F488036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 431 | 974 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10326415|Ga0157375_103264151 |
| Length | 240 |
| Sequence | MLCFFIDDAPFGGAAPDPSRKELTNMSRNRLFALIVAMLPAAVAAQEAAAPAKVDLAKAQQTATQICAACHGADGNSAVAANPNLAGQHADYITLQLAHFKAGIRVNAVMQGMVATLSDADMKALGVYFSQQKPKGQAAKDPATVKLAQRLYRGGDAVTAVPACASCHSPTGAGIAKNFPRVGGQYADYSYAQLKAFKAGERGADKEGKDVNGKIMATIAGRMTDAQMKAVADYMAGLRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 3 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 4 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 5 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 6 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 7 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 8 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 9 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 10 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 11 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 12 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 13 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 14 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 15 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 16 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 17 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 18 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 19 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 20 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 21 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 22 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 23 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 24 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 25 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 26 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 27 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 28 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 29 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 30 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 31 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 32 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 33 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 34 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 35 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 36 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 37 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 38 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 39 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 40 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 42 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 43 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 49 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 50 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 122 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 123 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 124 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 125 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 129 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 130 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 131 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 132 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 137 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 138 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 141 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 142 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 262 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 264 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 265 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 266 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 267 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 268 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 269 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 270 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 277 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 278 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 279 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 280 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 281 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 282 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 284 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 285 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 286 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 289 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 290 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 291 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 292 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 293 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 295 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 297 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 307 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 308 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 309 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 310 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 311 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 312 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 317 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 318 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 319 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 320 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 321 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 322 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 323 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 324 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 325 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 326 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 327 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 328 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 329 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 330 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 331 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 332 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 333 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 334 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 335 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 336 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 337 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 338 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 339 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 340 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 341 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 396 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 410 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 411 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 412 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 414 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 420 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 423 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.43 |
| Metatranscriptomes | 0.3 |
| Isolates | 3.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.3 |
| Nodule | 0.6 |
| Rhizoplane | 3.67 |
| Rhizosphere | 75.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014074 | 3300001979 | Bacteria | 2962 |
| 2 | JGI24743J22301_10060382 | 3300001991 | Bacteria | 780 |
| 3 | JGI24749J21850_1010698 | 3300002076 | Bacteria | 1288 |
| 4 | JGI24744J21845_10036270 | 3300002077 | Bacteria | 931 |
| 5 | JGI24034J26672_10005856 | 3300002239 | Bacteria | 1768 |
| 6 | JGI24751J29686_10015244 | 3300002459 | Bacteria | 1586 |
| 7 | JGI25158J39367_1009169 | 3300002739 | Bacteria | 1360 |
| 8 | JGI25152J39213_1014596 | 3300002773 | Bacteria | 1586 |
| 9 | JGI25150J39212_1006276 | 3300002774 | Bacteria | 2466 |
| 10 | JGI25159J45721_1016195 | 3300002987 | Bacteria | 1601 |
| 11 | JGI25151J46595_10014901 | 3300003187 | Bacteria | 3450 |
| 12 | JGI25153J46596_10018126 | 3300003215 | Bacteria | 2746 |
| 13 | rootH1_10016509 | 3300003323 | Bacteria | 14464 |
| 14 | rootH1_10037348 | 3300003323 | Bacteria | 3912 |
| 15 | JGI25160J50197_1013801 | 3300003354 | Bacteria | 2736 |
| 16 | JGI25161J50226_1005621 | 3300003374 | Bacteria | 2394 |
| 17 | Ga0006562J51391_1053276 | 3300003578 | Bacteria | 2010 |
| 18 | Ga0006562J51391_1094937 | 3300003578 | Bacteria | 4840 |
| 19 | Ga0006562J51391_1094939 | 3300003578 | Bacteria | 2220 |
| 20 | Ga0055532_1010963 | 3300003758 | Bacteria | 1075 |
| 21 | Ga0055535_1000940 | 3300003761 | Bacteria | 19336 |
| 22 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 23 | Ga0055526_1027606 | 3300003771 | Bacteria | 1748 |
| 24 | Ga0055537_1000250 | 3300003773 | Bacteria | 39199 |
| 25 | Ga0055537_1011777 | 3300003773 | Bacteria | 1750 |
| 26 | Ga0055524_1003603 | 3300003775 | Bacteria | 7465 |
| 27 | Ga0055524_1044620 | 3300003775 | Bacteria | 1076 |
| 28 | Ga0055524_1058711 | 3300003775 | Bacteria | 813 |
| 29 | Ga0055536_1003029 | 3300003781 | Bacteria | 9187 |
| 30 | Ga0055536_1006353 | 3300003781 | Bacteria | 5543 |
| 31 | Ga0055536_1009680 | 3300003781 | Bacteria | 3946 |
| 32 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 33 | Ga0055534_1004592 | 3300003784 | Bacteria | 3941 |
| 34 | Ga0055528_1000429 | 3300003790 | Bacteria | 33812 |
| 35 | Ga0055528_1023605 | 3300003790 | Bacteria | 1870 |
| 36 | Ga0055530_10004556 | 3300003791 | Bacteria | 7078 |
| 37 | Ga0055530_10005015 | 3300003791 | Bacteria | 6529 |
| 38 | Ga0055540_1002682 | 3300003792 | Bacteria | 9173 |
| 39 | Ga0055540_1005224 | 3300003792 | Bacteria | 5553 |
| 40 | Ga0055531_10007985 | 3300003794 | Bacteria | 5661 |
| 41 | Ga0055531_10012361 | 3300003794 | Bacteria | 4024 |
| 42 | Ga0055543_1040888 | 3300004625 | Bacteria | 782 |
| 43 | Ga0065165_1085222 | 3300005262 | Bacteria | 813 |
| 44 | Ga0065714_10101199 | 3300005288 | Bacteria | 1649 |
| 45 | Ga0065704_10370634 | 3300005289 | Bacteria | 783 |
| 46 | Ga0070658_10016361 | 3300005327 | Bacteria | 5937 |
| 47 | Ga0070676_10241127 | 3300005328 | Bacteria | 1202 |
| 48 | Ga0070676_10246805 | 3300005328 | Unclassified | 1190 |
| 49 | Ga0070683_100004377 | 3300005329 | Bacteria | 11618 |
| 50 | Ga0070683_100146971 | 3300005329 | Bacteria | 2234 |
| 51 | Ga0070683_100526052 | 3300005329 | Bacteria | 1130 |
| 52 | Ga0070690_100013195 | 3300005330 | Bacteria | 4877 |
| 53 | Ga0070690_100018410 | 3300005330 | Bacteria | 4219 |
| 54 | Ga0070670_100000664 | 3300005331 | Bacteria | 26740 |
| 55 | Ga0070670_100011387 | 3300005331 | Bacteria | 7605 |
| 56 | Ga0070670_100054285 | 3300005331 | Bacteria | 3440 |
| 57 | Ga0070670_100063865 | 3300005331 | Bacteria | 3159 |
| 58 | Ga0070670_100109562 | 3300005331 | Bacteria | 2379 |
| 59 | Ga0070677_10021558 | 3300005333 | Bacteria | 2365 |
| 60 | Ga0068869_100000984 | 3300005334 | Bacteria | 16517 |
| 61 | Ga0068869_100003158 | 3300005334 | Bacteria | 10059 |
| 62 | Ga0068869_100015323 | 3300005334 | Bacteria | 5139 |
| 63 | Ga0068869_100555113 | 3300005334 | Bacteria | 965 |
| 64 | Ga0070666_10019587 | 3300005335 | Bacteria | 4371 |
| 65 | Ga0070666_10036643 | 3300005335 | Bacteria | 3257 |
| 66 | Ga0070666_10186152 | 3300005335 | Bacteria | 1458 |
| 67 | Ga0070666_10332672 | 3300005335 | Bacteria | 1085 |
| 68 | Ga0070666_10383672 | 3300005335 | Unclassified | 1009 |
| 69 | Ga0070680_100442391 | 3300005336 | Unclassified | 1110 |
| 70 | Ga0068868_100035704 | 3300005338 | Bacteria | 3844 |
| 71 | Ga0068868_100057089 | 3300005338 | Unclassified | 3084 |
| 72 | Ga0068868_100058057 | 3300005338 | Bacteria | 3058 |
| 73 | Ga0070660_100004401 | 3300005339 | Bacteria | 9735 |
| 74 | Ga0070660_100025476 | 3300005339 | Bacteria | 4396 |
| 75 | Ga0070660_100073271 | 3300005339 | Bacteria | 2678 |
| 76 | Ga0070689_100233122 | 3300005340 | Bacteria | 1514 |
| 77 | Ga0070689_100379647 | 3300005340 | Bacteria | 1191 |
| 78 | Ga0070689_100470872 | 3300005340 | Unclassified | 1072 |
| 79 | Ga0070687_100001531 | 3300005343 | Bacteria | 8190 |
| 80 | Ga0070687_100139739 | 3300005343 | Bacteria | 1409 |
| 81 | Ga0070661_100002630 | 3300005344 | Bacteria | 12289 |
| 82 | Ga0070661_100009245 | 3300005344 | Bacteria | 6814 |
| 83 | Ga0070661_100079356 | 3300005344 | Bacteria | 2422 |
| 84 | Ga0070692_10493962 | 3300005345 | Bacteria | 792 |
| 85 | Ga0070668_100001133 | 3300005347 | Bacteria | 18723 |
| 86 | Ga0070668_100004017 | 3300005347 | Bacteria | 10879 |
| 87 | Ga0070668_100016923 | 3300005347 | Bacteria | 5454 |
| 88 | Ga0070668_100085563 | 3300005347 | Bacteria | 2478 |
| 89 | Ga0070668_100366929 | 3300005347 | Unclassified | 1222 |
| 90 | Ga0070669_100004906 | 3300005353 | Bacteria | 9656 |
| 91 | Ga0070669_100057425 | 3300005353 | Bacteria | 2855 |
| 92 | Ga0070669_100157405 | 3300005353 | Unclassified | 1763 |
| 93 | Ga0070669_100207733 | 3300005353 | Bacteria | 1543 |
| 94 | Ga0070669_100225936 | 3300005353 | Unclassified | 1482 |
| 95 | Ga0070669_100442967 | 3300005353 | Bacteria | 1069 |
| 96 | Ga0070669_100733498 | 3300005353 | Unclassified | 836 |
| 97 | Ga0070675_100000235 | 3300005354 | Bacteria | 35666 |
| 98 | Ga0070675_100304651 | 3300005354 | Unclassified | 1404 |
| 99 | Ga0070675_100549752 | 3300005354 | Bacteria | 1044 |
| 100 | Ga0070671_100003028 | 3300005355 | Bacteria | 13082 |
| 101 | Ga0070671_100016559 | 3300005355 | Bacteria | 5960 |
| 102 | Ga0070671_100017030 | 3300005355 | Bacteria | 5879 |
| 103 | Ga0070671_100044249 | 3300005355 | Bacteria | 3699 |
| 104 | Ga0070671_100082919 | 3300005355 | Bacteria | 2681 |
| 105 | Ga0070671_100366398 | 3300005355 | Bacteria | 1230 |
| 106 | Ga0070674_100002199 | 3300005356 | Bacteria | 10722 |
| 107 | Ga0070674_100047294 | 3300005356 | Bacteria | 2946 |
| 108 | Ga0070674_100056661 | 3300005356 | Bacteria | 2718 |
| 109 | Ga0070674_100339262 | 3300005356 | Unclassified | 1210 |
| 110 | Ga0070673_100002358 | 3300005364 | Bacteria | 11478 |
| 111 | Ga0070673_100004029 | 3300005364 | Bacteria | 9249 |
| 112 | Ga0070673_100044482 | 3300005364 | Bacteria | 3439 |
| 113 | Ga0070673_100134801 | 3300005364 | Bacteria | 2077 |
| 114 | Ga0070673_100137460 | 3300005364 | Bacteria | 2058 |
| 115 | Ga0070673_100168910 | 3300005364 | Bacteria | 1866 |
| 116 | Ga0070673_100335291 | 3300005364 | Bacteria | 1339 |
| 117 | Ga0070673_100372401 | 3300005364 | Bacteria | 1272 |
| 118 | Ga0070673_100767715 | 3300005364 | Bacteria | 888 |
| 119 | Ga0070688_100026897 | 3300005365 | Bacteria | 3422 |
| 120 | Ga0070688_100136286 | 3300005365 | Unclassified | 1662 |
| 121 | Ga0070688_100463764 | 3300005365 | Bacteria | 949 |
| 122 | Ga0070659_100010089 | 3300005366 | Bacteria | 6953 |
| 123 | Ga0070659_100031851 | 3300005366 | Bacteria | 4086 |
| 124 | Ga0070659_100197482 | 3300005366 | Bacteria | 1655 |
| 125 | Ga0070659_100293977 | 3300005366 | Bacteria | 1353 |
| 126 | Ga0070667_100002692 | 3300005367 | Bacteria | 15384 |
| 127 | Ga0070667_100018346 | 3300005367 | Bacteria | 5803 |
| 128 | Ga0070667_100063102 | 3300005367 | Bacteria | 3139 |
| 129 | Ga0070667_100063570 | 3300005367 | Bacteria | 3128 |
| 130 | Ga0070667_100088808 | 3300005367 | Bacteria | 2654 |
| 131 | Ga0070667_100090414 | 3300005367 | Bacteria | 2631 |
| 132 | Ga0070667_100117556 | 3300005367 | Bacteria | 2310 |
| 133 | Ga0070667_100130060 | 3300005367 | Bacteria | 2196 |
| 134 | Ga0070667_100267749 | 3300005367 | Bacteria | 1531 |
| 135 | Ga0070667_100291921 | 3300005367 | Bacteria | 1466 |
| 136 | Ga0070667_100700595 | 3300005367 | Bacteria | 937 |
| 137 | Ga0070709_10112924 | 3300005434 | Unclassified | 1829 |
| 138 | Ga0070701_10027616 | 3300005438 | Bacteria | 2782 |
| 139 | Ga0070701_10270240 | 3300005438 | Bacteria | 1034 |
| 140 | Ga0070705_100243445 | 3300005440 | Bacteria | 1258 |
| 141 | Ga0070705_100245475 | 3300005440 | Bacteria | 1254 |
| 142 | Ga0070700_100245619 | 3300005441 | Unclassified | 1281 |
| 143 | Ga0070700_100709808 | 3300005441 | Bacteria | 800 |
| 144 | Ga0070708_100000773 | 3300005445 | Bacteria | 24034 |
| 145 | Ga0070663_100001362 | 3300005455 | Bacteria | 13368 |
| 146 | Ga0070663_100023461 | 3300005455 | Bacteria | 4136 |
| 147 | Ga0070663_100079964 | 3300005455 | Unclassified | 2400 |
| 148 | Ga0070663_100230523 | 3300005455 | Bacteria | 1458 |
| 149 | Ga0070663_100824421 | 3300005455 | Bacteria | 797 |
| 150 | Ga0070678_100001357 | 3300005456 | Bacteria | 12997 |
| 151 | Ga0070678_100004731 | 3300005456 | Bacteria | 7757 |
| 152 | Ga0070678_100068267 | 3300005456 | Bacteria | 2649 |
| 153 | Ga0070678_100069507 | 3300005456 | Bacteria | 2629 |
| 154 | Ga0070678_100123760 | 3300005456 | Bacteria | 2043 |
| 155 | Ga0070678_100489495 | 3300005456 | Bacteria | 1083 |
| 156 | Ga0070662_100001027 | 3300005457 | Bacteria | 17072 |
| 157 | Ga0070662_100049784 | 3300005457 | Bacteria | 3022 |
| 158 | Ga0070662_100106673 | 3300005457 | Bacteria | 2128 |
| 159 | Ga0070662_100205882 | 3300005457 | Unclassified | 1563 |
| 160 | Ga0070681_10217116 | 3300005458 | Bacteria | 1828 |
| 161 | Ga0068867_100003026 | 3300005459 | Bacteria | 11854 |
| 162 | Ga0068867_100006238 | 3300005459 | Bacteria | 8439 |
| 163 | Ga0068867_100447731 | 3300005459 | Bacteria | 1099 |
| 164 | Ga0068867_100996351 | 3300005459 | Bacteria | 759 |
| 165 | Ga0070685_10021853 | 3300005466 | Bacteria | 3480 |
| 166 | Ga0070685_10437976 | 3300005466 | Unclassified | 913 |
| 167 | Ga0070698_100050333 | 3300005471 | Bacteria | 4248 |
