga0268264_10570503 | 3300028381 | Unclassified | 1112 |
| 787 | Ga0307513_10081866 | 3300031456 | Bacteria | 3325 |
| 788 | Ga0373926_0071875 | 3300035083 | Bacteria | 1272 |
| 789 | Ga0373934_0037529 | 3300035086 | Bacteria | 1908 |
| 790 | Ga0373944_0041175 | 3300035089 | Bacteria | 1429 |
| 791 | Ga0373951_0264004 | 3300035091 | Unclassified | 521 |
| 792 | Ga0373936_0575435 | 3300035113 | Unclassified | 528 |
| 793 | Ga0373939_0415510 | 3300035114 | Unclassified | 560 |
| 794 | Ga0373945_0134076 | 3300035116 | Unclassified | 994 |
| 795 | Ga0373945_0154255 | 3300035116 | Unclassified | 933 |
| 796 | Ga0373953_0048245 | 3300035117 | Bacteria | 1715 |
| 797 | Ga0373953_0107311 | 3300035117 | Bacteria | 1179 |
| 798 | Ga0373954_0208424 | 3300035118 | Unclassified | 961 |
| 799 | Ga0373956_0048478 | 3300035119 | Bacteria | 1903 |
| 800 | Ga0373956_0183057 | 3300035119 | Bacteria | 991 |
| 801 | Ga0373957_0047171 | 3300035120 | Bacteria | 1638 |
| 802 | Ga0373960_0115317 | 3300035121 | Bacteria | 886 |
| 803 | Ga0373943_0015104 | 3300035170 | Bacteria | 3505 |
| 804 | Ga0373943_0042762 | 3300035170 | Bacteria | 2197 |
| 805 | Ga0373943_0066888 | 3300035170 | Bacteria | 1811 |
| 806 | Ga0373943_0095035 | 3300035170 | Bacteria | 1550 |
| 807 | Ga0373943_0167533 | 3300035170 | Bacteria | 1200 |
| 808 | Ga0373943_0424648 | 3300035170 | Unclassified | 770 |
| 809 | Ga0373946_0082381 | 3300035171 | Bacteria | 1411 |
| 810 | Ga0373946_0139137 | 3300035171 | Bacteria | 1124 |
| 811 | Ga0373946_0476973 | 3300035171 | Unclassified | 638 |
| 812 | Ga0373946_0697437 | 3300035171 | Bacteria | 531 |
| 813 | Ga0373955_0509414 | 3300035172 | Unclassified | 735 |
| 814 | Ga0373962_0177204 | 3300035242 | Unclassified | 711 |
| 815 | Ga0373924_0110717 | 3300035410 | Bacteria | 1187 |
| 816 | Ga0373931_0309196 | 3300035691 | Bacteria | 978 |
| 817 | Ga0373931_0313080 | 3300035691 | Unclassified | 973 |
| 818 | Ga0373931_0973648 | 3300035691 | Unclassified | 573 |
| 819 | Ga0373935_0073904 | 3300035692 | Bacteria | 2203 |
| 820 | Ga0373935_0128168 | 3300035692 | Bacteria | 1702 |
| 821 | Ga0373935_0414408 | 3300035692 | Unclassified | 969 |
| 822 | Ga0373935_0508149 | 3300035692 | Bacteria | 875 |
| 823 | Ga0373935_1000535 | 3300035692 | Bacteria | 621 |
| 824 | Ga0373927_0079047 | 3300035695 | Bacteria | 2131 |
| 825 | Ga0373927_0329959 | 3300035695 | Bacteria | 1005 |
| 826 | Ga0373927_0433919 | 3300035695 | Unclassified | 867 |
| 827 | Ga0373947_0024953 | 3300035725 | Bacteria | 3486 |
| 828 | Ga0373947_0959159 | 3300035725 | Unclassified | 583 |
| 829 | Ga0373937_0189570 | 3300036401 | Unclassified | 1932 |
| 830 | Ga0373937_0327932 | 3300036401 | Unclassified | 1449 |
| 831 | Ga0373937_1485159 | 3300036401 | Unclassified | 625 |
| 832 | Ga0373925_0185037 | 3300037068 | Bacteria | 1651 |
| 833 | Ga0373925_0211021 | 3300037068 | Bacteria | 1547 |
| 834 | Ga0373925_0353460 | 3300037068 | Bacteria | 1193 |
| 835 | Ga0373925_1277245 | 3300037068 | Bacteria | 603 |
| 836 | Ga0395900_0187968 | 3300037418 | Bacteria | 2096 |
| 837 | Ga0395900_0328739 | 3300037418 | Bacteria | 1507 |
| 838 | Ga0395900_0819172 | 3300037418 | Bacteria | 858 |
| 839 | Ga0395898_0546663 | 3300037466 | Bacteria | 1100 |
| 840 | Ga0395905_1144168 | 3300037471 | Unclassified | 682 |
| 841 | Ga0395905_1404066 | 3300037471 | Bacteria | 602 |
| 842 | Ga0436364_1300954 | 3300037853 | Bacteria | 1911 |
| 843 | Ga0395901_0089419 | 3300038443 | Bacteria | 3223 |
| 844 | Ga0395901_0634846 | 3300038443 | Bacteria | 1073 |
| 845 | Ga0436361_0116159 | 3300039447 | Bacteria | 11207 |
| 846 | Ga0436362_0661146 | 3300039453 | Unclassified | 915 |
| 847 | Ga0451839_1517091 | 3300041496 | Unclassified | 557 |
| 848 | Ga0451853_0163666 | 3300041512 | Unclassified | 678 |
| 849 | Ga0451853_1432400 | 3300041512 | Unclassified | 808 |
| 850 | Ga0451853_3799293 | 3300041512 | Unclassified | 758 |
| 851 | Ga0439448_0041984 | 3300042005 | Unclassified | 1482 |
| 852 | Ga0439451_026132 | 3300042009 | Unclassified | 1177 |
| 853 | Ga0439455_0002794 | 3300042012 | Bacteria | 3238 |
| 854 | Ga0439464_0005373 | 3300042439 | Bacteria | 3311 |
| 855 | Ga0439440_0026978 | 3300042993 | Unclassified | 1332 |
| 856 | Ga0466964_0365299 | 3300044706 | Unclassified | 745 |
| 857 | Ga0466960_0706882 | 3300044901 | Unclassified | 605 |
| 858 | Ga0451576_0128289 | 3300045051 | Bacteria | 2643 |
| 859 | Ga0451576_1502492 | 3300045051 | Unclassified | 700 |
| 860 | Ga0466967_0073846 | 3300045976 | Bacteria | 3061 |
| 861 | Ga0495592_0030779 | 3300046454 | Bacteria | 4059 |
| 862 | Ga0495641_0047470 | 3300046461 | Bacteria | 1971 |
| 863 | Ga0495651_0036056 | 3300046462 | Bacteria | 3850 |
| 864 | Ga0495580_0314573 | 3300046472 | Bacteria | 1065 |
| 865 | Ga0495639_0162450 | 3300046475 | Unclassified | 1082 |
| 866 | Ga0495662_0309643 | 3300046476 | Unclassified | 777 |
| 867 | Ga0495664_0193556 | 3300046477 | Unclassified | 1233 |
| 868 | Ga0495584_0107485 | 3300046491 | Unclassified | 1411 |
| 869 | Ga0495585_0062846 | 3300046492 | Bacteria | 2039 |
| 870 | Ga0495594_0192278 | 3300046499 | Unclassified | 1163 |
| 871 | Ga0495594_0555068 | 3300046499 | Unclassified | 652 |
| 872 | Ga0495608_0167904 | 3300046511 | Unclassified | 1393 |
| 873 | Ga0495608_0566517 | 3300046511 | Unclassified | 684 |
| 874 | Ga0495616_0411717 | 3300046513 | Unclassified | 554 |
| 875 | Ga0495628_0075768 | 3300046516 | Bacteria | 2619 |
| 876 | Ga0495628_0138960 | 3300046516 | Bacteria | 1855 |
| 877 | Ga0495628_0940721 | 3300046516 | Unclassified | 598 |
| 878 | Ga0495630_0042785 | 3300046517 | Bacteria | 3383 |
| 879 | Ga0495630_1156304 | 3300046517 | Unclassified | 586 |
| 880 | Ga0495652_0111830 | 3300046529 | Bacteria | 2195 |
| 881 | Ga0495652_0511430 | 3300046529 | Unclassified | 831 |
| 882 | Ga0495665_0279404 | 3300046531 | Unclassified | 857 |
| 883 | Ga0495640_0655196 | 3300046533 | Unclassified | 632 |
| 884 | Ga0495586_0104035 | 3300046535 | Bacteria | 1577 |
| 885 | Ga0495645_0012204 | 3300046543 | Bacteria | 6050 |
| 886 | Ga0495645_0108438 | 3300046543 | Bacteria | 1967 |
| 887 | Ga0495633_0238967 | 3300046558 | Bacteria | 830 |
| 888 | Ga0495667_0226375 | 3300046559 | Unclassified | 1193 |