| 168 | Ga0070679_100350030 | 3300005530 | Bacteria | 1425 |
| 169 | Ga0070679_100612385 | 3300005530 | Bacteria | 1032 |
| 170 | Ga0070684_100109046 | 3300005535 | Bacteria | 2481 |
| 171 | Ga0068853_100014134 | 3300005539 | Bacteria | 6535 |
| 172 | Ga0068853_100033311 | 3300005539 | Bacteria | 4370 |
| 173 | Ga0068853_100053997 | 3300005539 | Bacteria | 3462 |
| 174 | Ga0068853_100332237 | 3300005539 | Bacteria | 1411 |
| 175 | Ga0070672_100008441 | 3300005543 | Bacteria | 7043 |
| 176 | Ga0070672_100029890 | 3300005543 | Bacteria | 4089 |
| 177 | Ga0070672_100032742 | 3300005543 | Bacteria | 3928 |
| 178 | Ga0070672_100033175 | 3300005543 | Bacteria | 3907 |
| 179 | Ga0070672_100113226 | 3300005543 | Unclassified | 2214 |
| 180 | Ga0070686_100033639 | 3300005544 | Bacteria | 3151 |
| 181 | Ga0070686_100064667 | 3300005544 | Bacteria | 2373 |
| 182 | Ga0070665_100004180 | 3300005548 | Bacteria | 15182 |
| 183 | Ga0070665_100010735 | 3300005548 | Bacteria | 9267 |
| 184 | Ga0070665_100012532 | 3300005548 | Bacteria | 8544 |
| 185 | Ga0070665_100077702 | 3300005548 | Bacteria | 3325 |
| 186 | Ga0070665_100116676 | 3300005548 | Bacteria | 2672 |
| 187 | Ga0070665_100158765 | 3300005548 | Bacteria | 2263 |
| 188 | Ga0070665_100731851 | 3300005548 | Unclassified | 1002 |
| 189 | Ga0070665_100988369 | 3300005548 | Unclassified | 854 |
| 190 | Ga0070704_100194730 | 3300005549 | Bacteria | 1632 |
| 191 | Ga0068855_100000446 | 3300005563 | Bacteria | 51081 |
| 192 | Ga0068855_100082535 | 3300005563 | Bacteria | 3725 |
| 193 | Ga0068855_101076282 | 3300005563 | Bacteria | 842 |
| 194 | Ga0070664_100012372 | 3300005564 | Bacteria | 6935 |
| 195 | Ga0070664_100012737 | 3300005564 | Bacteria | 6843 |
| 196 | Ga0070664_100020447 | 3300005564 | Bacteria | 5450 |
| 197 | Ga0070664_100029213 | 3300005564 | Bacteria | 4595 |
| 198 | Ga0070664_100040211 | 3300005564 | Bacteria | 3942 |
| 199 | Ga0070664_100178692 | 3300005564 | Bacteria | 1886 |
| 200 | Ga0070664_100220374 | 3300005564 | Bacteria | 1697 |
| 201 | Ga0068857_100037720 | 3300005577 | Bacteria | 4282 |
| 202 | Ga0068857_100053835 | 3300005577 | Bacteria | 3570 |
| 203 | Ga0068857_100182759 | 3300005577 | Bacteria | 1908 |
| 204 | Ga0068857_100593300 | 3300005577 | Bacteria | 1047 |
| 205 | Ga0068854_100026774 | 3300005578 | Bacteria | 3967 |
| 206 | Ga0068854_100322627 | 3300005578 | Unclassified | 1256 |
| 207 | Ga0068856_100003250 | 3300005614 | Bacteria | 16544 |
| 208 | Ga0068856_100026992 | 3300005614 | Bacteria | 5602 |
| 209 | Ga0068856_101004519 | 3300005614 | Bacteria | 852 |
| 210 | Ga0070702_100128683 | 3300005615 | Bacteria | 1596 |
| 211 | Ga0070702_100163520 | 3300005615 | Unclassified | 1441 |
| 212 | Ga0068852_100022774 | 3300005616 | Bacteria | 5030 |
| 213 | Ga0068852_100024496 | 3300005616 | Bacteria | 4879 |
| 214 | Ga0068852_100029844 | 3300005616 | Bacteria | 4482 |
| 215 | Ga0068852_100122460 | 3300005616 | Bacteria | 2384 |
| 216 | Ga0068852_100123993 | 3300005616 | Bacteria | 2369 |
| 217 | Ga0068852_100173763 | 3300005616 | Bacteria | 2021 |
| 218 | Ga0068852_100210387 | 3300005616 | Bacteria | 1845 |
| 219 | Ga0068852_100746476 | 3300005616 | Bacteria | 991 |
| 220 | Ga0068859_100005130 | 3300005617 | Bacteria | 13302 |
| 221 | Ga0068859_100020012 | 3300005617 | Bacteria | 6721 |
| 222 | Ga0068859_100179498 | 3300005617 | Bacteria | 2200 |
| 223 | Ga0068859_100300016 | 3300005617 | Unclassified | 1700 |
| 224 | Ga0068859_101327400 | 3300005617 | Bacteria | 793 |
| 225 | Ga0068864_100001839 | 3300005618 | Bacteria | 17453 |
| 226 | Ga0068864_100002013 | 3300005618 | Bacteria | 16753 |
| 227 | Ga0068864_100002166 | 3300005618 | Bacteria | 16217 |
| 228 | Ga0068864_100073958 | 3300005618 | Bacteria | 2972 |
| 229 | Ga0068864_100176227 | 3300005618 | Unclassified | 1952 |
| 230 | Ga0068864_100176871 | 3300005618 | Bacteria | 1949 |
| 231 | Ga0068864_100291088 | 3300005618 | Bacteria | 1527 |
| 232 | Ga0068864_100764330 | 3300005618 | Unclassified | 948 |
| 233 | Ga0068866_10043026 | 3300005718 | Bacteria | 2251 |
| 234 | Ga0068861_100001567 | 3300005719 | Bacteria | 14538 |
| 235 | Ga0068861_100026899 | 3300005719 | Bacteria | 4186 |
| 236 | Ga0068861_100112565 | 3300005719 | Bacteria | 2182 |
| 237 | Ga0068861_100128998 | 3300005719 | Bacteria | 2050 |
| 238 | Ga0068861_100163184 | 3300005719 | Bacteria | 1840 |
| 239 | Ga0068861_100197533 | 3300005719 | Bacteria | 1686 |
| 240 | Ga0068861_101036623 | 3300005719 | Unclassified | 785 |
| 241 | Ga0068851_10009906 | 3300005834 | Bacteria | 4438 |
| 242 | Ga0068851_10013177 | 3300005834 | Bacteria | 3911 |
| 243 | Ga0068851_10018615 | 3300005834 | Bacteria | 3347 |
| 244 | Ga0068851_10061209 | 3300005834 | Bacteria | 1929 |
| 245 | Ga0068851_10105043 | 3300005834 | Bacteria | 1502 |
| 246 | Ga0068870_10004622 | 3300005840 | Bacteria | 5938 |
| 247 | Ga0068870_10034754 | 3300005840 | Bacteria | 2581 |
| 248 | Ga0068870_10144590 | 3300005840 | Bacteria | 1394 |
| 249 | Ga0068870_10202311 | 3300005840 | Bacteria | 1205 |
| 250 | Ga0068863_100002459 | 3300005841 | Bacteria | 18405 |
| 251 | Ga0068863_100008456 | 3300005841 | Bacteria | 10052 |
| 252 | Ga0068863_100028700 | 3300005841 | Bacteria | 5313 |
| 253 | Ga0068863_100042608 | 3300005841 | Bacteria | 4313 |
| 254 | Ga0068863_100136515 | 3300005841 | Bacteria | 2343 |
| 255 | Ga0068863_100321307 | 3300005841 | Bacteria | 1503 |
| 256 | Ga0068863_100394656 | 3300005841 | Bacteria | 1352 |
| 257 | Ga0068858_100008257 | 3300005842 | Bacteria | 10008 |
| 258 | Ga0068858_100018525 | 3300005842 | Bacteria | 6518 |
| 259 | Ga0068858_100149379 | 3300005842 | Bacteria | 2196 |
| 260 | Ga0068858_100196322 | 3300005842 | Bacteria | 1907 |
| 261 | Ga0068860_100002129 | 3300005843 | Bacteria | 20879 |
| 262 | Ga0068860_100014571 | 3300005843 | Bacteria | 7692 |
| 263 | Ga0068860_100050601 | 3300005843 | Bacteria | 3954 |
| 264 | Ga0068860_100148128 | 3300005843 | Bacteria | 2259 |
| 265 | Ga0068860_100385300 | 3300005843 | Bacteria | 1384 |
| 266 | Ga0068860_100697296 | 3300005843 | Bacteria | 1025 |
| 267 | Ga0068862_100004308 | 3300005844 | Bacteria | 12043 |
| 268 | Ga0068862_100171528 | 3300005844 | Unclassified | 1942 |
| 269 | Ga0075363_100077889 | 3300006048 | Bacteria | 1809 |
| 270 | Ga0075363_100102923 | 3300006048 | Bacteria | 1582 |
| 271 | Ga0075364_10263172 | 3300006051 | Bacteria | 1172 |
| 272 | Ga0075364_10277863 | 3300006051 | Bacteria | 1139 |
| 273 | Ga0075432_10002230 | 3300006058 | Bacteria | 6452 |
| 274 | Ga0075432_10153313 | 3300006058 | Bacteria | 887 |
| 275 | Ga0075362_10007390 | 3300006177 | Bacteria | 4160 |
| 276 | Ga0075362_10035412 | 3300006177 | Bacteria | 2179 |
| 277 | Ga0075362_10094089 | 3300006177 | Bacteria | 1394 |
| 278 | Ga0075362_10146377 | 3300006177 | Bacteria | 1131 |
| 279 | Ga0075367_10006590 | 3300006178 | Bacteria | 5880 |
| 280 | Ga0075367_10021596 | 3300006178 | Bacteria | 3599 |
| 281 | Ga0075367_10039303 | 3300006178 | Bacteria | 2758 |
| 282 | Ga0075369_10010977 | 3300006186 | Bacteria | 3553 |
| 283 | Ga0075366_10006939 | 3300006195 | Bacteria | 6233 |
| 284 | Ga0075366_10018033 | 3300006195 | Bacteria | 4074 |
| 285 | Ga0075366_10034976 | 3300006195 | Bacteria | 2961 |
| 286 | Ga0097621_100016802 | 3300006237 | Bacteria | 5544 |
| 287 | Ga0097621_100102903 | 3300006237 | Bacteria | 2405 |
| 288 | Ga0097621_100133706 | 3300006237 | Bacteria | 2113 |
| 289 | Ga0097621_100191196 | 3300006237 | Bacteria | 1773 |
| 290 | Ga0097621_100206227 | 3300006237 | Bacteria | 1708 |
| 291 | Ga0097621_100369779 | 3300006237 | Bacteria | 1279 |
| 292 | Ga0097621_100670258 | 3300006237 | Unclassified | 953 |
| 293 | Ga0097621_100940884 | 3300006237 | Bacteria | 806 |
| 294 | Ga0075370_10007838 | 3300006353 | Bacteria | 5462 |
| 295 | Ga0075370_10010040 | 3300006353 | Bacteria | 4938 |
| 296 | Ga0075370_10025457 | 3300006353 | Bacteria | 3274 |
| 297 | Ga0075370_10028330 | 3300006353 | Bacteria | 3113 |
| 298 | Ga0075370_10066418 | 3300006353 | Bacteria | 2058 |
| 299 | Ga0075370_10209610 | 3300006353 | Bacteria | 1150 |
| 300 | Ga0075370_10221471 | 3300006353 | Bacteria | 1118 |
| 301 | Ga0068871_100005265 | 3300006358 | Bacteria | 9057 |
| 302 | Ga0068871_100057888 | 3300006358 | Bacteria | 3154 |
| 303 | Ga0068871_100103581 | 3300006358 | Bacteria | 2386 |
| 304 | Ga0068871_100402945 | 3300006358 | Bacteria | 1218 |
| 305 | Ga0068871_100453811 | 3300006358 | Bacteria | 1149 |
| 306 | Ga0068871_100803823 | 3300006358 | Unclassified | 867 |
| 307 | Ga0075434_100114823 | 3300006871 | Bacteria | 2706 |
| 308 | Ga0075434_100655680 | 3300006871 | Bacteria | 1068 |
| 309 | Ga0075429_100031290 | 3300006880 | Bacteria | 4624 |
| 310 | Ga0068865_100122158 | 3300006881 | Unclassified | 1938 |
| 311 | Ga0068865_100140568 | 3300006881 | Bacteria | 1820 |
| 312 | Ga0068865_100363561 | 3300006881 | Bacteria | 1176 |
| 313 | Ga0068865_100379138 | 3300006881 | Bacteria | 1153 |
| 314 | Ga0097620_100005130 | 3300006931 | Bacteria | 13302 |
| 315 | Ga0097620_100020012 | 3300006931 | Bacteria | 6721 |
| 316 | Ga0097620_100179503 | 3300006931 | Bacteria | 2200 |
| 317 | Ga0097620_100300030 | 3300006931 | Unclassified | 1700 |
| 318 | Ga0097620_101327762 | 3300006931 | Bacteria | 793 |
| 319 | Ga0099824_1045242 | 3300006942 | Bacteria | 932 |
| 320 | Ga0099823_1000069 | 3300006944 | Bacteria | 48672 |
| 321 | Ga0099826_10000894 | 3300006948 | Bacteria | 16356 |
| 322 | Ga0099826_10030609 | 3300006948 | Bacteria | 3906 |
| 323 | Ga0075435_100310710 | 3300007076 | Bacteria | 1349 |
| 324 | Ga0105244_10085085 | 3300009036 | Bacteria | 1561 |
| 325 | Ga0105240_10266543 | 3300009093 | Bacteria | 1974 |
| 326 | Ga0105240_10347509 | 3300009093 | Bacteria | 1683 |
| 327 | Ga0111539_10114865 | 3300009094 | Bacteria | 3157 |
| 328 | Ga0105245_10563450 | 3300009098 | Bacteria | 1162 |
| 329 | Ga0105247_10265201 | 3300009101 | Bacteria | 1179 |
| 330 | Ga0105243_10009495 | 3300009148 | Bacteria | 7405 |
| 331 | Ga0105243_10091035 | 3300009148 | Bacteria | 2511 |
| 332 | Ga0105243_10274632 | 3300009148 | Bacteria | 1515 |
| 333 | Ga0105243_10300230 | 3300009148 | Bacteria | 1455 |
| 334 | Ga0105242_10005758 | 3300009176 | Bacteria | 9548 |
| 335 | Ga0105242_10025335 | 3300009176 | Bacteria | 4694 |
| 336 | Ga0105242_10156117 | 3300009176 | Bacteria | 1993 |
| 337 | Ga0105248_10021876 | 3300009177 | Bacteria | 7086 |
| 338 | Ga0105248_10088427 | 3300009177 | Bacteria | 3487 |
| 339 | Ga0105248_10275410 | 3300009177 | Unclassified | 1895 |
| 340 | Ga0105248_10384699 | 3300009177 | Bacteria | 1580 |
| 341 | Ga0105248_10414372 | 3300009177 | Bacteria | 1517 |
| 342 | Ga0105237_10144947 | 3300009545 | Bacteria | 2369 |
| 343 | Ga0105237_10242721 | 3300009545 | Bacteria | 1803 |
| 344 | Ga0105238_10061064 | 3300009551 | Bacteria | 3773 |
| 345 | Ga0105238_10069168 | 3300009551 | Bacteria | 3531 |
| 346 | Ga0105238_10431980 | 3300009551 | Bacteria | 1313 |
| 347 | Ga0105249_10058498 | 3300009553 | Bacteria | 3532 |
| 348 | Ga0105249_10224426 | 3300009553 | Bacteria | 1850 |
| 349 | Ga0105249_10703870 | 3300009553 | Bacteria | 1070 |
| 350 | Ga0105239_10171933 | 3300010375 | Bacteria | 2423 |
| 351 | Ga0105239_10426776 | 3300010375 | Bacteria | 1502 |
| 352 | Ga0105239_10909255 | 3300010375 | Bacteria | 1010 |
| 353 | Ga0105246_10078722 | 3300011119 | Unclassified | 2342 |
| 354 | Ga0105246_10270839 | 3300011119 | Bacteria | 1357 |
| 355 | Ga0105246_10559291 | 3300011119 | Bacteria | 982 |
| 356 | Ga0157373_10001349 | 3300013100 | Bacteria | 18818 |
| 357 | Ga0157373_10030606 | 3300013100 | Bacteria | 3872 |
| 358 | Ga0157373_10043408 | 3300013100 | Bacteria | 3211 |
| 359 | Ga0157373_10245829 | 3300013100 | Bacteria | 1265 |
| 360 | Ga0157371_10000787 | 3300013102 | Bacteria | 36521 |
| 361 | Ga0157371_10154657 | 3300013102 | Bacteria | 1636 |
| 362 | Ga0157371_10393340 | 3300013102 | Bacteria | 1013 |
| 363 | Ga0157370_10011558 | 3300013104 | Bacteria | 9216 |
| 364 | Ga0157370_10016713 | 3300013104 | Bacteria | 7425 |
| 365 | Ga0157370_10045835 | 3300013104 | Bacteria | 4194 |
| 366 | Ga0157370_10263071 | 3300013104 | Bacteria | 1594 |
| 367 | Ga0157369_10002892 | 3300013105 | Bacteria | 20518 |
| 368 | Ga0157374_10272014 | 3300013296 | Bacteria | 1671 |
| 369 | Ga0157378_10009053 | 3300013297 | Bacteria | 8665 |
| 370 | Ga0157378_10030194 | 3300013297 | Bacteria | 4789 |
| 371 | Ga0157378_10081747 | 3300013297 | Bacteria | 2920 |
| 372 | Ga0157378_10139525 | 3300013297 | Bacteria | 2250 |
| 373 | Ga0157378_10680016 | 3300013297 | Bacteria | 1047 |
| 374 | Ga0163162_10067804 | 3300013306 | Bacteria | 3618 |
| 375 | Ga0163162_10141504 | 3300013306 | Bacteria | 2519 |
| 376 | Ga0163162_10182650 | 3300013306 | Bacteria | 2224 |
| 377 | Ga0163162_10184469 | 3300013306 | Bacteria | 2213 |
| 378 | Ga0163162_10320934 | 3300013306 | Bacteria | 1681 |
| 379 | Ga0163162_11565598 | 3300013306 | Bacteria | 751 |
| 380 | Ga0157372_10009210 | 3300013307 | Bacteria | 10496 |
| 381 | Ga0157372_10052329 | 3300013307 | Bacteria | 4546 |
| 382 | Ga0157372_10145117 | 3300013307 | Bacteria | 2737 |
| 383 | Ga0157372_10344546 | 3300013307 | Bacteria | 1736 |
| 384 | Ga0157372_10464124 | 3300013307 | Bacteria | 1476 |
| 385 | Ga0157375_10000781 | 3300013308 | Bacteria | 27817 |
| 386 | Ga0157375_10009140 | 3300013308 | Bacteria | 8684 |
| 387 | Ga0157375_10033977 | 3300013308 | Bacteria | 4853 |
| 388 | Ga0157375_10086926 | 3300013308 | Bacteria | 3178 |
| 389 | Ga0157375_10241803 | 3300013308 | Bacteria | 1965 |
| 390 | Ga0157375_10251633 | 3300013308 | Unclassified | 1928 |
| 391 | Ga0157375_10326415 | 3300013308 | Bacteria | 1699 |
| 392 | Ga0157375_10391763 | 3300013308 | Bacteria | 1556 |
| 393 | Ga0157375_11016383 | 3300013308 | Bacteria | 968 |
| 394 | Ga0163163_10007489 | 3300014325 | Bacteria | 9634 |
| 395 | Ga0163163_10017519 | 3300014325 | Bacteria | 6683 |
| 396 | Ga0163163_10019390 | 3300014325 | Bacteria | 6387 |
| 397 | Ga0163163_10135307 | 3300014325 | Bacteria | 2506 |
| 398 | Ga0163163_10171958 | 3300014325 | Bacteria | 2213 |
| 399 | Ga0163163_10216213 | 3300014325 | Bacteria | 1965 |
| 400 | Ga0163163_10256732 | 3300014325 | Bacteria | 1799 |
| 401 | Ga0157380_10020902 | 3300014326 | Bacteria | 4902 |
| 402 | Ga0157380_10078238 | 3300014326 | Bacteria | 2697 |
| 403 | Ga0157380_10176299 | 3300014326 | Unclassified | 1873 |
| 404 | Ga0182008_10001493 | 3300014497 | Bacteria | 15633 |
| 405 | Ga0182008_10001559 | 3300014497 | Bacteria | 15235 |
| 406 | Ga0182008_10009662 | 3300014497 | Bacteria | 5194 |
| 407 | Ga0182008_10014383 | 3300014497 | Bacteria | 4145 |
| 408 | Ga0182008_10107656 | 3300014497 | Bacteria | 1380 |
| 409 | Ga0157379_10000871 | 3300014968 | Bacteria | 24416 |
| 410 | Ga0157379_10002711 | 3300014968 | Bacteria | 14939 |
| 411 | Ga0157379_10037583 | 3300014968 | Bacteria | 4318 |
| 412 | Ga0157379_10394773 | 3300014968 | Bacteria | 1271 |
| 413 | Ga0157379_10716643 | 3300014968 | Bacteria | 940 |
| 414 | Ga0157376_10022890 | 3300014969 | Bacteria | 4879 |
| 415 | Ga0157376_10148922 | 3300014969 | Bacteria | 2109 |
| 416 | Ga0157376_10347528 | 3300014969 | Bacteria | 1418 |
| 417 | Ga0157376_10497982 | 3300014969 | Bacteria | 1197 |
| 418 | Ga0157376_10564218 | 3300014969 | Bacteria | 1128 |
| 419 | Ga0157376_10815265 | 3300014969 | Bacteria | 947 |
| 420 | Ga0182006_1002058 | 3300015261 | Bacteria | 11278 |
| 421 | Ga0182006_1037727 | 3300015261 | Bacteria | 1914 |
| 422 | Ga0182007_10003158 | 3300015262 | Bacteria | 7896 |
| 423 | Ga0182007_10015862 | 3300015262 | Bacteria | 2795 |
| 424 | Ga0182007_10086993 | 3300015262 | Bacteria | 1028 |
| 425 | Ga0182005_1042169 | 3300015265 | Bacteria | 1240 |
| 426 | Ga0163161_10002188 | 3300017792 | Bacteria | 14097 |
| 427 | Ga0163161_10020791 | 3300017792 | Bacteria | 4608 |
| 428 | Ga0163161_10053505 | 3300017792 | Bacteria | 2928 |
| 429 | Ga0163161_10087107 | 3300017792 | Bacteria | 2306 |
| 430 | Ga0163161_10122246 | 3300017792 | Bacteria | 1957 |
| 431 | Ga0209672_103131 | 3300025228 | Bacteria | 3564 |
| 432 | Ga0209147_100450 | 3300025229 | Bacteria | 25862 |
| 433 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 434 | Ga0209258_107630 | 3300025242 | Bacteria | 1592 |
| 435 | Ga0207425_1007188 | 3300025245 | Bacteria | 2967 |
| 436 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 437 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 438 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 439 | Ga0209565_1000603 | 3300025263 | Bacteria | 24045 |
| 440 | Ga0209565_1006214 | 3300025263 | Bacteria | 3379 |
| 441 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 442 | Ga0209673_1002131 | 3300025273 | Bacteria | 14771 |
| 443 | Ga0209673_1004152 | 3300025273 | Bacteria | 7921 |
| 444 | Ga0209130_1046283 | 3300025284 | Bacteria | 813 |
| 445 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 446 | Ga0209675_1007565 | 3300025291 | Bacteria | 4141 |
| 447 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 448 | Ga0209676_1000317 | 3300025292 | Bacteria | 94105 |
| 449 | Ga0209676_1001130 | 3300025292 | Bacteria | 29344 |
| 450 | Ga0209676_1003633 | 3300025292 | Bacteria | 9273 |
| 451 | Ga0209025_1008081 | 3300025294 | Bacteria | 7659 |
| 452 | Ga0209025_1034891 | 3300025294 | Bacteria | 2285 |
| 453 | Ga0209025_1115608 | 3300025294 | Bacteria | 813 |
| 454 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 455 | Ga0209564_1005094 | 3300025295 | Bacteria | 7653 |