| 889 | Ga0495634_0555254 | 3300046642 | Bacteria | 669 |
| 890 | Ga0495659_0179511 | 3300046664 | Bacteria | 862 |
| 891 | Ga0495588_0103975 | 3300046674 | Unclassified | 1494 |
| 892 | Ga0495657_0360909 | 3300046675 | Bacteria | 859 |
| 893 | Ga0495657_0436421 | 3300046675 | Unclassified | 768 |
| 894 | Ga0495599_0001261 | 3300046678 | Bacteria | 14359 |
| 895 | Ga0495599_0045422 | 3300046678 | Bacteria | 2755 |
| 896 | Ga0495623_0004789 | 3300046679 | Bacteria | 8894 |
| 897 | Ga0495646_0028892 | 3300046680 | Bacteria | 3469 |
| 898 | Ga0495646_0237755 | 3300046680 | Unclassified | 980 |
| 899 | Ga0495647_0038968 | 3300046681 | Bacteria | 1799 |
| 900 | Ga0495647_0054240 | 3300046681 | Bacteria | 1566 |
| 901 | Ga0495647_0392040 | 3300046681 | Unclassified | 637 |
| 902 | Ga0495658_0090337 | 3300046683 | Unclassified | 1813 |
| 903 | Ga0495658_0096386 | 3300046683 | Bacteria | 1759 |
| 904 | Ga0495669_0032580 | 3300046684 | Bacteria | 2291 |
| 905 | Ga0495669_0045956 | 3300046684 | Bacteria | 1948 |
| 906 | Ga0495669_0079548 | 3300046684 | Bacteria | 1503 |
| 907 | Ga0495613_0584009 | 3300046689 | Unclassified | 745 |
| 908 | Ga0495624_0181861 | 3300046690 | Unclassified | 1281 |
| 909 | Ga0495624_0576803 | 3300046690 | Unclassified | 671 |
| 910 | Ga0495670_0494467 | 3300046691 | Unclassified | 664 |
| 911 | Ga0495660_0352436 | 3300046810 | Bacteria | 654 |
| 912 | Ga0495674_0050277 | 3300047319 | Bacteria | 3679 |
| 913 | Ga0495676_0225163 | 3300047321 | Unclassified | 1291 |
| 914 | Ga0495680_0295362 | 3300047322 | Unclassified | 1139 |
| 915 | Ga0495683_0305932 | 3300047323 | Unclassified | 682 |
| 916 | Ga0495675_0039717 | 3300047444 | Bacteria | 2998 |
| 917 | Ga0495681_0330264 | 3300047470 | Unclassified | 584 |
| 918 | Ga0495684_0026060 | 3300047471 | Bacteria | 4494 |
| 919 | Ga0495684_0188928 | 3300047471 | Unclassified | 1524 |
| 920 | Ga0496100_0050137 | 3300048903 | Bacteria | 2703 |
| 921 | Ga0496100_0141139 | 3300048903 | Unclassified | 1708 |
| 922 | Ga0496100_0173756 | 3300048903 | Bacteria | 1554 |
| 923 | Ga0496100_0393186 | 3300048903 | Bacteria | 1055 |
| 924 | Ga0496100_0605693 | 3300048903 | Unclassified | 851 |
| 925 | Ga0496101_0048881 | 3300048904 | Bacteria | 3041 |
| 926 | Ga0496101_0094410 | 3300048904 | Bacteria | 2229 |
| 927 | Ga0496101_0476990 | 3300048904 | Unclassified | 985 |
| 928 | Ga0496102_0266591 | 3300048905 | Unclassified | 1615 |
| 929 | Ga0496102_0276440 | 3300048905 | Bacteria | 1583 |
| 930 | Ga0496102_0335715 | 3300048905 | Bacteria | 1423 |
| 931 | Ga0496102_0372702 | 3300048905 | Unclassified | 1343 |
| 932 | Ga0496102_0892295 | 3300048905 | Bacteria | 811 |
| 933 | Ga0496104_0027669 | 3300048907 | Bacteria | 5250 |
| 934 | Ga0496104_0130296 | 3300048907 | Bacteria | 2416 |
| 935 | Ga0496104_0393095 | 3300048907 | Bacteria | 1299 |
| 936 | Ga0496104_0393901 | 3300048907 | Bacteria | 1297 |
| 937 | Ga0496104_0433303 | 3300048907 | Bacteria | 1227 |
| 938 | Ga0496104_1394803 | 3300048907 | Unclassified | 604 |
| 939 | Ga0496105_0027342 | 3300048908 | Bacteria | 4659 |
| 940 | Ga0496105_0130926 | 3300048908 | Bacteria | 2068 |
| 941 | Ga0496105_0260663 | 3300048908 | Unclassified | 1402 |
| 942 | Ga0496105_0608303 | 3300048908 | Bacteria | 847 |
| 943 | Ga0496106_0047246 | 3300048909 | Bacteria | 3239 |
| 944 | Ga0496106_0160877 | 3300048909 | Bacteria | 1775 |
| 945 | Ga0496106_0225288 | 3300048909 | Bacteria | 1496 |
| 946 | Ga0496107_0037363 | 3300048910 | Bacteria | 3484 |
| 947 | Ga0496107_0085001 | 3300048910 | Unclassified | 2309 |
| 948 | Ga0496107_0646424 | 3300048910 | Unclassified | 780 |
| 949 | Ga0496107_0664374 | 3300048910 | Bacteria | 768 |
| 950 | Ga0496108_0203878 | 3300048911 | Bacteria | 1716 |
| 951 | Ga0496108_0295108 | 3300048911 | Unclassified | 1412 |
| 952 | Ga0496108_0896753 | 3300048911 | Unclassified | 761 |
| 953 | Ga0496108_1033322 | 3300048911 | Unclassified | 701 |
| 954 | Ga0496109_0013505 | 3300048912 | Bacteria | 7085 |
| 955 | Ga0496109_0193187 | 3300048912 | Unclassified | 1913 |
| 956 | Ga0496109_0218856 | 3300048912 | Unclassified | 1791 |
| 957 | Ga0496109_0254018 | 3300048912 | Bacteria | 1655 |
| 958 | Ga0496109_0265414 | 3300048912 | Unclassified | 1617 |
| 959 | Ga0496109_0330676 | 3300048912 | Unclassified | 1439 |
| 960 | Ga0496109_0507684 | 3300048912 | Bacteria | 1138 |
| 961 | Ga0496109_1863980 | 3300048912 | Unclassified | 534 |
| 962 | Ga0496110_0119170 | 3300048913 | Bacteria | 2377 |
| 963 | Ga0496110_0119191 | 3300048913 | Bacteria | 2377 |
| 964 | Ga0496110_0335389 | 3300048913 | Unclassified | 1378 |
| 965 | Ga0496111_0107611 | 3300048914 | Bacteria | 2053 |
| 966 | Ga0496111_0576379 | 3300048914 | Bacteria | 825 |
| 967 | Ga0496111_0620842 | 3300048914 | Unclassified | 790 |
| 968 | Ga0496111_1156060 | 3300048914 | Unclassified | 550 |
| 969 | Ga0496112_0022444 | 3300048915 | Bacteria | 6015 |
| 970 | Ga0496112_0025243 | 3300048915 | Bacteria | 5705 |
| 971 | Ga0496112_0292925 | 3300048915 | Unclassified | 1573 |
| 972 | Ga0496112_0373006 | 3300048915 | Bacteria | 1368 |
| 973 | Ga0496112_0801237 | 3300048915 | Bacteria | 867 |
| 974 | Ga0496113_0199609 | 3300048916 | Bacteria | 1590 |
| 975 | Ga0496114_0009375 | 3300048917 | Bacteria | 7772 |
| 976 | Ga0496114_0041374 | 3300048917 | Bacteria | 3819 |
| 977 | Ga0496114_0046897 | 3300048917 | Bacteria | 3592 |
| 978 | Ga0496114_0237013 | 3300048917 | Bacteria | 1604 |
| 979 | Ga0496115_0005412 | 3300048918 | Bacteria | 9284 |
| 980 | Ga0496115_0005523 | 3300048918 | Bacteria | 9202 |
| 981 | Ga0496115_0083134 | 3300048918 | Unclassified | 2609 |
| 982 | Ga0496115_0125245 | 3300048918 | Bacteria | 2116 |
| 983 | Ga0496115_0757548 | 3300048918 | Unclassified | 759 |
| 984 | Ga0496115_1042147 | 3300048918 | Unclassified | 623 |
| 985 | nmdc:mga05p37_176863_c1 | 3300050507 | Unclassified | 2599 |
| 986 | nmdc:mga05p37_217959_c1 | 3300050507 | Bacteria | 2304 |
| 987 | nmdc:mga05p37_392650_c1 | 3300050507 | Bacteria | 1622 |
| 988 | nmdc:mga08y16_1259552_c1 | 3300050511 | Unclassified | 708 |
| 989 | nmdc:mga08y16_326661_c1 | 3300050511 | Unclassified | 1578 |
| 990 | nmdc:mga08y16_688627_c1 | 3300050511 | Unclassified | 1023 |
| 991 | nmdc:mga0n895_1091723_c1 | 3300050512 | Unclassified | 776 |
| 992 | nmdc:mga0n895_129254_c1 | 3300050512 | Bacteria | 2550 |
| 993 | nmdc:mga0n895_1365090_c1 | 3300050512 | Bacteria | 678 |
| 994 | nmdc:mga0n895_339315_c1 | 3300050512 | Unclassified | 1522 |
| 995 | nmdc:mga0n895_443577_c1 | 3300050512 | Bacteria | 1311 |
| 996 | nmdc:mga0n895_685221_c1 | 3300050512 | Bacteria | 1022 |
| 997 | nmdc:mga0n895_786013_c1 | 3300050512 | Bacteria | 943 |
| 998 | nmdc:mga0rr50_550433_c1 | 3300050513 | Bacteria | 982 |
| 999 | nmdc:mga0rr50_900818_c1 | 3300050513 | Unclassified | 754 |
| 1000 | nmdc:mga08x19_290480_c1 | 3300050514 | Unclassified | 1134 |
| 1001 | nmdc:mga0a205_146370_c2 | 3300050515 | Bacteria | 952 |
| 1002 | nmdc:mga0a205_269020_c1 | 3300050515 | Bacteria | 1581 |
| 1003 | nmdc:mga0a205_391479_c1 | 3300050515 | Bacteria | 1254 |
| 1004 | nmdc:mga0a205_847300_c1 | 3300050515 | Bacteria | 761 |
| 1005 | Ga0495601_0002282 | 3300053077 | Bacteria | 10822 |
| 1006 | Ga0495601_0508381 | 3300053077 | Bacteria | 777 |
| 1007 | Ga0495612_0031895 | 3300053078 | Bacteria | 2127 |
| 1008 | Ga0495595_0419337 | 3300053084 | Unclassified | 679 |
| 1009 | Ga0495619_0393072 | 3300053085 | Unclassified | 958 |
| 1010 | Ga0495619_0537784 | 3300053085 | Bacteria | 802 |
| 1011 | Ga0207692_10442017 | |||
| 1012 | SwRhRL2b_contig_1671213 | |||
| 1013 | CNXas_1000026 | |||
| 1014 | JGI24035J26624_1000575 | |||
| 1015 | JGI25406J46586_10000033 | |||
| 1016 | JGI25404J52841_10015420 | |||
| 1017 | JGI25405J52794_10000663 | |||
| 1018 | JGI25405J52794_10009159 | |||
| 1019 | Ga0065703_1023538 | |||
| 1020 | Ga0065714_10233837 | |||
| 1021 | Ga0065704_10004677 | |||
| 1022 | Ga0065704_10018974 | |||
| 1023 | Ga0065704_10081455 | |||
| 1024 | Ga0065704_10328315 | |||
| 1025 | Ga0065712_10001143 | |||
| 1026 | Ga0065712_10020601 | |||
| 1027 | Ga0065712_10044756 | |||
| 1028 | Ga0065712_10084282 | |||
| 1029 | Ga0065712_10167829 | |||
| 1030 | Ga0065712_10185494 | |||
| 1031 | Ga0065712_10192000 | |||
| 1032 | Ga0065715_10005093 | |||
| 1033 | Ga0065715_10088969 | |||
| 1034 | Ga0065715_10241343 | |||
| 1035 | Ga0065715_10377202 | |||
| 1036 | Ga0065715_10530284 | |||
| 1037 | Ga0065715_10594046 | |||
| 1038 | Ga0065715_10597891 | |||
| 1039 | Ga0065707_10119741 | |||
| 1040 | Ga0065707_10206917 | |||
| 1041 | Ga0070658_10085451 | |||
| 1042 | Ga0070658_10324660 | |||
| 1043 | Ga0070676_10103370 | |||
| 1044 | Ga0070676_10282025 | |||
| 1045 | Ga0070676_10311117 | |||
| 1046 | Ga0070676_10467964 | |||
| 1047 | Ga0070676_10494572 | |||
| 1048 | Ga0070683_100004598 | |||
| 1049 | Ga0070683_100024766 | |||
| 1050 | Ga0070683_100033543 | |||
| 1051 | Ga0070683_100277797 | |||
| 1052 | Ga0070683_100492676 | |||
| 1053 | Ga0070690_100084117 | |||
| 1054 | Ga0070690_100121181 | |||
| 1055 | Ga0070670_100002008 | |||
| 1056 | Ga0070670_100047271 | |||
| 1057 | Ga0070670_100348529 | |||
| 1058 | Ga0070670_101857466 | |||
| 1059 | Ga0068869_100081505 | |||
| 1060 | Ga0068869_100625198 | |||
| 1061 | Ga0070666_10010260 | |||
| 1062 | Ga0070666_10029890 | |||
| 1063 | Ga0070666_10032209 | |||
| 1064 | Ga0070666_10160593 | |||
| 1065 | Ga0070666_10527848 | |||
| 1066 | Ga0070682_100518364 | |||
| 1067 | Ga0068868_100055927 | |||
| 1068 | Ga0068868_100085894 | |||
| 1069 | Ga0068868_100700845 | |||
| 1070 | Ga0070660_100012566 | |||
| 1071 | Ga0070660_100128098 | |||
| 1072 | Ga0070689_100030546 | |||
| 1073 | Ga0070689_100102749 | |||
| 1074 | Ga0070689_100401152 | |||
| 1075 | Ga0070689_100546775 | |||
| 1076 | Ga0070689_100636153 | |||
| 1077 | Ga0070691_10272347 | |||
| 1078 | Ga0070687_100046065 | |||
| 1079 | Ga0070687_100208600 | |||
| 1080 | Ga0070661_100073608 | |||
| 1081 | Ga0070661_100182351 | |||
| 1082 | Ga0070661_100424588 | |||
| 1083 | Ga0070692_10157834 | |||
| 1084 | Ga0070668_100058632 | |||
| 1085 | Ga0070668_100250019 | |||
| 1086 | Ga0070668_100290835 | |||
| 1087 | Ga0070669_100019703 | |||
| 1088 | Ga0070669_100032860 | |||
| 1089 | Ga0070669_100062604 | |||
| 1090 | Ga0070669_100109730 | |||
| 1091 | Ga0070669_100316780 | |||
| 1092 | Ga0070669_100334327 | |||
| 1093 | Ga0070669_100580661 | |||
| 1094 | Ga0070669_100591723 | |||
| 1095 | Ga0070669_100603217 | |||
| 1096 | Ga0070675_100008423 | |||
| 1097 | Ga0070675_100017443 | |||
| 1098 | Ga0070675_100031538 | |||
| 1099 | Ga0070675_100037593 | |||
| 1100 | Ga0070675_100081868 | |||
| 1101 | Ga0070675_100110121 | |||
| 1102 | Ga0070675_100205800 | |||
| 1103 | Ga0070675_100244763 | |||
| 1104 | Ga0070675_100393225 | |||
| 1105 | Ga0070671_100014686 | |||
| 1106 | Ga0070671_100015360 | |||
| 1107 | Ga0070671_100023639 | |||
| 1108 | Ga0070671_100078361 | |||
| 1109 | Ga0070671_100148702 | |||
| 1110 | Ga0070671_100175834 | |||
| 1111 | Ga0070671_100204564 | |||
| 1112 | Ga0070671_100307270 | |||
| 1113 | Ga0070671_100406672 | |||
| 1114 | Ga0070671_100928570 | |||
| 1115 | Ga0070671_101143972 | |||
| 1116 | Ga0070674_100023977 | |||
| 1117 | Ga0070674_100189354 | |||
| 1118 | Ga0070674_100534079 | |||
| 1119 | Ga0070674_100612379 | |||
| 1120 | Ga0070673_100003285 | |||
| 1121 | Ga0070673_100008962 | |||
| 1122 | Ga0070673_100019856 | |||
| 1123 | Ga0070673_100044904 | |||
| 1124 | Ga0070673_102282280 | |||
| 1125 | Ga0070673_102342563 | |||
| 1126 | Ga0070688_100001026 | |||
| 1127 | Ga0070688_100005864 | |||
| 1128 | Ga0070688_100034024 | |||
| 1129 | Ga0070688_100592253 | |||
| 1130 | Ga0070688_100713831 | |||
| 1131 | Ga0070659_100081994 | |||
| 1132 | Ga0070659_100349702 | |||
| 1133 | Ga0070667_100022881 | |||
| 1134 | Ga0070667_100068243 | |||
| 1135 | Ga0070667_100183298 | |||
| 1136 | Ga0070667_100184333 | |||
| 1137 | Ga0070667_100199428 | |||
| 1138 | Ga0070667_100209082 | |||
| 1139 | Ga0070667_100473349 | |||
| 1140 | Ga0070667_100932877 | |||
| 1141 | Ga0070667_101083637 | |||
| 1142 | Ga0070703_10022618 | |||
| 1143 | Ga0070703_10049827 | |||
| 1144 | Ga0070709_10019660 | |||
| 1145 | Ga0070709_10066059 | |||
| 1146 | Ga0070714_100007154 | |||
| 1147 | Ga0070714_100036206 | |||
| 1148 | Ga0070714_100129332 | |||
| 1149 | Ga0070714_100387880 | |||
| 1150 | Ga0070714_101306509 | |||
| 1151 | Ga0070713_100014508 | |||
| 1152 | Ga0070713_100023194 | |||
| 1153 | Ga0070713_100537601 | |||
| 1154 | Ga0070710_10010909 | |||