| 456 | Ga0209758_1013950 | 3300025297 | Bacteria | 4324 |
| 457 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 458 | Ga0209050_1000786 | 3300025298 | Bacteria | 45131 |
| 459 | Ga0209050_1001905 | 3300025298 | Bacteria | 19963 |
| 460 | Ga0209256_1001798 | 3300025299 | Bacteria | 20214 |
| 461 | Ga0209256_1001983 | 3300025299 | Bacteria | 18434 |
| 462 | Ga0209256_1004664 | 3300025299 | Bacteria | 8423 |
| 463 | Ga0209256_1007096 | 3300025299 | Bacteria | 5658 |
| 464 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 465 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 466 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 467 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 468 | Ga0209051_1000392 | 3300025303 | Bacteria | 61223 |
| 469 | Ga0209051_1000984 | 3300025303 | Bacteria | 27620 |
| 470 | Ga0209051_1001474 | 3300025303 | Bacteria | 19907 |
| 471 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 472 | Ga0209257_1002615 | 3300025304 | Bacteria | 17418 |
| 473 | Ga0209257_1003276 | 3300025304 | Bacteria | 14140 |
| 474 | Ga0209257_1004781 | 3300025304 | Bacteria | 10096 |
| 475 | Ga0209257_1011209 | 3300025304 | Bacteria | 4356 |
| 476 | Ga0207697_10000102 | 3300025315 | Bacteria | 38762 |
| 477 | Ga0207656_10005124 | 3300025321 | Bacteria | 4610 |
| 478 | Ga0207656_10031148 | 3300025321 | Bacteria | 2208 |
| 479 | Ga0207656_10132904 | 3300025321 | Bacteria | 1167 |
| 480 | Ga0207655_1002097 | 3300025728 | Bacteria | 16711 |
| 481 | Ga0207682_10000165 | 3300025893 | Bacteria | 30318 |
| 482 | Ga0207642_10070692 | 3300025899 | Bacteria | 1660 |
| 483 | Ga0207710_10266071 | 3300025900 | Bacteria | 860 |
| 484 | Ga0207688_10000286 | 3300025901 | Bacteria | 23042 |
| 485 | Ga0207680_10002735 | 3300025903 | Bacteria | 8248 |
| 486 | Ga0207680_10008569 | 3300025903 | Bacteria | 5029 |
| 487 | Ga0207680_10053024 | 3300025903 | Bacteria | 2433 |
| 488 | Ga0207680_10085375 | 3300025903 | Bacteria | 1994 |
| 489 | Ga0207680_10114712 | 3300025903 | Bacteria | 1753 |
| 490 | Ga0207680_10120018 | 3300025903 | Bacteria | 1718 |
| 491 | Ga0207680_10531639 | 3300025903 | Bacteria | 839 |
| 492 | Ga0207647_10101368 | 3300025904 | Unclassified | 1708 |
| 493 | Ga0207645_10000045 | 3300025907 | Bacteria | 85310 |
| 494 | Ga0207645_10000437 | 3300025907 | Bacteria | 34598 |
| 495 | Ga0207645_10037385 | 3300025907 | Bacteria | 3115 |
| 496 | Ga0207645_10159068 | 3300025907 | Bacteria | 1477 |
| 497 | Ga0207643_10001528 | 3300025908 | Bacteria | 13206 |
| 498 | Ga0207643_10030341 | 3300025908 | Bacteria | 3008 |
| 499 | Ga0207643_10172960 | 3300025908 | Bacteria | 1304 |
| 500 | Ga0207695_10287526 | 3300025913 | Bacteria | 1537 |
| 501 | Ga0207671_10126117 | 3300025914 | Bacteria | 1961 |
| 502 | Ga0207671_10204961 | 3300025914 | Bacteria | 1541 |
| 503 | Ga0207660_10157013 | 3300025917 | Bacteria | 1752 |
| 504 | Ga0207660_10447117 | 3300025917 | Unclassified | 1045 |
| 505 | Ga0207662_10006635 | 3300025918 | Bacteria | 6251 |
| 506 | Ga0207657_10006421 | 3300025919 | Bacteria | 12194 |
| 507 | Ga0207657_10027114 | 3300025919 | Bacteria | 5252 |
| 508 | Ga0207657_10027676 | 3300025919 | Bacteria | 5188 |
| 509 | Ga0207649_10005560 | 3300025920 | Bacteria | 6816 |
| 510 | Ga0207649_10036109 | 3300025920 | Bacteria | 2974 |
| 511 | Ga0207649_10167970 | 3300025920 | Bacteria | 1526 |
| 512 | Ga0207652_10096020 | 3300025921 | Unclassified | 2611 |
| 513 | Ga0207681_10006754 | 3300025923 | Bacteria | 7042 |
| 514 | Ga0207681_10030082 | 3300025923 | Bacteria | 3537 |
| 515 | Ga0207681_10089930 | 3300025923 | Unclassified | 2190 |
| 516 | Ga0207681_10090369 | 3300025923 | Bacteria | 2185 |
| 517 | Ga0207681_10183315 | 3300025923 | Unclassified | 1596 |
| 518 | Ga0207681_10244260 | 3300025923 | Bacteria | 1399 |
| 519 | Ga0207694_10181287 | 3300025924 | Bacteria | 1708 |
| 520 | Ga0207694_10301474 | 3300025924 | Bacteria | 1319 |
| 521 | Ga0207650_10002517 | 3300025925 | Bacteria | 12722 |
| 522 | Ga0207650_10047981 | 3300025925 | Bacteria | 3148 |
| 523 | Ga0207650_10051055 | 3300025925 | Bacteria | 3060 |
| 524 | Ga0207650_10067025 | 3300025925 | Bacteria | 2693 |
| 525 | Ga0207650_10128554 | 3300025925 | Bacteria | 1980 |
| 526 | Ga0207659_10001999 | 3300025926 | Bacteria | 12077 |
| 527 | Ga0207659_10157041 | 3300025926 | Bacteria | 1782 |
| 528 | Ga0207687_10881181 | 3300025927 | Bacteria | 765 |
| 529 | Ga0207644_10009310 | 3300025931 | Bacteria | 6447 |
| 530 | Ga0207644_10009759 | 3300025931 | Bacteria | 6311 |
| 531 | Ga0207644_10098476 | 3300025931 | Bacteria | 2192 |
| 532 | Ga0207644_10182744 | 3300025931 | Bacteria | 1644 |
| 533 | Ga0207644_10297098 | 3300025931 | Bacteria | 1300 |
| 534 | Ga0207644_10378861 | 3300025931 | Bacteria | 1153 |
| 535 | Ga0207690_10000485 | 3300025932 | Bacteria | 25649 |
| 536 | Ga0207690_10665547 | 3300025932 | Unclassified | 854 |
| 537 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 538 | Ga0207706_10000774 | 3300025933 | Bacteria | 33156 |
| 539 | Ga0207706_10070215 | 3300025933 | Bacteria | 3081 |
| 540 | Ga0207706_10074987 | 3300025933 | Bacteria | 2974 |
| 541 | Ga0207706_10234349 | 3300025933 | Bacteria | 1605 |
| 542 | Ga0207686_10028152 | 3300025934 | Bacteria | 3300 |
| 543 | Ga0207686_10497364 | 3300025934 | Bacteria | 945 |
| 544 | Ga0207709_10000955 | 3300025935 | Bacteria | 21620 |
| 545 | Ga0207709_10002740 | 3300025935 | Bacteria | 10864 |
| 546 | Ga0207709_10132097 | 3300025935 | Bacteria | 1703 |
| 547 | Ga0207670_10342238 | 3300025936 | Bacteria | 1182 |
| 548 | Ga0207669_10003418 | 3300025937 | Bacteria | 6867 |
| 549 | Ga0207669_10072813 | 3300025937 | Bacteria | 2165 |
| 550 | Ga0207704_10039976 | 3300025938 | Bacteria | 2737 |
| 551 | Ga0207691_10000279 | 3300025940 | Bacteria | 50526 |
| 552 | Ga0207691_10019010 | 3300025940 | Bacteria | 6507 |
| 553 | Ga0207691_10034391 | 3300025940 | Bacteria | 4712 |
| 554 | Ga0207691_10048202 | 3300025940 | Bacteria | 3907 |
| 555 | Ga0207691_10086305 | 3300025940 | Bacteria | 2816 |
| 556 | Ga0207691_10477071 | 3300025940 | Bacteria | 1060 |
| 557 | Ga0207711_10059109 | 3300025941 | Bacteria | 3301 |
| 558 | Ga0207711_10143534 | 3300025941 | Bacteria | 2149 |
| 559 | Ga0207689_10000258 | 3300025942 | Bacteria | 47518 |
| 560 | Ga0207689_10000356 | 3300025942 | Bacteria | 42960 |
| 561 | Ga0207689_10030686 | 3300025942 | Bacteria | 4479 |
| 562 | Ga0207689_10506489 | 3300025942 | Unclassified | 1012 |
| 563 | Ga0207689_10528683 | 3300025942 | Bacteria | 989 |
| 564 | Ga0207661_10289401 | 3300025944 | Bacteria | 1466 |
| 565 | Ga0207679_10007168 | 3300025945 | Bacteria | 7061 |
| 566 | Ga0207679_10021574 | 3300025945 | Bacteria | 4369 |
| 567 | Ga0207679_10091838 | 3300025945 | Unclassified | 2350 |
| 568 | Ga0207679_10349099 | 3300025945 | Bacteria | 1289 |
| 569 | Ga0207679_10461456 | 3300025945 | Bacteria | 1128 |
| 570 | Ga0207667_10004129 | 3300025949 | Bacteria | 17847 |
| 571 | Ga0207667_10303021 | 3300025949 | Bacteria | 1633 |
| 572 | Ga0207651_10002260 | 3300025960 | Bacteria | 9148 |
| 573 | Ga0207651_10004733 | 3300025960 | Bacteria | 6915 |
| 574 | Ga0207651_10158122 | 3300025960 | Bacteria | 1773 |
| 575 | Ga0207651_10326950 | 3300025960 | Bacteria | 1283 |
| 576 | Ga0207651_10508839 | 3300025960 | Bacteria | 1042 |
| 577 | Ga0207712_10529287 | 3300025961 | Unclassified | 1011 |
| 578 | Ga0207668_10002332 | 3300025972 | Bacteria | 11091 |
| 579 | Ga0207668_10004878 | 3300025972 | Bacteria | 7893 |
| 580 | Ga0207668_10068451 | 3300025972 | Bacteria | 2524 |
| 581 | Ga0207668_10108435 | 3300025972 | Bacteria | 2078 |
| 582 | Ga0207668_10539384 | 3300025972 | Bacteria | 1009 |
| 583 | Ga0207640_10004855 | 3300025981 | Bacteria | 7301 |
| 584 | Ga0207640_10077818 | 3300025981 | Bacteria | 2256 |
| 585 | Ga0207640_10167070 | 3300025981 | Bacteria | 1635 |
| 586 | Ga0207640_10451727 | 3300025981 | Bacteria | 1059 |
| 587 | Ga0207658_10006421 | 3300025986 | Bacteria | 8026 |
| 588 | Ga0207658_10012186 | 3300025986 | Bacteria | 5866 |
| 589 | Ga0207658_10021840 | 3300025986 | Bacteria | 4449 |
| 590 | Ga0207658_10032895 | 3300025986 | Bacteria | 3695 |
| 591 | Ga0207658_10038643 | 3300025986 | Bacteria | 3440 |
| 592 | Ga0207658_10102385 | 3300025986 | Unclassified | 2246 |
| 593 | Ga0207658_10360044 | 3300025986 | Bacteria | 1269 |
| 594 | Ga0207658_10474753 | 3300025986 | Bacteria | 1110 |
| 595 | Ga0207677_10003411 | 3300026023 | Bacteria | 8420 |
| 596 | Ga0207677_10124469 | 3300026023 | Bacteria | 1945 |
| 597 | Ga0207677_10296732 | 3300026023 | Bacteria | 1333 |
| 598 | Ga0207677_10311076 | 3300026023 | Bacteria | 1305 |
| 599 | Ga0207703_10002766 | 3300026035 | Bacteria | 15021 |
| 600 | Ga0207703_10026514 | 3300026035 | Bacteria | 4562 |
| 601 | Ga0207703_10059806 | 3300026035 | Bacteria | 3113 |
| 602 | Ga0207703_10453555 | 3300026035 | Unclassified | 1198 |
| 603 | Ga0207639_10002492 | 3300026041 | Bacteria | 12339 |
| 604 | Ga0207639_10058518 | 3300026041 | Bacteria | 2965 |
| 605 | Ga0207639_10116562 | 3300026041 | Bacteria | 2187 |
| 606 | Ga0207639_10483254 | 3300026041 | Bacteria | 1129 |
| 607 | Ga0207678_10017290 | 3300026067 | Bacteria | 6331 |
| 608 | Ga0207678_10074000 | 3300026067 | Unclassified | 2919 |
| 609 | Ga0207678_10269352 | 3300026067 | Bacteria | 1460 |
| 610 | Ga0207708_10000864 | 3300026075 | Bacteria | 22828 |
| 611 | Ga0207708_10080168 | 3300026075 | Bacteria | 2509 |
| 612 | Ga0207708_10367729 | 3300026075 | Bacteria | 1183 |
| 613 | Ga0207702_10000523 | 3300026078 | Bacteria | 43069 |
| 614 | Ga0207702_10013354 | 3300026078 | Bacteria | 6830 |
| 615 | Ga0207641_10004011 | 3300026088 | Bacteria | 12845 |
| 616 | Ga0207641_10024408 | 3300026088 | Bacteria | 4984 |
| 617 | Ga0207641_10035790 | 3300026088 | Bacteria | 4140 |
| 618 | Ga0207641_10037009 | 3300026088 | Bacteria | 4074 |
| 619 | Ga0207641_10064970 | 3300026088 | Bacteria | 3120 |
| 620 | Ga0207641_10272864 | 3300026088 | Bacteria | 1587 |
| 621 | Ga0207641_10304160 | 3300026088 | Bacteria | 1507 |
| 622 | Ga0207648_10000667 | 3300026089 | Bacteria | 38445 |
| 623 | Ga0207648_10001435 | 3300026089 | Bacteria | 26241 |
| 624 | Ga0207648_10028568 | 3300026089 | Bacteria | 4944 |
| 625 | Ga0207648_10048370 | 3300026089 | Bacteria | 3723 |
| 626 | Ga0207648_10065432 | 3300026089 | Bacteria | 3169 |
| 627 | Ga0207648_10760263 | 3300026089 | Unclassified | 900 |
| 628 | Ga0207676_10004021 | 3300026095 | Bacteria | 10378 |
| 629 | Ga0207676_10009106 | 3300026095 | Bacteria | 7070 |
| 630 | Ga0207676_10017450 | 3300026095 | Bacteria | 5202 |
| 631 | Ga0207676_10027357 | 3300026095 | Bacteria | 4246 |
| 632 | Ga0207676_10077358 | 3300026095 | Bacteria | 2691 |
| 633 | Ga0207676_10336916 | 3300026095 | Bacteria | 1390 |
| 634 | Ga0207676_10414567 | 3300026095 | Bacteria | 1262 |
| 635 | Ga0207676_10627973 | 3300026095 | Bacteria | 1034 |
| 636 | Ga0207676_10773242 | 3300026095 | Bacteria | 935 |
| 637 | Ga0207674_10023530 | 3300026116 | Bacteria | 6596 |
| 638 | Ga0207674_10067282 | 3300026116 | Bacteria | 3607 |
| 639 | Ga0207674_10219375 | 3300026116 | Bacteria | 1850 |
| 640 | Ga0207674_10396910 | 3300026116 | Unclassified | 1333 |
| 641 | Ga0207674_10805160 | 3300026116 | Bacteria | 907 |
| 642 | Ga0207675_100002057 | 3300026118 | Bacteria | 20074 |
| 643 | Ga0207675_100007608 | 3300026118 | Bacteria | 10236 |
| 644 | Ga0207675_100023959 | 3300026118 | Bacteria | 5674 |
| 645 | Ga0207675_100032799 | 3300026118 | Bacteria | 4839 |
| 646 | Ga0207675_100151102 | 3300026118 | Bacteria | 2210 |
| 647 | Ga0207675_100151553 | 3300026118 | Bacteria | 2207 |
| 648 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 649 | Ga0207683_10003717 | 3300026121 | Bacteria | 13244 |
| 650 | Ga0207683_10004027 | 3300026121 | Bacteria | 12710 |
| 651 | Ga0207683_10005506 | 3300026121 | Bacteria | 10851 |
| 652 | Ga0207683_10027372 | 3300026121 | Bacteria | 4926 |
| 653 | Ga0207683_10220513 | 3300026121 | Bacteria | 1728 |
| 654 | Ga0207698_10058979 | 3300026142 | Bacteria | 2978 |
| 655 | Ga0207698_10063574 | 3300026142 | Unclassified | 2889 |
| 656 | Ga0207698_10128256 | 3300026142 | Bacteria | 2162 |
| 657 | Ga0207698_10188136 | 3300026142 | Bacteria | 1836 |
| 658 | Ga0207698_10240502 | 3300026142 | Bacteria | 1650 |
| 659 | Ga0207698_10389250 | 3300026142 | Bacteria | 1329 |
| 660 | Ga0207698_10716584 | 3300026142 | Bacteria | 997 |
| 661 | Ga0207698_10960517 | 3300026142 | Unclassified | 864 |
| 662 | Ga0209973_1000393 | 3300027252 | Bacteria | 3236 |
| 663 | Ga0209389_1000460 | 3300027296 | Bacteria | 24402 |
| 664 | Ga0209371_1017622 | 3300027312 | Bacteria | 1844 |
| 665 | Ga0209970_1001507 | 3300027614 | Bacteria | 4060 |
| 666 | Ga0209970_1021239 | 3300027614 | Unclassified | 1099 |
| 667 | Ga0209983_1001514 | 3300027665 | Bacteria | 5159 |
| 668 | Ga0209282_1000362 | 3300027666 | Bacteria | 22248 |
| 669 | Ga0209966_1021715 | 3300027695 | Unclassified | 1250 |
| 670 | Ga0209998_10023613 | 3300027717 | Bacteria | 1330 |
| 671 | Ga0209974_10001817 | 3300027876 | Bacteria | 7780 |
| 672 | Ga0209974_10015348 | 3300027876 | Unclassified | 2542 |
| 673 | Ga0209974_10017806 | 3300027876 | Unclassified | 2355 |
| 674 | Ga0209974_10039174 | 3300027876 | Bacteria | 1576 |
| 675 | Ga0268266_10006480 | 3300028379 | Bacteria | 10714 |
| 676 | Ga0268266_10092762 | 3300028379 | Bacteria | 2650 |
| 677 | Ga0268266_10194128 | 3300028379 | Bacteria | 1855 |
| 678 | Ga0268266_10450444 | 3300028379 | Bacteria | 1223 |
| 679 | Ga0268265_10018243 | 3300028380 | Bacteria | 4860 |
| 680 | Ga0268265_10172771 | 3300028380 | Bacteria | 1849 |
| 681 | Ga0268265_10237539 | 3300028380 | Bacteria | 1606 |
| 682 | Ga0268265_10572170 | 3300028380 | Bacteria | 1075 |
| 683 | Ga0268264_10003471 | 3300028381 | Bacteria | 13596 |
| 684 | Ga0268264_10017610 | 3300028381 | Bacteria | 5850 |
| 685 | Ga0268264_10054237 | 3300028381 | Bacteria | 3347 |
| 686 | Ga0268264_10320925 | 3300028381 | Bacteria | 1464 |
| 687 | Ga0268264_10448102 | 3300028381 | Bacteria | 1250 |
| 688 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 689 | Ga0307515_10072181 | 3300028794 | Bacteria | 4665 |
| 690 | Ga0268256_1019642 | 3300030500 | Bacteria | 1844 |
| 691 | Ga0316177_1131827 | 3300030731 | Bacteria | 7049 |
| 692 | Ga0316176_1054729 | 3300030732 | Bacteria | 5067 |
| 693 | Ga0316178_1095890 | 3300030735 | Bacteria | 1853 |
| 694 | Ga0316180_1144680 | 3300030736 | Bacteria | 2019 |
| 695 | Ga0316183_1018820 | 3300030742 | Bacteria | 5208 |
| 696 | Ga0316181_1035092 | 3300030744 | Bacteria | 2015 |
| 697 | Ga0316182_1051023 | 3300030745 | Bacteria | 932 |
| 698 | Ga0265330_10002123 | 3300031235 | Bacteria | 10941 |
| 699 | Ga0265332_10001981 | 3300031238 | Bacteria | 10776 |
| 700 | Ga0265329_10003194 | 3300031242 | Bacteria | 7202 |
| 701 | Ga0265331_10003705 | 3300031250 | Bacteria | 9722 |
| 702 | Ga0265327_10003393 | 3300031251 | Bacteria | 15305 |
| 703 | Ga0265327_10006673 | 3300031251 | Bacteria | 9152 |
| 704 | Ga0265327_10021540 | 3300031251 | Bacteria | 3886 |
| 705 | Ga0265316_10018501 | 3300031344 | Bacteria | 5984 |
| 706 | Ga0307513_10000029 | 3300031456 | Bacteria | 191823 |
| 707 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 708 | Ga0307513_10006829 | 3300031456 | Bacteria | 14871 |
| 709 | Ga0307513_10123040 | 3300031456 | Bacteria | 2556 |
| 710 | Ga0307408_100000795 | 3300031548 | Bacteria | 25277 |
| 711 | Ga0307408_100009486 | 3300031548 | Bacteria | 6419 |
| 712 | Ga0307408_100028947 | 3300031548 | Bacteria | 3832 |
| 713 | Ga0307408_100044047 | 3300031548 | Bacteria | 3178 |
| 714 | Ga0307408_100045466 | 3300031548 | Bacteria | 3136 |
| 715 | Ga0307408_100391752 | 3300031548 | Bacteria | 1190 |
| 716 | Ga0265313_10054495 | 3300031595 | Unclassified | 1899 |
| 717 | Ga0307514_10003041 | 3300031649 | Bacteria | 16567 |
| 718 | Ga0307514_10015687 | 3300031649 | Bacteria | 6244 |
| 719 | Ga0265342_10006293 | 3300031712 | Bacteria | 8857 |
| 720 | Ga0307516_10001817 | 3300031730 | Bacteria | 29320 |
| 721 | Ga0307405_10000854 | 3300031731 | Bacteria | 12026 |
| 722 | Ga0307405_10001567 | 3300031731 | Bacteria | 9702 |
| 723 | Ga0307405_10155217 | 3300031731 | Bacteria | 1614 |
| 724 | Ga0307413_10003751 | 3300031824 | Bacteria | 6466 |
| 725 | Ga0307413_10013062 | 3300031824 | Bacteria | 4157 |
| 726 | Ga0307413_10259491 | 3300031824 | Bacteria | 1294 |
| 727 | Ga0307410_10000388 | 3300031852 | Bacteria | 17310 |
| 728 | Ga0307410_10085331 | 3300031852 | Bacteria | 2228 |
| 729 | Ga0307410_10226403 | 3300031852 | Bacteria | 1441 |
| 730 | Ga0307410_10307788 | 3300031852 | Bacteria | 1252 |
| 731 | Ga0307406_10001760 | 3300031901 | Bacteria | 11860 |
| 732 | Ga0307406_10002039 | 3300031901 | Bacteria | 11025 |
| 733 | Ga0307406_10005261 | 3300031901 | Bacteria | 7073 |
| 734 | Ga0307406_10014344 | 3300031901 | Bacteria | 4557 |
| 735 | Ga0307406_10091731 | 3300031901 | Bacteria | 2047 |
| 736 | Ga0307406_10260293 | 3300031901 | Bacteria | 1312 |
| 737 | Ga0307407_10008540 | 3300031903 | Bacteria | 4710 |
| 738 | Ga0307407_10016334 | 3300031903 | Bacteria | 3694 |
| 739 | Ga0307412_10001020 | 3300031911 | Bacteria | 16024 |
| 740 | Ga0307412_10007471 | 3300031911 | Bacteria | 6200 |
| 741 | Ga0307412_10057513 | 3300031911 | Bacteria | 2596 |
| 742 | Ga0307412_10136298 | 3300031911 | Bacteria | 1791 |
| 743 | Ga0307412_10175396 | 3300031911 | Bacteria | 1606 |
| 744 | Ga0307412_10310861 | 3300031911 | Bacteria | 1249 |
| 745 | Ga0307409_100000380 | 3300031995 | Bacteria | 18816 |