| 1155 | Ga0070710_10085815 | |||
| 1156 | Ga0070710_10132531 | |||
| 1157 | Ga0070710_10385729 | |||
| 1158 | Ga0070701_10221684 | |||
| 1159 | Ga0070711_100002729 | |||
| 1160 | Ga0070711_100004590 | |||
| 1161 | Ga0070711_100125979 | |||
| 1162 | Ga0070711_101383042 | |||
| 1163 | Ga0070705_100040869 | |||
| 1164 | Ga0070705_100076968 | |||
| 1165 | Ga0070705_100101970 | |||
| 1166 | Ga0070705_100720357 | |||
| 1167 | Ga0070705_100990925 | |||
| 1168 | Ga0070705_101418244 | |||
| 1169 | Ga0070700_100082665 | |||
| 1170 | Ga0070694_100229178 | |||
| 1171 | Ga0070708_100003045 | |||
| 1172 | Ga0070708_100014233 | |||
| 1173 | Ga0070708_100018984 | |||
| 1174 | Ga0070708_100097314 | |||
| 1175 | Ga0070708_100239848 | |||
| 1176 | Ga0070708_100317401 | |||
| 1177 | Ga0070708_100458501 | |||
| 1178 | Ga0070708_100521241 | |||
| 1179 | Ga0070708_100529677 | |||
| 1180 | Ga0070708_100558249 | |||
| 1181 | Ga0070708_101424983 | |||
| 1182 | Ga0070663_100559394 | |||
| 1183 | Ga0070678_100020294 | |||
| 1184 | Ga0070678_100038821 | |||
| 1185 | Ga0070678_100064988 | |||
| 1186 | Ga0070678_100085436 | |||
| 1187 | Ga0070678_102188924 | |||
| 1188 | Ga0070662_100001248 | |||
| 1189 | Ga0070662_100006768 | |||
| 1190 | Ga0070662_100057436 | |||
| 1191 | Ga0070662_100201430 | |||
| 1192 | Ga0070662_100364650 | |||
| 1193 | Ga0070662_101098608 | |||
| 1194 | Ga0070662_101566446 | |||
| 1195 | Ga0070681_10075353 | |||
| 1196 | Ga0068867_100049988 | |||
| 1197 | Ga0068867_100214717 | |||
| 1198 | Ga0068867_100795541 | |||
| 1199 | Ga0070685_10059947 | |||
| 1200 | Ga0070685_10312326 | |||
| 1201 | Ga0070706_100000973 | |||
| 1202 | Ga0070706_100001536 | |||
| 1203 | Ga0070706_100001644 | |||
| 1204 | Ga0070706_100033401 | |||
| 1205 | Ga0070706_100040011 | |||
| 1206 | Ga0070706_100086137 | |||
| 1207 | Ga0070706_100086348 | |||
| 1208 | Ga0070706_100107129 | |||
| 1209 | Ga0070706_100166588 | |||
| 1210 | Ga0070706_100220111 | |||
| 1211 | Ga0070706_100250669 | |||
| 1212 | Ga0070706_100273891 | |||
| 1213 | Ga0070706_100361697 | |||
| 1214 | Ga0070706_100408504 | |||
| 1215 | Ga0070706_100779036 | |||
| 1216 | Ga0070706_101334934 | |||
| 1217 | Ga0070707_100000417 | |||
| 1218 | Ga0070707_100004330 | |||
| 1219 | Ga0070707_100008826 | |||
| 1220 | Ga0070707_100021566 | |||
| 1221 | Ga0070707_100023820 | |||
| 1222 | Ga0070707_100064468 | |||
| 1223 | Ga0070707_100075891 | |||
| 1224 | Ga0070707_100147303 | |||
| 1225 | Ga0070707_100209315 | |||
| 1226 | Ga0070707_100287337 | |||
| 1227 | Ga0070707_100305317 | |||
| 1228 | Ga0070707_100318083 | |||
| 1229 | Ga0070707_100400921 | |||
| 1230 | Ga0070707_100407018 | |||
| 1231 | Ga0070707_100570287 | |||
| 1232 | Ga0070707_101676830 | |||
| 1233 | Ga0070698_100001912 | |||
| 1234 | Ga0070698_100029103 | |||
| 1235 | Ga0070698_100078849 | |||
| 1236 | Ga0070698_100188921 | |||
| 1237 | Ga0070698_100236208 | |||
| 1238 | Ga0070698_100440158 | |||
| 1239 | Ga0070698_100854702 | |||
| 1240 | Ga0070699_100151140 | |||
| 1241 | Ga0070699_100189486 | |||
| 1242 | Ga0070699_100208815 | |||
| 1243 | Ga0070699_100310078 | |||
| 1244 | Ga0070699_100381370 | |||
| 1245 | Ga0070699_100724764 | |||
| 1246 | Ga0070679_100170634 | |||
| 1247 | Ga0070684_100009794 | |||
| 1248 | Ga0070684_100035854 | |||
| 1249 | Ga0070684_100084266 | |||
| 1250 | Ga0070684_100150877 | |||
| 1251 | Ga0070684_101286408 | |||
| 1252 | Ga0070697_100005670 | |||
| 1253 | Ga0070697_100052012 | |||
| 1254 | Ga0070697_100059575 | |||
| 1255 | Ga0070697_100070961 | |||
| 1256 | Ga0070697_100084789 | |||
| 1257 | Ga0070697_100149876 | |||
| 1258 | Ga0070697_100198152 | |||
| 1259 | Ga0070697_100202648 | |||
| 1260 | Ga0070697_100220955 | |||
| 1261 | Ga0070697_100323836 | |||
| 1262 | Ga0070697_100336777 | |||
| 1263 | Ga0070697_100412395 | |||
| 1264 | Ga0070697_100494819 | |||
| 1265 | Ga0070697_100583572 | |||
| 1266 | Ga0070697_100975550 | |||
| 1267 | Ga0070697_101167844 | |||
| 1268 | Ga0070697_101402799 | |||
| 1269 | Ga0068853_101430434 | |||
| 1270 | Ga0070672_100018459 | |||
| 1271 | Ga0070672_100031488 | |||
| 1272 | Ga0070672_100291863 | |||
| 1273 | Ga0070695_100025384 | |||
| 1274 | Ga0070696_100201562 | |||
| 1275 | Ga0070696_101407382 | |||
| 1276 | Ga0070693_100270692 | |||
| 1277 | Ga0070665_100005367 | |||
| 1278 | Ga0070665_100051024 | |||
| 1279 | Ga0070665_100051452 | |||
| 1280 | Ga0070665_100059119 | |||
| 1281 | Ga0070665_100154346 | |||
| 1282 | Ga0070665_100279098 | |||
| 1283 | Ga0070704_100281204 | |||
| 1284 | Ga0070704_100438833 | |||
| 1285 | Ga0070704_101070427 | |||
| 1286 | Ga0068855_100866624 | |||
| 1287 | Ga0070664_100031763 | |||
| 1288 | Ga0070664_100084022 | |||
| 1289 | Ga0070664_100682311 | |||
| 1290 | Ga0068857_100503564 | |||
| 1291 | Ga0068854_100991953 | |||
| 1292 | Ga0068856_100097738 | |||
| 1293 | Ga0068856_100313712 | |||
| 1294 | Ga0070702_100967277 | |||
| 1295 | Ga0068852_100261739 | |||
| 1296 | Ga0068852_101428386 | |||
| 1297 | Ga0068859_100061813 | |||
| 1298 | Ga0068859_101956349 | |||
| 1299 | Ga0068864_100461240 | |||
| 1300 | Ga0068864_100844676 | |||
| 1301 | Ga0068864_100973056 | |||
| 1302 | Ga0068864_102358926 | |||
| 1303 | Ga0068866_10179843 | |||
| 1304 | Ga0068861_100177234 | |||
| 1305 | Ga0068861_100545271 | |||
| 1306 | Ga0068870_10328578 | |||
| 1307 | Ga0068863_100053121 | |||
| 1308 | Ga0068863_100251730 | |||
| 1309 | Ga0068863_101394993 | |||
| 1310 | Ga0068858_100233377 | |||
| 1311 | Ga0068858_101342866 | |||
| 1312 | Ga0068860_100021532 | |||
| 1313 | Ga0068860_101112428 | |||
| 1314 | Ga0068860_102322226 | |||
| 1315 | Ga0068862_100115929 | |||
| 1316 | Ga0068862_100343238 | |||
| 1317 | Ga0068862_101764123 | |||
| 1318 | Ga0081455_10000917 | |||
| 1319 | Ga0081455_10001114 | |||
| 1320 | Ga0081455_10004812 | |||
| 1321 | Ga0081455_10022784 | |||
| 1322 | Ga0081455_10097507 | |||
| 1323 | Ga0081455_10108041 | |||
| 1324 | Ga0081455_10144829 | |||
| 1325 | Ga0081540_1024135 | |||
| 1326 | Ga0081540_1032635 | |||
| 1327 | Ga0081539_10000138 | |||
| 1328 | Ga0081539_10000727 | |||
| 1329 | Ga0081539_10008457 | |||
| 1330 | Ga0081539_10015667 | |||
| 1331 | Ga0081539_10154711 | |||
| 1332 | Ga0070717_10000307 | |||
| 1333 | Ga0070717_10021189 | |||
| 1334 | Ga0070717_10041272 | |||
| 1335 | Ga0070717_10056508 | |||
| 1336 | Ga0070717_10129793 | |||
| 1337 | Ga0070717_10142422 | |||
| 1338 | Ga0070717_10345227 | |||
| 1339 | Ga0070717_10399400 | |||
| 1340 | Ga0070717_10462030 | |||
| 1341 | Ga0070717_10710225 | |||
| 1342 | Ga0070717_10897786 | |||
| 1343 | Ga0070715_10063175 | |||
| 1344 | Ga0070716_100005743 | |||
| 1345 | Ga0070716_100014888 | |||
| 1346 | Ga0070716_100066906 | |||
| 1347 | Ga0070716_100358297 | |||
| 1348 | Ga0070716_100459624 | |||
| 1349 | Ga0070716_100584840 | |||
| 1350 | Ga0070712_100011157 | |||
| 1351 | Ga0070712_100113940 | |||
| 1352 | Ga0070712_100116700 | |||
| 1353 | Ga0070712_100182703 | |||
| 1354 | Ga0070712_100196336 | |||
| 1355 | Ga0070712_100425138 | |||
| 1356 | Ga0070712_100546498 | |||
| 1357 | Ga0070712_100556982 | |||
| 1358 | Ga0097621_100030303 | |||
| 1359 | Ga0097621_100077409 | |||
| 1360 | Ga0097621_100517254 | |||
| 1361 | Ga0097621_101066649 | |||
| 1362 | Ga0097621_101641319 | |||
| 1363 | Ga0068871_100074807 | |||
| 1364 | Ga0068871_100121126 | |||
| 1365 | Ga0068871_100162494 | |||
| 1366 | Ga0068871_100194916 | |||
| 1367 | Ga0068871_100792046 | |||
| 1368 | Ga0068871_101136230 | |||
| 1369 | Ga0075428_100959126 | |||
| 1370 | Ga0075428_101270889 | |||
| 1371 | Ga0075433_10110059 | |||
| 1372 | Ga0075433_10361187 | |||
| 1373 | Ga0075433_10399325 | |||
| 1374 | Ga0075433_10411518 | |||
| 1375 | Ga0075433_10751759 | |||
| 1376 | Ga0075434_100135895 | |||
| 1377 | Ga0075434_100228804 | |||
| 1378 | Ga0075434_101012563 | |||
| 1379 | Ga0068865_100238706 | |||
| 1380 | Ga0068865_100288165 | |||
| 1381 | Ga0068865_100298274 | |||
| 1382 | Ga0068865_100308938 | |||
| 1383 | Ga0075436_100063155 | |||
| 1384 | Ga0075436_100322826 | |||
| 1385 | Ga0097620_100061812 | |||
| 1386 | Ga0097620_101956259 | |||
| 1387 | Ga0075435_100256254 | |||
| 1388 | Ga0075435_101037901 | |||
| 1389 | Ga0099794_10034040 | |||
| 1390 | Ga0099794_10102596 | |||
| 1391 | Ga0099794_10196488 | |||
| 1392 | Ga0099795_10032861 | |||
| 1393 | Ga0099795_10099107 | |||
| 1394 | Ga0099795_10201632 | |||
| 1395 | Ga0099795_10469752 | |||
| 1396 | Ga0105244_10206818 | |||
| 1397 | Ga0105240_11344443 | |||
| 1398 | Ga0105240_11807404 | |||
| 1399 | Ga0111539_10154474 | |||
| 1400 | Ga0111539_10166473 | |||
| 1401 | Ga0111539_10630589 | |||
| 1402 | Ga0105245_10099858 | |||
| 1403 | Ga0105245_10387402 | |||
| 1404 | Ga0105245_10809460 | |||
| 1405 | Ga0105245_10822417 | |||
| 1406 | Ga0105245_11045162 | |||
| 1407 | Ga0105247_10508748 | |||
| 1408 | Ga0105247_10693997 | |||
| 1409 | Ga0105247_10767747 | |||
| 1410 | Ga0114129_10193325 | |||
| 1411 | Ga0114129_10309841 | |||
| 1412 | Ga0114129_10376077 | |||
| 1413 | Ga0114129_10834606 | |||
| 1414 | Ga0114129_11392988 | |||
| 1415 | Ga0105241_10096165 | |||
| 1416 | Ga0105241_10465553 | |||
| 1417 | Ga0105242_10003071 | |||
| 1418 | Ga0105242_10144638 | |||
| 1419 | Ga0105242_11673086 | |||
| 1420 | Ga0105248_10871670 | |||
| 1421 | Ga0105248_11088295 | |||
| 1422 | Ga0105237_10403847 | |||
| 1423 | Ga0105237_10521047 | |||
| 1424 | Ga0105238_11146306 | |||
| 1425 | Ga0105249_10006685 | |||
| 1426 | Ga0105249_10223648 | |||
| 1427 | Ga0105249_10470488 | |||
| 1428 | Ga0105249_10520645 | |||
| 1429 | Ga0105249_11845407 | |||
| 1430 | Ga0099796_10021116 | |||
| 1431 | Ga0099796_10138854 | |||
| 1432 | Ga0099796_10532861 | |||
| 1433 | Ga0105239_10045207 | |||
| 1434 | Ga0105239_10247852 | |||
| 1435 | Ga0105239_10512425 | |||
| 1436 | Ga0105239_10698308 | |||
| 1437 | Ga0105239_11021591 | |||
| 1438 | Ga0105239_11881702 | |||
| 1439 | Ga0105246_10641075 | |||
| 1440 | Ga0105246_10763501 | |||
| 1441 | Ga0105246_11929361 | |||
| 1442 | Ga0157329_1014665 | |||
| 1443 | Ga0157313_1050927 | |||
| 1444 | Ga0157342_1033568 | |||
| 1445 | Ga0157327_1020759 | |||
| 1446 | Ga0157373_10346328 | |||
| 1447 | Ga0157371_10071693 | |||
| 1448 | Ga0157371_10104294 | |||
| 1449 | Ga0157371_10129153 | |||
| 1450 | Ga0157371_10184713 | |||
| 1451 | Ga0157371_10240184 | |||
| 1452 | Ga0157370_10196344 | |||
| 1453 | Ga0157369_10061578 | |||
| 1454 | Ga0157374_10010486 | |||
| 1455 | Ga0157374_10013787 | |||
| 1456 | Ga0157374_10031906 | |||
| 1457 | Ga0157374_10034876 | |||
| 1458 | Ga0157374_10041582 | |||
| 1459 | Ga0157374_10050974 | |||
| 1460 | Ga0157374_10106786 | |||
| 1461 | Ga0157374_10147006 | |||
| 1462 | Ga0157374_10416909 | |||
| 1463 | Ga0157374_10495836 | |||
| 1464 | Ga0157374_10736823 | |||
| 1465 | Ga0157374_11520167 | |||
| 1466 | Ga0157374_11584534 | |||
| 1467 | Ga0157374_11860585 | |||
| 1468 | Ga0157374_12774831 | |||
| 1469 | Ga0157378_10011344 | |||
| 1470 | Ga0157378_10043703 | |||
| 1471 | Ga0157378_10048896 | |||
| 1472 | Ga0157378_10076120 | |||
| 1473 | Ga0157378_10098627 | |||
| 1474 | Ga0157378_10200080 | |||
| 1475 | Ga0157378_10254865 | |||
| 1476 | Ga0157378_10255914 | |||
| 1477 | Ga0157378_10298284 | |||
| 1478 | Ga0157378_10346912 | |||
| 1479 | Ga0157378_10537659 | |||
| 1480 | Ga0157378_10784107 | |||
| 1481 | Ga0157378_11039043 | |||
| 1482 | Ga0157378_11067099 | |||
| 1483 | Ga0157378_12712500 | |||
| 1484 | Ga0163162_10003956 | |||
| 1485 | Ga0163162_10011424 | |||
| 1486 | Ga0163162_10032151 | |||
| 1487 | Ga0163162_10076949 | |||
| 1488 | Ga0163162_10224876 | |||
| 1489 | Ga0163162_10288276 | |||
| 1490 | Ga0163162_10503427 | |||
| 1491 | Ga0163162_10592892 | |||
| 1492 | Ga0157372_10025879 | |||
| 1493 | Ga0157372_10070226 | |||
| 1494 | Ga0157372_10072102 | |||
| 1495 | Ga0157372_10379542 | |||
| 1496 | Ga0157372_10482257 | |||
| 1497 | Ga0157372_10545716 | |||
| 1498 | Ga0157372_11758748 | |||
| 1499 | Ga0157372_12510515 | |||
| 1500 | Ga0157375_10003551 | |||
| 1501 | Ga0157375_10011315 | |||
| 1502 | Ga0157375_10019073 | |||
| 1503 | Ga0157375_10037238 | |||
| 1504 | Ga0157375_10045195 | |||
| 1505 | Ga0157375_10114005 | |||
| 1506 | Ga0157375_10421497 | |||
| 1507 | Ga0157375_10555537 | |||
| 1508 | Ga0157375_10702397 | |||
| 1509 | Ga0157375_11225859 | |||
| 1510 | Ga0157375_12206379 | |||
| 1511 | Ga0157375_12313346 | |||
| 1512 | Ga0163163_10094500 | |||
| 1513 | Ga0163163_10181079 | |||
| 1514 | Ga0163163_10228960 | |||
| 1515 | Ga0163163_10361337 | |||