| 746 | Ga0307409_100013393 | 3300031995 | Bacteria | 5276 |
| 747 | Ga0307409_100130234 | 3300031995 | Bacteria | 2148 |
| 748 | Ga0307409_101000689 | 3300031995 | Bacteria | 854 |
| 749 | Ga0307416_100016007 | 3300032002 | Bacteria | 5198 |
| 750 | Ga0307416_100236630 | 3300032002 | Bacteria | 1765 |
| 751 | Ga0307416_101288601 | 3300032002 | Unclassified | 836 |
| 752 | Ga0307414_10002583 | 3300032004 | Bacteria | 9532 |
| 753 | Ga0307414_10040606 | 3300032004 | Bacteria | 3144 |
| 754 | Ga0307414_10117931 | 3300032004 | Bacteria | 2035 |
| 755 | Ga0307414_10159379 | 3300032004 | Bacteria | 1790 |
| 756 | Ga0307411_10000093 | 3300032005 | Bacteria | 27213 |
| 757 | Ga0307411_10000235 | 3300032005 | Bacteria | 18066 |
| 758 | Ga0307411_10250348 | 3300032005 | Bacteria | 1392 |
| 759 | Ga0307415_100000580 | 3300032126 | Bacteria | 16031 |
| 760 | Ga0307415_100019465 | 3300032126 | Bacteria | 4122 |
| 761 | Ga0373948_0024625 | 3300034817 | Bacteria | 1176 |
| 762 | Ga0373952_0001218 | 3300035092 | Bacteria | 4679 |
| 763 | Ga0373952_0044599 | 3300035092 | Bacteria | 1037 |
| 764 | Ga0373923_0092136 | 3300035111 | Bacteria | 1327 |
| 765 | Ga0373957_0185065 | 3300035120 | Bacteria | 864 |
| 766 | Ga0373955_0213488 | 3300035172 | Bacteria | 1151 |
| 767 | Ga0373955_0323253 | 3300035172 | Bacteria | 932 |
| 768 | Ga0373924_0091205 | 3300035410 | Bacteria | 1304 |
| 769 | Ga0373931_0111404 | 3300035691 | Bacteria | 1553 |
| 770 | Ga0373935_0389151 | 3300035692 | Bacteria | 999 |
| 771 | Ga0373933_0279409 | 3300035724 | Bacteria | 1079 |
| 772 | Ga0373937_0022215 | 3300036401 | Bacteria | 5702 |
| 773 | Ga0373937_0080973 | 3300036401 | Bacteria | 3004 |
| 774 | Ga0373937_0246627 | 3300036401 | Bacteria | 1683 |
| 775 | Ga0373925_0080141 | 3300037068 | Bacteria | 2481 |
| 776 | Ga0395898_0010634 | 3300037466 | Bacteria | 9612 |
| 777 | Ga0395901_0404985 | 3300038443 | Bacteria | 1401 |
| 778 | Ga0439436_0000549 | 3300041404 | Bacteria | 9884 |
| 779 | Ga0439438_042041 | 3300041405 | Bacteria | 1183 |
| 780 | Ga0439439_0002668 | 3300041406 | Bacteria | 3821 |
| 781 | Ga0439439_0026041 | 3300041406 | Bacteria | 1472 |
| 782 | Ga0439461_0046482 | 3300041410 | Bacteria | 951 |
| 783 | Ga0439466_0002413 | 3300041411 | Bacteria | 7333 |
| 784 | Ga0439465_0018186 | 3300041413 | Bacteria | 2196 |
| 785 | Ga0451789_0108685 | 3300041443 | Bacteria | 940 |
| 786 | Ga0451791_0536485 | 3300041451 | Bacteria | 1402 |
| 787 | Ga0451793_0083951 | 3300041452 | Bacteria | 1277 |
| 788 | Ga0451807_1548440 | 3300041486 | Bacteria | 972 |
| 789 | Ga0451833_1230188 | 3300041491 | Bacteria | 1189 |
| 790 | Ga0451853_2647754 | 3300041512 | Bacteria | 1823 |
| 791 | Ga0439433_0004489 | 3300041999 | Bacteria | 3004 |
| 792 | Ga0439433_0010895 | 3300041999 | Bacteria | 1988 |
| 793 | Ga0439442_019309 | 3300042002 | Bacteria | 1410 |
| 794 | Ga0439445_0002343 | 3300042004 | Bacteria | 4211 |
| 795 | Ga0439445_0032560 | 3300042004 | Bacteria | 1359 |
| 796 | Ga0439432_006747 | 3300042006 | Bacteria | 4088 |
| 797 | Ga0439432_016399 | 3300042006 | Bacteria | 2493 |
| 798 | Ga0439432_042946 | 3300042006 | Bacteria | 1428 |
| 799 | Ga0439449_0000718 | 3300042007 | Bacteria | 12673 |
| 800 | Ga0439449_0001501 | 3300042007 | Bacteria | 9140 |
| 801 | Ga0439452_001555 | 3300042010 | Bacteria | 9199 |
| 802 | Ga0439452_042579 | 3300042010 | Bacteria | 1063 |
| 803 | Ga0439454_010708 | 3300042011 | Bacteria | 1213 |
| 804 | Ga0439457_005434 | 3300042014 | Bacteria | 3209 |
| 805 | Ga0439462_0000171 | 3300042015 | Bacteria | 10896 |
| 806 | Ga0439462_0006709 | 3300042015 | Bacteria | 2871 |
| 807 | Ga0450911_000644 | 3300042115 | Bacteria | 10463 |
| 808 | Ga0450921_001550 | 3300042123 | Bacteria | 1409 |
| 809 | Ga0450921_006309 | 3300042123 | Bacteria | 919 |
| 810 | Ga0450923_002679 | 3300042125 | Bacteria | 2587 |
| 811 | Ga0450923_014989 | 3300042125 | Bacteria | 1444 |
| 812 | Ga0450890_007040 | 3300042127 | Bacteria | 1434 |
| 813 | Ga0450894_003448 | 3300042131 | Bacteria | 2067 |
| 814 | Ga0450905_017413 | 3300042142 | Bacteria | 1042 |
| 815 | Ga0450906_005728 | 3300042145 | Bacteria | 2537 |
| 816 | Ga0450906_029529 | 3300042145 | Bacteria | 969 |
| 817 | Ga0439446_0001776 | 3300042156 | Bacteria | 5026 |
| 818 | Ga0450908_013237 | 3300042184 | Bacteria | 1489 |
| 819 | Ga0450909_000723 | 3300042185 | Bacteria | 4442 |
| 820 | Ga0450909_028578 | 3300042185 | Bacteria | 843 |
| 821 | Ga0439434_0002712 | 3300042435 | Bacteria | 5156 |
| 822 | Ga0439434_0021261 | 3300042435 | Bacteria | 1949 |
| 823 | Ga0439434_0043207 | 3300042435 | Bacteria | 1386 |
| 824 | Ga0439444_0032122 | 3300042437 | Bacteria | 991 |
| 825 | Ga0439459_0001027 | 3300042438 | Bacteria | 3979 |
| 826 | Ga0439459_0016864 | 3300042438 | Bacteria | 1354 |
| 827 | Ga0466965_0146971 | 3300044683 | Bacteria | 1230 |
| 828 | Ga0466963_0137690 | 3300044694 | Bacteria | 1690 |
| 829 | Ga0466960_0008038 | 3300044901 | Bacteria | 4307 |
| 830 | Ga0495627_005263 | 3300046453 | Bacteria | 5242 |
| 831 | Ga0495638_0039490 | 3300046460 | Bacteria | 2996 |
| 832 | Ga0495639_0066058 | 3300046475 | Bacteria | 1664 |
| 833 | Ga0495616_0002386 | 3300046513 | Bacteria | 12503 |
| 834 | Ga0495620_0008396 | 3300046515 | Bacteria | 5550 |
| 835 | Ga0495620_0043110 | 3300046515 | Bacteria | 1967 |
| 836 | Ga0495631_0003838 | 3300046518 | Bacteria | 8146 |
| 837 | Ga0495637_0007697 | 3300046520 | Bacteria | 5328 |
| 838 | Ga0495637_0066254 | 3300046520 | Bacteria | 1468 |
| 839 | Ga0495643_0017713 | 3300046522 | Bacteria | 4158 |
| 840 | Ga0495663_0125654 | 3300046525 | Bacteria | 861 |
| 841 | Ga0495642_0074367 | 3300046528 | Bacteria | 1424 |
| 842 | Ga0495654_0029156 | 3300046530 | Bacteria | 2816 |
| 843 | Ga0495654_0216126 | 3300046530 | Bacteria | 813 |
| 844 | Ga0495598_0089592 | 3300046537 | Bacteria | 1001 |
| 845 | Ga0495621_0004441 | 3300046539 | Bacteria | 3945 |
| 846 | Ga0495621_0027512 | 3300046539 | Bacteria | 1926 |
| 847 | Ga0495622_0021877 | 3300046557 | Bacteria | 2979 |
| 848 | Ga0495633_0001069 | 3300046558 | Bacteria | 22144 |
| 849 | Ga0495667_0338377 | 3300046559 | Bacteria | 952 |
| 850 | Ga0495656_0000173 | 3300046615 | Bacteria | 22836 |
| 851 | Ga0495625_0001007 | 3300046660 | Bacteria | 37199 |
| 852 | Ga0495625_0069985 | 3300046660 | Bacteria | 2464 |
| 853 | Ga0495625_0112354 | 3300046660 | Bacteria | 1861 |
| 854 | Ga0495661_0084956 | 3300046665 | Bacteria | 1815 |
| 855 | Ga0495588_0015532 | 3300046674 | Bacteria | 3666 |
| 856 | Ga0495599_0230575 | 3300046678 | Bacteria | 1131 |
| 857 | Ga0495624_0146923 | 3300046690 | Bacteria | 1443 |
| 858 | Ga0495670_0053506 | 3300046691 | Bacteria | 2022 |
| 859 | Ga0495671_0024654 | 3300046692 | Bacteria | 3130 |
| 860 | Ga0495676_0030589 | 3300047321 | Bacteria | 4565 |
| 861 | Ga0495685_024705 | 3300047447 | Bacteria | 2068 |
| 862 | Ga0495593_0053810 | 3300047673 | Bacteria | 2123 |
| 863 | Ga0495593_0121852 | 3300047673 | Bacteria | 1327 |
| 864 | Ga0495614_0006224 | 3300048089 | Bacteria | 5362 |
| 865 | Ga0495615_0004467 | 3300048090 | Bacteria | 2445 |
| 866 | Ga0496100_0109502 | 3300048903 | Bacteria | 1916 |
| 867 | Ga0496100_0141066 | 3300048903 | Bacteria | 1708 |
| 868 | Ga0496101_0008759 | 3300048904 | Bacteria | 6620 |
| 869 | Ga0496101_0115314 | 3300048904 | Unclassified | 2026 |
| 870 | Ga0496102_0009515 | 3300048905 | Bacteria | 8355 |
| 871 | Ga0496102_0014776 | 3300048905 | Bacteria | 6790 |
| 872 | Ga0496102_0033317 | 3300048905 | Bacteria | 4628 |
| 873 | Ga0496103_0139926 | 3300048906 | Bacteria | 1547 |
| 874 | Ga0496103_0144151 | 3300048906 | Bacteria | 1524 |
| 875 | Ga0496104_0036397 | 3300048907 | Bacteria | 4601 |
| 876 | Ga0496104_0281717 | 3300048907 | Bacteria | 1575 |
| 877 | Ga0496105_0008753 | 3300048908 | Bacteria | 7876 |
| 878 | Ga0496105_0105152 | 3300048908 | Bacteria | 2330 |
| 879 | Ga0496105_0239505 | 3300048908 | Bacteria | 1473 |
| 880 | Ga0496106_0002076 | 3300048909 | Bacteria | 15006 |
| 881 | Ga0496106_0066014 | 3300048909 | Bacteria | 2755 |
| 882 | Ga0496106_0083861 | 3300048909 | Bacteria | 2451 |
| 883 | Ga0496107_0037822 | 3300048910 | Unclassified | 3464 |
| 884 | Ga0496107_0178773 | 3300048910 | Bacteria | 1575 |
| 885 | Ga0496107_0537095 | 3300048910 | Bacteria | 866 |
| 886 | Ga0496107_0627113 | 3300048910 | Bacteria | 793 |
| 887 | Ga0496108_0114058 | 3300048911 | Bacteria | 2313 |
| 888 | Ga0496108_0191551 | 3300048911 | Bacteria | 1772 |
| 889 | Ga0496109_0081831 | 3300048912 | Bacteria | 2975 |
| 890 | Ga0496109_0348468 | 3300048912 | Bacteria | 1399 |
| 891 | Ga0496109_0489352 | 3300048912 | Unclassified | 1161 |
| 892 | Ga0496110_0011634 | 3300048913 | Bacteria | 7215 |
| 893 | Ga0496110_0261858 | 3300048913 | Bacteria | 1574 |
| 894 | Ga0496111_0120593 | 3300048914 | Bacteria | 1937 |
| 895 | Ga0496111_0653545 | 3300048914 | Bacteria | 767 |
| 896 | Ga0496112_0002911 | 3300048915 | Bacteria | 13933 |
| 897 | Ga0496112_0124087 | 3300048915 | Bacteria | 2553 |
| 898 | Ga0496114_0098988 | 3300048917 | Bacteria | 2487 |
| 899 | Ga0496117_0023008 | 3300048920 | Bacteria | 4982 |
| 900 | Ga0496117_0030845 | 3300048920 | Bacteria | 4104 |
| 901 | Ga0496118_0012382 | 3300048921 | Bacteria | 8196 |
| 902 | Ga0496118_0013172 | 3300048921 | Bacteria | 7846 |
| 903 | Ga0496121_0035725 | 3300048924 | Bacteria | 4446 |
| 904 | Ga0496122_0038114 | 3300048925 | Bacteria | 3857 |
| 905 | Ga0496122_0055704 | 3300048925 | Bacteria | 2955 |
| 906 | Ga0496122_0181182 | 3300048925 | Bacteria | 1256 |
| 907 | Ga0496122_0268808 | 3300048925 | Bacteria | 941 |
| 908 | Ga0496123_0086477 | 3300048926 | Bacteria | 1880 |
| 909 | Ga0496123_0114023 | 3300048926 | Bacteria | 1538 |
| 910 | Ga0496123_0133230 | 3300048926 | Bacteria | 1372 |
| 911 | Ga0496124_0095575 | 3300048927 | Bacteria | 2415 |
| 912 | Ga0496124_0097393 | 3300048927 | Bacteria | 2388 |
| 913 | Ga0496124_0176589 | 3300048927 | Bacteria | 1648 |
| 914 | Ga0496124_0239005 | 3300048927 | Bacteria | 1352 |
| 915 | Ga0496125_0019249 | 3300048928 | Bacteria | 6447 |
| 916 | Ga0496125_0025807 | 3300048928 | Bacteria | 5371 |
| 917 | Ga0496125_0037448 | 3300048928 | Bacteria | 4217 |
| 918 | Ga0496125_0053548 | 3300048928 | Bacteria | 3306 |
| 919 | Ga0496125_0111091 | 3300048928 | Bacteria | 1985 |
| 920 | Ga0496126_0106125 | 3300048929 | Bacteria | 2452 |
| 921 | Ga0501039_0789557 | 3300049575 | Bacteria | 741 |
| 922 | Ga0501209_004018 | 3300049656 | Bacteria | 2501 |
| 923 | Ga0501262_000071 | 3300049759 | Bacteria | 12483 |
| 924 | nmdc:mga03683_10580_c1 | 3300050489 | Bacteria | 3312 |
| 925 | nmdc:mga03683_1511_c2 | 3300050489 | Bacteria | 5935 |
| 926 | nmdc:mga03n38_32329_c1 | 3300050490 | Bacteria | 2216 |
| 927 | nmdc:mga03n38_60683_c1 | 3300050490 | Bacteria | 1720 |
| 928 | nmdc:mga0k408_15116_c1 | 3300050493 | Bacteria | 4266 |
| 929 | nmdc:mga0k408_50285_c1 | 3300050493 | Bacteria | 2413 |
| 930 | nmdc:mga0k408_8200_c1 | 3300050493 | Bacteria | 5599 |
| 931 | nmdc:mga06z11_170836_c1 | 3300050494 | Bacteria | 1248 |
| 932 | nmdc:mga07m45_106256_c1 | 3300050496 | Bacteria | 1615 |
| 933 | nmdc:mga07m45_160285_c1 | 3300050496 | Bacteria | 1306 |
| 934 | nmdc:mga07m45_26743_c1 | 3300050496 | Bacteria | 3172 |
| 935 | nmdc:mga07m45_61284_c1 | 3300050496 | Bacteria | 2131 |
| 936 | nmdc:mga07m45_63901_c1 | 3300050496 | Bacteria | 2088 |
| 937 | nmdc:mga09592_3416_c1 | 3300050508 | Bacteria | 12836 |
| 938 | nmdc:mga0qj67_46701_c1 | 3300050509 | Bacteria | 3419 |
| 939 | nmdc:mga08y16_237728_c1 | 3300050511 | Bacteria | 1883 |
| 940 | nmdc:mga08y16_85090_c1 | 3300050511 | Bacteria | 3295 |
| 941 | nmdc:mga0n895_81956_c2 | 3300050512 | Bacteria | 2784 |
| 942 | nmdc:mga0rr50_113462_c1 | 3300050513 | Bacteria | 2147 |
| 943 | nmdc:mga0sz30_240354_c1 | 3300050516 | Bacteria | 806 |
| 944 | Ga0500610_0000979 | 3300053079 | Bacteria | 9275 |
| 945 | Ga0500610_0192048 | 3300053079 | Bacteria | 990 |
| 946 | Ga0500643_016325 | 3300053087 | Bacteria | 2517 |
| 947 | Ga0500643_033127 | 3300053087 | Bacteria | 1564 |
| 948 | Ga0500651_0000057 | 3300053093 | Bacteria | 72615 |
| 949 | Ga0500651_0009638 | 3300053093 | Bacteria | 5755 |
| 950 | Ga0500560_059017 | 3300053107 | Bacteria | 1247 |
| 951 | Ga0500562_016023 | 3300053108 | Bacteria | 1925 |
| 952 | Ga0500569_091221 | 3300053109 | Bacteria | 987 |
| 953 | Ga0500571_000050 | 3300053110 | Bacteria | 36128 |
| 954 | Ga0500592_002926 | 3300053116 | Bacteria | 2740 |
| 955 | Ga0500593_001195 | 3300053117 | Bacteria | 9375 |
| 956 | Ga0500594_0000713 | 3300053118 | Bacteria | 7081 |
| 957 | Ga0500597_005016 | 3300053120 | Bacteria | 4203 |
| 958 | Ga0500607_004546 | 3300053121 | Bacteria | 9502 |
| 959 | Ga0500607_129554 | 3300053121 | Bacteria | 1205 |
| 960 | Ga0500608_016553 | 3300053122 | Bacteria | 3334 |
| 961 | Ga0500626_047139 | 3300053128 | Bacteria | 1944 |
| 962 | Ga0500655_003462 | 3300053133 | Bacteria | 2850 |
| 963 | Ga0500658_0000652 | 3300053134 | Bacteria | 14279 |
| 964 | Ga0500658_0002198 | 3300053134 | Bacteria | 7576 |
| 965 | Ga0500559_0002632 | 3300053136 | Bacteria | 9158 |
| 966 | Ga0500559_0032833 | 3300053136 | Bacteria | 2232 |
| 967 | Ga0500559_0175136 | 3300053136 | Bacteria | 1009 |
| 968 | Ga0500568_0003720 | 3300053139 | Bacteria | 8366 |
| 969 | Ga0500573_0021700 | 3300053140 | Bacteria | 3683 |
| 970 | Ga0500616_0021639 | 3300053153 | Bacteria | 3601 |
| 971 | Ga0500627_0000717 | 3300053158 | Bacteria | 8806 |
| 972 | Ga0500634_0063981 | 3300053161 | Bacteria | 1944 |
| 973 | Ga0500638_012573 | 3300053162 | Bacteria | 3797 |
| 974 | Ga0500636_0127796 | 3300053177 | Bacteria | 1419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100082919 | Ga0070671_1000829192 | 169 |
| 2 | 3300025931 | Ga0207644_10098476 | Ga0207644_100984762 | 169 |
| 3 | 3300049656 | Ga0501209_004018 | Ga0501209_004018_614_1264 | 172 |
| 4 | 3300005329 | Ga0070683_100526052 | Ga0070683_1005260522 | 173 |
| 5 | 3300005334 | Ga0068869_100555113 | Ga0068869_1005551131 | 173 |
| 6 | 3300005366 | Ga0070659_100293977 | Ga0070659_1002939772 | 173 |
| 7 | 3300005577 | Ga0068857_100053835 | Ga0068857_1000538353 | 173 |
| 8 | 3300005616 | Ga0068852_100122460 | Ga0068852_1001224602 | 173 |
| 9 | 3300009098 | Ga0105245_10563450 | Ga0105245_105634502 | 173 |
| 10 | 3300010375 | Ga0105239_10909255 | Ga0105239_109092552 | 173 |
| 11 | 3300025927 | Ga0207687_10881181 | Ga0207687_108811812 | 173 |
| 12 | 3300025942 | Ga0207689_10528683 | Ga0207689_105286832 | 173 |
| 13 | 3300026116 | Ga0207674_10067282 | Ga0207674_100672823 | 173 |
| 14 | 3300026142 | Ga0207698_10240502 | Ga0207698_102405022 | 173 |
| 15 | 3300014325 | Ga0163163_10017519 | Ga0163163_100175193 | 176 |
| 16 | 3300031730 | Ga0307516_10001817 | Ga0307516_1000181717 | 176 |
| 17 | 3300031995 | Ga0307409_100130234 | Ga0307409_1001302342 | 176 |
| 18 | 3300006048 | Ga0075363_100077889 | Ga0075363_1000778892 | 178 |
| 19 | 3300006178 | Ga0075367_10021596 | Ga0075367_100215961 | 178 |
| 20 | 3300003323 | rootH1_10016509 | rootH1_100165094 | 179 |
| 21 | 3300003775 | Ga0055524_1003603 | Ga0055524_10036035 | 179 |
| 22 | 3300003775 | Ga0055524_1044620 | Ga0055524_10446202 | 179 |
| 23 | 3300003794 | Ga0055531_10012361 | Ga0055531_100123612 | 179 |
| 24 | 3300006353 | Ga0075370_10007838 | Ga0075370_100078384 | 179 |
| 25 | 3300006942 | Ga0099824_1045242 | Ga0099824_10452421 | 179 |
| 26 | 3300006944 | Ga0099823_1000069 | Ga0099823_100006932 | 179 |
| 27 | 3300025242 | Ga0209258_107630 | Ga0209258_1076302 | 179 |
| 28 | 3300025299 | Ga0209256_1001983 | Ga0209256_100198311 | 179 |
| 29 | 3300025299 | Ga0209256_1004664 | Ga0209256_10046645 | 179 |
| 30 | 3300025304 | Ga0209257_1003276 | Ga0209257_10032763 | 179 |
| 31 | 3300027296 | Ga0209389_1000460 | Ga0209389_100046012 | 179 |
| 32 | 3300027312 | Ga0209371_1017622 | Ga0209371_10176222 | 179 |
| 33 | 3300030500 | Ga0268256_1019642 | Ga0268256_10196422 | 179 |
| 34 | 3300031548 | Ga0307408_100009486 | Ga0307408_1000094862 | 179 |
| 35 | 3300031731 | Ga0307405_10000854 | Ga0307405_100008544 | 179 |
| 36 | 3300031824 | Ga0307413_10003751 | Ga0307413_100037512 | 179 |
| 37 | 3300031852 | Ga0307410_10307788 | Ga0307410_103077881 | 179 |
| 38 | 3300031901 | Ga0307406_10005261 | Ga0307406_100052613 | 179 |
| 39 | 3300031903 | Ga0307407_10008540 | Ga0307407_100085401 | 179 |
| 40 | 3300031995 | Ga0307409_100000380 | Ga0307409_1000003806 | 179 |
| 41 | 3300032004 | Ga0307414_10002583 | Ga0307414_1000258310 | 179 |
| 42 | 3300032005 | Ga0307411_10000235 | Ga0307411_1000023512 | 179 |
| 43 | 3300032126 | Ga0307415_100019465 | Ga0307415_1000194654 | 179 |
| 44 | 3300041512 | Ga0451853_2647754 | Ga0451853_2647754_71_793 | 179 |
| 45 | 3300027614 | Ga0209970_1001507 | Ga0209970_10015074 | 180 |
| 46 | 3300027876 | Ga0209974_10039174 | Ga0209974_100391742 | 180 |
| 47 | 3300036401 | Ga0373937_0022215 | Ga0373937_0022215_414_1049 | 180 |
| 48 | 3300035092 | Ga0373952_0044599 | Ga0373952_0044599_68_733 | 181 |
| 49 | 3300042435 | Ga0439434_0021261 | Ga0439434_0021261_541_1218 | 181 |
| 50 | 3300048915 | Ga0496112_0002911 | Ga0496112_0002911_993_1646 | 181 |
| 51 | 3300005288 | Ga0065714_10101199 | Ga0065714_101011992 | 182 |
| 52 | 3300005335 | Ga0070666_10332672 | Ga0070666_103326721 | 182 |
| 53 | 3300005364 | Ga0070673_100372401 | Ga0070673_1003724012 | 182 |
| 54 | 3300005367 | Ga0070667_100117556 | Ga0070667_1001175562 | 182 |
| 55 | 3300009148 | Ga0105243_10300230 | Ga0105243_103002301 | 182 |