| 1516 | Ga0157380_12504131 | |||
| 1517 | Ga0182008_10012262 | |||
| 1518 | Ga0157377_10018404 | |||
| 1519 | Ga0157377_10036435 | |||
| 1520 | Ga0157377_10288541 | |||
| 1521 | Ga0157377_10387647 | |||
| 1522 | Ga0157377_11388629 | |||
| 1523 | Ga0157379_10170489 | |||
| 1524 | Ga0157376_10004555 | |||
| 1525 | Ga0157376_10248868 | |||
| 1526 | Ga0157376_10599849 | |||
| 1527 | Ga0157376_10653567 | |||
| 1528 | Ga0157376_10658104 | |||
| 1529 | Ga0157376_11394554 | |||
| 1530 | Ga0182005_1020527 | |||
| 1531 | Ga0163161_10086072 | |||
| 1532 | Ga0163161_10206690 | |||
| 1533 | Ga0213872_10001096 | |||
| 1534 | Ga0207666_1000260 | |||
| 1535 | Ga0207666_1001670 | |||
| 1536 | Ga0207673_1000464 | |||
| 1537 | Ga0207673_1008209 | |||
| 1538 | Ga0207697_10000568 | |||
| 1539 | Ga0207697_10000868 | |||
| 1540 | Ga0207697_10001518 | |||
| 1541 | Ga0207697_10005602 | |||
| 1542 | Ga0207697_10007623 | |||
| 1543 | Ga0207697_10008440 | |||
| 1544 | Ga0207697_10012518 | |||
| 1545 | Ga0207697_10051854 | |||
| 1546 | Ga0207697_10056676 | |||
| 1547 | Ga0207697_10078042 | |||
| 1548 | Ga0207697_10182806 | |||
| 1549 | Ga0207682_10115839 | |||
| 1550 | Ga0207692_10016595 | |||
| 1551 | Ga0207692_10043802 | |||
| 1552 | Ga0207692_10044217 | |||
| 1553 | Ga0207692_10180478 | |||
| 1554 | Ga0207692_10259964 | |||
| 1555 | Ga0207692_10864619 | |||
| 1556 | Ga0207642_10056813 | |||
| 1557 | Ga0207688_10021372 | |||
| 1558 | Ga0207688_10077543 | |||
| 1559 | Ga0207688_10189488 | |||
| 1560 | Ga0207688_10254252 | |||
| 1561 | Ga0207680_10007065 | |||
| 1562 | Ga0207680_10064532 | |||
| 1563 | Ga0207680_10153306 | |||
| 1564 | Ga0207647_10006064 | |||
| 1565 | Ga0207685_10027892 | |||
| 1566 | Ga0207699_10017528 | |||
| 1567 | Ga0207699_10092052 | |||
| 1568 | Ga0207699_10246953 | |||
| 1569 | Ga0207699_10279742 | |||
| 1570 | Ga0207645_10015838 | |||
| 1571 | Ga0207645_10024627 | |||
| 1572 | Ga0207645_10049566 | |||
| 1573 | Ga0207645_10124028 | |||
| 1574 | Ga0207645_10211413 | |||
| 1575 | Ga0207643_10259995 | |||
| 1576 | Ga0207684_10000086 | |||
| 1577 | Ga0207684_10000420 | |||
| 1578 | Ga0207684_10002005 | |||
| 1579 | Ga0207684_10010903 | |||
| 1580 | Ga0207684_10011801 | |||
| 1581 | Ga0207684_10040478 | |||
| 1582 | Ga0207684_10107671 | |||
| 1583 | Ga0207684_10107970 | |||
| 1584 | Ga0207684_10133099 | |||
| 1585 | Ga0207684_10332192 | |||
| 1586 | Ga0207684_10617136 | |||
| 1587 | Ga0207684_10691744 | |||
| 1588 | Ga0207684_10691778 | |||
| 1589 | Ga0207684_10775972 | |||
| 1590 | Ga0207684_11113825 | |||
| 1591 | Ga0207654_10517284 | |||
| 1592 | Ga0207707_10421670 | |||
| 1593 | Ga0207671_10161183 | |||
| 1594 | Ga0207671_10264391 | |||
| 1595 | Ga0207693_10002604 | |||
| 1596 | Ga0207693_10004447 | |||
| 1597 | Ga0207693_10014225 | |||
| 1598 | Ga0207693_10017311 | |||
| 1599 | Ga0207693_10030768 | |||
| 1600 | Ga0207693_10038374 | |||
| 1601 | Ga0207693_10044851 | |||
| 1602 | Ga0207693_10064667 | |||
| 1603 | Ga0207693_10119387 | |||
| 1604 | Ga0207693_10238448 | |||
| 1605 | Ga0207693_10673807 | |||
| 1606 | Ga0207663_10004534 | |||
| 1607 | Ga0207663_10006188 | |||
| 1608 | Ga0207663_10043102 | |||
| 1609 | Ga0207663_10095743 | |||
| 1610 | Ga0207663_10481896 | |||
| 1611 | Ga0207660_10054366 | |||
| 1612 | Ga0207662_10000089 | |||
| 1613 | Ga0207662_10040370 | |||
| 1614 | Ga0207662_10350579 | |||
| 1615 | Ga0207662_10853663 | |||
| 1616 | Ga0207657_10011863 | |||
| 1617 | Ga0207657_10502068 | |||
| 1618 | Ga0207657_10657858 | |||
| 1619 | Ga0207649_10544724 | |||
| 1620 | Ga0207649_10685213 | |||
| 1621 | Ga0207646_10003191 | |||
| 1622 | Ga0207646_10006143 | |||
| 1623 | Ga0207646_10016763 | |||
| 1624 | Ga0207646_10022613 | |||
| 1625 | Ga0207646_10057285 | |||
| 1626 | Ga0207646_10080202 | |||
| 1627 | Ga0207646_10156134 | |||
| 1628 | Ga0207646_10213769 | |||
| 1629 | Ga0207646_10238743 | |||
| 1630 | Ga0207646_10397861 | |||
| 1631 | Ga0207646_10406407 | |||
| 1632 | Ga0207646_10495126 | |||
| 1633 | Ga0207646_10625729 | |||
| 1634 | Ga0207646_11177731 | |||
| 1635 | Ga0207646_11274875 | |||
| 1636 | Ga0207646_11803858 | |||
| 1637 | Ga0207681_10060386 | |||
| 1638 | Ga0207681_10131864 | |||
| 1639 | Ga0207681_10164049 | |||
| 1640 | Ga0207681_10262073 | |||
| 1641 | Ga0207681_10658863 | |||
| 1642 | Ga0207681_11148164 | |||
| 1643 | Ga0207650_10052226 | |||
| 1644 | Ga0207650_10088966 | |||
| 1645 | Ga0207650_10366412 | |||
| 1646 | Ga0207650_10456906 | |||
| 1647 | Ga0207650_10586519 | |||
| 1648 | Ga0207659_10015580 | |||
| 1649 | Ga0207659_10021183 | |||
| 1650 | Ga0207659_10066124 | |||
| 1651 | Ga0207659_10126807 | |||
| 1652 | Ga0207659_10157362 | |||
| 1653 | Ga0207659_10197623 | |||
| 1654 | Ga0207659_10397215 | |||
| 1655 | Ga0207659_11275020 | |||
| 1656 | Ga0207687_10987201 | |||
| 1657 | Ga0207687_11318811 | |||
| 1658 | Ga0207700_10017289 | |||
| 1659 | Ga0207700_10045160 | |||
| 1660 | Ga0207700_10085493 | |||
| 1661 | Ga0207700_10239441 | |||
| 1662 | Ga0207700_10285426 | |||
| 1663 | Ga0207664_10169372 | |||
| 1664 | Ga0207664_10208550 | |||
| 1665 | Ga0207664_10264388 | |||
| 1666 | Ga0207664_10307113 | |||
| 1667 | Ga0207664_10339238 | |||
| 1668 | Ga0207664_10661145 | |||
| 1669 | Ga0207664_11675097 | |||
| 1670 | Ga0207644_10011551 | |||
| 1671 | Ga0207644_10020106 | |||
| 1672 | Ga0207644_10034550 | |||
| 1673 | Ga0207644_10040767 | |||
| 1674 | Ga0207644_10041879 | |||
| 1675 | Ga0207644_10183117 | |||
| 1676 | Ga0207644_10193804 | |||
| 1677 | Ga0207644_10343387 | |||
| 1678 | Ga0207644_10466783 | |||
| 1679 | Ga0207644_10917386 | |||
| 1680 | Ga0207690_10005749 | |||
| 1681 | Ga0207690_10238379 | |||
| 1682 | Ga0207706_10000188 | |||
| 1683 | Ga0207706_10010080 | |||
| 1684 | Ga0207706_10044328 | |||
| 1685 | Ga0207706_10059551 | |||
| 1686 | Ga0207706_10118939 | |||
| 1687 | Ga0207706_10151759 | |||
| 1688 | Ga0207706_10189907 | |||
| 1689 | Ga0207706_10566386 | |||
| 1690 | Ga0207706_10650048 | |||
| 1691 | Ga0207686_10003060 | |||
| 1692 | Ga0207686_10703276 | |||
| 1693 | Ga0207686_10842352 | |||
| 1694 | Ga0207709_11095545 | |||
| 1695 | Ga0207670_10047887 | |||
| 1696 | Ga0207670_10109325 | |||
| 1697 | Ga0207670_10300494 | |||
| 1698 | Ga0207670_10905249 | |||
| 1699 | Ga0207669_10090693 | |||
| 1700 | Ga0207669_10193127 | |||
| 1701 | Ga0207669_10536477 | |||
| 1702 | Ga0207704_10331020 | |||
| 1703 | Ga0207704_11109053 | |||
| 1704 | Ga0207665_10022019 | |||
| 1705 | Ga0207665_10203684 | |||
| 1706 | Ga0207665_10269645 | |||
| 1707 | Ga0207665_10554646 | |||
| 1708 | Ga0207665_10899554 | |||
| 1709 | Ga0207665_11073247 | |||
| 1710 | Ga0207691_10008869 | |||
| 1711 | Ga0207691_10088805 | |||
| 1712 | Ga0207691_10225101 | |||
| 1713 | Ga0207691_11526670 | |||
| 1714 | Ga0207711_10583408 | |||
| 1715 | Ga0207689_10070895 | |||
| 1716 | Ga0207689_10373304 | |||
| 1717 | Ga0207661_10084032 | |||
| 1718 | Ga0207661_10209700 | |||
| 1719 | Ga0207661_10234492 | |||
| 1720 | Ga0207661_10354353 | |||
| 1721 | Ga0207661_10815376 | |||
| 1722 | Ga0207667_10508714 | |||
| 1723 | Ga0207651_10055391 | |||
| 1724 | Ga0207651_10273474 | |||
| 1725 | Ga0207651_10308546 | |||
| 1726 | Ga0207651_10373713 | |||
| 1727 | Ga0207651_10393477 | |||
| 1728 | Ga0207651_10525186 | |||
| 1729 | Ga0207712_10033917 | |||
| 1730 | Ga0207668_10047253 | |||
| 1731 | Ga0207668_10158166 | |||
| 1732 | Ga0207668_10257155 | |||
| 1733 | Ga0207668_10353414 | |||
| 1734 | Ga0207658_10054081 | |||
| 1735 | Ga0207658_10055104 | |||
| 1736 | Ga0207658_10169671 | |||
| 1737 | Ga0207658_10209256 | |||
| 1738 | Ga0207658_10239954 | |||
| 1739 | Ga0207658_10550770 | |||
| 1740 | Ga0207658_10623411 | |||
| 1741 | Ga0207658_10700286 | |||
| 1742 | Ga0207658_10986638 | |||
| 1743 | Ga0207677_10055340 | |||
| 1744 | Ga0207677_10089494 | |||
| 1745 | Ga0207677_10115658 | |||
| 1746 | Ga0207677_10438649 | |||
| 1747 | Ga0207677_10895214 | |||
| 1748 | Ga0207677_11579088 | |||
| 1749 | Ga0207703_10223540 | |||
| 1750 | Ga0207703_10334384 | |||
| 1751 | Ga0207703_10507542 | |||
| 1752 | Ga0207703_11084824 | |||
| 1753 | Ga0207678_10016608 | |||
| 1754 | Ga0207678_11218149 | |||
| 1755 | Ga0207708_10017596 | |||
| 1756 | Ga0207702_10067449 | |||
| 1757 | Ga0207702_10131820 | |||
| 1758 | Ga0207702_11139311 | |||
| 1759 | Ga0207641_10194876 | |||
| 1760 | Ga0207641_10545080 | |||
| 1761 | Ga0207641_10549687 | |||
| 1762 | Ga0207641_11301147 | |||
| 1763 | Ga0207648_10033297 | |||
| 1764 | Ga0207648_10256946 | |||
| 1765 | Ga0207648_10409229 | |||
| 1766 | Ga0207648_10524517 | |||
| 1767 | Ga0207648_10563402 | |||
| 1768 | Ga0207676_10266573 | |||
| 1769 | Ga0207674_10181056 | |||
| 1770 | Ga0207675_100147175 | |||
| 1771 | Ga0207675_100191431 | |||
| 1772 | Ga0207675_100226766 | |||
| 1773 | Ga0207683_10009787 | |||
| 1774 | Ga0207683_10065759 | |||
| 1775 | Ga0207683_10113212 | |||
| 1776 | Ga0207683_10377554 | |||
| 1777 | Ga0207683_10634955 | |||
| 1778 | Ga0207683_12015337 | |||
| 1779 | Ga0209968_1041570 | |||
| 1780 | Ga0209970_1022530 | |||
| 1781 | Ga0210002_1017781 | |||
| 1782 | Ga0209974_10117792 | |||
| 1783 | Ga0268266_10029888 | |||
| 1784 | Ga0268266_10061954 | |||
| 1785 | Ga0268266_10177242 | |||
| 1786 | Ga0268266_10178840 | |||
| 1787 | Ga0268266_10314768 | |||
| 1788 | Ga0268266_10593835 | |||
| 1789 | Ga0268266_11233983 | |||
| 1790 | Ga0268266_11375421 | |||
| 1791 | Ga0268266_11823142 | |||
| 1792 | Ga0268265_10095375 | |||
| 1793 | Ga0268265_10221479 | |||
| 1794 | Ga0268265_10365348 | |||
| 1795 | Ga0268264_10176400 | |||
| 1796 | Ga0268264_10570503 | |||
| 1797 | Ga0307513_10081866 | |||
| 1798 | Ga0373926_0071875 | |||
| 1799 | Ga0373934_0037529 | |||
| 1800 | Ga0373944_0041175 | |||
| 1801 | Ga0373951_0264004 | |||
| 1802 | Ga0373936_0575435 | |||
| 1803 | Ga0373939_0415510 | |||
| 1804 | Ga0373945_0134076 | |||
| 1805 | Ga0373945_0154255 | |||
| 1806 | Ga0373953_0048245 | |||
| 1807 | Ga0373953_0107311 | |||
| 1808 | Ga0373954_0208424 | |||
| 1809 | Ga0373956_0048478 | |||
| 1810 | Ga0373956_0183057 | |||
| 1811 | Ga0373957_0047171 | |||
| 1812 | Ga0373960_0115317 | |||
| 1813 | Ga0373943_0015104 | |||
| 1814 | Ga0373943_0042762 | |||
| 1815 | Ga0373943_0066888 | |||
| 1816 | Ga0373943_0095035 | |||
| 1817 | Ga0373943_0167533 | |||
| 1818 | Ga0373943_0424648 | |||
| 1819 | Ga0373946_0082381 | |||
| 1820 | Ga0373946_0139137 | |||
| 1821 | Ga0373946_0476973 | |||
| 1822 | Ga0373946_0697437 | |||
| 1823 | Ga0373955_0509414 | |||
| 1824 | Ga0373962_0177204 | |||
| 1825 | Ga0373924_0110717 | |||
| 1826 | Ga0373931_0309196 | |||
| 1827 | Ga0373931_0313080 | |||
| 1828 | Ga0373931_0973648 | |||
| 1829 | Ga0373935_0073904 | |||
| 1830 | Ga0373935_0128168 | |||
| 1831 | Ga0373935_0414408 | |||
| 1832 | Ga0373935_0508149 | |||
| 1833 | Ga0373935_1000535 | |||
| 1834 | Ga0373927_0079047 | |||
| 1835 | Ga0373927_0329959 | |||
| 1836 | Ga0373927_0433919 | |||
| 1837 | Ga0373947_0024953 | |||
| 1838 | Ga0373947_0959159 | |||
| 1839 | Ga0373937_0189570 | |||
| 1840 | Ga0373937_0327932 | |||
| 1841 | Ga0373937_1485159 | |||
| 1842 | Ga0373925_0185037 | |||
| 1843 | Ga0373925_0211021 | |||
| 1844 | Ga0373925_0353460 | |||
| 1845 | Ga0373925_1277245 | |||
| 1846 | Ga0395900_0187968 | |||
| 1847 | Ga0395900_0328739 | |||
| 1848 | Ga0395900_0819172 | |||
| 1849 | Ga0395898_0546663 | |||
| 1850 | Ga0395905_1144168 | |||
| 1851 | Ga0395905_1404066 | |||
| 1852 | Ga0436364_1300954 | |||
| 1853 | Ga0395901_0089419 | |||
| 1854 | Ga0395901_0634846 | |||
| 1855 | Ga0436361_0116159 | |||
| 1856 | Ga0436362_0661146 | |||
| 1857 | Ga0451839_1517091 | |||
| 1858 | Ga0451853_0163666 | |||
| 1859 | Ga0451853_1432400 | |||
| 1860 | Ga0451853_3799293 | |||
| 1861 | Ga0439448_0041984 | |||
| 1862 | Ga0439451_026132 | |||
| 1863 | Ga0439455_0002794 | |||
| 1864 | Ga0439464_0005373 | |||
| 1865 | Ga0439440_0026978 | |||
| 1866 | Ga0466964_0365299 | |||
| 1867 | Ga0466960_0706882 | |||
| 1868 | Ga0451576_0128289 | |||
| 1869 | Ga0451576_1502492 | |||
| 1870 | Ga0466967_0073846 | |||
| 1871 | Ga0495592_0030779 | |||
| 1872 | Ga0495641_0047470 | |||
| 1873 | Ga0495651_0036056 | |||
| 1874 | Ga0495580_0314573 | |||
| 1875 | Ga0495639_0162450 | |||
| 1876 | Ga0495662_0309643 | |||
| 1877 | Ga0495664_0193556 | |||
| 1878 | Ga0495584_0107485 | |||
| 1879 | Ga0495585_0062846 | |||
| 1880 | Ga0495594_0192278 | |||
| 1881 | Ga0495594_0555068 | |||
| 1882 | Ga0495608_0167904 | |||
| 1883 | Ga0495608_0566517 | |||
| 1884 | Ga0495616_0411717 | |||
| 1885 | Ga0495628_0075768 | |||