| 56 | 3300009551 | Ga0105238_10069168 | Ga0105238_100691683 | 182 |
| 57 | 3300013306 | Ga0163162_10067804 | Ga0163162_100678043 | 182 |
| 58 | 3300014497 | Ga0182008_10001559 | Ga0182008_100015592 | 182 |
| 59 | 3300014969 | Ga0157376_10347528 | Ga0157376_103475282 | 182 |
| 60 | 3300025903 | Ga0207680_10531639 | Ga0207680_105316391 | 182 |
| 61 | 3300026121 | Ga0207683_10027372 | Ga0207683_100273723 | 182 |
| 62 | 3300028381 | Ga0268264_10448102 | Ga0268264_104481021 | 182 |
| 63 | 3300042011 | Ga0439454_010708 | Ga0439454_010708_446_1036 | 182 |
| 64 | 3300042115 | Ga0450911_000644 | Ga0450911_000644_6747_7388 | 182 |
| 65 | 3300042437 | Ga0439444_0032122 | Ga0439444_0032122_179_769 | 182 |
| 66 | 3300042438 | Ga0439459_0001027 | Ga0439459_0001027_2743_3333 | 182 |
| 67 | 3300044694 | Ga0466963_0137690 | Ga0466963_0137690_380_970 | 182 |
| 68 | 3300046530 | Ga0495654_0216126 | Ga0495654_0216126_64_732 | 182 |
| 69 | 3300046674 | Ga0495588_0015532 | Ga0495588_0015532_1955_2629 | 182 |
| 70 | 3300046678 | Ga0495599_0230575 | Ga0495599_0230575_373_1047 | 182 |
| 71 | 3300047447 | Ga0495685_024705 | Ga0495685_024705_963_1637 | 182 |
| 72 | 3300048903 | Ga0496100_0109502 | Ga0496100_0109502_338_1012 | 182 |
| 73 | 3300048905 | Ga0496102_0009515 | Ga0496102_0009515_3465_4139 | 182 |
| 74 | 3300048906 | Ga0496103_0144151 | Ga0496103_0144151_409_1083 | 182 |
| 75 | 3300048907 | Ga0496104_0036397 | Ga0496104_0036397_922_1596 | 182 |
| 76 | 3300048908 | Ga0496105_0008753 | Ga0496105_0008753_3021_3695 | 182 |
| 77 | 3300048909 | Ga0496106_0066014 | Ga0496106_0066014_1182_1856 | 182 |
| 78 | 3300048910 | Ga0496107_0178773 | Ga0496107_0178773_804_1478 | 182 |
| 79 | 3300050496 | nmdc:mga07m45_106256_c1 | nmdc:mga07m45_106256_c1_298_888 | 182 |
| 80 | 3300053079 | Ga0500610_0192048 | Ga0500610_0192048_214_885 | 182 |
| 81 | 3300005331 | Ga0070670_100063865 | Ga0070670_1000638653 | 183 |
| 82 | 3300009176 | Ga0105242_10005758 | Ga0105242_100057588 | 183 |
| 83 | 3300014969 | Ga0157376_10148922 | Ga0157376_101489221 | 183 |
| 84 | 3300025925 | Ga0207650_10051055 | Ga0207650_100510552 | 183 |
| 85 | 3300025934 | Ga0207686_10028152 | Ga0207686_100281523 | 183 |
| 86 | 3300042004 | Ga0439445_0032560 | Ga0439445_0032560_704_1345 | 183 |
| 87 | 3300042142 | Ga0450905_017413 | Ga0450905_017413_357_998 | 183 |
| 88 | 3300048924 | Ga0496121_0035725 | Ga0496121_0035725_3342_3983 | 183 |
| 89 | 3300048928 | Ga0496125_0019249 | Ga0496125_0019249_3282_3923 | 183 |
| 90 | 3300005456 | Ga0070678_100069507 | Ga0070678_1000695072 | 184 |
| 91 | 3300005843 | Ga0068860_100697296 | Ga0068860_1006972961 | 184 |
| 92 | 3300006353 | Ga0075370_10066418 | Ga0075370_100664182 | 184 |
| 93 | 3300014497 | Ga0182008_10014383 | Ga0182008_100143833 | 184 |
| 94 | 3300015262 | Ga0182007_10015862 | Ga0182007_100158623 | 184 |
| 95 | 3300015265 | Ga0182005_1042169 | Ga0182005_10421692 | 184 |
| 96 | 3300017792 | Ga0163161_10087107 | Ga0163161_100871072 | 184 |
| 97 | 3300031548 | Ga0307408_100044047 | Ga0307408_1000440472 | 184 |
| 98 | 3300031911 | Ga0307412_10310861 | Ga0307412_103108612 | 184 |
| 99 | 3300032002 | Ga0307416_100016007 | Ga0307416_1000160072 | 184 |
| 100 | 3300041406 | Ga0439439_0002668 | Ga0439439_0002668_2044_2721 | 184 |
| 101 | 3300041999 | Ga0439433_0010895 | Ga0439433_0010895_509_1186 | 184 |
| 102 | 3300042006 | Ga0439432_016399 | Ga0439432_016399_827_1504 | 184 |
| 103 | 3300042007 | Ga0439449_0001501 | Ga0439449_0001501_3416_4093 | 184 |
| 104 | 3300042010 | Ga0439452_042579 | Ga0439452_042579_249_926 | 184 |
| 105 | 3300042015 | Ga0439462_0000171 | Ga0439462_0000171_2890_3567 | 184 |
| 106 | 3300042123 | Ga0450921_006309 | Ga0450921_006309_73_750 | 184 |
| 107 | 3300042131 | Ga0450894_003448 | Ga0450894_003448_739_1416 | 184 |
| 108 | 3300042145 | Ga0450906_005728 | Ga0450906_005728_1090_1767 | 184 |
| 109 | 3300042184 | Ga0450908_013237 | Ga0450908_013237_58_735 | 184 |
| 110 | 3300042185 | Ga0450909_000723 | Ga0450909_000723_144_821 | 184 |
| 111 | 3300046475 | Ga0495639_0066058 | Ga0495639_0066058_446_1120 | 184 |
| 112 | 3300046528 | Ga0495642_0074367 | Ga0495642_0074367_326_1000 | 184 |
| 113 | 3300046559 | Ga0495667_0338377 | Ga0495667_0338377_108_782 | 184 |
| 114 | 3300047673 | Ga0495593_0121852 | Ga0495593_0121852_626_1300 | 184 |
| 115 | 3300048912 | Ga0496109_0081831 | Ga0496109_0081831_714_1388 | 184 |
| 116 | 3300005577 | Ga0068857_100593300 | Ga0068857_1005933002 | 185 |
| 117 | 3300030731 | Ga0316177_1131827 | Ga0316177_11318271 | 185 |
| 118 | 3300030732 | Ga0316176_1054729 | Ga0316176_10547293 | 185 |
| 119 | 3300030735 | Ga0316178_1095890 | Ga0316178_10958903 | 185 |
| 120 | 3300030736 | Ga0316180_1144680 | Ga0316180_11446802 | 185 |
| 121 | 3300030742 | Ga0316183_1018820 | Ga0316183_10188201 | 185 |
| 122 | 3300030744 | Ga0316181_1035092 | Ga0316181_10350922 | 185 |
| 123 | 3300030745 | Ga0316182_1051023 | Ga0316182_10510232 | 185 |
| 124 | 3300031251 | Ga0265327_10021540 | Ga0265327_100215402 | 185 |
| 125 | 3300031548 | Ga0307408_100391752 | Ga0307408_1003917522 | 185 |
| 126 | 3300031824 | Ga0307413_10259491 | Ga0307413_102594912 | 185 |
| 127 | 3300031852 | Ga0307410_10085331 | Ga0307410_100853312 | 185 |
| 128 | 3300031901 | Ga0307406_10091731 | Ga0307406_100917312 | 185 |
| 129 | 3300031911 | Ga0307412_10175396 | Ga0307412_101753962 | 185 |
| 130 | 3300032002 | Ga0307416_101288601 | Ga0307416_1012886011 | 185 |
| 131 | 3300032004 | Ga0307414_10117931 | Ga0307414_101179312 | 185 |
| 132 | 3300041404 | Ga0439436_0000549 | Ga0439436_0000549_8073_8747 | 185 |
| 133 | 3300041406 | Ga0439439_0026041 | Ga0439439_0026041_643_1317 | 185 |
| 134 | 3300041410 | Ga0439461_0046482 | Ga0439461_0046482_34_708 | 185 |
| 135 | 3300041411 | Ga0439466_0002413 | Ga0439466_0002413_3705_4379 | 185 |
| 136 | 3300041999 | Ga0439433_0004489 | Ga0439433_0004489_499_1173 | 185 |
| 137 | 3300042004 | Ga0439445_0002343 | Ga0439445_0002343_1373_2047 | 185 |
| 138 | 3300042006 | Ga0439432_006747 | Ga0439432_006747_2390_3064 | 185 |
| 139 | 3300042007 | Ga0439449_0000718 | Ga0439449_0000718_10066_10740 | 185 |
| 140 | 3300042010 | Ga0439452_001555 | Ga0439452_001555_6911_7585 | 185 |
| 141 | 3300042014 | Ga0439457_005434 | Ga0439457_005434_2215_2889 | 185 |
| 142 | 3300042015 | Ga0439462_0006709 | Ga0439462_0006709_589_1263 | 185 |
| 143 | 3300042156 | Ga0439446_0001776 | Ga0439446_0001776_760_1434 | 185 |
| 144 | 3300042435 | Ga0439434_0002712 | Ga0439434_0002712_246_920 | 185 |
| 145 | 3300048928 | Ga0496125_0053548 | Ga0496125_0053548_2239_2877 | 185 |
| 146 | 3300049575 | Ga0501039_0789557 | Ga0501039_0789557_103_726 | 185 |
| 147 | iso_pu_bacteria | 2643221609 | 2644062285 | 185 |
| 148 | iso_pu_bacteria | 2643221611 | 2644071472 | 185 |
| 149 | iso_pu_bacteria | 2738543012 | 2739245894 | 185 |
| 150 | iso_pu_bacteria | 2816332133 | 2816470590 | 185 |
| 151 | 3300003781 | Ga0055536_1003029 | Ga0055536_10030296 | 186 |
| 152 | 3300003792 | Ga0055540_1002682 | Ga0055540_10026826 | 186 |
| 153 | 3300025292 | Ga0209676_1001130 | Ga0209676_10011304 | 186 |
| 154 | 3300025303 | Ga0209051_1000392 | Ga0209051_100039234 | 186 |
| 155 | 3300025304 | Ga0209257_1011209 | Ga0209257_10112093 | 186 |
| 156 | 3300034817 | Ga0373948_0024625 | Ga0373948_0024625_355_981 | 186 |
| 157 | 3300035092 | Ga0373952_0001218 | Ga0373952_0001218_1667_2293 | 186 |
| 158 | 3300041443 | Ga0451789_0108685 | Ga0451789_0108685_24_695 | 186 |
| 159 | 3300042127 | Ga0450890_007040 | Ga0450890_007040_114_779 | 186 |
| 160 | 3300053136 | Ga0500559_0002632 | Ga0500559_0002632_4206_4877 | 186 |
| 161 | 3300053140 | Ga0500573_0021700 | Ga0500573_0021700_2946_3617 | 186 |
| 162 | 3300005834 | Ga0068851_10061209 | Ga0068851_100612092 | 187 |
| 163 | 3300005841 | Ga0068863_100136515 | Ga0068863_1001365152 | 187 |
| 164 | 3300006048 | Ga0075363_100102923 | Ga0075363_1001029232 | 187 |
| 165 | 3300006051 | Ga0075364_10263172 | Ga0075364_102631722 | 187 |
| 166 | 3300006058 | Ga0075432_10002230 | Ga0075432_100022306 | 187 |
| 167 | 3300006177 | Ga0075362_10007390 | Ga0075362_100073902 | 187 |
| 168 | 3300006353 | Ga0075370_10221471 | Ga0075370_102214712 | 187 |
| 169 | 3300013307 | Ga0157372_10344546 | Ga0157372_103445462 | 187 |
| 170 | 3300017792 | Ga0163161_10002188 | Ga0163161_1000218812 | 187 |
| 171 | 3300026088 | Ga0207641_10064970 | Ga0207641_100649703 | 187 |
| 172 | 3300026095 | Ga0207676_10414567 | Ga0207676_104145672 | 187 |
| 173 | 3300026142 | Ga0207698_10960517 | Ga0207698_109605171 | 187 |
| 174 | 3300028794 | Ga0307515_10072181 | Ga0307515_100721811 | 187 |
| 175 | 3300031456 | Ga0307513_10000038 | Ga0307513_1000003892 | 187 |
| 176 | 3300031456 | Ga0307513_10123040 | Ga0307513_101230402 | 187 |
| 177 | 3300031911 | Ga0307412_10136298 | Ga0307412_101362982 | 187 |
| 178 | 3300032005 | Ga0307411_10250348 | Ga0307411_102503482 | 187 |
| 179 | 3300042125 | Ga0450923_014989 | Ga0450923_014989_738_1415 | 187 |
| 180 | 3300050489 | nmdc:mga03683_1511_c2 | nmdc:mga03683_1511_c2_3411_4088 | 187 |
| 181 | 3300005328 | Ga0070676_10246805 | Ga0070676_102468052 | 188 |
| 182 | 3300005330 | Ga0070690_100018410 | Ga0070690_1000184102 | 188 |
| 183 | 3300005334 | Ga0068869_100015323 | Ga0068869_1000153232 | 188 |
| 184 | 3300005347 | Ga0070668_100004017 | Ga0070668_1000040173 | 188 |
| 185 | 3300005353 | Ga0070669_100207733 | Ga0070669_1002077332 | 188 |
| 186 | 3300005353 | Ga0070669_100225936 | Ga0070669_1002259362 | 188 |
| 187 | 3300005354 | Ga0070675_100304651 | Ga0070675_1003046512 | 188 |
| 188 | 3300005356 | Ga0070674_100047294 | Ga0070674_1000472942 | 188 |
| 189 | 3300005364 | Ga0070673_100137460 | Ga0070673_1001374601 | 188 |
| 190 | 3300005365 | Ga0070688_100136286 | Ga0070688_1001362861 | 188 |
| 191 | 3300005440 | Ga0070705_100243445 | Ga0070705_1002434452 | 188 |
| 192 | 3300005441 | Ga0070700_100709808 | Ga0070700_1007098081 | 188 |
| 193 | 3300005456 | Ga0070678_100123760 | Ga0070678_1001237602 | 188 |
| 194 | 3300005459 | Ga0068867_100996351 | Ga0068867_1009963511 | 188 |
| 195 | 3300005543 | Ga0070672_100113226 | Ga0070672_1001132262 | 188 |
| 196 | 3300005544 | Ga0070686_100033639 | Ga0070686_1000336393 | 188 |
| 197 | 3300005548 | Ga0070665_100731851 | Ga0070665_1007318511 | 188 |
| 198 | 3300005615 | Ga0070702_100163520 | Ga0070702_1001635202 | 188 |
| 199 | 3300005617 | Ga0068859_100179498 | Ga0068859_1001794981 | 188 |
| 200 | 3300005618 | Ga0068864_100176227 | Ga0068864_1001762272 | 188 |
| 201 | 3300005718 | Ga0068866_10043026 | Ga0068866_100430262 | 188 |
| 202 | 3300005719 | Ga0068861_100026899 | Ga0068861_1000268994 | 188 |
| 203 | 3300005840 | Ga0068870_10202311 | Ga0068870_102023112 | 188 |
| 204 | 3300005841 | Ga0068863_100321307 | Ga0068863_1003213071 | 188 |
| 205 | 3300005842 | Ga0068858_100149379 | Ga0068858_1001493792 | 188 |
| 206 | 3300005843 | Ga0068860_100385300 | Ga0068860_1003853002 | 188 |
| 207 | 3300005844 | Ga0068862_100171528 | Ga0068862_1001715282 | 188 |
| 208 | 3300006195 | Ga0075366_10034976 | Ga0075366_100349763 | 188 |
| 209 | 3300006237 | Ga0097621_100016802 | Ga0097621_1000168022 | 188 |
| 210 | 3300006358 | Ga0068871_100005265 | Ga0068871_1000052654 | 188 |
| 211 | 3300006881 | Ga0068865_100122158 | Ga0068865_1001221582 | 188 |
| 212 | 3300006931 | Ga0097620_100179503 | Ga0097620_1001795031 | 188 |
| 213 | 3300009094 | Ga0111539_10114865 | Ga0111539_101148652 | 188 |
| 214 | 3300009148 | Ga0105243_10274632 | Ga0105243_102746322 | 188 |
| 215 | 3300009176 | Ga0105242_10025335 | Ga0105242_100253355 | 188 |
| 216 | 3300009177 | Ga0105248_10275410 | Ga0105248_102754101 | 188 |
| 217 | 3300009553 | Ga0105249_10058498 | Ga0105249_100584984 | 188 |
| 218 | 3300013297 | Ga0157378_10009053 | Ga0157378_100090532 | 188 |
| 219 | 3300013306 | Ga0163162_10182650 | Ga0163162_101826502 | 188 |
| 220 | 3300014326 | Ga0157380_10020902 | Ga0157380_100209023 | 188 |
| 221 | 3300014326 | Ga0157380_10176299 | Ga0157380_101762992 | 188 |
| 222 | 3300017792 | Ga0163161_10053505 | Ga0163161_100535054 | 188 |
| 223 | 3300025908 | Ga0207643_10172960 | Ga0207643_101729602 | 188 |
| 224 | 3300025923 | Ga0207681_10090369 | Ga0207681_100903693 | 188 |
| 225 | 3300025923 | Ga0207681_10183315 | Ga0207681_101833152 | 188 |
| 226 | 3300025940 | Ga0207691_10034391 | Ga0207691_100343915 | 188 |
| 227 | 3300025942 | Ga0207689_10030686 | Ga0207689_100306862 | 188 |
| 228 | 3300025972 | Ga0207668_10002332 | Ga0207668_100023329 | 188 |
| 229 | 3300026035 | Ga0207703_10453555 | Ga0207703_104535552 | 188 |
| 230 | 3300026075 | Ga0207708_10367729 | Ga0207708_103677292 | 188 |
| 231 | 3300026089 | Ga0207648_10065432 | Ga0207648_100654324 | 188 |
| 232 | 3300026118 | Ga0207675_100023959 | Ga0207675_1000239596 | 188 |
| 233 | 3300026121 | Ga0207683_10003717 | Ga0207683_1000371712 | 188 |
| 234 | 3300028380 | Ga0268265_10572170 | Ga0268265_105721701 | 188 |
| 235 | 3300041405 | Ga0439438_042041 | Ga0439438_042041_276_953 | 188 |
| 236 | 3300042438 | Ga0439459_0016864 | Ga0439459_0016864_163_840 | 188 |
| 237 | 3300050511 | nmdc:mga08y16_85090_c1 | nmdc:mga08y16_85090_c1_900_1583 | 188 |
| 238 | 3300005331 | Ga0070670_100000664 | Ga0070670_10000066415 | 189 |
| 239 | 3300005334 | Ga0068869_100000984 | Ga0068869_1000009844 | 189 |
| 240 | 3300005338 | Ga0068868_100057089 | Ga0068868_1000570893 | 189 |
| 241 | 3300005340 | Ga0070689_100233122 | Ga0070689_1002331222 | 189 |
| 242 | 3300005347 | Ga0070668_100016923 | Ga0070668_1000169234 | 189 |
| 243 | 3300005353 | Ga0070669_100004906 | Ga0070669_1000049066 | 189 |
| 244 | 3300005364 | Ga0070673_100004029 | Ga0070673_1000040296 | 189 |
| 245 | 3300005367 | Ga0070667_100018346 | Ga0070667_1000183461 | 189 |
| 246 | 3300005459 | Ga0068867_100006238 | Ga0068867_1000062383 | 189 |
| 247 | 3300005549 | Ga0070704_100194730 | Ga0070704_1001947302 | 189 |
| 248 | 3300005577 | Ga0068857_100037720 | Ga0068857_1000377205 | 189 |
| 249 | 3300005578 | Ga0068854_100322627 | Ga0068854_1003226271 | 189 |
| 250 | 3300005617 | Ga0068859_100005130 | Ga0068859_1000051303 | 189 |
| 251 | 3300005618 | Ga0068864_100002166 | Ga0068864_1000021666 | 189 |
| 252 | 3300005719 | Ga0068861_100001567 | Ga0068861_1000015678 | 189 |
| 253 | 3300005840 | Ga0068870_10034754 | Ga0068870_100347543 | 189 |
| 254 | 3300005841 | Ga0068863_100002459 | Ga0068863_10000245910 | 189 |
| 255 | 3300005841 | Ga0068863_100394656 | Ga0068863_1003946562 | 189 |
| 256 | 3300005842 | Ga0068858_100008257 | Ga0068858_1000082573 | 189 |
| 257 | 3300005843 | Ga0068860_100002129 | Ga0068860_1000021293 | 189 |
| 258 | 3300005844 | Ga0068862_100004308 | Ga0068862_1000043081 | 189 |
| 259 | 3300006051 | Ga0075364_10277863 | Ga0075364_102778632 | 189 |
| 260 | 3300006058 | Ga0075432_10153313 | Ga0075432_101533132 | 189 |
| 261 | 3300006177 | Ga0075362_10146377 | Ga0075362_101463772 | 189 |
| 262 | 3300006178 | Ga0075367_10039303 | Ga0075367_100393032 | 189 |
| 263 | 3300006195 | Ga0075366_10006939 | Ga0075366_100069396 | 189 |
| 264 | 3300006237 | Ga0097621_100369779 | Ga0097621_1003697791 | 189 |
| 265 | 3300006358 | Ga0068871_100402945 | Ga0068871_1004029451 | 189 |
| 266 | 3300006881 | Ga0068865_100140568 | Ga0068865_1001405682 | 189 |
| 267 | 3300006931 | Ga0097620_100005130 | Ga0097620_1000051303 | 189 |
| 268 | 3300006948 | Ga0099826_10030609 | Ga0099826_100306093 | 189 |
| 269 | 3300009177 | Ga0105248_10021876 | Ga0105248_100218762 | 189 |
| 270 | 3300009553 | Ga0105249_10703870 | Ga0105249_107038702 | 189 |
| 271 | 3300011119 | Ga0105246_10270839 | Ga0105246_102708392 | 189 |
| 272 | 3300013297 | Ga0157378_10139525 | Ga0157378_101395252 | 189 |
| 273 | 3300013308 | Ga0157375_10391763 | Ga0157375_103917631 | 189 |
| 274 | 3300014968 | Ga0157379_10000871 | Ga0157379_1000087115 | 189 |
| 275 | 3300025903 | Ga0207680_10085375 | Ga0207680_100853752 | 189 |
| 276 | 3300025923 | Ga0207681_10006754 | Ga0207681_100067546 | 189 |
| 277 | 3300025935 | Ga0207709_10132097 | Ga0207709_101320972 | 189 |
| 278 | 3300025942 | Ga0207689_10000258 | Ga0207689_1000025830 | 189 |
| 279 | 3300025960 | Ga0207651_10004733 | Ga0207651_100047336 | 189 |
| 280 | 3300025961 | Ga0207712_10529287 | Ga0207712_105292871 | 189 |
| 281 | 3300025972 | Ga0207668_10108435 | Ga0207668_101084352 | 189 |
| 282 | 3300025986 | Ga0207658_10006421 | Ga0207658_100064212 | 189 |
| 283 | 3300026035 | Ga0207703_10002766 | Ga0207703_100027663 | 189 |
| 284 | 3300026088 | Ga0207641_10037009 | Ga0207641_100370092 | 189 |
| 285 | 3300026088 | Ga0207641_10272864 | Ga0207641_102728641 | 189 |
| 286 | 3300026089 | Ga0207648_10000667 | Ga0207648_1000066728 | 189 |
| 287 | 3300026089 | Ga0207648_10048370 | Ga0207648_100483703 | 189 |
| 288 | 3300026095 | Ga0207676_10009106 | Ga0207676_100091062 | 189 |
| 289 | 3300026116 | Ga0207674_10023530 | Ga0207674_100235302 | 189 |
| 290 | 3300026116 | Ga0207674_10805160 | Ga0207674_108051601 | 189 |
| 291 | 3300026118 | Ga0207675_100002057 | Ga0207675_10000205710 | 189 |
| 292 | 3300028380 | Ga0268265_10018243 | Ga0268265_100182433 | 189 |
| 293 | 3300028381 | Ga0268264_10003471 | Ga0268264_100034713 | 189 |
| 294 | 3300031548 | Ga0307408_100000795 | Ga0307408_10000079518 | 189 |
| 295 | 3300031548 | Ga0307408_100028947 | Ga0307408_1000289472 | 189 |
| 296 | 3300031649 | Ga0307514_10015687 | Ga0307514_100156874 | 189 |
| 297 | 3300031731 | Ga0307405_10001567 | Ga0307405_100015677 | 189 |
| 298 | 3300031731 | Ga0307405_10155217 | Ga0307405_101552172 | 189 |
| 299 | 3300031824 | Ga0307413_10013062 | Ga0307413_100130623 | 189 |