| 1886 | Ga0495628_0138960 | |||
| 1887 | Ga0495628_0940721 | |||
| 1888 | Ga0495630_0042785 | |||
| 1889 | Ga0495630_1156304 | |||
| 1890 | Ga0495652_0111830 | |||
| 1891 | Ga0495652_0511430 | |||
| 1892 | Ga0495665_0279404 | |||
| 1893 | Ga0495640_0655196 | |||
| 1894 | Ga0495586_0104035 | |||
| 1895 | Ga0495645_0012204 | |||
| 1896 | Ga0495645_0108438 | |||
| 1897 | Ga0495633_0238967 | |||
| 1898 | Ga0495667_0226375 | |||
| 1899 | Ga0495634_0555254 | |||
| 1900 | Ga0495659_0179511 | |||
| 1901 | Ga0495588_0103975 | |||
| 1902 | Ga0495657_0360909 | |||
| 1903 | Ga0495657_0436421 | |||
| 1904 | Ga0495599_0001261 | |||
| 1905 | Ga0495599_0045422 | |||
| 1906 | Ga0495623_0004789 | |||
| 1907 | Ga0495646_0028892 | |||
| 1908 | Ga0495646_0237755 | |||
| 1909 | Ga0495647_0038968 | |||
| 1910 | Ga0495647_0054240 | |||
| 1911 | Ga0495647_0392040 | |||
| 1912 | Ga0495658_0090337 | |||
| 1913 | Ga0495658_0096386 | |||
| 1914 | Ga0495669_0032580 | |||
| 1915 | Ga0495669_0045956 | |||
| 1916 | Ga0495669_0079548 | |||
| 1917 | Ga0495613_0584009 | |||
| 1918 | Ga0495624_0181861 | |||
| 1919 | Ga0495624_0576803 | |||
| 1920 | Ga0495670_0494467 | |||
| 1921 | Ga0495660_0352436 | |||
| 1922 | Ga0495674_0050277 | |||
| 1923 | Ga0495676_0225163 | |||
| 1924 | Ga0495680_0295362 | |||
| 1925 | Ga0495683_0305932 | |||
| 1926 | Ga0495675_0039717 | |||
| 1927 | Ga0495681_0330264 | |||
| 1928 | Ga0495684_0026060 | |||
| 1929 | Ga0495684_0188928 | |||
| 1930 | Ga0496100_0050137 | |||
| 1931 | Ga0496100_0141139 | |||
| 1932 | Ga0496100_0173756 | |||
| 1933 | Ga0496100_0393186 | |||
| 1934 | Ga0496100_0605693 | |||
| 1935 | Ga0496101_0048881 | |||
| 1936 | Ga0496101_0094410 | |||
| 1937 | Ga0496101_0476990 | |||
| 1938 | Ga0496102_0266591 | |||
| 1939 | Ga0496102_0276440 | |||
| 1940 | Ga0496102_0335715 | |||
| 1941 | Ga0496102_0372702 | |||
| 1942 | Ga0496102_0892295 | |||
| 1943 | Ga0496104_0027669 | |||
| 1944 | Ga0496104_0130296 | |||
| 1945 | Ga0496104_0393095 | |||
| 1946 | Ga0496104_0393901 | |||
| 1947 | Ga0496104_0433303 | |||
| 1948 | Ga0496104_1394803 | |||
| 1949 | Ga0496105_0027342 | |||
| 1950 | Ga0496105_0130926 | |||
| 1951 | Ga0496105_0260663 | |||
| 1952 | Ga0496105_0608303 | |||
| 1953 | Ga0496106_0047246 | |||
| 1954 | Ga0496106_0160877 | |||
| 1955 | Ga0496106_0225288 | |||
| 1956 | Ga0496107_0037363 | |||
| 1957 | Ga0496107_0085001 | |||
| 1958 | Ga0496107_0646424 | |||
| 1959 | Ga0496107_0664374 | |||
| 1960 | Ga0496108_0203878 | |||
| 1961 | Ga0496108_0295108 | |||
| 1962 | Ga0496108_0896753 | |||
| 1963 | Ga0496108_1033322 | |||
| 1964 | Ga0496109_0013505 | |||
| 1965 | Ga0496109_0193187 | |||
| 1966 | Ga0496109_0218856 | |||
| 1967 | Ga0496109_0254018 | |||
| 1968 | Ga0496109_0265414 | |||
| 1969 | Ga0496109_0330676 | |||
| 1970 | Ga0496109_0507684 | |||
| 1971 | Ga0496109_1863980 | |||
| 1972 | Ga0496110_0119170 | |||
| 1973 | Ga0496110_0119191 | |||
| 1974 | Ga0496110_0335389 | |||
| 1975 | Ga0496111_0107611 | |||
| 1976 | Ga0496111_0576379 | |||
| 1977 | Ga0496111_0620842 | |||
| 1978 | Ga0496111_1156060 | |||
| 1979 | Ga0496112_0022444 | |||
| 1980 | Ga0496112_0025243 | |||
| 1981 | Ga0496112_0292925 | |||
| 1982 | Ga0496112_0373006 | |||
| 1983 | Ga0496112_0801237 | |||
| 1984 | Ga0496113_0199609 | |||
| 1985 | Ga0496114_0009375 | |||
| 1986 | Ga0496114_0041374 | |||
| 1987 | Ga0496114_0046897 | |||
| 1988 | Ga0496114_0237013 | |||
| 1989 | Ga0496115_0005412 | |||
| 1990 | Ga0496115_0005523 | |||
| 1991 | Ga0496115_0083134 | |||
| 1992 | Ga0496115_0125245 | |||
| 1993 | Ga0496115_0757548 | |||
| 1994 | Ga0496115_1042147 | |||
| 1995 | nmdc:mga05p37_176863_c1 | |||
| 1996 | nmdc:mga05p37_217959_c1 | |||
| 1997 | nmdc:mga05p37_392650_c1 | |||
| 1998 | nmdc:mga08y16_1259552_c1 | |||
| 1999 | nmdc:mga08y16_326661_c1 | |||
| 2000 | nmdc:mga08y16_688627_c1 | |||
| 2001 | nmdc:mga0n895_1091723_c1 | |||
| 2002 | nmdc:mga0n895_129254_c1 | |||
| 2003 | nmdc:mga0n895_1365090_c1 | |||
| 2004 | nmdc:mga0n895_339315_c1 | |||
| 2005 | nmdc:mga0n895_443577_c1 | |||
| 2006 | nmdc:mga0n895_685221_c1 | |||
| 2007 | nmdc:mga0n895_786013_c1 | |||
| 2008 | nmdc:mga0rr50_550433_c1 | |||
| 2009 | nmdc:mga0rr50_900818_c1 | |||
| 2010 | nmdc:mga08x19_290480_c1 | |||
| 2011 | nmdc:mga0a205_146370_c2 | |||
| 2012 | nmdc:mga0a205_269020_c1 | |||
| 2013 | nmdc:mga0a205_391479_c1 | |||
| 2014 | nmdc:mga0a205_847300_c1 | |||
| 2015 | Ga0495601_0002282 | |||
| 2016 | Ga0495601_0508381 | |||
| 2017 | Ga0495612_0031895 | |||
| 2018 | Ga0495595_0419337 | |||
| 2019 | Ga0495619_0393072 | |||
| 2020 | Ga0495619_0537784 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3omd-assembly2.cif.gz_B | crystal structure of unknown function protein from leptospirillum rubarum | 0.8812 | 2 | 139 |
| 3omd-assembly2.cif.gz_B | crystal structure of unknown function protein from leptospirillum rubarum | 0.8363 | 2 | 139 |
| 7a24-assembly1.cif.gz_R | assembly intermediate of the plant mitochondrial complex i | 0.2968 | 7 | 97 |
| 7a23-assembly1.cif.gz_R | plant mitochondrial respiratory complex i | 0.2968 | 7 | 97 |
| 7a24-assembly1.cif.gz_R | assembly intermediate of the plant mitochondrial complex i | 0.2306 | 7 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XUB7_219_455_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7863 | 100 | 121 | 3.30.420.10 |
| af_A4I2W2_84_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5456 | 96 | 135 | 3.40.50.300 |
| af_Q8GW96_373_447_1.10.10.630 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like | 0.3971 | 25 | 93 | 1.10.10.630 |
| af_Q8GW96_373_447_1.10.10.630 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like | 0.3458 | 25 | 93 | 1.10.10.630 |
| af_A4IDS9_54_182_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.2969 | 75 | 141 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6J3J6-F1-model_v4 | DUF5069 domain-containing protein | 0.9924 | 52 | 139 |
|
| AF-A0A2V5Y6S1-F1-model_v4 | DUF5069 domain-containing protein | 0.9865 | 2 | 139 |
|
| AF-A0A2V5XS02-F1-model_v4 | DUF5069 domain-containing protein | 0.9847 | 1 | 139 |
|
| AF-A0A2V6FWD7-F1-model_v4 | DUF5069 domain-containing protein | 0.9844 | 2 | 139 |
|
| AF-A0A2V5YNY3-F1-model_v4 | DUF5069 domain-containing protein | 0.983 | 1 | 139 |
|