| 300 | 3300031852 | Ga0307410_10000388 | Ga0307410_100003887 | 189 |
| 301 | 3300031852 | Ga0307410_10226403 | Ga0307410_102264032 | 189 |
| 302 | 3300031901 | Ga0307406_10001760 | Ga0307406_100017609 | 189 |
| 303 | 3300031901 | Ga0307406_10014344 | Ga0307406_100143443 | 189 |
| 304 | 3300031903 | Ga0307407_10016334 | Ga0307407_100163343 | 189 |
| 305 | 3300031911 | Ga0307412_10001020 | Ga0307412_100010202 | 189 |
| 306 | 3300031995 | Ga0307409_100013393 | Ga0307409_1000133933 | 189 |
| 307 | 3300031995 | Ga0307409_101000689 | Ga0307409_1010006891 | 189 |
| 308 | 3300032002 | Ga0307416_100236630 | Ga0307416_1002366302 | 189 |
| 309 | 3300032004 | Ga0307414_10040606 | Ga0307414_100406064 | 189 |
| 310 | 3300032004 | Ga0307414_10159379 | Ga0307414_101593792 | 189 |
| 311 | 3300032005 | Ga0307411_10000093 | Ga0307411_100000934 | 189 |
| 312 | 3300032126 | Ga0307415_100000580 | Ga0307415_1000005805 | 189 |
| 313 | 3300041413 | Ga0439465_0018186 | Ga0439465_0018186_947_1615 | 189 |
| 314 | 3300042002 | Ga0439442_019309 | Ga0439442_019309_404_1072 | 189 |
| 315 | 3300042006 | Ga0439432_042946 | Ga0439432_042946_34_672 | 189 |
| 316 | 3300042123 | Ga0450921_001550 | Ga0450921_001550_131_799 | 189 |
| 317 | 3300042125 | Ga0450923_002679 | Ga0450923_002679_1731_2399 | 189 |
| 318 | 3300042145 | Ga0450906_029529 | Ga0450906_029529_187_855 | 189 |
| 319 | 3300042185 | Ga0450909_028578 | Ga0450909_028578_24_692 | 189 |
| 320 | 3300042435 | Ga0439434_0043207 | Ga0439434_0043207_80_748 | 189 |
| 321 | 3300046660 | Ga0495625_0001007 | Ga0495625_0001007_14364_15032 | 189 |
| 322 | 3300048905 | Ga0496102_0014776 | Ga0496102_0014776_643_1296 | 189 |
| 323 | 3300048906 | Ga0496103_0139926 | Ga0496103_0139926_96_749 | 189 |
| 324 | 3300048908 | Ga0496105_0239505 | Ga0496105_0239505_538_1155 | 189 |
| 325 | 3300048911 | Ga0496108_0114058 | Ga0496108_0114058_1626_2279 | 189 |
| 326 | 3300048912 | Ga0496109_0489352 | Ga0496109_0489352_96_749 | 189 |
| 327 | 3300050490 | nmdc:mga03n38_32329_c1 | nmdc:mga03n38_32329_c1_479_1147 | 189 |
| 328 | 3300050493 | nmdc:mga0k408_8200_c1 | nmdc:mga0k408_8200_c1_2618_3286 | 189 |
| 329 | 3300003781 | Ga0055536_1006353 | Ga0055536_10063532 | 190 |
| 330 | 3300003791 | Ga0055530_10004556 | Ga0055530_100045562 | 190 |
| 331 | 3300003792 | Ga0055540_1005224 | Ga0055540_10052242 | 190 |
| 332 | 3300003794 | Ga0055531_10007985 | Ga0055531_100079852 | 190 |
| 333 | 3300005328 | Ga0070676_10241127 | Ga0070676_102411272 | 190 |
| 334 | 3300005331 | Ga0070670_100054285 | Ga0070670_1000542853 | 190 |
| 335 | 3300005331 | Ga0070670_100109562 | Ga0070670_1001095623 | 190 |
| 336 | 3300005335 | Ga0070666_10036643 | Ga0070666_100366432 | 190 |
| 337 | 3300005335 | Ga0070666_10186152 | Ga0070666_101861521 | 190 |
| 338 | 3300005338 | Ga0068868_100035704 | Ga0068868_1000357044 | 190 |
| 339 | 3300005347 | Ga0070668_100001133 | Ga0070668_1000011334 | 190 |
| 340 | 3300005347 | Ga0070668_100366929 | Ga0070668_1003669292 | 190 |
| 341 | 3300005353 | Ga0070669_100057425 | Ga0070669_1000574253 | 190 |
| 342 | 3300005353 | Ga0070669_100733498 | Ga0070669_1007334981 | 190 |
| 343 | 3300005354 | Ga0070675_100000235 | Ga0070675_10000023515 | 190 |
| 344 | 3300005354 | Ga0070675_100549752 | Ga0070675_1005497521 | 190 |
| 345 | 3300005355 | Ga0070671_100003028 | Ga0070671_10000302812 | 190 |
| 346 | 3300005355 | Ga0070671_100017030 | Ga0070671_1000170302 | 190 |
| 347 | 3300005355 | Ga0070671_100044249 | Ga0070671_1000442492 | 190 |
| 348 | 3300005356 | Ga0070674_100002199 | Ga0070674_10000219910 | 190 |
| 349 | 3300005364 | Ga0070673_100002358 | Ga0070673_1000023589 | 190 |
| 350 | 3300005364 | Ga0070673_100168910 | Ga0070673_1001689102 | 190 |
| 351 | 3300005364 | Ga0070673_100335291 | Ga0070673_1003352912 | 190 |
| 352 | 3300005367 | Ga0070667_100002692 | Ga0070667_1000026921 | 190 |
| 353 | 3300005367 | Ga0070667_100063570 | Ga0070667_1000635704 | 190 |
| 354 | 3300005367 | Ga0070667_100090414 | Ga0070667_1000904141 | 190 |
| 355 | 3300005367 | Ga0070667_100291921 | Ga0070667_1002919212 | 190 |
| 356 | 3300005367 | Ga0070667_100700595 | Ga0070667_1007005951 | 190 |
| 357 | 3300005438 | Ga0070701_10270240 | Ga0070701_102702401 | 190 |
| 358 | 3300005441 | Ga0070700_100245619 | Ga0070700_1002456191 | 190 |
| 359 | 3300005445 | Ga0070708_100000773 | Ga0070708_1000007736 | 190 |
| 360 | 3300005455 | Ga0070663_100001362 | Ga0070663_1000013626 | 190 |
| 361 | 3300005455 | Ga0070663_100230523 | Ga0070663_1002305231 | 190 |
| 362 | 3300005456 | Ga0070678_100001357 | Ga0070678_1000013571 | 190 |
| 363 | 3300005457 | Ga0070662_100049784 | Ga0070662_1000497843 | 190 |
| 364 | 3300005457 | Ga0070662_100106673 | Ga0070662_1001066732 | 190 |
| 365 | 3300005457 | Ga0070662_100205882 | Ga0070662_1002058822 | 190 |
| 366 | 3300005459 | Ga0068867_100003026 | Ga0068867_1000030266 | 190 |
| 367 | 3300005539 | Ga0068853_100014134 | Ga0068853_1000141346 | 190 |
| 368 | 3300005543 | Ga0070672_100033175 | Ga0070672_1000331755 | 190 |
| 369 | 3300005548 | Ga0070665_100004180 | Ga0070665_10000418014 | 190 |
| 370 | 3300005548 | Ga0070665_100077702 | Ga0070665_1000777022 | 190 |
| 371 | 3300005548 | Ga0070665_100158765 | Ga0070665_1001587652 | 190 |
| 372 | 3300005548 | Ga0070665_100988369 | Ga0070665_1009883691 | 190 |
| 373 | 3300005564 | Ga0070664_100020447 | Ga0070664_1000204474 | 190 |
| 374 | 3300005564 | Ga0070664_100040211 | Ga0070664_1000402113 | 190 |
| 375 | 3300005615 | Ga0070702_100128683 | Ga0070702_1001286832 | 190 |
| 376 | 3300005616 | Ga0068852_100024496 | Ga0068852_1000244964 | 190 |
| 377 | 3300005616 | Ga0068852_100746476 | Ga0068852_1007464762 | 190 |
| 378 | 3300005617 | Ga0068859_101327400 | Ga0068859_1013274001 | 190 |
| 379 | 3300005618 | Ga0068864_100291088 | Ga0068864_1002910882 | 190 |
| 380 | 3300005719 | Ga0068861_100112565 | Ga0068861_1001125652 | 190 |
| 381 | 3300005719 | Ga0068861_100163184 | Ga0068861_1001631842 | 190 |
| 382 | 3300005719 | Ga0068861_100197533 | Ga0068861_1001975332 | 190 |
| 383 | 3300005719 | Ga0068861_101036623 | Ga0068861_1010366231 | 190 |
| 384 | 3300005834 | Ga0068851_10018615 | Ga0068851_100186153 | 190 |
| 385 | 3300005840 | Ga0068870_10004622 | Ga0068870_100046225 | 190 |
| 386 | 3300005841 | Ga0068863_100008456 | Ga0068863_1000084569 | 190 |
| 387 | 3300005842 | Ga0068858_100018525 | Ga0068858_1000185255 | 190 |
| 388 | 3300005843 | Ga0068860_100014571 | Ga0068860_1000145712 | 190 |
| 389 | 3300005843 | Ga0068860_100050601 | Ga0068860_1000506014 | 190 |
| 390 | 3300006237 | Ga0097621_100191196 | Ga0097621_1001911962 | 190 |
| 391 | 3300006353 | Ga0075370_10209610 | Ga0075370_102096102 | 190 |
| 392 | 3300006358 | Ga0068871_100057888 | Ga0068871_1000578883 | 190 |
| 393 | 3300006358 | Ga0068871_100103581 | Ga0068871_1001035812 | 190 |
| 394 | 3300006931 | Ga0097620_101327762 | Ga0097620_1013277621 | 190 |
| 395 | 3300009101 | Ga0105247_10265201 | Ga0105247_102652012 | 190 |
| 396 | 3300009148 | Ga0105243_10091035 | Ga0105243_100910352 | 190 |
| 397 | 3300009176 | Ga0105242_10156117 | Ga0105242_101561172 | 190 |
| 398 | 3300009177 | Ga0105248_10088427 | Ga0105248_100884273 | 190 |
| 399 | 3300009177 | Ga0105248_10384699 | Ga0105248_103846991 | 190 |
| 400 | 3300009545 | Ga0105237_10144947 | Ga0105237_101449472 | 190 |
| 401 | 3300009551 | Ga0105238_10431980 | Ga0105238_104319801 | 190 |
| 402 | 3300013297 | Ga0157378_10030194 | Ga0157378_100301942 | 190 |
| 403 | 3300013297 | Ga0157378_10081747 | Ga0157378_100817473 | 190 |
| 404 | 3300013306 | Ga0163162_10141504 | Ga0163162_101415042 | 190 |
| 405 | 3300013306 | Ga0163162_11565598 | Ga0163162_115655981 | 190 |
| 406 | 3300013308 | Ga0157375_10000781 | Ga0157375_1000078110 | 190 |
| 407 | 3300013308 | Ga0157375_10009140 | Ga0157375_100091405 | 190 |
| 408 | 3300013308 | Ga0157375_10033977 | Ga0157375_100339773 | 190 |
| 409 | 3300013308 | Ga0157375_10326415 | Ga0157375_103264151 | 190 |
| 410 | 3300014325 | Ga0163163_10135307 | Ga0163163_101353073 | 190 |
| 411 | 3300014325 | Ga0163163_10171958 | Ga0163163_101719583 | 190 |
| 412 | 3300014325 | Ga0163163_10216213 | Ga0163163_102162133 | 190 |
| 413 | 3300014325 | Ga0163163_10256732 | Ga0163163_102567322 | 190 |
| 414 | 3300014326 | Ga0157380_10078238 | Ga0157380_100782383 | 190 |
| 415 | 3300014497 | Ga0182008_10001493 | Ga0182008_100014934 | 190 |
| 416 | 3300014968 | Ga0157379_10002711 | Ga0157379_100027113 | 190 |
| 417 | 3300014969 | Ga0157376_10815265 | Ga0157376_108152652 | 190 |
| 418 | 3300015261 | Ga0182006_1002058 | Ga0182006_10020589 | 190 |
| 419 | 3300015262 | Ga0182007_10003158 | Ga0182007_100031584 | 190 |
| 420 | 3300017792 | Ga0163161_10122246 | Ga0163161_101222462 | 190 |
| 421 | 3300025292 | Ga0209676_1003633 | Ga0209676_10036334 | 190 |
| 422 | 3300025298 | Ga0209050_1001905 | Ga0209050_10019056 | 190 |
| 423 | 3300025303 | Ga0209051_1000984 | Ga0209051_10009846 | 190 |
| 424 | 3300025304 | Ga0209257_1004781 | Ga0209257_10047816 | 190 |
| 425 | 3300025321 | Ga0207656_10031148 | Ga0207656_100311482 | 190 |
| 426 | 3300025728 | Ga0207655_1002097 | Ga0207655_10020979 | 190 |
| 427 | 3300025893 | Ga0207682_10000165 | Ga0207682_1000016524 | 190 |
| 428 | 3300025899 | Ga0207642_10070692 | Ga0207642_100706922 | 190 |
| 429 | 3300025900 | Ga0207710_10266071 | Ga0207710_102660711 | 190 |
| 430 | 3300025903 | Ga0207680_10002735 | Ga0207680_100027357 | 190 |
| 431 | 3300025903 | Ga0207680_10053024 | Ga0207680_100530242 | 190 |
| 432 | 3300025903 | Ga0207680_10120018 | Ga0207680_101200182 | 190 |
| 433 | 3300025907 | Ga0207645_10000045 | Ga0207645_1000004556 | 190 |
| 434 | 3300025907 | Ga0207645_10037385 | Ga0207645_100373852 | 190 |
| 435 | 3300025908 | Ga0207643_10030341 | Ga0207643_100303412 | 190 |
| 436 | 3300025914 | Ga0207671_10204961 | Ga0207671_102049612 | 190 |
| 437 | 3300025920 | Ga0207649_10036109 | Ga0207649_100361092 | 190 |
| 438 | 3300025923 | Ga0207681_10030082 | Ga0207681_100300822 | 190 |
| 439 | 3300025923 | Ga0207681_10244260 | Ga0207681_102442602 | 190 |
| 440 | 3300025924 | Ga0207694_10181287 | Ga0207694_101812872 | 190 |
| 441 | 3300025925 | Ga0207650_10067025 | Ga0207650_100670251 | 190 |
| 442 | 3300025926 | Ga0207659_10001999 | Ga0207659_1000199912 | 190 |
| 443 | 3300025926 | Ga0207659_10157041 | Ga0207659_101570412 | 190 |
| 444 | 3300025931 | Ga0207644_10009759 | Ga0207644_100097595 | 190 |
| 445 | 3300025931 | Ga0207644_10182744 | Ga0207644_101827442 | 190 |
| 446 | 3300025933 | Ga0207706_10070215 | Ga0207706_100702152 | 190 |
| 447 | 3300025933 | Ga0207706_10234349 | Ga0207706_102343492 | 190 |
| 448 | 3300025934 | Ga0207686_10497364 | Ga0207686_104973642 | 190 |
| 449 | 3300025935 | Ga0207709_10000955 | Ga0207709_1000095513 | 190 |
| 450 | 3300025937 | Ga0207669_10003418 | Ga0207669_100034184 | 190 |
| 451 | 3300025938 | Ga0207704_10039976 | Ga0207704_100399762 | 190 |
| 452 | 3300025940 | Ga0207691_10000279 | Ga0207691_1000027914 | 190 |
| 453 | 3300025940 | Ga0207691_10048202 | Ga0207691_100482025 | 190 |
| 454 | 3300025940 | Ga0207691_10086305 | Ga0207691_100863053 | 190 |
| 455 | 3300025940 | Ga0207691_10477071 | Ga0207691_104770712 | 190 |
| 456 | 3300025941 | Ga0207711_10059109 | Ga0207711_100591093 | 190 |
| 457 | 3300025945 | Ga0207679_10021574 | Ga0207679_100215742 | 190 |
| 458 | 3300025960 | Ga0207651_10002260 | Ga0207651_100022609 | 190 |
| 459 | 3300025960 | Ga0207651_10158122 | Ga0207651_101581222 | 190 |
| 460 | 3300025972 | Ga0207668_10004878 | Ga0207668_100048785 | 190 |
| 461 | 3300025972 | Ga0207668_10068451 | Ga0207668_100684512 | 190 |
| 462 | 3300025981 | Ga0207640_10451727 | Ga0207640_104517271 | 190 |
| 463 | 3300025986 | Ga0207658_10012186 | Ga0207658_100121864 | 190 |
| 464 | 3300025986 | Ga0207658_10032895 | Ga0207658_100328954 | 190 |
| 465 | 3300025986 | Ga0207658_10038643 | Ga0207658_100386432 | 190 |
| 466 | 3300026023 | Ga0207677_10003411 | Ga0207677_100034119 | 190 |
| 467 | 3300026023 | Ga0207677_10311076 | Ga0207677_103110762 | 190 |
| 468 | 3300026035 | Ga0207703_10026514 | Ga0207703_100265143 | 190 |
| 469 | 3300026041 | Ga0207639_10058518 | Ga0207639_100585182 | 190 |
| 470 | 3300026067 | Ga0207678_10017290 | Ga0207678_100172902 | 190 |
| 471 | 3300026067 | Ga0207678_10269352 | Ga0207678_102693521 | 190 |
| 472 | 3300026075 | Ga0207708_10080168 | Ga0207708_100801682 | 190 |
| 473 | 3300026088 | Ga0207641_10024408 | Ga0207641_100244085 | 190 |
| 474 | 3300026088 | Ga0207641_10035790 | Ga0207641_100357902 | 190 |
| 475 | 3300026089 | Ga0207648_10001435 | Ga0207648_1000143519 | 190 |
| 476 | 3300026089 | Ga0207648_10760263 | Ga0207648_107602631 | 190 |
| 477 | 3300026095 | Ga0207676_10077358 | Ga0207676_100773582 | 190 |
| 478 | 3300026095 | Ga0207676_10627973 | Ga0207676_106279731 | 190 |
| 479 | 3300026095 | Ga0207676_10773242 | Ga0207676_107732422 | 190 |
| 480 | 3300026118 | Ga0207675_100151102 | Ga0207675_1001511023 | 190 |
| 481 | 3300026118 | Ga0207675_100151553 | Ga0207675_1001515532 | 190 |
| 482 | 3300026121 | Ga0207683_10000003 | Ga0207683_1000000343 | 190 |
| 483 | 3300026142 | Ga0207698_10716584 | Ga0207698_107165841 | 190 |
| 484 | 3300028379 | Ga0268266_10006480 | Ga0268266_100064803 | 190 |
| 485 | 3300028379 | Ga0268266_10092762 | Ga0268266_100927623 | 190 |
| 486 | 3300028379 | Ga0268266_10194128 | Ga0268266_101941282 | 190 |
| 487 | 3300028380 | Ga0268265_10237539 | Ga0268265_102375392 | 190 |
| 488 | 3300028381 | Ga0268264_10054237 | Ga0268264_100542372 | 190 |
| 489 | 3300028381 | Ga0268264_10320925 | Ga0268264_103209252 | 190 |
| 490 | 3300031911 | Ga0307412_10057513 | Ga0307412_100575132 | 190 |
| 491 | 3300035691 | Ga0373931_0111404 | Ga0373931_0111404_849_1496 | 190 |
| 492 | 3300046525 | Ga0495663_0125654 | Ga0495663_0125654_90_764 | 190 |
| 493 | 3300046615 | Ga0495656_0000173 | Ga0495656_0000173_1801_2475 | 190 |
| 494 | 3300048090 | Ga0495615_0004467 | Ga0495615_0004467_918_1592 | 190 |
| 495 | 3300048917 | Ga0496114_0098988 | Ga0496114_0098988_1584_2258 | 190 |
| 496 | 3300048920 | Ga0496117_0023008 | Ga0496117_0023008_2940_3611 | 190 |
| 497 | 3300048921 | Ga0496118_0012382 | Ga0496118_0012382_5025_5696 | 190 |
| 498 | 3300048927 | Ga0496124_0095575 | Ga0496124_0095575_355_1026 | 190 |
| 499 | 3300048928 | Ga0496125_0037448 | Ga0496125_0037448_691_1362 | 190 |
| 500 | 3300049759 | Ga0501262_000071 | Ga0501262_000071_11555_12220 | 190 |
| 501 | 3300050494 | nmdc:mga06z11_170836_c1 | nmdc:mga06z11_170836_c1_177_848 | 190 |
| 502 | 3300050496 | nmdc:mga07m45_61284_c1 | nmdc:mga07m45_61284_c1_1266_1937 | 190 |
| 503 | iso_pu_bacteria | 2939631187 | 2939634093 | 190 |
| 504 | 3300005335 | Ga0070666_10019587 | Ga0070666_100195873 | 191 |
| 505 | 3300005340 | Ga0070689_100470872 | Ga0070689_1004708722 | 191 |
| 506 | 3300005347 | Ga0070668_100085563 | Ga0070668_1000855632 | 191 |
| 507 | 3300005356 | Ga0070674_100339262 | Ga0070674_1003392622 | 191 |
| 508 | 3300005367 | Ga0070667_100130060 | Ga0070667_1001300603 | 191 |
| 509 | 3300005367 | Ga0070667_100267749 | Ga0070667_1002677492 | 191 |
| 510 | 3300005434 | Ga0070709_10112924 | Ga0070709_101129242 | 191 |
| 511 | 3300005456 | Ga0070678_100004731 | Ga0070678_1000047312 | 191 |
| 512 | 3300005456 | Ga0070678_100489495 | Ga0070678_1004894951 | 191 |
| 513 | 3300005459 | Ga0068867_100447731 | Ga0068867_1004477312 | 191 |
| 514 | 3300005466 | Ga0070685_10437976 | Ga0070685_104379761 | 191 |
| 515 | 3300005471 | Ga0070698_100050333 | Ga0070698_1000503332 | 191 |
| 516 | 3300005530 | Ga0070679_100612385 | Ga0070679_1006123852 | 191 |
| 517 | 3300005539 | Ga0068853_100332237 | Ga0068853_1003322372 | 191 |
| 518 | 3300005543 | Ga0070672_100032742 | Ga0070672_1000327423 | 191 |
| 519 | 3300005548 | Ga0070665_100010735 | Ga0070665_10001073510 | 191 |
| 520 | 3300005564 | Ga0070664_100029213 | Ga0070664_1000292133 | 191 |
| 521 | 3300005614 | Ga0068856_100026992 | Ga0068856_1000269925 | 191 |
| 522 | 3300005616 | Ga0068852_100210387 | Ga0068852_1002103872 | 191 |
| 523 | 3300005841 | Ga0068863_100028700 | Ga0068863_1000287002 | 191 |
| 524 | 3300005843 | Ga0068860_100148128 | Ga0068860_1001481281 | 191 |
| 525 | 3300006237 | Ga0097621_100206227 | Ga0097621_1002062272 | 191 |
| 526 | 3300006237 | Ga0097621_100670258 | Ga0097621_1006702582 | 191 |
| 527 | 3300006358 | Ga0068871_100803823 | Ga0068871_1008038231 | 191 |
| 528 | 3300006871 | Ga0075434_100114823 | Ga0075434_1001148233 | 191 |
| 529 | 3300006871 | Ga0075434_100655680 | Ga0075434_1006556801 | 191 |
| 530 | 3300006881 | Ga0068865_100363561 | Ga0068865_1003635611 | 191 |
| 531 | 3300007076 | Ga0075435_100310710 | Ga0075435_1003107102 | 191 |
| 532 | 3300009093 | Ga0105240_10347509 | Ga0105240_103475092 | 191 |
| 533 | 3300009177 | Ga0105248_10414372 | Ga0105248_104143721 | 191 |
| 534 | 3300009545 | Ga0105237_10242721 | Ga0105237_102427212 | 191 |
| 535 | 3300009551 | Ga0105238_10061064 | Ga0105238_100610642 | 191 |
| 536 | 3300009553 | Ga0105249_10224426 | Ga0105249_102244263 | 191 |
| 537 | 3300010375 | Ga0105239_10171933 | Ga0105239_101719332 | 191 |
| 538 | 3300013104 | Ga0157370_10045835 | Ga0157370_100458352 | 191 |
| 539 | 3300013105 | Ga0157369_10002892 | Ga0157369_1000289210 | 191 |
| 540 | 3300013297 | Ga0157378_10680016 | Ga0157378_106800161 | 191 |
| 541 | 3300013308 | Ga0157375_10241803 | Ga0157375_102418032 | 191 |
| 542 | 3300014968 | Ga0157379_10394773 | Ga0157379_103947732 | 191 |
| 543 | 3300014968 | Ga0157379_10716643 | Ga0157379_107166432 | 191 |
| 544 | 3300014969 | Ga0157376_10022890 | Ga0157376_100228904 | 191 |
| 545 | 3300025903 | Ga0207680_10114712 | Ga0207680_101147122 | 191 |
| 546 | 3300025913 | Ga0207695_10287526 | Ga0207695_102875262 | 191 |
| 547 | 3300025914 | Ga0207671_10126117 | Ga0207671_101261172 | 191 |
| 548 | 3300025924 | Ga0207694_10301474 | Ga0207694_103014742 | 191 |
| 549 | 3300025941 | Ga0207711_10143534 | Ga0207711_101435343 | 191 |
| 550 | 3300025945 | Ga0207679_10461456 | Ga0207679_104614562 | 191 |
| 551 | 3300025960 | Ga0207651_10508839 | Ga0207651_105088391 | 191 |
| 552 | 3300025981 | Ga0207640_10077818 | Ga0207640_100778182 | 191 |
| 553 | 3300025986 | Ga0207658_10021840 | Ga0207658_100218402 | 191 |
| 554 | 3300025986 | Ga0207658_10474753 | Ga0207658_104747532 | 191 |
| 555 | 3300026078 | Ga0207702_10013354 | Ga0207702_100133545 | 191 |
| 556 | 3300026088 | Ga0207641_10304160 | Ga0207641_103041601 | 191 |
| 557 | 3300026089 | Ga0207648_10028568 | Ga0207648_100285685 | 191 |
| 558 | 3300026121 | Ga0207683_10005506 | Ga0207683_100055065 | 191 |
| 559 | 3300026142 | Ga0207698_10389250 | Ga0207698_103892502 | 191 |
| 560 | 3300027695 | Ga0209966_1021715 | Ga0209966_10217151 | 191 |
| 561 | 3300027717 | Ga0209998_10023613 | Ga0209998_100236131 | 191 |
| 562 | 3300027876 | Ga0209974_10017806 | Ga0209974_100178061 | 191 |
| 563 | 3300028380 | Ga0268265_10172771 | Ga0268265_101727712 | 191 |
| 564 | 3300028381 | Ga0268264_10017610 | Ga0268264_100176105 | 191 |
| 565 | 3300035172 | Ga0373955_0323253 | Ga0373955_0323253_91_732 | 191 |
| 566 | 3300035692 | Ga0373935_0389151 | Ga0373935_0389151_141_782 | 191 |
| 567 | 3300035724 | Ga0373933_0279409 | Ga0373933_0279409_408_1049 | 191 |
| 568 | 3300036401 | Ga0373937_0246627 | Ga0373937_0246627_133_774 | 191 |
| 569 | 3300037068 | Ga0373925_0080141 | Ga0373925_0080141_676_1317 | 191 |
| 570 | 3300046453 | Ga0495627_005263 | Ga0495627_005263_3926_4597 | 191 |
| 571 | 3300046515 | Ga0495620_0008396 | Ga0495620_0008396_354_1025 | 191 |
| 572 | 3300046520 | Ga0495637_0007697 | Ga0495637_0007697_4168_4839 | 191 |
| 573 | 3300046660 | Ga0495625_0112354 | Ga0495625_0112354_1161_1832 | 191 |
| 574 | 3300046665 | Ga0495661_0084956 | Ga0495661_0084956_621_1292 | 191 |
| 575 | 3300046692 | Ga0495671_0024654 | Ga0495671_0024654_269_940 | 191 |
| 576 | 3300048927 | Ga0496124_0097393 | Ga0496124_0097393_1501_2181 | 191 |
| 577 | 3300050511 | nmdc:mga08y16_237728_c1 | nmdc:mga08y16_237728_c1_174_815 | 191 |
| 578 | 3300050512 | nmdc:mga0n895_81956_c2 | nmdc:mga0n895_81956_c2_703_1350 | 191 |
| 579 | 3300050513 | nmdc:mga0rr50_113462_c1 | nmdc:mga0rr50_113462_c1_1386_2033 | 191 |
| 580 | 3300053079 | Ga0500610_0000979 | Ga0500610_0000979_8534_9205 | 191 |
| 581 | 3300053087 | Ga0500643_033127 | Ga0500643_033127_764_1435 | 191 |
| 582 | 3300053109 | Ga0500569_091221 | Ga0500569_091221_77_748 | 191 |
| 583 | 3300053117 | Ga0500593_001195 | Ga0500593_001195_4091_4762 | 191 |
| 584 | 3300053158 | Ga0500627_0000717 | Ga0500627_0000717_3632_4303 | 191 |
| 585 | iso_pu_bacteria | 2547132374 | 2548499110 | 191 |
| 586 | iso_pu_bacteria | 2643221570 | 2643867687 | 191 |
| 587 | iso_pu_bacteria | 2643221652 | 2644293282 | 191 |
| 588 | iso_pu_bacteria | 2643221717 | 2644648566 | 191 |
| 589 | iso_pu_bacteria | 2990710928 | 2990714005 | 191 |
| 590 | 3300001991 | JGI24743J22301_10060382 | JGI24743J22301_100603821 | 192 |
| 591 | 3300002076 | JGI24749J21850_1010698 | JGI24749J21850_10106982 | 192 |
| 592 | 3300002077 | JGI24744J21845_10036270 | JGI24744J21845_100362701 | 192 |
| 593 | 3300002239 | JGI24034J26672_10005856 | JGI24034J26672_100058563 | 192 |
| 594 | 3300002459 | JGI24751J29686_10015244 | JGI24751J29686_100152442 | 192 |
| 595 | 3300005327 | Ga0070658_10016361 | Ga0070658_100163615 | 192 |
| 596 | 3300005329 | Ga0070683_100004377 | Ga0070683_10000437710 | 192 |
| 597 | 3300005329 | Ga0070683_100146971 | Ga0070683_1001469712 | 192 |
| 598 | 3300005330 | Ga0070690_100013195 | Ga0070690_1000131952 | 192 |
| 599 | 3300005333 | Ga0070677_10021558 | Ga0070677_100215583 | 192 |
| 600 | 3300005334 | Ga0068869_100003158 | Ga0068869_1000031585 | 192 |
| 601 | 3300005335 | Ga0070666_10383672 | Ga0070666_103836721 | 192 |
| 602 | 3300005336 | Ga0070680_100442391 | Ga0070680_1004423911 | 192 |
| 603 | 3300005338 | Ga0068868_100058057 | Ga0068868_1000580572 | 192 |
| 604 | 3300005339 | Ga0070660_100004401 | Ga0070660_1000044013 | 192 |
| 605 | 3300005339 | Ga0070660_100025476 | Ga0070660_1000254762 | 192 |
| 606 | 3300005339 | Ga0070660_100073271 | Ga0070660_1000732712 | 192 |
| 607 | 3300005340 | Ga0070689_100379647 | Ga0070689_1003796471 | 192 |
| 608 | 3300005343 | Ga0070687_100001531 | Ga0070687_1000015317 | 192 |
| 609 | 3300005343 | Ga0070687_100139739 | Ga0070687_1001397392 | 192 |
| 610 | 3300005344 | Ga0070661_100002630 | Ga0070661_10000263010 | 192 |
| 611 | 3300005344 | Ga0070661_100009245 | Ga0070661_1000092452 | 192 |
| 612 | 3300005344 | Ga0070661_100079356 | Ga0070661_1000793563 | 192 |
| 613 | 3300005345 | Ga0070692_10493962 | Ga0070692_104939621 | 192 |
| 614 | 3300005353 | Ga0070669_100157405 | Ga0070669_1001574051 | 192 |
| 615 | 3300005353 | Ga0070669_100442967 | Ga0070669_1004429671 | 192 |
| 616 | 3300005355 | Ga0070671_100016559 | Ga0070671_1000165594 | 192 |
| 617 | 3300005364 | Ga0070673_100044482 | Ga0070673_1000444823 | 192 |
| 618 | 3300005364 | Ga0070673_100134801 | Ga0070673_1001348012 | 192 |
| 619 | 3300005364 | Ga0070673_100767715 | Ga0070673_1007677151 | 192 |
| 620 | 3300005365 | Ga0070688_100026897 | Ga0070688_1000268972 | 192 |
| 621 | 3300005365 | Ga0070688_100463764 | Ga0070688_1004637641 | 192 |
| 622 | 3300005366 | Ga0070659_100010089 | Ga0070659_1000100893 | 192 |
| 623 | 3300005366 | Ga0070659_100031851 | Ga0070659_1000318514 | 192 |
| 624 | 3300005366 | Ga0070659_100197482 | Ga0070659_1001974822 | 192 |
| 625 | 3300005367 | Ga0070667_100063102 | Ga0070667_1000631021 | 192 |
| 626 | 3300005438 | Ga0070701_10027616 | Ga0070701_100276162 | 192 |
| 627 | 3300005440 | Ga0070705_100245475 | Ga0070705_1002454752 | 192 |
| 628 | 3300005455 | Ga0070663_100023461 | Ga0070663_1000234613 | 192 |
| 629 | 3300005455 | Ga0070663_100079964 | Ga0070663_1000799641 | 192 |
| 630 | 3300005455 | Ga0070663_100824421 | Ga0070663_1008244211 | 192 |
| 631 | 3300005457 | Ga0070662_100001027 | Ga0070662_10000102714 | 192 |
| 632 | 3300005458 | Ga0070681_10217116 | Ga0070681_102171162 | 192 |
| 633 | 3300005466 | Ga0070685_10021853 | Ga0070685_100218534 | 192 |
| 634 | 3300005530 | Ga0070679_100350030 | Ga0070679_1003500302 | 192 |
| 635 | 3300005535 | Ga0070684_100109046 | Ga0070684_1001090462 | 192 |
| 636 | 3300005539 | Ga0068853_100033311 | Ga0068853_1000333113 | 192 |
| 637 | 3300005539 | Ga0068853_100053997 | Ga0068853_1000539972 | 192 |
| 638 | 3300005543 | Ga0070672_100008441 | Ga0070672_1000084412 | 192 |
| 639 | 3300005543 | Ga0070672_100029890 | Ga0070672_1000298901 | 192 |
| 640 | 3300005544 | Ga0070686_100064667 | Ga0070686_1000646673 | 192 |
| 641 | 3300005548 | Ga0070665_100116676 | Ga0070665_1001166762 | 192 |
| 642 | 3300005563 | Ga0068855_100000446 | Ga0068855_10000044647 | 192 |
| 643 | 3300005563 | Ga0068855_100082535 | Ga0068855_1000825352 | 192 |
| 644 | 3300005563 | Ga0068855_101076282 | Ga0068855_1010762821 | 192 |
| 645 | 3300005564 | Ga0070664_100012372 | Ga0070664_1000123726 | 192 |
| 646 | 3300005564 | Ga0070664_100012737 | Ga0070664_1000127375 | 192 |
| 647 | 3300005564 | Ga0070664_100178692 | Ga0070664_1001786922 | 192 |
| 648 | 3300005564 | Ga0070664_100220374 | Ga0070664_1002203742 | 192 |
| 649 | 3300005577 | Ga0068857_100182759 | Ga0068857_1001827592 | 192 |
| 650 | 3300005578 | Ga0068854_100026774 | Ga0068854_1000267742 | 192 |
| 651 | 3300005614 | Ga0068856_100003250 | Ga0068856_1000032502 | 192 |
| 652 | 3300005616 | Ga0068852_100022774 | Ga0068852_1000227742 | 192 |
| 653 | 3300005616 | Ga0068852_100029844 | Ga0068852_1000298441 | 192 |
| 654 | 3300005616 | Ga0068852_100123993 | Ga0068852_1001239932 | 192 |
| 655 | 3300005616 | Ga0068852_100173763 | Ga0068852_1001737632 | 192 |
| 656 | 3300005617 | Ga0068859_100020012 | Ga0068859_1000200123 | 192 |
| 657 | 3300005617 | Ga0068859_100300016 | Ga0068859_1003000161 | 192 |
| 658 | 3300005618 | Ga0068864_100002013 | Ga0068864_1000020138 | 192 |
| 659 | 3300005618 | Ga0068864_100176871 | Ga0068864_1001768712 | 192 |
| 660 | 3300005618 | Ga0068864_100764330 | Ga0068864_1007643301 | 192 |
| 661 | 3300005719 | Ga0068861_100128998 | Ga0068861_1001289982 | 192 |
| 662 | 3300005834 | Ga0068851_10013177 | Ga0068851_100131772 | 192 |
| 663 | 3300005834 | Ga0068851_10105043 | Ga0068851_101050432 | 192 |
| 664 | 3300005840 | Ga0068870_10144590 | Ga0068870_101445902 | 192 |
| 665 | 3300005842 | Ga0068858_100196322 | Ga0068858_1001963221 | 192 |
| 666 | 3300006237 | Ga0097621_100102903 | Ga0097621_1001029031 | 192 |
| 667 | 3300006237 | Ga0097621_100133706 | Ga0097621_1001337062 | 192 |
| 668 | 3300006237 | Ga0097621_100940884 | Ga0097621_1009408841 | 192 |
| 669 | 3300006358 | Ga0068871_100453811 | Ga0068871_1004538112 | 192 |
| 670 | 3300006931 | Ga0097620_100020012 | Ga0097620_1000200123 | 192 |
| 671 | 3300006931 | Ga0097620_100300030 | Ga0097620_1003000301 | 192 |
| 672 | 3300009148 | Ga0105243_10009495 | Ga0105243_100094953 | 192 |
| 673 | 3300010375 | Ga0105239_10426776 | Ga0105239_104267761 | 192 |
| 674 | 3300011119 | Ga0105246_10078722 | Ga0105246_100787222 | 192 |
| 675 | 3300013100 | Ga0157373_10001349 | Ga0157373_1000134915 | 192 |
| 676 | 3300013100 | Ga0157373_10245829 | Ga0157373_102458292 | 192 |
| 677 | 3300013102 | Ga0157371_10000787 | Ga0157371_1000078714 | 192 |
| 678 | 3300013102 | Ga0157371_10393340 | Ga0157371_103933401 | 192 |
| 679 | 3300013104 | Ga0157370_10011558 | Ga0157370_100115584 | 192 |
| 680 | 3300013104 | Ga0157370_10016713 | Ga0157370_100167137 | 192 |
| 681 | 3300013296 | Ga0157374_10272014 | Ga0157374_102720141 | 192 |
| 682 | 3300013306 | Ga0163162_10320934 | Ga0163162_103209341 | 192 |
| 683 | 3300013307 | Ga0157372_10009210 | Ga0157372_100092103 | 192 |
| 684 | 3300013307 | Ga0157372_10052329 | Ga0157372_100523295 | 192 |
| 685 | 3300013307 | Ga0157372_10145117 | Ga0157372_101451171 | 192 |
| 686 | 3300013307 | Ga0157372_10464124 | Ga0157372_104641241 | 192 |
| 687 | 3300013308 | Ga0157375_10251633 | Ga0157375_102516332 | 192 |
| 688 | 3300013308 | Ga0157375_11016383 | Ga0157375_110163831 | 192 |
| 689 | 3300014325 | Ga0163163_10007489 | Ga0163163_100074892 | 192 |
| 690 | 3300014968 | Ga0157379_10037583 | Ga0157379_100375835 | 192 |
| 691 | 3300025315 | Ga0207697_10000102 | Ga0207697_1000010224 | 192 |
| 692 | 3300025321 | Ga0207656_10132904 | Ga0207656_101329041 | 192 |
| 693 | 3300025901 | Ga0207688_10000286 | Ga0207688_1000028614 | 192 |
| 694 | 3300025903 | Ga0207680_10008569 | Ga0207680_100085694 | 192 |
| 695 | 3300025904 | Ga0207647_10101368 | Ga0207647_101013681 | 192 |
| 696 | 3300025907 | Ga0207645_10000437 | Ga0207645_1000043724 | 192 |
| 697 | 3300025907 | Ga0207645_10159068 | Ga0207645_101590682 | 192 |
| 698 | 3300025908 | Ga0207643_10001528 | Ga0207643_1000152812 | 192 |
| 699 | 3300025917 | Ga0207660_10157013 | Ga0207660_101570133 | 192 |
| 700 | 3300025917 | Ga0207660_10447117 | Ga0207660_104471172 | 192 |
| 701 | 3300025918 | Ga0207662_10006635 | Ga0207662_100066356 | 192 |
| 702 | 3300025919 | Ga0207657_10006421 | Ga0207657_100064212 | 192 |
| 703 | 3300025919 | Ga0207657_10027114 | Ga0207657_100271142 | 192 |
| 704 | 3300025919 | Ga0207657_10027676 | Ga0207657_100276762 | 192 |
| 705 | 3300025920 | Ga0207649_10005560 | Ga0207649_100055603 | 192 |
| 706 | 3300025920 | Ga0207649_10167970 | Ga0207649_101679702 | 192 |
| 707 | 3300025921 | Ga0207652_10096020 | Ga0207652_100960202 | 192 |
| 708 | 3300025923 | Ga0207681_10089930 | Ga0207681_100899302 | 192 |
| 709 | 3300025925 | Ga0207650_10002517 | Ga0207650_100025172 | 192 |
| 710 | 3300025931 | Ga0207644_10009310 | Ga0207644_100093104 | 192 |
| 711 | 3300025931 | Ga0207644_10378861 | Ga0207644_103788612 | 192 |
| 712 | 3300025932 | Ga0207690_10000485 | Ga0207690_1000048516 | 192 |
| 713 | 3300025932 | Ga0207690_10665547 | Ga0207690_106655471 | 192 |
| 714 | 3300025933 | Ga0207706_10000023 | Ga0207706_1000002348 | 192 |
| 715 | 3300025933 | Ga0207706_10000774 | Ga0207706_100007746 | 192 |
| 716 | 3300025933 | Ga0207706_10074987 | Ga0207706_100749873 | 192 |
| 717 | 3300025935 | Ga0207709_10002740 | Ga0207709_100027406 | 192 |
| 718 | 3300025936 | Ga0207670_10342238 | Ga0207670_103422381 | 192 |
| 719 | 3300025940 | Ga0207691_10019010 | Ga0207691_100190103 | 192 |
| 720 | 3300025942 | Ga0207689_10000356 | Ga0207689_100003565 | 192 |
| 721 | 3300025942 | Ga0207689_10506489 | Ga0207689_105064891 | 192 |
| 722 | 3300025944 | Ga0207661_10289401 | Ga0207661_102894012 | 192 |
| 723 | 3300025945 | Ga0207679_10007168 | Ga0207679_100071686 | 192 |
| 724 | 3300025945 | Ga0207679_10091838 | Ga0207679_100918382 | 192 |
| 725 | 3300025945 | Ga0207679_10349099 | Ga0207679_103490991 | 192 |
| 726 | 3300025949 | Ga0207667_10004129 | Ga0207667_1000412911 | 192 |
| 727 | 3300025949 | Ga0207667_10303021 | Ga0207667_103030212 | 192 |
| 728 | 3300025960 | Ga0207651_10326950 | Ga0207651_103269501 | 192 |
| 729 | 3300025972 | Ga0207668_10539384 | Ga0207668_105393842 | 192 |
| 730 | 3300025981 | Ga0207640_10004855 | Ga0207640_100048555 | 192 |
| 731 | 3300025981 | Ga0207640_10167070 | Ga0207640_101670702 | 192 |
| 732 | 3300025986 | Ga0207658_10102385 | Ga0207658_101023852 | 192 |
| 733 | 3300025986 | Ga0207658_10360044 | Ga0207658_103600442 | 192 |
| 734 | 3300026023 | Ga0207677_10124469 | Ga0207677_101244691 | 192 |
| 735 | 3300026023 | Ga0207677_10296732 | Ga0207677_102967322 | 192 |
| 736 | 3300026035 | Ga0207703_10059806 | Ga0207703_100598062 | 192 |
| 737 | 3300026041 | Ga0207639_10002492 | Ga0207639_1000249210 | 192 |
| 738 | 3300026041 | Ga0207639_10483254 | Ga0207639_104832541 | 192 |
| 739 | 3300026067 | Ga0207678_10074000 | Ga0207678_100740001 | 192 |
| 740 | 3300026075 | Ga0207708_10000864 | Ga0207708_1000086412 | 192 |
| 741 | 3300026078 | Ga0207702_10000523 | Ga0207702_100005236 | 192 |
| 742 | 3300026095 | Ga0207676_10027357 | Ga0207676_100273572 | 192 |
| 743 | 3300026095 | Ga0207676_10336916 | Ga0207676_103369161 | 192 |
| 744 | 3300026116 | Ga0207674_10219375 | Ga0207674_102193752 | 192 |
| 745 | 3300026116 | Ga0207674_10396910 | Ga0207674_103969102 | 192 |
| 746 | 3300026118 | Ga0207675_100007608 | Ga0207675_1000076089 | 192 |
| 747 | 3300026118 | Ga0207675_100032799 | Ga0207675_1000327995 | 192 |
| 748 | 3300026121 | Ga0207683_10004027 | Ga0207683_1000402712 | 192 |
| 749 | 3300026142 | Ga0207698_10058979 | Ga0207698_100589792 | 192 |
| 750 | 3300026142 | Ga0207698_10063574 | Ga0207698_100635742 | 192 |
| 751 | 3300026142 | Ga0207698_10128256 | Ga0207698_101282562 | 192 |
| 752 | 3300026142 | Ga0207698_10188136 | Ga0207698_101881363 | 192 |
| 753 | 3300027614 | Ga0209970_1021239 | Ga0209970_10212392 | 192 |
| 754 | 3300027665 | Ga0209983_1001514 | Ga0209983_10015144 | 192 |
| 755 | 3300027876 | Ga0209974_10015348 | Ga0209974_100153482 | 192 |
| 756 | 3300031235 | Ga0265330_10002123 | Ga0265330_1000212311 | 192 |
| 757 | 3300031238 | Ga0265332_10001981 | Ga0265332_100019815 | 192 |
| 758 | 3300031242 | Ga0265329_10003194 | Ga0265329_100031944 | 192 |
| 759 | 3300031250 | Ga0265331_10003705 | Ga0265331_100037056 | 192 |
| 760 | 3300031251 | Ga0265327_10003393 | Ga0265327_1000339310 | 192 |
| 761 | 3300031344 | Ga0265316_10018501 | Ga0265316_100185015 | 192 |
| 762 | 3300031595 | Ga0265313_10054495 | Ga0265313_100544952 | 192 |
| 763 | 3300031712 | Ga0265342_10006293 | Ga0265342_100062933 | 192 |
| 764 | 3300031901 | Ga0307406_10260293 | Ga0307406_102602932 | 192 |
| 765 | 3300031911 | Ga0307412_10007471 | Ga0307412_100074715 | 192 |
| 766 | 3300035111 | Ga0373923_0092136 | Ga0373923_0092136_136_786 | 192 |
| 767 | 3300035120 | Ga0373957_0185065 | Ga0373957_0185065_94_744 | 192 |
| 768 | 3300035172 | Ga0373955_0213488 | Ga0373955_0213488_52_702 | 192 |
| 769 | 3300035410 | Ga0373924_0091205 | Ga0373924_0091205_519_1169 | 192 |
| 770 | 3300036401 | Ga0373937_0080973 | Ga0373937_0080973_2293_2943 | 192 |
| 771 | 3300037466 | Ga0395898_0010634 | Ga0395898_0010634_5922_6599 | 192 |
| 772 | 3300038443 | Ga0395901_0404985 | Ga0395901_0404985_573_1250 | 192 |
| 773 | 3300041491 | Ga0451833_1230188 | Ga0451833_1230188_201_875 | 192 |
| 774 | 3300046537 | Ga0495598_0089592 | Ga0495598_0089592_323_988 | 192 |
| 775 | 3300048903 | Ga0496100_0141066 | Ga0496100_0141066_748_1413 | 192 |
| 776 | 3300048904 | Ga0496101_0008759 | Ga0496101_0008759_5925_6590 | 192 |
| 777 | 3300048904 | Ga0496101_0115314 | Ga0496101_0115314_652_1302 | 192 |
| 778 | 3300048905 | Ga0496102_0033317 | Ga0496102_0033317_117_767 | 192 |
| 779 | 3300048907 | Ga0496104_0281717 | Ga0496104_0281717_142_807 | 192 |
| 780 | 3300048908 | Ga0496105_0105152 | Ga0496105_0105152_396_1061 | 192 |
| 781 | 3300048909 | Ga0496106_0002076 | Ga0496106_0002076_12540_13190 | 192 |
| 782 | 3300048909 | Ga0496106_0083861 | Ga0496106_0083861_322_987 | 192 |
| 783 | 3300048910 | Ga0496107_0037822 | Ga0496107_0037822_1623_2273 | 192 |
| 784 | 3300048910 | Ga0496107_0537095 | Ga0496107_0537095_170_835 | 192 |
| 785 | 3300048910 | Ga0496107_0627113 | Ga0496107_0627113_86_736 | 192 |
| 786 | 3300048911 | Ga0496108_0191551 | Ga0496108_0191551_1044_1709 | 192 |
| 787 | 3300048913 | Ga0496110_0011634 | Ga0496110_0011634_5918_6583 | 192 |
| 788 | 3300048913 | Ga0496110_0261858 | Ga0496110_0261858_159_809 | 192 |
| 789 | 3300048914 | Ga0496111_0120593 | Ga0496111_0120593_625_1290 | 192 |
| 790 | 3300048914 | Ga0496111_0653545 | Ga0496111_0653545_81_731 | 192 |
| 791 | 3300053121 | Ga0500607_004546 | Ga0500607_004546_4297_4968 | 192 |
| 792 | 3300003773 | Ga0055537_1000250 | Ga0055537_100025031 | 193 |
| 793 | 3300003784 | Ga0055534_1000016 | Ga0055534_1000016139 | 193 |
| 794 | 3300003790 | Ga0055528_1000429 | Ga0055528_100042912 | 193 |
| 795 | 3300006177 | Ga0075362_10094089 | Ga0075362_100940892 | 193 |
| 796 | 3300006178 | Ga0075367_10006590 | Ga0075367_100065902 | 193 |
| 797 | 3300006353 | Ga0075370_10025457 | Ga0075370_100254573 | 193 |
| 798 | 3300006948 | Ga0099826_10000894 | Ga0099826_1000089412 | 193 |
| 799 | 3300014969 | Ga0157376_10564218 | Ga0157376_105642181 | 193 |
| 800 | 3300025263 | Ga0209565_1000098 | Ga0209565_100009839 | 193 |
| 801 | 3300025273 | Ga0209673_1000058 | Ga0209673_1000058212 | 193 |
| 802 | 3300025291 | Ga0209675_1000010 | Ga0209675_100001054 | 193 |
| 803 | 3300025294 | Ga0209025_1034891 | Ga0209025_10348912 | 193 |
| 804 | 3300027666 | Ga0209282_1000362 | Ga0209282_100036210 | 193 |
| 805 | 3300041486 | Ga0451807_1548440 | Ga0451807_1548440_203_925 | 193 |
| 806 | 3300044683 | Ga0466965_0146971 | Ga0466965_0146971_459_1133 | 193 |
| 807 | 3300044901 | Ga0466960_0008038 | Ga0466960_0008038_261_935 | 193 |
| 808 | 3300048925 | Ga0496122_0055704 | Ga0496122_0055704_1962_2639 | 193 |
| 809 | 3300048926 | Ga0496123_0086477 | Ga0496123_0086477_532_1209 | 193 |
| 810 | 3300048927 | Ga0496124_0176589 | Ga0496124_0176589_123_800 | 193 |
| 811 | 3300050490 | nmdc:mga03n38_60683_c1 | nmdc:mga03n38_60683_c1_532_1206 | 193 |
| 812 | 3300050493 | nmdc:mga0k408_15116_c1 | nmdc:mga0k408_15116_c1_740_1414 | 193 |
| 813 | 3300050496 | nmdc:mga07m45_26743_c1 | nmdc:mga07m45_26743_c1_692_1366 | 193 |
| 814 | 3300050516 | nmdc:mga0sz30_240354_c1 | nmdc:mga0sz30_240354_c1_74_754 | 193 |
| 815 | 3300053136 | Ga0500559_0175136 | Ga0500559_0175136_321_992 | 193 |
| 816 | iso_pu_bacteria | 2881101125 | 2881103369 | 193 |
| 817 | 3300005331 | Ga0070670_100011387 | Ga0070670_1000113876 | 194 |
| 818 | 3300005355 | Ga0070671_100366398 | Ga0070671_1003663981 | 194 |
| 819 | 3300005618 | Ga0068864_100001839 | Ga0068864_1000018399 | 194 |
| 820 | 3300005618 | Ga0068864_100073958 | Ga0068864_1000739583 | 194 |
| 821 | 3300005841 | Ga0068863_100042608 | Ga0068863_1000426084 | 194 |
| 822 | 3300006880 | Ga0075429_100031290 | Ga0075429_1000312905 | 194 |
| 823 | 3300014325 | Ga0163163_10019390 | Ga0163163_100193905 | 194 |
| 824 | 3300025273 | Ga0209673_1002131 | Ga0209673_100213110 | 194 |
| 825 | 3300025925 | Ga0207650_10047981 | Ga0207650_100479814 | 194 |
| 826 | 3300025925 | Ga0207650_10128554 | Ga0207650_101285543 | 194 |
| 827 | 3300025931 | Ga0207644_10297098 | Ga0207644_102970982 | 194 |
| 828 | 3300026088 | Ga0207641_10004011 | Ga0207641_100040113 | 194 |
| 829 | 3300026095 | Ga0207676_10004021 | Ga0207676_100040213 | 194 |
| 830 | 3300026095 | Ga0207676_10017450 | Ga0207676_100174505 | 194 |
| 831 | 3300048912 | Ga0496109_0348468 | Ga0496109_0348468_179_904 | 194 |
| 832 | 3300048915 | Ga0496112_0124087 | Ga0496112_0124087_601_1326 | 194 |
| 833 | 3300050508 | nmdc:mga09592_3416_c1 | nmdc:mga09592_3416_c1_7172_7798 | 194 |
| 834 | 3300050509 | nmdc:mga0qj67_46701_c1 | nmdc:mga0qj67_46701_c1_1066_1692 | 194 |
| 835 | 3300005289 | Ga0065704_10370634 | Ga0065704_103706341 | 195 |
| 836 | 3300006195 | Ga0075366_10018033 | Ga0075366_100180332 | 195 |
| 837 | 3300006353 | Ga0075370_10028330 | Ga0075370_100283302 | 195 |
| 838 | 3300027252 | Ga0209973_1000393 | Ga0209973_10003932 | 195 |
| 839 | 3300027876 | Ga0209974_10001817 | Ga0209974_100018174 | 195 |
| 840 | 3300028794 | Ga0307515_10000084 | Ga0307515_10000084209 | 195 |
| 841 | 3300031456 | Ga0307513_10000029 | Ga0307513_10000029137 | 195 |
| 842 | 3300031456 | Ga0307513_10006829 | Ga0307513_100068295 | 195 |
| 843 | 3300031548 | Ga0307408_100045466 | Ga0307408_1000454662 | 195 |
| 844 | 3300031649 | Ga0307514_10003041 | Ga0307514_1000304112 | 195 |
| 845 | 3300031901 | Ga0307406_10002039 | Ga0307406_100020395 | 195 |
| 846 | 3300041451 | Ga0451791_0536485 | Ga0451791_0536485_712_1359 | 195 |
| 847 | 3300046558 | Ga0495633_0001069 | Ga0495633_0001069_2977_3609 | 195 |
| 848 | 3300048925 | Ga0496122_0268808 | Ga0496122_0268808_287_919 | 195 |
| 849 | 3300048926 | Ga0496123_0114023 | Ga0496123_0114023_136_768 | 195 |
| 850 | 3300048927 | Ga0496124_0239005 | Ga0496124_0239005_523_1164 | 195 |
| 851 | 3300048928 | Ga0496125_0025807 | Ga0496125_0025807_2854_3495 | 195 |
| 852 | 3300050493 | nmdc:mga0k408_50285_c1 | nmdc:mga0k408_50285_c1_1167_1805 | 195 |
| 853 | 3300050496 | nmdc:mga07m45_63901_c1 | nmdc:mga07m45_63901_c1_506_1144 | 195 |
| 854 | 3300053093 | Ga0500651_0009638 | Ga0500651_0009638_4754_5398 | 195 |
| 855 | iso_pu_bacteria | 2643221628 | 2644162130 | 196 |
| 856 | iso_pu_bacteria | 2842677519 | 2842680551 | 196 |
| 857 | iso_pu_bacteria | 2904449895 | 2904450803 | 196 |
| 858 | iso_pu_bacteria | 2904456579 | 2904459697 | 196 |
| 859 | iso_pu_bacteria | 2919462493 | 2919462667 | 196 |
| 860 | iso_pu_bacteria | 2929520902 | 2929521521 | 196 |
| 861 | iso_pu_bacteria | 2945945610 | 2945949535 | 196 |
| 862 | iso_pu_bacteria | 2945972063 | 2945973579 | 196 |
| 863 | iso_pu_bacteria | 2954767861 | 2954770805 | 196 |
| 864 | 3300005367 | Ga0070667_100088808 | Ga0070667_1000888082 | 197 |
| 865 | 3300005548 | Ga0070665_100012532 | Ga0070665_1000125323 | 197 |
| 866 | 3300011119 | Ga0105246_10559291 | Ga0105246_105592911 | 197 |
| 867 | 3300014969 | Ga0157376_10497982 | Ga0157376_104979822 | 197 |
| 868 | 3300017792 | Ga0163161_10020791 | Ga0163161_100207913 | 197 |
| 869 | 3300028379 | Ga0268266_10450444 | Ga0268266_104504442 | 197 |
| 870 | 3300046460 | Ga0495638_0039490 | Ga0495638_0039490_1625_2332 | 197 |
| 871 | 3300046513 | Ga0495616_0002386 | Ga0495616_0002386_2275_2982 | 197 |
| 872 | 3300046515 | Ga0495620_0043110 | Ga0495620_0043110_228_935 | 197 |
| 873 | 3300046518 | Ga0495631_0003838 | Ga0495631_0003838_3402_4109 | 197 |
| 874 | 3300046520 | Ga0495637_0066254 | Ga0495637_0066254_14_694 | 197 |
| 875 | 3300046522 | Ga0495643_0017713 | Ga0495643_0017713_2243_2899 | 197 |
| 876 | 3300046530 | Ga0495654_0029156 | Ga0495654_0029156_739_1446 | 197 |
| 877 | 3300046539 | Ga0495621_0027512 | Ga0495621_0027512_888_1595 | 197 |
| 878 | 3300046557 | Ga0495622_0021877 | Ga0495622_0021877_183_890 | 197 |
| 879 | 3300046660 | Ga0495625_0069985 | Ga0495625_0069985_59_766 | 197 |
| 880 | 3300048925 | Ga0496122_0038114 | Ga0496122_0038114_2155_2862 | 197 |
| 881 | 3300048926 | Ga0496123_0133230 | Ga0496123_0133230_16_723 | 197 |
| 882 | 3300048929 | Ga0496126_0106125 | Ga0496126_0106125_1224_1931 | 197 |
| 883 | 3300053093 | Ga0500651_0000057 | Ga0500651_0000057_22008_22715 | 197 |
| 884 | 3300053108 | Ga0500562_016023 | Ga0500562_016023_311_1018 | 197 |
| 885 | 3300053116 | Ga0500592_002926 | Ga0500592_002926_1725_2405 | 197 |
| 886 | 3300053118 | Ga0500594_0000713 | Ga0500594_0000713_3527_4234 | 197 |
| 887 | 3300053128 | Ga0500626_047139 | Ga0500626_047139_420_1100 | 197 |
| 888 | 3300053134 | Ga0500658_0000652 | Ga0500658_0000652_10828_11535 | 197 |
| 889 | 3300053134 | Ga0500658_0002198 | Ga0500658_0002198_2736_3443 | 197 |
| 890 | 3300053136 | Ga0500559_0032833 | Ga0500559_0032833_1014_1694 | 197 |
| 891 | 3300053139 | Ga0500568_0003720 | Ga0500568_0003720_3376_4083 | 197 |
| 892 | 3300053153 | Ga0500616_0021639 | Ga0500616_0021639_2413_3120 | 197 |
| 893 | iso_pu_bacteria | 2904541872 | 2904548028 | 197 |
| 894 | iso_pu_bacteria | 2929160207 | 2929161577 | 197 |
| 895 | 3300005356 | Ga0070674_100056661 | Ga0070674_1000566612 | 198 |
| 896 | 3300005456 | Ga0070678_100068267 | Ga0070678_1000682671 | 198 |
| 897 | 3300006881 | Ga0068865_100379138 | Ga0068865_1003791381 | 198 |
| 898 | 3300009036 | Ga0105244_10085085 | Ga0105244_100850851 | 198 |
| 899 | 3300025937 | Ga0207669_10072813 | Ga0207669_100728132 | 198 |
| 900 | 3300026121 | Ga0207683_10220513 | Ga0207683_102205132 | 198 |
| 901 | 3300046690 | Ga0495624_0146923 | Ga0495624_0146923_274_963 | 198 |
| 902 | 3300046691 | Ga0495670_0053506 | Ga0495670_0053506_760_1449 | 198 |
| 903 | 3300047321 | Ga0495676_0030589 | Ga0495676_0030589_2804_3520 | 198 |
| 904 | 3300047673 | Ga0495593_0053810 | Ga0495593_0053810_1284_2000 | 198 |
| 905 | 3300048089 | Ga0495614_0006224 | Ga0495614_0006224_517_1233 | 198 |
| 906 | 3300053087 | Ga0500643_016325 | Ga0500643_016325_1000_1689 | 198 |
| 907 | 3300053107 | Ga0500560_059017 | Ga0500560_059017_328_1017 | 198 |
| 908 | 3300053110 | Ga0500571_000050 | Ga0500571_000050_4596_5312 | 198 |
| 909 | 3300053120 | Ga0500597_005016 | Ga0500597_005016_2531_3220 | 198 |
| 910 | 3300053122 | Ga0500608_016553 | Ga0500608_016553_838_1554 | 198 |
| 911 | 3300053133 | Ga0500655_003462 | Ga0500655_003462_726_1415 | 198 |
| 912 | 3300053161 | Ga0500634_0063981 | Ga0500634_0063981_856_1545 | 198 |
| 913 | 3300053162 | Ga0500638_012573 | Ga0500638_012573_984_1673 | 198 |
| 914 | 3300053177 | Ga0500636_0127796 | Ga0500636_0127796_410_1126 | 198 |
| 915 | 3300013100 | Ga0157373_10030606 | Ga0157373_100306062 | 199 |
| 916 | iso_pu_bacteria | 2643221672 | 2644396094 | 199 |
| 917 | iso_pu_bacteria | 2738543019 | 2739279702 | 199 |
| 918 | iso_pu_bacteria | 2818991446 | 2819601185 | 199 |
| 919 | iso_pu_bacteria | 2842733646 | 2842736445 | 199 |
| 920 | iso_pu_bacteria | 2885192300 | 2885197020 | 199 |
| 921 | iso_pu_bacteria | 2899924645 | 2899927468 | 199 |
| 922 | iso_pu_bacteria | 2928037797 | 2928042620 | 199 |
| 923 | iso_pu_bacteria | 2928044640 | 2928048953 | 199 |
| 924 | iso_pu_bacteria | 2928051484 | 2928051503 | 199 |
| 925 | iso_pu_bacteria | 2928064002 | 2928068715 | 199 |
| 926 | iso_pu_bacteria | 2928084124 | 2928087047 | 199 |
| 927 | 3300003578 | Ga0006562J51391_1094937 | Ga0006562J51391_10949371 | 200 |
| 928 | 3300003578 | Ga0006562J51391_1094939 | Ga0006562J51391_10949393 | 200 |
| 929 | 3300006177 | Ga0075362_10035412 | Ga0075362_100354122 | 200 |
| 930 | 3300006186 | Ga0075369_10010977 | Ga0075369_100109773 | 200 |
| 931 | 3300006353 | Ga0075370_10010040 | Ga0075370_100100404 | 200 |
| 932 | 3300013100 | Ga0157373_10043408 | Ga0157373_100434082 | 200 |
| 933 | 3300014497 | Ga0182008_10009662 | Ga0182008_100096625 | 200 |
| 934 | 3300015261 | Ga0182006_1037727 | Ga0182006_10377272 | 200 |
| 935 | 3300015262 | Ga0182007_10086993 | Ga0182007_100869931 | 200 |
| 936 | 3300025303 | Ga0209051_1001474 | Ga0209051_100147414 | 200 |
| 937 | 3300048928 | Ga0496125_0111091 | Ga0496125_0111091_170_838 | 200 |
| 938 | 3300050489 | nmdc:mga03683_10580_c1 | nmdc:mga03683_10580_c1_2291_2959 | 200 |
| 939 | 3300002773 | JGI25152J39213_1014596 | JGI25152J39213_10145961 | 201 |
| 940 | 3300003187 | JGI25151J46595_10014901 | JGI25151J46595_100149013 | 201 |
| 941 | 3300003215 | JGI25153J46596_10018126 | JGI25153J46596_100181263 | 201 |
| 942 | 3300003771 | Ga0055526_1027606 | Ga0055526_10276062 | 201 |
| 943 | 3300003773 | Ga0055537_1011777 | Ga0055537_10117772 | 201 |
| 944 | 3300003775 | Ga0055524_1058711 | Ga0055524_10587111 | 201 |
| 945 | 3300003790 | Ga0055528_1023605 | Ga0055528_10236052 | 201 |
| 946 | 3300013306 | Ga0163162_10184469 | Ga0163162_101844692 | 201 |
| 947 | 3300013308 | Ga0157375_10086926 | Ga0157375_100869262 | 201 |
| 948 | 3300046539 | Ga0495621_0004441 | Ga0495621_0004441_2515_3189 | 201 |
| 949 | 3300002774 | JGI25150J39212_1006276 | JGI25150J39212_10062762 | 202 |
| 950 | 3300002987 | JGI25159J45721_1016195 | JGI25159J45721_10161951 | 202 |
| 951 | 3300003323 | rootH1_10037348 | rootH1_100373482 | 202 |
| 952 | 3300003354 | JGI25160J50197_1013801 | JGI25160J50197_10138013 | 202 |
| 953 | 3300003374 | JGI25161J50226_1005621 | JGI25161J50226_10056213 | 202 |
| 954 | 3300003578 | Ga0006562J51391_1053276 | Ga0006562J51391_10532763 | 202 |
| 955 | 3300003781 | Ga0055536_1009680 | Ga0055536_10096802 | 202 |
| 956 | 3300003784 | Ga0055534_1004592 | Ga0055534_10045923 | 202 |
| 957 | 3300003791 | Ga0055530_10005015 | Ga0055530_100050157 | 202 |
| 958 | 3300004625 | Ga0055543_1040888 | Ga0055543_10408881 | 202 |
| 959 | 3300005262 | Ga0065165_1085222 | Ga0065165_10852221 | 202 |
| 960 | 3300005614 | Ga0068856_101004519 | Ga0068856_1010045191 | 202 |
| 961 | 3300005834 | Ga0068851_10009906 | Ga0068851_100099062 | 202 |
| 962 | 3300013102 | Ga0157371_10154657 | Ga0157371_101546572 | 202 |
| 963 | 3300025245 | Ga0207425_1007188 | Ga0207425_10071882 | 202 |
| 964 | 3300025258 | Ga0209129_1000024 | Ga0209129_100002450 | 202 |
| 965 | 3300025263 | Ga0209565_1000603 | Ga0209565_10006035 | 202 |
| 966 | 3300025263 | Ga0209565_1006214 | Ga0209565_10062142 | 202 |
| 967 | 3300025273 | Ga0209673_1004152 | Ga0209673_10041523 | 202 |
| 968 | 3300025284 | Ga0209130_1046283 | Ga0209130_10462831 | 202 |
| 969 | 3300025291 | Ga0209675_1007565 | Ga0209675_10075652 | 202 |
| 970 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028308 | 202 |
| 971 | 3300025292 | Ga0209676_1000317 | Ga0209676_100031722 | 202 |
| 972 | 3300025294 | Ga0209025_1008081 | Ga0209025_10080815 | 202 |
| 973 | 3300025294 | Ga0209025_1115608 | Ga0209025_11156081 | 202 |
| 974 | 3300025295 | Ga0209564_1000209 | Ga0209564_1000209123 | 202 |
| 975 | 3300025295 | Ga0209564_1005094 | Ga0209564_10050945 | 202 |
| 976 | 3300025297 | Ga0209758_1013950 | Ga0209758_10139503 | 202 |
| 977 | 3300025298 | Ga0209050_1000072 | Ga0209050_100007264 | 202 |
| 978 | 3300025298 | Ga0209050_1000786 | Ga0209050_100078629 | 202 |
| 979 | 3300025299 | Ga0209256_1001798 | Ga0209256_100179816 | 202 |
| 980 | 3300025299 | Ga0209256_1007096 | Ga0209256_10070965 | 202 |
| 981 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038410 | 202 |
| 982 | 3300025302 | Ga0207426_1000053 | Ga0207426_10000535 | 202 |
| 983 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015237 | 202 |
| 984 | 3300025303 | Ga0209051_1000056 | Ga0209051_1000056163 | 202 |
| 985 | 3300025304 | Ga0209257_1000037 | Ga0209257_1000037508 | 202 |
| 986 | 3300025304 | Ga0209257_1002615 | Ga0209257_100261514 | 202 |
| 987 | 3300025321 | Ga0207656_10005124 | Ga0207656_100051242 | 202 |
| 988 | 3300050496 | nmdc:mga07m45_160285_c1 | nmdc:mga07m45_160285_c1_276_950 | 202 |
| 989 | 3300001979 | JGI24740J21852_10014074 | JGI24740J21852_100140742 | 203 |
| 990 | 3300002739 | JGI25158J39367_1009169 | JGI25158J39367_10091692 | 203 |
| 991 | 3300003758 | Ga0055532_1010963 | Ga0055532_10109631 | 203 |
| 992 | 3300003761 | Ga0055535_1000940 | Ga0055535_100094013 | 203 |
| 993 | 3300003762 | Ga0055542_1000080 | Ga0055542_100008050 | 203 |
| 994 | 3300009093 | Ga0105240_10266543 | Ga0105240_102665431 | 203 |
| 995 | 3300013104 | Ga0157370_10263071 | Ga0157370_102630712 | 203 |
| 996 | 3300014497 | Ga0182008_10107656 | Ga0182008_101076562 | 203 |
| 997 | 3300025228 | Ga0209672_103131 | Ga0209672_1031312 | 203 |
| 998 | 3300025229 | Ga0209147_100450 | Ga0209147_10045021 | 203 |
| 999 | 3300025242 | Ga0209258_100093 | Ga0209258_10009361 | 203 |
| 1000 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071028 | 203 |
| 1001 | 3300026041 | Ga0207639_10116562 | Ga0207639_101165622 | 203 |
| 1002 | 3300031251 | Ga0265327_10006673 | Ga0265327_1000667310 | 203 |
| 1003 | 3300041452 | Ga0451793_0083951 | Ga0451793_0083951_336_1025 | 203 |
| 1004 | 3300048920 | Ga0496117_0030845 | Ga0496117_0030845_2535_3215 | 203 |
| 1005 | 3300048921 | Ga0496118_0013172 | Ga0496118_0013172_4147_4827 | 203 |
| 1006 | 3300048925 | Ga0496122_0181182 | Ga0496122_0181182_486_1166 | 203 |
| 1007 | 3300053121 | Ga0500607_129554 | Ga0500607_129554_359_1039 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o1w-assembly2.cif.gz_B | crystal structure of colwellia psychrerythraea cytochrome c | 0.9758 | 39 | 102 |
| 2zzs-assembly1.cif.gz_A | crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 | 0.9695 | 39 | 103 |
| 1m70-assembly2.cif.gz_B | crystal structure of oxidized recombinant cytochrome c4 from pseudomonas stutzeri | 0.9567 | 39 | 203 |
| 8smr-assembly1.cif.gz_N | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.9408 | 22 | 203 |
| 6q2u-assembly1.cif.gz_A | structure of cytochrome c4 from pseudomonas aeruginosa | 0.9357 | 22 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4o1wD00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.984 | 39 | 102 | 1.10.760.10 |
| 2zzsM00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9631 | 39 | 101 | 1.10.760.10 |
| 3vrdA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9532 | 39 | 105 | 1.10.760.10 |
| 1h1oB02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9513 | 118 | 202 | 1.10.760.10 |
| 2zzsS00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9485 | 39 | 103 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2UH10-F1-model_v4 | C-type cytochrome | 0.999 | 119 | 203 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-C9Y823-F1-model_v4 | Cytochrome c4 | 0.9946 | 23 | 203 |
GO:0005506
GO:0009055 GO:0020037 GO:0042597 |
| AF-A0A521ZL93-F1-model_v4 | C-type cytochrome | 0.9937 | 57 | 203 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A258REN4-F1-model_v4 | Cytochrome c domain-containing protein | 0.9891 | 84 | 203 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-C9Y823-F1-model_v4 | Cytochrome c4 | 0.9834 | 23 | 203 |
GO:0005506
GO:0009055 GO:0020037 GO:0042597 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar