F488036

General Info

Members Datasets Scaffolds Average Seq Length
1007 431 974 207

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10326415|Ga0157375_103264151
Length 240
Sequence MLCFFIDDAPFGGAAPDPSRKELTNMSRNRLFALIVAMLPAAVAAQEAAAPAKVDLAKAQQTATQICAACHGADGNSAVAANPNLAGQHADYITLQLAHFKAGIRVNAVMQGMVATLSDADMKALGVYFSQQKPKGQAAKDPATVKLAQRLYRGGDAVTAVPACASCHSPTGAGIAKNFPRVGGQYADYSYAQLKAFKAGERGADKEGKDVNGKIMATIAGRMTDAQMKAVADYMAGLRN

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
6 2643221652 Acidovorax sp. Root402 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2738543019 Variovorax sp. GV040 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2818991446 Variovorax sp. 1180 Isolate Unclassified
13 2842677519 Variovorax sp. R-72495 Isolate Unclassified
14 2842733646 Variovorax sp. R-72446 Isolate Unclassified
15 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
16 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
19 2904456579 Variovorax sp. 2002 Isolate Unclassified
20 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
21 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
22 2928037797 Variovorax sp. 1126 Isolate Unclassified
23 2928044640 Variovorax sp. 1128 Isolate Unclassified
24 2928051484 Variovorax sp. 1133 Isolate Unclassified
25 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
26 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
27 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
28 2929520902 Variovorax beijingensis 502 Isolate Unclassified
29 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
30 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
31 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
32 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
33 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
36 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
37 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
38 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
39 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
40 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
91 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
92 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
125 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
129 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
130 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
131 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
141 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
151 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
255 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
262 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
263 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
264 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
265 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
266 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
267 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
268 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
269 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
270 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
271 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
272 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
276 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
277 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
278 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
279 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
280 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
281 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
282 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
283 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
284 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
291 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
292 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
293 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
294 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
295 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
297 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
298 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
307 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
308 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
309 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
310 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
311 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
312 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
313 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
316 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
317 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
318 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
319 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
320 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
321 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
322 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
323 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
324 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
325 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
326 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
327 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
328 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
329 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
330 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
331 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
332 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
333 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
334 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
335 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
336 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
337 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
338 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
339 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
340 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
341 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
350 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
353 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
354 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
355 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
356 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
357 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
358 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
359 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
396 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
405 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
406 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
407 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
408 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
409 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
410 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
411 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
412 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
413 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
414 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
415 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
416 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
419 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
420 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
421 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
422 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
423 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
424 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
425 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
426 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
427 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0.3
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 0.6
Rhizoplane 3.67
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014074 3300001979 Bacteria 2962
2 JGI24743J22301_10060382 3300001991 Bacteria 780
3 JGI24749J21850_1010698 3300002076 Bacteria 1288
4 JGI24744J21845_10036270 3300002077 Bacteria 931
5 JGI24034J26672_10005856 3300002239 Bacteria 1768
6 JGI24751J29686_10015244 3300002459 Bacteria 1586
7 JGI25158J39367_1009169 3300002739 Bacteria 1360
8 JGI25152J39213_1014596 3300002773 Bacteria 1586
9 JGI25150J39212_1006276 3300002774 Bacteria 2466
10 JGI25159J45721_1016195 3300002987 Bacteria 1601
11 JGI25151J46595_10014901 3300003187 Bacteria 3450
12 JGI25153J46596_10018126 3300003215 Bacteria 2746
13 rootH1_10016509 3300003323 Bacteria 14464
14 rootH1_10037348 3300003323 Bacteria 3912
15 JGI25160J50197_1013801 3300003354 Bacteria 2736
16 JGI25161J50226_1005621 3300003374 Bacteria 2394
17 Ga0006562J51391_1053276 3300003578 Bacteria 2010
18 Ga0006562J51391_1094937 3300003578 Bacteria 4840
19 Ga0006562J51391_1094939 3300003578 Bacteria 2220
20 Ga0055532_1010963 3300003758 Bacteria 1075
21 Ga0055535_1000940 3300003761 Bacteria 19336
22 Ga0055542_1000080 3300003762 Bacteria 129634
23 Ga0055526_1027606 3300003771 Bacteria 1748
24 Ga0055537_1000250 3300003773 Bacteria 39199
25 Ga0055537_1011777 3300003773 Bacteria 1750
26 Ga0055524_1003603 3300003775 Bacteria 7465
27 Ga0055524_1044620 3300003775 Bacteria 1076
28 Ga0055524_1058711 3300003775 Bacteria 813
29 Ga0055536_1003029 3300003781 Bacteria 9187
30 Ga0055536_1006353 3300003781 Bacteria 5543
31 Ga0055536_1009680 3300003781 Bacteria 3946
32 Ga0055534_1000016 3300003784 Bacteria 144444
33 Ga0055534_1004592 3300003784 Bacteria 3941
34 Ga0055528_1000429 3300003790 Bacteria 33812
35 Ga0055528_1023605 3300003790 Bacteria 1870
36 Ga0055530_10004556 3300003791 Bacteria 7078
37 Ga0055530_10005015 3300003791 Bacteria 6529
38 Ga0055540_1002682 3300003792 Bacteria 9173
39 Ga0055540_1005224 3300003792 Bacteria 5553
40 Ga0055531_10007985 3300003794 Bacteria 5661
41 Ga0055531_10012361 3300003794 Bacteria 4024
42 Ga0055543_1040888 3300004625 Bacteria 782
43 Ga0065165_1085222 3300005262 Bacteria 813
44 Ga0065714_10101199 3300005288 Bacteria 1649
45 Ga0065704_10370634 3300005289 Bacteria 783
46 Ga0070658_10016361 3300005327 Bacteria 5937
47 Ga0070676_10241127 3300005328 Bacteria 1202
48 Ga0070676_10246805 3300005328 Unclassified 1190
49 Ga0070683_100004377 3300005329 Bacteria 11618
50 Ga0070683_100146971 3300005329 Bacteria 2234
51 Ga0070683_100526052 3300005329 Bacteria 1130
52 Ga0070690_100013195 3300005330 Bacteria 4877
53 Ga0070690_100018410 3300005330 Bacteria 4219
54 Ga0070670_100000664 3300005331 Bacteria 26740
55 Ga0070670_100011387 3300005331 Bacteria 7605
56 Ga0070670_100054285 3300005331 Bacteria 3440
57 Ga0070670_100063865 3300005331 Bacteria 3159
58 Ga0070670_100109562 3300005331 Bacteria 2379
59 Ga0070677_10021558 3300005333 Bacteria 2365
60 Ga0068869_100000984 3300005334 Bacteria 16517
61 Ga0068869_100003158 3300005334 Bacteria 10059
62 Ga0068869_100015323 3300005334 Bacteria 5139
63 Ga0068869_100555113 3300005334 Bacteria 965
64 Ga0070666_10019587 3300005335 Bacteria 4371
65 Ga0070666_10036643 3300005335 Bacteria 3257
66 Ga0070666_10186152 3300005335 Bacteria 1458
67 Ga0070666_10332672 3300005335 Bacteria 1085
68 Ga0070666_10383672 3300005335 Unclassified 1009
69 Ga0070680_100442391 3300005336 Unclassified 1110
70 Ga0068868_100035704 3300005338 Bacteria 3844
71 Ga0068868_100057089 3300005338 Unclassified 3084
72 Ga0068868_100058057 3300005338 Bacteria 3058
73 Ga0070660_100004401 3300005339 Bacteria 9735
74 Ga0070660_100025476 3300005339 Bacteria 4396
75 Ga0070660_100073271 3300005339 Bacteria 2678
76 Ga0070689_100233122 3300005340 Bacteria 1514
77 Ga0070689_100379647 3300005340 Bacteria 1191
78 Ga0070689_100470872 3300005340 Unclassified 1072
79 Ga0070687_100001531 3300005343 Bacteria 8190
80 Ga0070687_100139739 3300005343 Bacteria 1409
81 Ga0070661_100002630 3300005344 Bacteria 12289
82 Ga0070661_100009245 3300005344 Bacteria 6814
83 Ga0070661_100079356 3300005344 Bacteria 2422
84 Ga0070692_10493962 3300005345 Bacteria 792
85 Ga0070668_100001133 3300005347 Bacteria 18723
86 Ga0070668_100004017 3300005347 Bacteria 10879
87 Ga0070668_100016923 3300005347 Bacteria 5454
88 Ga0070668_100085563 3300005347 Bacteria 2478
89 Ga0070668_100366929 3300005347 Unclassified 1222
90 Ga0070669_100004906 3300005353 Bacteria 9656
91 Ga0070669_100057425 3300005353 Bacteria 2855
92 Ga0070669_100157405 3300005353 Unclassified 1763
93 Ga0070669_100207733 3300005353 Bacteria 1543
94 Ga0070669_100225936 3300005353 Unclassified 1482
95 Ga0070669_100442967 3300005353 Bacteria 1069
96 Ga0070669_100733498 3300005353 Unclassified 836
97 Ga0070675_100000235 3300005354 Bacteria 35666
98 Ga0070675_100304651 3300005354 Unclassified 1404
99 Ga0070675_100549752 3300005354 Bacteria 1044
100 Ga0070671_100003028 3300005355 Bacteria 13082
101 Ga0070671_100016559 3300005355 Bacteria 5960
102 Ga0070671_100017030 3300005355 Bacteria 5879
103 Ga0070671_100044249 3300005355 Bacteria 3699
104 Ga0070671_100082919 3300005355 Bacteria 2681
105 Ga0070671_100366398 3300005355 Bacteria 1230
106 Ga0070674_100002199 3300005356 Bacteria 10722
107 Ga0070674_100047294 3300005356 Bacteria 2946
108 Ga0070674_100056661 3300005356 Bacteria 2718
109 Ga0070674_100339262 3300005356 Unclassified 1210
110 Ga0070673_100002358 3300005364 Bacteria 11478
111 Ga0070673_100004029 3300005364 Bacteria 9249
112 Ga0070673_100044482 3300005364 Bacteria 3439
113 Ga0070673_100134801 3300005364 Bacteria 2077
114 Ga0070673_100137460 3300005364 Bacteria 2058
115 Ga0070673_100168910 3300005364 Bacteria 1866
116 Ga0070673_100335291 3300005364 Bacteria 1339
117 Ga0070673_100372401 3300005364 Bacteria 1272
118 Ga0070673_100767715 3300005364 Bacteria 888
119 Ga0070688_100026897 3300005365 Bacteria 3422
120 Ga0070688_100136286 3300005365 Unclassified 1662
121 Ga0070688_100463764 3300005365 Bacteria 949
122 Ga0070659_100010089 3300005366 Bacteria 6953
123 Ga0070659_100031851 3300005366 Bacteria 4086
124 Ga0070659_100197482 3300005366 Bacteria 1655
125 Ga0070659_100293977 3300005366 Bacteria 1353
126 Ga0070667_100002692 3300005367 Bacteria 15384
127 Ga0070667_100018346 3300005367 Bacteria 5803
128 Ga0070667_100063102 3300005367 Bacteria 3139
129 Ga0070667_100063570 3300005367 Bacteria 3128
130 Ga0070667_100088808 3300005367 Bacteria 2654
131 Ga0070667_100090414 3300005367 Bacteria 2631
132 Ga0070667_100117556 3300005367 Bacteria 2310
133 Ga0070667_100130060 3300005367 Bacteria 2196
134 Ga0070667_100267749 3300005367 Bacteria 1531
135 Ga0070667_100291921 3300005367 Bacteria 1466
136 Ga0070667_100700595 3300005367 Bacteria 937
137 Ga0070709_10112924 3300005434 Unclassified 1829
138 Ga0070701_10027616 3300005438 Bacteria 2782
139 Ga0070701_10270240 3300005438 Bacteria 1034
140 Ga0070705_100243445 3300005440 Bacteria 1258
141 Ga0070705_100245475 3300005440 Bacteria 1254
142 Ga0070700_100245619 3300005441 Unclassified 1281
143 Ga0070700_100709808 3300005441 Bacteria 800
144 Ga0070708_100000773 3300005445 Bacteria 24034
145 Ga0070663_100001362 3300005455 Bacteria 13368
146 Ga0070663_100023461 3300005455 Bacteria 4136
147 Ga0070663_100079964 3300005455 Unclassified 2400
148 Ga0070663_100230523 3300005455 Bacteria 1458
149 Ga0070663_100824421 3300005455 Bacteria 797
150 Ga0070678_100001357 3300005456 Bacteria 12997
151 Ga0070678_100004731 3300005456 Bacteria 7757
152 Ga0070678_100068267 3300005456 Bacteria 2649
153 Ga0070678_100069507 3300005456 Bacteria 2629
154 Ga0070678_100123760 3300005456 Bacteria 2043
155 Ga0070678_100489495 3300005456 Bacteria 1083
156 Ga0070662_100001027 3300005457 Bacteria 17072
157 Ga0070662_100049784 3300005457 Bacteria 3022
158 Ga0070662_100106673 3300005457 Bacteria 2128
159 Ga0070662_100205882 3300005457 Unclassified 1563
160 Ga0070681_10217116 3300005458 Bacteria 1828
161 Ga0068867_100003026 3300005459 Bacteria 11854
162 Ga0068867_100006238 3300005459 Bacteria 8439
163 Ga0068867_100447731 3300005459 Bacteria 1099
164 Ga0068867_100996351 3300005459 Bacteria 759
165 Ga0070685_10021853 3300005466 Bacteria 3480
166 Ga0070685_10437976 3300005466 Unclassified 913
167 Ga0070698_100050333 3300005471 Bacteria 4248
168 Ga0070679_100350030 3300005530 Bacteria 1425
169 Ga0070679_100612385 3300005530 Bacteria 1032
170 Ga0070684_100109046 3300005535 Bacteria 2481
171 Ga0068853_100014134 3300005539 Bacteria 6535
172 Ga0068853_100033311 3300005539 Bacteria 4370
173 Ga0068853_100053997 3300005539 Bacteria 3462
174 Ga0068853_100332237 3300005539 Bacteria 1411
175 Ga0070672_100008441 3300005543 Bacteria 7043
176 Ga0070672_100029890 3300005543 Bacteria 4089
177 Ga0070672_100032742 3300005543 Bacteria 3928
178 Ga0070672_100033175 3300005543 Bacteria 3907
179 Ga0070672_100113226 3300005543 Unclassified 2214
180 Ga0070686_100033639 3300005544 Bacteria 3151
181 Ga0070686_100064667 3300005544 Bacteria 2373
182 Ga0070665_100004180 3300005548 Bacteria 15182
183 Ga0070665_100010735 3300005548 Bacteria 9267
184 Ga0070665_100012532 3300005548 Bacteria 8544
185 Ga0070665_100077702 3300005548 Bacteria 3325
186 Ga0070665_100116676 3300005548 Bacteria 2672
187 Ga0070665_100158765 3300005548 Bacteria 2263
188 Ga0070665_100731851 3300005548 Unclassified 1002
189 Ga0070665_100988369 3300005548 Unclassified 854
190 Ga0070704_100194730 3300005549 Bacteria 1632
191 Ga0068855_100000446 3300005563 Bacteria 51081
192 Ga0068855_100082535 3300005563 Bacteria 3725
193 Ga0068855_101076282 3300005563 Bacteria 842
194 Ga0070664_100012372 3300005564 Bacteria 6935
195 Ga0070664_100012737 3300005564 Bacteria 6843
196 Ga0070664_100020447 3300005564 Bacteria 5450
197 Ga0070664_100029213 3300005564 Bacteria 4595
198 Ga0070664_100040211 3300005564 Bacteria 3942
199 Ga0070664_100178692 3300005564 Bacteria 1886
200 Ga0070664_100220374 3300005564 Bacteria 1697
201 Ga0068857_100037720 3300005577 Bacteria 4282
202 Ga0068857_100053835 3300005577 Bacteria 3570
203 Ga0068857_100182759 3300005577 Bacteria 1908
204 Ga0068857_100593300 3300005577 Bacteria 1047
205 Ga0068854_100026774 3300005578 Bacteria 3967
206 Ga0068854_100322627 3300005578 Unclassified 1256
207 Ga0068856_100003250 3300005614 Bacteria 16544
208 Ga0068856_100026992 3300005614 Bacteria 5602
209 Ga0068856_101004519 3300005614 Bacteria 852
210 Ga0070702_100128683 3300005615 Bacteria 1596
211 Ga0070702_100163520 3300005615 Unclassified 1441
212 Ga0068852_100022774 3300005616 Bacteria 5030
213 Ga0068852_100024496 3300005616 Bacteria 4879
214 Ga0068852_100029844 3300005616 Bacteria 4482
215 Ga0068852_100122460 3300005616 Bacteria 2384
216 Ga0068852_100123993 3300005616 Bacteria 2369
217 Ga0068852_100173763 3300005616 Bacteria 2021
218 Ga0068852_100210387 3300005616 Bacteria 1845
219 Ga0068852_100746476 3300005616 Bacteria 991
220 Ga0068859_100005130 3300005617 Bacteria 13302
221 Ga0068859_100020012 3300005617 Bacteria 6721
222 Ga0068859_100179498 3300005617 Bacteria 2200
223 Ga0068859_100300016 3300005617 Unclassified 1700
224 Ga0068859_101327400 3300005617 Bacteria 793
225 Ga0068864_100001839 3300005618 Bacteria 17453
226 Ga0068864_100002013 3300005618 Bacteria 16753
227 Ga0068864_100002166 3300005618 Bacteria 16217
228 Ga0068864_100073958 3300005618 Bacteria 2972
229 Ga0068864_100176227 3300005618 Unclassified 1952
230 Ga0068864_100176871 3300005618 Bacteria 1949
231 Ga0068864_100291088 3300005618 Bacteria 1527
232 Ga0068864_100764330 3300005618 Unclassified 948
233 Ga0068866_10043026 3300005718 Bacteria 2251
234 Ga0068861_100001567 3300005719 Bacteria 14538
235 Ga0068861_100026899 3300005719 Bacteria 4186
236 Ga0068861_100112565 3300005719 Bacteria 2182
237 Ga0068861_100128998 3300005719 Bacteria 2050
238 Ga0068861_100163184 3300005719 Bacteria 1840
239 Ga0068861_100197533 3300005719 Bacteria 1686
240 Ga0068861_101036623 3300005719 Unclassified 785
241 Ga0068851_10009906 3300005834 Bacteria 4438
242 Ga0068851_10013177 3300005834 Bacteria 3911
243 Ga0068851_10018615 3300005834 Bacteria 3347
244 Ga0068851_10061209 3300005834 Bacteria 1929
245 Ga0068851_10105043 3300005834 Bacteria 1502
246 Ga0068870_10004622 3300005840 Bacteria 5938
247 Ga0068870_10034754 3300005840 Bacteria 2581
248 Ga0068870_10144590 3300005840 Bacteria 1394
249 Ga0068870_10202311 3300005840 Bacteria 1205
250 Ga0068863_100002459 3300005841 Bacteria 18405
251 Ga0068863_100008456 3300005841 Bacteria 10052
252 Ga0068863_100028700 3300005841 Bacteria 5313
253 Ga0068863_100042608 3300005841 Bacteria 4313
254 Ga0068863_100136515 3300005841 Bacteria 2343
255 Ga0068863_100321307 3300005841 Bacteria 1503
256 Ga0068863_100394656 3300005841 Bacteria 1352
257 Ga0068858_100008257 3300005842 Bacteria 10008
258 Ga0068858_100018525 3300005842 Bacteria 6518
259 Ga0068858_100149379 3300005842 Bacteria 2196
260 Ga0068858_100196322 3300005842 Bacteria 1907
261 Ga0068860_100002129 3300005843 Bacteria 20879
262 Ga0068860_100014571 3300005843 Bacteria 7692
263 Ga0068860_100050601 3300005843 Bacteria 3954
264 Ga0068860_100148128 3300005843 Bacteria 2259
265 Ga0068860_100385300 3300005843 Bacteria 1384
266 Ga0068860_100697296 3300005843 Bacteria 1025
267 Ga0068862_100004308 3300005844 Bacteria 12043
268 Ga0068862_100171528 3300005844 Unclassified 1942
269 Ga0075363_100077889 3300006048 Bacteria 1809
270 Ga0075363_100102923 3300006048 Bacteria 1582
271 Ga0075364_10263172 3300006051 Bacteria 1172
272 Ga0075364_10277863 3300006051 Bacteria 1139
273 Ga0075432_10002230 3300006058 Bacteria 6452
274 Ga0075432_10153313 3300006058 Bacteria 887
275 Ga0075362_10007390 3300006177 Bacteria 4160
276 Ga0075362_10035412 3300006177 Bacteria 2179
277 Ga0075362_10094089 3300006177 Bacteria 1394
278 Ga0075362_10146377 3300006177 Bacteria 1131
279 Ga0075367_10006590 3300006178 Bacteria 5880
280 Ga0075367_10021596 3300006178 Bacteria 3599
281 Ga0075367_10039303 3300006178 Bacteria 2758
282 Ga0075369_10010977 3300006186 Bacteria 3553
283 Ga0075366_10006939 3300006195 Bacteria 6233
284 Ga0075366_10018033 3300006195 Bacteria 4074
285 Ga0075366_10034976 3300006195 Bacteria 2961
286 Ga0097621_100016802 3300006237 Bacteria 5544
287 Ga0097621_100102903 3300006237 Bacteria 2405
288 Ga0097621_100133706 3300006237 Bacteria 2113
289 Ga0097621_100191196 3300006237 Bacteria 1773
290 Ga0097621_100206227 3300006237 Bacteria 1708
291 Ga0097621_100369779 3300006237 Bacteria 1279
292 Ga0097621_100670258 3300006237 Unclassified 953
293 Ga0097621_100940884 3300006237 Bacteria 806
294 Ga0075370_10007838 3300006353 Bacteria 5462
295 Ga0075370_10010040 3300006353 Bacteria 4938
296 Ga0075370_10025457 3300006353 Bacteria 3274
297 Ga0075370_10028330 3300006353 Bacteria 3113
298 Ga0075370_10066418 3300006353 Bacteria 2058
299 Ga0075370_10209610 3300006353 Bacteria 1150
300 Ga0075370_10221471 3300006353 Bacteria 1118
301 Ga0068871_100005265 3300006358 Bacteria 9057
302 Ga0068871_100057888 3300006358 Bacteria 3154
303 Ga0068871_100103581 3300006358 Bacteria 2386
304 Ga0068871_100402945 3300006358 Bacteria 1218
305 Ga0068871_100453811 3300006358 Bacteria 1149
306 Ga0068871_100803823 3300006358 Unclassified 867
307 Ga0075434_100114823 3300006871 Bacteria 2706
308 Ga0075434_100655680 3300006871 Bacteria 1068
309 Ga0075429_100031290 3300006880 Bacteria 4624
310 Ga0068865_100122158 3300006881 Unclassified 1938
311 Ga0068865_100140568 3300006881 Bacteria 1820
312 Ga0068865_100363561 3300006881 Bacteria 1176
313 Ga0068865_100379138 3300006881 Bacteria 1153
314 Ga0097620_100005130 3300006931 Bacteria 13302
315 Ga0097620_100020012 3300006931 Bacteria 6721
316 Ga0097620_100179503 3300006931 Bacteria 2200
317 Ga0097620_100300030 3300006931 Unclassified 1700
318 Ga0097620_101327762 3300006931 Bacteria 793
319 Ga0099824_1045242 3300006942 Bacteria 932
320 Ga0099823_1000069 3300006944 Bacteria 48672
321 Ga0099826_10000894 3300006948 Bacteria 16356
322 Ga0099826_10030609 3300006948 Bacteria 3906
323 Ga0075435_100310710 3300007076 Bacteria 1349
324 Ga0105244_10085085 3300009036 Bacteria 1561
325 Ga0105240_10266543 3300009093 Bacteria 1974
326 Ga0105240_10347509 3300009093 Bacteria 1683
327 Ga0111539_10114865 3300009094 Bacteria 3157
328 Ga0105245_10563450 3300009098 Bacteria 1162
329 Ga0105247_10265201 3300009101 Bacteria 1179
330 Ga0105243_10009495 3300009148 Bacteria 7405
331 Ga0105243_10091035 3300009148 Bacteria 2511
332 Ga0105243_10274632 3300009148 Bacteria 1515
333 Ga0105243_10300230 3300009148 Bacteria 1455
334 Ga0105242_10005758 3300009176 Bacteria 9548
335 Ga0105242_10025335 3300009176 Bacteria 4694
336 Ga0105242_10156117 3300009176 Bacteria 1993
337 Ga0105248_10021876 3300009177 Bacteria 7086
338 Ga0105248_10088427 3300009177 Bacteria 3487
339 Ga0105248_10275410 3300009177 Unclassified 1895
340 Ga0105248_10384699 3300009177 Bacteria 1580
341 Ga0105248_10414372 3300009177 Bacteria 1517
342 Ga0105237_10144947 3300009545 Bacteria 2369
343 Ga0105237_10242721 3300009545 Bacteria 1803
344 Ga0105238_10061064 3300009551 Bacteria 3773
345 Ga0105238_10069168 3300009551 Bacteria 3531
346 Ga0105238_10431980 3300009551 Bacteria 1313
347 Ga0105249_10058498 3300009553 Bacteria 3532
348 Ga0105249_10224426 3300009553 Bacteria 1850
349 Ga0105249_10703870 3300009553 Bacteria 1070
350 Ga0105239_10171933 3300010375 Bacteria 2423
351 Ga0105239_10426776 3300010375 Bacteria 1502
352 Ga0105239_10909255 3300010375 Bacteria 1010
353 Ga0105246_10078722 3300011119 Unclassified 2342
354 Ga0105246_10270839 3300011119 Bacteria 1357
355 Ga0105246_10559291 3300011119 Bacteria 982
356 Ga0157373_10001349 3300013100 Bacteria 18818
357 Ga0157373_10030606 3300013100 Bacteria 3872
358 Ga0157373_10043408 3300013100 Bacteria 3211
359 Ga0157373_10245829 3300013100 Bacteria 1265
360 Ga0157371_10000787 3300013102 Bacteria 36521
361 Ga0157371_10154657 3300013102 Bacteria 1636
362 Ga0157371_10393340 3300013102 Bacteria 1013
363 Ga0157370_10011558 3300013104 Bacteria 9216
364 Ga0157370_10016713 3300013104 Bacteria 7425
365 Ga0157370_10045835 3300013104 Bacteria 4194
366 Ga0157370_10263071 3300013104 Bacteria 1594
367 Ga0157369_10002892 3300013105 Bacteria 20518
368 Ga0157374_10272014 3300013296 Bacteria 1671
369 Ga0157378_10009053 3300013297 Bacteria 8665
370 Ga0157378_10030194 3300013297 Bacteria 4789
371 Ga0157378_10081747 3300013297 Bacteria 2920
372 Ga0157378_10139525 3300013297 Bacteria 2250
373 Ga0157378_10680016 3300013297 Bacteria 1047
374 Ga0163162_10067804 3300013306 Bacteria 3618
375 Ga0163162_10141504 3300013306 Bacteria 2519
376 Ga0163162_10182650 3300013306 Bacteria 2224
377 Ga0163162_10184469 3300013306 Bacteria 2213
378 Ga0163162_10320934 3300013306 Bacteria 1681
379 Ga0163162_11565598 3300013306 Bacteria 751
380 Ga0157372_10009210 3300013307 Bacteria 10496
381 Ga0157372_10052329 3300013307 Bacteria 4546
382 Ga0157372_10145117 3300013307 Bacteria 2737
383 Ga0157372_10344546 3300013307 Bacteria 1736
384 Ga0157372_10464124 3300013307 Bacteria 1476
385 Ga0157375_10000781 3300013308 Bacteria 27817
386 Ga0157375_10009140 3300013308 Bacteria 8684
387 Ga0157375_10033977 3300013308 Bacteria 4853
388 Ga0157375_10086926 3300013308 Bacteria 3178
389 Ga0157375_10241803 3300013308 Bacteria 1965
390 Ga0157375_10251633 3300013308 Unclassified 1928
391 Ga0157375_10326415 3300013308 Bacteria 1699
392 Ga0157375_10391763 3300013308 Bacteria 1556
393 Ga0157375_11016383 3300013308 Bacteria 968
394 Ga0163163_10007489 3300014325 Bacteria 9634
395 Ga0163163_10017519 3300014325 Bacteria 6683
396 Ga0163163_10019390 3300014325 Bacteria 6387
397 Ga0163163_10135307 3300014325 Bacteria 2506
398 Ga0163163_10171958 3300014325 Bacteria 2213
399 Ga0163163_10216213 3300014325 Bacteria 1965
400 Ga0163163_10256732 3300014325 Bacteria 1799
401 Ga0157380_10020902 3300014326 Bacteria 4902
402 Ga0157380_10078238 3300014326 Bacteria 2697
403 Ga0157380_10176299 3300014326 Unclassified 1873
404 Ga0182008_10001493 3300014497 Bacteria 15633
405 Ga0182008_10001559 3300014497 Bacteria 15235
406 Ga0182008_10009662 3300014497 Bacteria 5194
407 Ga0182008_10014383 3300014497 Bacteria 4145
408 Ga0182008_10107656 3300014497 Bacteria 1380
409 Ga0157379_10000871 3300014968 Bacteria 24416
410 Ga0157379_10002711 3300014968 Bacteria 14939
411 Ga0157379_10037583 3300014968 Bacteria 4318
412 Ga0157379_10394773 3300014968 Bacteria 1271
413 Ga0157379_10716643 3300014968 Bacteria 940
414 Ga0157376_10022890 3300014969 Bacteria 4879
415 Ga0157376_10148922 3300014969 Bacteria 2109
416 Ga0157376_10347528 3300014969 Bacteria 1418
417 Ga0157376_10497982 3300014969 Bacteria 1197
418 Ga0157376_10564218 3300014969 Bacteria 1128
419 Ga0157376_10815265 3300014969 Bacteria 947
420 Ga0182006_1002058 3300015261 Bacteria 11278
421 Ga0182006_1037727 3300015261 Bacteria 1914
422 Ga0182007_10003158 3300015262 Bacteria 7896
423 Ga0182007_10015862 3300015262 Bacteria 2795
424 Ga0182007_10086993 3300015262 Bacteria 1028
425 Ga0182005_1042169 3300015265 Bacteria 1240
426 Ga0163161_10002188 3300017792 Bacteria 14097
427 Ga0163161_10020791 3300017792 Bacteria 4608
428 Ga0163161_10053505 3300017792 Bacteria 2928
429 Ga0163161_10087107 3300017792 Bacteria 2306
430 Ga0163161_10122246 3300017792 Bacteria 1957
431 Ga0209672_103131 3300025228 Bacteria 3564
432 Ga0209147_100450 3300025229 Bacteria 25862
433 Ga0209258_100093 3300025242 Bacteria 223559
434 Ga0209258_107630 3300025242 Bacteria 1592
435 Ga0207425_1007188 3300025245 Bacteria 2967
436 Ga0209148_1000007 3300025254 Bacteria 1592273
437 Ga0209129_1000024 3300025258 Bacteria 417268
438 Ga0209565_1000098 3300025263 Bacteria 132021
439 Ga0209565_1000603 3300025263 Bacteria 24045
440 Ga0209565_1006214 3300025263 Bacteria 3379
441 Ga0209673_1000058 3300025273 Bacteria 269028
442 Ga0209673_1002131 3300025273 Bacteria 14771
443 Ga0209673_1004152 3300025273 Bacteria 7921
444 Ga0209130_1046283 3300025284 Bacteria 813
445 Ga0209675_1000010 3300025291 Bacteria 541927
446 Ga0209675_1007565 3300025291 Bacteria 4141
447 Ga0209676_1000028 3300025292 Bacteria 559745
448 Ga0209676_1000317 3300025292 Bacteria 94105
449 Ga0209676_1001130 3300025292 Bacteria 29344
450 Ga0209676_1003633 3300025292 Bacteria 9273
451 Ga0209025_1008081 3300025294 Bacteria 7659
452 Ga0209025_1034891 3300025294 Bacteria 2285
453 Ga0209025_1115608 3300025294 Bacteria 813
454 Ga0209564_1000209 3300025295 Bacteria 133651
455 Ga0209564_1005094 3300025295 Bacteria 7653
456 Ga0209758_1013950 3300025297 Bacteria 4324
457 Ga0209050_1000072 3300025298 Bacteria 293619
458 Ga0209050_1000786 3300025298 Bacteria 45131
459 Ga0209050_1001905 3300025298 Bacteria 19963
460 Ga0209256_1001798 3300025299 Bacteria 20214
461 Ga0209256_1001983 3300025299 Bacteria 18434
462 Ga0209256_1004664 3300025299 Bacteria 8423
463 Ga0209256_1007096 3300025299 Bacteria 5658
464 Ga0207426_1000038 3300025302 Bacteria 441522
465 Ga0207426_1000053 3300025302 Bacteria 384818
466 Ga0209051_1000015 3300025303 Bacteria 546798
467 Ga0209051_1000056 3300025303 Bacteria 271616
468 Ga0209051_1000392 3300025303 Bacteria 61223
469 Ga0209051_1000984 3300025303 Bacteria 27620
470 Ga0209051_1001474 3300025303 Bacteria 19907
471 Ga0209257_1000037 3300025304 Bacteria 612915
472 Ga0209257_1002615 3300025304 Bacteria 17418
473 Ga0209257_1003276 3300025304 Bacteria 14140
474 Ga0209257_1004781 3300025304 Bacteria 10096
475 Ga0209257_1011209 3300025304 Bacteria 4356
476 Ga0207697_10000102 3300025315 Bacteria 38762
477 Ga0207656_10005124 3300025321 Bacteria 4610
478 Ga0207656_10031148 3300025321 Bacteria 2208
479 Ga0207656_10132904 3300025321 Bacteria 1167
480 Ga0207655_1002097 3300025728 Bacteria 16711
481 Ga0207682_10000165 3300025893 Bacteria 30318
482 Ga0207642_10070692 3300025899 Bacteria 1660
483 Ga0207710_10266071 3300025900 Bacteria 860
484 Ga0207688_10000286 3300025901 Bacteria 23042
485 Ga0207680_10002735 3300025903 Bacteria 8248
486 Ga0207680_10008569 3300025903 Bacteria 5029
487 Ga0207680_10053024 3300025903 Bacteria 2433
488 Ga0207680_10085375 3300025903 Bacteria 1994
489 Ga0207680_10114712 3300025903 Bacteria 1753
490 Ga0207680_10120018 3300025903 Bacteria 1718
491 Ga0207680_10531639 3300025903 Bacteria 839
492 Ga0207647_10101368 3300025904 Unclassified 1708
493 Ga0207645_10000045 3300025907 Bacteria 85310
494 Ga0207645_10000437 3300025907 Bacteria 34598
495 Ga0207645_10037385 3300025907 Bacteria 3115
496 Ga0207645_10159068 3300025907 Bacteria 1477
497 Ga0207643_10001528 3300025908 Bacteria 13206
498 Ga0207643_10030341 3300025908 Bacteria 3008
499 Ga0207643_10172960 3300025908 Bacteria 1304
500 Ga0207695_10287526 3300025913 Bacteria 1537
501 Ga0207671_10126117 3300025914 Bacteria 1961
502 Ga0207671_10204961 3300025914 Bacteria 1541
503 Ga0207660_10157013 3300025917 Bacteria 1752
504 Ga0207660_10447117 3300025917 Unclassified 1045
505 Ga0207662_10006635 3300025918 Bacteria 6251
506 Ga0207657_10006421 3300025919 Bacteria 12194
507 Ga0207657_10027114 3300025919 Bacteria 5252
508 Ga0207657_10027676 3300025919 Bacteria 5188
509 Ga0207649_10005560 3300025920 Bacteria 6816
510 Ga0207649_10036109 3300025920 Bacteria 2974
511 Ga0207649_10167970 3300025920 Bacteria 1526
512 Ga0207652_10096020 3300025921 Unclassified 2611
513 Ga0207681_10006754 3300025923 Bacteria 7042
514 Ga0207681_10030082 3300025923 Bacteria 3537
515 Ga0207681_10089930 3300025923 Unclassified 2190
516 Ga0207681_10090369 3300025923 Bacteria 2185
517 Ga0207681_10183315 3300025923 Unclassified 1596
518 Ga0207681_10244260 3300025923 Bacteria 1399
519 Ga0207694_10181287 3300025924 Bacteria 1708
520 Ga0207694_10301474 3300025924 Bacteria 1319
521 Ga0207650_10002517 3300025925 Bacteria 12722
522 Ga0207650_10047981 3300025925 Bacteria 3148
523 Ga0207650_10051055 3300025925 Bacteria 3060
524 Ga0207650_10067025 3300025925 Bacteria 2693
525 Ga0207650_10128554 3300025925 Bacteria 1980
526 Ga0207659_10001999 3300025926 Bacteria 12077
527 Ga0207659_10157041 3300025926 Bacteria 1782
528 Ga0207687_10881181 3300025927 Bacteria 765
529 Ga0207644_10009310 3300025931 Bacteria 6447
530 Ga0207644_10009759 3300025931 Bacteria 6311
531 Ga0207644_10098476 3300025931 Bacteria 2192
532 Ga0207644_10182744 3300025931 Bacteria 1644
533 Ga0207644_10297098 3300025931 Bacteria 1300
534 Ga0207644_10378861 3300025931 Bacteria 1153
535 Ga0207690_10000485 3300025932 Bacteria 25649
536 Ga0207690_10665547 3300025932 Unclassified 854
537 Ga0207706_10000023 3300025933 Bacteria 153979
538 Ga0207706_10000774 3300025933 Bacteria 33156
539 Ga0207706_10070215 3300025933 Bacteria 3081
540 Ga0207706_10074987 3300025933 Bacteria 2974
541 Ga0207706_10234349 3300025933 Bacteria 1605
542 Ga0207686_10028152 3300025934 Bacteria 3300
543 Ga0207686_10497364 3300025934 Bacteria 945
544 Ga0207709_10000955 3300025935 Bacteria 21620
545 Ga0207709_10002740 3300025935 Bacteria 10864
546 Ga0207709_10132097 3300025935 Bacteria 1703
547 Ga0207670_10342238 3300025936 Bacteria 1182
548 Ga0207669_10003418 3300025937 Bacteria 6867
549 Ga0207669_10072813 3300025937 Bacteria 2165
550 Ga0207704_10039976 3300025938 Bacteria 2737
551 Ga0207691_10000279 3300025940 Bacteria 50526
552 Ga0207691_10019010 3300025940 Bacteria 6507
553 Ga0207691_10034391 3300025940 Bacteria 4712
554 Ga0207691_10048202 3300025940 Bacteria 3907
555 Ga0207691_10086305 3300025940 Bacteria 2816
556 Ga0207691_10477071 3300025940 Bacteria 1060
557 Ga0207711_10059109 3300025941 Bacteria 3301
558 Ga0207711_10143534 3300025941 Bacteria 2149
559 Ga0207689_10000258 3300025942 Bacteria 47518
560 Ga0207689_10000356 3300025942 Bacteria 42960
561 Ga0207689_10030686 3300025942 Bacteria 4479
562 Ga0207689_10506489 3300025942 Unclassified 1012
563 Ga0207689_10528683 3300025942 Bacteria 989
564 Ga0207661_10289401 3300025944 Bacteria 1466
565 Ga0207679_10007168 3300025945 Bacteria 7061
566 Ga0207679_10021574 3300025945 Bacteria 4369
567 Ga0207679_10091838 3300025945 Unclassified 2350
568 Ga0207679_10349099 3300025945 Bacteria 1289
569 Ga0207679_10461456 3300025945 Bacteria 1128
570 Ga0207667_10004129 3300025949 Bacteria 17847
571 Ga0207667_10303021 3300025949 Bacteria 1633
572 Ga0207651_10002260 3300025960 Bacteria 9148
573 Ga0207651_10004733 3300025960 Bacteria 6915
574 Ga0207651_10158122 3300025960 Bacteria 1773
575 Ga0207651_10326950 3300025960 Bacteria 1283
576 Ga0207651_10508839 3300025960 Bacteria 1042
577 Ga0207712_10529287 3300025961 Unclassified 1011
578 Ga0207668_10002332 3300025972 Bacteria 11091
579 Ga0207668_10004878 3300025972 Bacteria 7893
580 Ga0207668_10068451 3300025972 Bacteria 2524
581 Ga0207668_10108435 3300025972 Bacteria 2078
582 Ga0207668_10539384 3300025972 Bacteria 1009
583 Ga0207640_10004855 3300025981 Bacteria 7301
584 Ga0207640_10077818 3300025981 Bacteria 2256
585 Ga0207640_10167070 3300025981 Bacteria 1635
586 Ga0207640_10451727 3300025981 Bacteria 1059
587 Ga0207658_10006421 3300025986 Bacteria 8026
588 Ga0207658_10012186 3300025986 Bacteria 5866
589 Ga0207658_10021840 3300025986 Bacteria 4449
590 Ga0207658_10032895 3300025986 Bacteria 3695
591 Ga0207658_10038643 3300025986 Bacteria 3440
592 Ga0207658_10102385 3300025986 Unclassified 2246
593 Ga0207658_10360044 3300025986 Bacteria 1269
594 Ga0207658_10474753 3300025986 Bacteria 1110
595 Ga0207677_10003411 3300026023 Bacteria 8420
596 Ga0207677_10124469 3300026023 Bacteria 1945
597 Ga0207677_10296732 3300026023 Bacteria 1333
598 Ga0207677_10311076 3300026023 Bacteria 1305
599 Ga0207703_10002766 3300026035 Bacteria 15021
600 Ga0207703_10026514 3300026035 Bacteria 4562
601 Ga0207703_10059806 3300026035 Bacteria 3113
602 Ga0207703_10453555 3300026035 Unclassified 1198
603 Ga0207639_10002492 3300026041 Bacteria 12339
604 Ga0207639_10058518 3300026041 Bacteria 2965
605 Ga0207639_10116562 3300026041 Bacteria 2187
606 Ga0207639_10483254 3300026041 Bacteria 1129
607 Ga0207678_10017290 3300026067 Bacteria 6331
608 Ga0207678_10074000 3300026067 Unclassified 2919
609 Ga0207678_10269352 3300026067 Bacteria 1460
610 Ga0207708_10000864 3300026075 Bacteria 22828
611 Ga0207708_10080168 3300026075 Bacteria 2509
612 Ga0207708_10367729 3300026075 Bacteria 1183
613 Ga0207702_10000523 3300026078 Bacteria 43069
614 Ga0207702_10013354 3300026078 Bacteria 6830
615 Ga0207641_10004011 3300026088 Bacteria 12845
616 Ga0207641_10024408 3300026088 Bacteria 4984
617 Ga0207641_10035790 3300026088 Bacteria 4140
618 Ga0207641_10037009 3300026088 Bacteria 4074
619 Ga0207641_10064970 3300026088 Bacteria 3120
620 Ga0207641_10272864 3300026088 Bacteria 1587
621 Ga0207641_10304160 3300026088 Bacteria 1507
622 Ga0207648_10000667 3300026089 Bacteria 38445
623 Ga0207648_10001435 3300026089 Bacteria 26241
624 Ga0207648_10028568 3300026089 Bacteria 4944
625 Ga0207648_10048370 3300026089 Bacteria 3723
626 Ga0207648_10065432 3300026089 Bacteria 3169
627 Ga0207648_10760263 3300026089 Unclassified 900
628 Ga0207676_10004021 3300026095 Bacteria 10378
629 Ga0207676_10009106 3300026095 Bacteria 7070
630 Ga0207676_10017450 3300026095 Bacteria 5202
631 Ga0207676_10027357 3300026095 Bacteria 4246
632 Ga0207676_10077358 3300026095 Bacteria 2691
633 Ga0207676_10336916 3300026095 Bacteria 1390
634 Ga0207676_10414567 3300026095 Bacteria 1262
635 Ga0207676_10627973 3300026095 Bacteria 1034
636 Ga0207676_10773242 3300026095 Bacteria 935
637 Ga0207674_10023530 3300026116 Bacteria 6596
638 Ga0207674_10067282 3300026116 Bacteria 3607
639 Ga0207674_10219375 3300026116 Bacteria 1850
640 Ga0207674_10396910 3300026116 Unclassified 1333
641 Ga0207674_10805160 3300026116 Bacteria 907
642 Ga0207675_100002057 3300026118 Bacteria 20074
643 Ga0207675_100007608 3300026118 Bacteria 10236
644 Ga0207675_100023959 3300026118 Bacteria 5674
645 Ga0207675_100032799 3300026118 Bacteria 4839
646 Ga0207675_100151102 3300026118 Bacteria 2210
647 Ga0207675_100151553 3300026118 Bacteria 2207
648 Ga0207683_10000003 3300026121 Bacteria 191866
649 Ga0207683_10003717 3300026121 Bacteria 13244
650 Ga0207683_10004027 3300026121 Bacteria 12710
651 Ga0207683_10005506 3300026121 Bacteria 10851
652 Ga0207683_10027372 3300026121 Bacteria 4926
653 Ga0207683_10220513 3300026121 Bacteria 1728
654 Ga0207698_10058979 3300026142 Bacteria 2978
655 Ga0207698_10063574 3300026142 Unclassified 2889
656 Ga0207698_10128256 3300026142 Bacteria 2162
657 Ga0207698_10188136 3300026142 Bacteria 1836
658 Ga0207698_10240502 3300026142 Bacteria 1650
659 Ga0207698_10389250 3300026142 Bacteria 1329
660 Ga0207698_10716584 3300026142 Bacteria 997
661 Ga0207698_10960517 3300026142 Unclassified 864
662 Ga0209973_1000393 3300027252 Bacteria 3236
663 Ga0209389_1000460 3300027296 Bacteria 24402
664 Ga0209371_1017622 3300027312 Bacteria 1844
665 Ga0209970_1001507 3300027614 Bacteria 4060
666 Ga0209970_1021239 3300027614 Unclassified 1099
667 Ga0209983_1001514 3300027665 Bacteria 5159
668 Ga0209282_1000362 3300027666 Bacteria 22248
669 Ga0209966_1021715 3300027695 Unclassified 1250
670 Ga0209998_10023613 3300027717 Bacteria 1330
671 Ga0209974_10001817 3300027876 Bacteria 7780
672 Ga0209974_10015348 3300027876 Unclassified 2542
673 Ga0209974_10017806 3300027876 Unclassified 2355
674 Ga0209974_10039174 3300027876 Bacteria 1576
675 Ga0268266_10006480 3300028379 Bacteria 10714
676 Ga0268266_10092762 3300028379 Bacteria 2650
677 Ga0268266_10194128 3300028379 Bacteria 1855
678 Ga0268266_10450444 3300028379 Bacteria 1223
679 Ga0268265_10018243 3300028380 Bacteria 4860
680 Ga0268265_10172771 3300028380 Bacteria 1849
681 Ga0268265_10237539 3300028380 Bacteria 1606
682 Ga0268265_10572170 3300028380 Bacteria 1075
683 Ga0268264_10003471 3300028381 Bacteria 13596
684 Ga0268264_10017610 3300028381 Bacteria 5850
685 Ga0268264_10054237 3300028381 Bacteria 3347
686 Ga0268264_10320925 3300028381 Bacteria 1464
687 Ga0268264_10448102 3300028381 Bacteria 1250
688 Ga0307515_10000084 3300028794 Bacteria 221434
689 Ga0307515_10072181 3300028794 Bacteria 4665
690 Ga0268256_1019642 3300030500 Bacteria 1844
691 Ga0316177_1131827 3300030731 Bacteria 7049
692 Ga0316176_1054729 3300030732 Bacteria 5067
693 Ga0316178_1095890 3300030735 Bacteria 1853
694 Ga0316180_1144680 3300030736 Bacteria 2019
695 Ga0316183_1018820 3300030742 Bacteria 5208
696 Ga0316181_1035092 3300030744 Bacteria 2015
697 Ga0316182_1051023 3300030745 Bacteria 932
698 Ga0265330_10002123 3300031235 Bacteria 10941
699 Ga0265332_10001981 3300031238 Bacteria 10776
700 Ga0265329_10003194 3300031242 Bacteria 7202
701 Ga0265331_10003705 3300031250 Bacteria 9722
702 Ga0265327_10003393 3300031251 Bacteria 15305
703 Ga0265327_10006673 3300031251 Bacteria 9152
704 Ga0265327_10021540 3300031251 Bacteria 3886
705 Ga0265316_10018501 3300031344 Bacteria 5984
706 Ga0307513_10000029 3300031456 Bacteria 191823
707 Ga0307513_10000038 3300031456 Bacteria 174780
708 Ga0307513_10006829 3300031456 Bacteria 14871
709 Ga0307513_10123040 3300031456 Bacteria 2556
710 Ga0307408_100000795 3300031548 Bacteria 25277
711 Ga0307408_100009486 3300031548 Bacteria 6419
712 Ga0307408_100028947 3300031548 Bacteria 3832
713 Ga0307408_100044047 3300031548 Bacteria 3178
714 Ga0307408_100045466 3300031548 Bacteria 3136
715 Ga0307408_100391752 3300031548 Bacteria 1190
716 Ga0265313_10054495 3300031595 Unclassified 1899
717 Ga0307514_10003041 3300031649 Bacteria 16567
718 Ga0307514_10015687 3300031649 Bacteria 6244
719 Ga0265342_10006293 3300031712 Bacteria 8857
720 Ga0307516_10001817 3300031730 Bacteria 29320
721 Ga0307405_10000854 3300031731 Bacteria 12026
722 Ga0307405_10001567 3300031731 Bacteria 9702
723 Ga0307405_10155217 3300031731 Bacteria 1614
724 Ga0307413_10003751 3300031824 Bacteria 6466
725 Ga0307413_10013062 3300031824 Bacteria 4157
726 Ga0307413_10259491 3300031824 Bacteria 1294
727 Ga0307410_10000388 3300031852 Bacteria 17310
728 Ga0307410_10085331 3300031852 Bacteria 2228
729 Ga0307410_10226403 3300031852 Bacteria 1441
730 Ga0307410_10307788 3300031852 Bacteria 1252
731 Ga0307406_10001760 3300031901 Bacteria 11860
732 Ga0307406_10002039 3300031901 Bacteria 11025
733 Ga0307406_10005261 3300031901 Bacteria 7073
734 Ga0307406_10014344 3300031901 Bacteria 4557
735 Ga0307406_10091731 3300031901 Bacteria 2047
736 Ga0307406_10260293 3300031901 Bacteria 1312
737 Ga0307407_10008540 3300031903 Bacteria 4710
738 Ga0307407_10016334 3300031903 Bacteria 3694
739 Ga0307412_10001020 3300031911 Bacteria 16024
740 Ga0307412_10007471 3300031911 Bacteria 6200
741 Ga0307412_10057513 3300031911 Bacteria 2596
742 Ga0307412_10136298 3300031911 Bacteria 1791
743 Ga0307412_10175396 3300031911 Bacteria 1606
744 Ga0307412_10310861 3300031911 Bacteria 1249
745 Ga0307409_100000380 3300031995 Bacteria 18816
746 Ga0307409_100013393 3300031995 Bacteria 5276
747 Ga0307409_100130234 3300031995 Bacteria 2148
748 Ga0307409_101000689 3300031995 Bacteria 854
749 Ga0307416_100016007 3300032002 Bacteria 5198
750 Ga0307416_100236630 3300032002 Bacteria 1765
751 Ga0307416_101288601 3300032002 Unclassified 836
752 Ga0307414_10002583 3300032004 Bacteria 9532
753 Ga0307414_10040606 3300032004 Bacteria 3144
754 Ga0307414_10117931 3300032004 Bacteria 2035
755 Ga0307414_10159379 3300032004 Bacteria 1790
756 Ga0307411_10000093 3300032005 Bacteria 27213
757 Ga0307411_10000235 3300032005 Bacteria 18066
758 Ga0307411_10250348 3300032005 Bacteria 1392
759 Ga0307415_100000580 3300032126 Bacteria 16031
760 Ga0307415_100019465 3300032126 Bacteria 4122
761 Ga0373948_0024625 3300034817 Bacteria 1176
762 Ga0373952_0001218 3300035092 Bacteria 4679
763 Ga0373952_0044599 3300035092 Bacteria 1037
764 Ga0373923_0092136 3300035111 Bacteria 1327
765 Ga0373957_0185065 3300035120 Bacteria 864
766 Ga0373955_0213488 3300035172 Bacteria 1151
767 Ga0373955_0323253 3300035172 Bacteria 932
768 Ga0373924_0091205 3300035410 Bacteria 1304
769 Ga0373931_0111404 3300035691 Bacteria 1553
770 Ga0373935_0389151 3300035692 Bacteria 999
771 Ga0373933_0279409 3300035724 Bacteria 1079
772 Ga0373937_0022215 3300036401 Bacteria 5702
773 Ga0373937_0080973 3300036401 Bacteria 3004
774 Ga0373937_0246627 3300036401 Bacteria 1683
775 Ga0373925_0080141 3300037068 Bacteria 2481
776 Ga0395898_0010634 3300037466 Bacteria 9612
777 Ga0395901_0404985 3300038443 Bacteria 1401
778 Ga0439436_0000549 3300041404 Bacteria 9884
779 Ga0439438_042041 3300041405 Bacteria 1183
780 Ga0439439_0002668 3300041406 Bacteria 3821
781 Ga0439439_0026041 3300041406 Bacteria 1472
782 Ga0439461_0046482 3300041410 Bacteria 951
783 Ga0439466_0002413 3300041411 Bacteria 7333
784 Ga0439465_0018186 3300041413 Bacteria 2196
785 Ga0451789_0108685 3300041443 Bacteria 940
786 Ga0451791_0536485 3300041451 Bacteria 1402
787 Ga0451793_0083951 3300041452 Bacteria 1277
788 Ga0451807_1548440 3300041486 Bacteria 972
789 Ga0451833_1230188 3300041491 Bacteria 1189
790 Ga0451853_2647754 3300041512 Bacteria 1823
791 Ga0439433_0004489 3300041999 Bacteria 3004
792 Ga0439433_0010895 3300041999 Bacteria 1988
793 Ga0439442_019309 3300042002 Bacteria 1410
794 Ga0439445_0002343 3300042004 Bacteria 4211
795 Ga0439445_0032560 3300042004 Bacteria 1359
796 Ga0439432_006747 3300042006 Bacteria 4088
797 Ga0439432_016399 3300042006 Bacteria 2493
798 Ga0439432_042946 3300042006 Bacteria 1428
799 Ga0439449_0000718 3300042007 Bacteria 12673
800 Ga0439449_0001501 3300042007 Bacteria 9140
801 Ga0439452_001555 3300042010 Bacteria 9199
802 Ga0439452_042579 3300042010 Bacteria 1063
803 Ga0439454_010708 3300042011 Bacteria 1213
804 Ga0439457_005434 3300042014 Bacteria 3209
805 Ga0439462_0000171 3300042015 Bacteria 10896
806 Ga0439462_0006709 3300042015 Bacteria 2871
807 Ga0450911_000644 3300042115 Bacteria 10463
808 Ga0450921_001550 3300042123 Bacteria 1409
809 Ga0450921_006309 3300042123 Bacteria 919
810 Ga0450923_002679 3300042125 Bacteria 2587
811 Ga0450923_014989 3300042125 Bacteria 1444
812 Ga0450890_007040 3300042127 Bacteria 1434
813 Ga0450894_003448 3300042131 Bacteria 2067
814 Ga0450905_017413 3300042142 Bacteria 1042
815 Ga0450906_005728 3300042145 Bacteria 2537
816 Ga0450906_029529 3300042145 Bacteria 969
817 Ga0439446_0001776 3300042156 Bacteria 5026
818 Ga0450908_013237 3300042184 Bacteria 1489
819 Ga0450909_000723 3300042185 Bacteria 4442
820 Ga0450909_028578 3300042185 Bacteria 843
821 Ga0439434_0002712 3300042435 Bacteria 5156
822 Ga0439434_0021261 3300042435 Bacteria 1949
823 Ga0439434_0043207 3300042435 Bacteria 1386
824 Ga0439444_0032122 3300042437 Bacteria 991
825 Ga0439459_0001027 3300042438 Bacteria 3979
826 Ga0439459_0016864 3300042438 Bacteria 1354
827 Ga0466965_0146971 3300044683 Bacteria 1230
828 Ga0466963_0137690 3300044694 Bacteria 1690
829 Ga0466960_0008038 3300044901 Bacteria 4307
830 Ga0495627_005263 3300046453 Bacteria 5242
831 Ga0495638_0039490 3300046460 Bacteria 2996
832 Ga0495639_0066058 3300046475 Bacteria 1664
833 Ga0495616_0002386 3300046513 Bacteria 12503
834 Ga0495620_0008396 3300046515 Bacteria 5550
835 Ga0495620_0043110 3300046515 Bacteria 1967
836 Ga0495631_0003838 3300046518 Bacteria 8146
837 Ga0495637_0007697 3300046520 Bacteria 5328
838 Ga0495637_0066254 3300046520 Bacteria 1468
839 Ga0495643_0017713 3300046522 Bacteria 4158
840 Ga0495663_0125654 3300046525 Bacteria 861
841 Ga0495642_0074367 3300046528 Bacteria 1424
842 Ga0495654_0029156 3300046530 Bacteria 2816
843 Ga0495654_0216126 3300046530 Bacteria 813
844 Ga0495598_0089592 3300046537 Bacteria 1001
845 Ga0495621_0004441 3300046539 Bacteria 3945
846 Ga0495621_0027512 3300046539 Bacteria 1926
847 Ga0495622_0021877 3300046557 Bacteria 2979
848 Ga0495633_0001069 3300046558 Bacteria 22144
849 Ga0495667_0338377 3300046559 Bacteria 952
850 Ga0495656_0000173 3300046615 Bacteria 22836
851 Ga0495625_0001007 3300046660 Bacteria 37199
852 Ga0495625_0069985 3300046660 Bacteria 2464
853 Ga0495625_0112354 3300046660 Bacteria 1861
854 Ga0495661_0084956 3300046665 Bacteria 1815
855 Ga0495588_0015532 3300046674 Bacteria 3666
856 Ga0495599_0230575 3300046678 Bacteria 1131
857 Ga0495624_0146923 3300046690 Bacteria 1443
858 Ga0495670_0053506 3300046691 Bacteria 2022
859 Ga0495671_0024654 3300046692 Bacteria 3130
860 Ga0495676_0030589 3300047321 Bacteria 4565
861 Ga0495685_024705 3300047447 Bacteria 2068
862 Ga0495593_0053810 3300047673 Bacteria 2123
863 Ga0495593_0121852 3300047673 Bacteria 1327
864 Ga0495614_0006224 3300048089 Bacteria 5362
865 Ga0495615_0004467 3300048090 Bacteria 2445
866 Ga0496100_0109502 3300048903 Bacteria 1916
867 Ga0496100_0141066 3300048903 Bacteria 1708
868 Ga0496101_0008759 3300048904 Bacteria 6620
869 Ga0496101_0115314 3300048904 Unclassified 2026
870 Ga0496102_0009515 3300048905 Bacteria 8355
871 Ga0496102_0014776 3300048905 Bacteria 6790
872 Ga0496102_0033317 3300048905 Bacteria 4628
873 Ga0496103_0139926 3300048906 Bacteria 1547
874 Ga0496103_0144151 3300048906 Bacteria 1524
875 Ga0496104_0036397 3300048907 Bacteria 4601
876 Ga0496104_0281717 3300048907 Bacteria 1575
877 Ga0496105_0008753 3300048908 Bacteria 7876
878 Ga0496105_0105152 3300048908 Bacteria 2330
879 Ga0496105_0239505 3300048908 Bacteria 1473
880 Ga0496106_0002076 3300048909 Bacteria 15006
881 Ga0496106_0066014 3300048909 Bacteria 2755
882 Ga0496106_0083861 3300048909 Bacteria 2451
883 Ga0496107_0037822 3300048910 Unclassified 3464
884 Ga0496107_0178773 3300048910 Bacteria 1575
885 Ga0496107_0537095 3300048910 Bacteria 866
886 Ga0496107_0627113 3300048910 Bacteria 793
887 Ga0496108_0114058 3300048911 Bacteria 2313
888 Ga0496108_0191551 3300048911 Bacteria 1772
889 Ga0496109_0081831 3300048912 Bacteria 2975
890 Ga0496109_0348468 3300048912 Bacteria 1399
891 Ga0496109_0489352 3300048912 Unclassified 1161
892 Ga0496110_0011634 3300048913 Bacteria 7215
893 Ga0496110_0261858 3300048913 Bacteria 1574
894 Ga0496111_0120593 3300048914 Bacteria 1937
895 Ga0496111_0653545 3300048914 Bacteria 767
896 Ga0496112_0002911 3300048915 Bacteria 13933
897 Ga0496112_0124087 3300048915 Bacteria 2553
898 Ga0496114_0098988 3300048917 Bacteria 2487
899 Ga0496117_0023008 3300048920 Bacteria 4982
900 Ga0496117_0030845 3300048920 Bacteria 4104
901 Ga0496118_0012382 3300048921 Bacteria 8196
902 Ga0496118_0013172 3300048921 Bacteria 7846
903 Ga0496121_0035725 3300048924 Bacteria 4446
904 Ga0496122_0038114 3300048925 Bacteria 3857
905 Ga0496122_0055704 3300048925 Bacteria 2955
906 Ga0496122_0181182 3300048925 Bacteria 1256
907 Ga0496122_0268808 3300048925 Bacteria 941
908 Ga0496123_0086477 3300048926 Bacteria 1880
909 Ga0496123_0114023 3300048926 Bacteria 1538
910 Ga0496123_0133230 3300048926 Bacteria 1372
911 Ga0496124_0095575 3300048927 Bacteria 2415
912 Ga0496124_0097393 3300048927 Bacteria 2388
913 Ga0496124_0176589 3300048927 Bacteria 1648
914 Ga0496124_0239005 3300048927 Bacteria 1352
915 Ga0496125_0019249 3300048928 Bacteria 6447
916 Ga0496125_0025807 3300048928 Bacteria 5371
917 Ga0496125_0037448 3300048928 Bacteria 4217
918 Ga0496125_0053548 3300048928 Bacteria 3306
919 Ga0496125_0111091 3300048928 Bacteria 1985
920 Ga0496126_0106125 3300048929 Bacteria 2452
921 Ga0501039_0789557 3300049575 Bacteria 741
922 Ga0501209_004018 3300049656 Bacteria 2501
923 Ga0501262_000071 3300049759 Bacteria 12483
924 nmdc:mga03683_10580_c1 3300050489 Bacteria 3312
925 nmdc:mga03683_1511_c2 3300050489 Bacteria 5935
926 nmdc:mga03n38_32329_c1 3300050490 Bacteria 2216
927 nmdc:mga03n38_60683_c1 3300050490 Bacteria 1720
928 nmdc:mga0k408_15116_c1 3300050493 Bacteria 4266
929 nmdc:mga0k408_50285_c1 3300050493 Bacteria 2413
930 nmdc:mga0k408_8200_c1 3300050493 Bacteria 5599
931 nmdc:mga06z11_170836_c1 3300050494 Bacteria 1248
932 nmdc:mga07m45_106256_c1 3300050496 Bacteria 1615
933 nmdc:mga07m45_160285_c1 3300050496 Bacteria 1306
934 nmdc:mga07m45_26743_c1 3300050496 Bacteria 3172
935 nmdc:mga07m45_61284_c1 3300050496 Bacteria 2131
936 nmdc:mga07m45_63901_c1 3300050496 Bacteria 2088
937 nmdc:mga09592_3416_c1 3300050508 Bacteria 12836
938 nmdc:mga0qj67_46701_c1 3300050509 Bacteria 3419
939 nmdc:mga08y16_237728_c1 3300050511 Bacteria 1883
940 nmdc:mga08y16_85090_c1 3300050511 Bacteria 3295
941 nmdc:mga0n895_81956_c2 3300050512 Bacteria 2784
942 nmdc:mga0rr50_113462_c1 3300050513 Bacteria 2147
943 nmdc:mga0sz30_240354_c1 3300050516 Bacteria 806
944 Ga0500610_0000979 3300053079 Bacteria 9275
945 Ga0500610_0192048 3300053079 Bacteria 990
946 Ga0500643_016325 3300053087 Bacteria 2517
947 Ga0500643_033127 3300053087 Bacteria 1564
948 Ga0500651_0000057 3300053093 Bacteria 72615
949 Ga0500651_0009638 3300053093 Bacteria 5755
950 Ga0500560_059017 3300053107 Bacteria 1247
951 Ga0500562_016023 3300053108 Bacteria 1925
952 Ga0500569_091221 3300053109 Bacteria 987
953 Ga0500571_000050 3300053110 Bacteria 36128
954 Ga0500592_002926 3300053116 Bacteria 2740
955 Ga0500593_001195 3300053117 Bacteria 9375
956 Ga0500594_0000713 3300053118 Bacteria 7081
957 Ga0500597_005016 3300053120 Bacteria 4203
958 Ga0500607_004546 3300053121 Bacteria 9502
959 Ga0500607_129554 3300053121 Bacteria 1205
960 Ga0500608_016553 3300053122 Bacteria 3334
961 Ga0500626_047139 3300053128 Bacteria 1944
962 Ga0500655_003462 3300053133 Bacteria 2850
963 Ga0500658_0000652 3300053134 Bacteria 14279
964 Ga0500658_0002198 3300053134 Bacteria 7576
965 Ga0500559_0002632 3300053136 Bacteria 9158
966 Ga0500559_0032833 3300053136 Bacteria 2232
967 Ga0500559_0175136 3300053136 Bacteria 1009
968 Ga0500568_0003720 3300053139 Bacteria 8366
969 Ga0500573_0021700 3300053140 Bacteria 3683
970 Ga0500616_0021639 3300053153 Bacteria 3601
971 Ga0500627_0000717 3300053158 Bacteria 8806
972 Ga0500634_0063981 3300053161 Bacteria 1944
973 Ga0500638_012573 3300053162 Bacteria 3797
974 Ga0500636_0127796 3300053177 Bacteria 1419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100082919 Ga0070671_1000829192 169
2 3300025931 Ga0207644_10098476 Ga0207644_100984762 169
3 3300049656 Ga0501209_004018 Ga0501209_004018_614_1264 172
4 3300005329 Ga0070683_100526052 Ga0070683_1005260522 173
5 3300005334 Ga0068869_100555113 Ga0068869_1005551131 173
6 3300005366 Ga0070659_100293977 Ga0070659_1002939772 173
7 3300005577 Ga0068857_100053835 Ga0068857_1000538353 173
8 3300005616 Ga0068852_100122460 Ga0068852_1001224602 173
9 3300009098 Ga0105245_10563450 Ga0105245_105634502 173
10 3300010375 Ga0105239_10909255 Ga0105239_109092552 173
11 3300025927 Ga0207687_10881181 Ga0207687_108811812 173
12 3300025942 Ga0207689_10528683 Ga0207689_105286832 173
13 3300026116 Ga0207674_10067282 Ga0207674_100672823 173
14 3300026142 Ga0207698_10240502 Ga0207698_102405022 173
15 3300014325 Ga0163163_10017519 Ga0163163_100175193 176
16 3300031730 Ga0307516_10001817 Ga0307516_1000181717 176
17 3300031995 Ga0307409_100130234 Ga0307409_1001302342 176
18 3300006048 Ga0075363_100077889 Ga0075363_1000778892 178
19 3300006178 Ga0075367_10021596 Ga0075367_100215961 178
20 3300003323 rootH1_10016509 rootH1_100165094 179
21 3300003775 Ga0055524_1003603 Ga0055524_10036035 179
22 3300003775 Ga0055524_1044620 Ga0055524_10446202 179
23 3300003794 Ga0055531_10012361 Ga0055531_100123612 179
24 3300006353 Ga0075370_10007838 Ga0075370_100078384 179
25 3300006942 Ga0099824_1045242 Ga0099824_10452421 179
26 3300006944 Ga0099823_1000069 Ga0099823_100006932 179
27 3300025242 Ga0209258_107630 Ga0209258_1076302 179
28 3300025299 Ga0209256_1001983 Ga0209256_100198311 179
29 3300025299 Ga0209256_1004664 Ga0209256_10046645 179
30 3300025304 Ga0209257_1003276 Ga0209257_10032763 179
31 3300027296 Ga0209389_1000460 Ga0209389_100046012 179
32 3300027312 Ga0209371_1017622 Ga0209371_10176222 179
33 3300030500 Ga0268256_1019642 Ga0268256_10196422 179
34 3300031548 Ga0307408_100009486 Ga0307408_1000094862 179
35 3300031731 Ga0307405_10000854 Ga0307405_100008544 179
36 3300031824 Ga0307413_10003751 Ga0307413_100037512 179
37 3300031852 Ga0307410_10307788 Ga0307410_103077881 179
38 3300031901 Ga0307406_10005261 Ga0307406_100052613 179
39 3300031903 Ga0307407_10008540 Ga0307407_100085401 179
40 3300031995 Ga0307409_100000380 Ga0307409_1000003806 179
41 3300032004 Ga0307414_10002583 Ga0307414_1000258310 179
42 3300032005 Ga0307411_10000235 Ga0307411_1000023512 179
43 3300032126 Ga0307415_100019465 Ga0307415_1000194654 179
44 3300041512 Ga0451853_2647754 Ga0451853_2647754_71_793 179
45 3300027614 Ga0209970_1001507 Ga0209970_10015074 180
46 3300027876 Ga0209974_10039174 Ga0209974_100391742 180
47 3300036401 Ga0373937_0022215 Ga0373937_0022215_414_1049 180
48 3300035092 Ga0373952_0044599 Ga0373952_0044599_68_733 181
49 3300042435 Ga0439434_0021261 Ga0439434_0021261_541_1218 181
50 3300048915 Ga0496112_0002911 Ga0496112_0002911_993_1646 181
51 3300005288 Ga0065714_10101199 Ga0065714_101011992 182
52 3300005335 Ga0070666_10332672 Ga0070666_103326721 182
53 3300005364 Ga0070673_100372401 Ga0070673_1003724012 182
54 3300005367 Ga0070667_100117556 Ga0070667_1001175562 182
55 3300009148 Ga0105243_10300230 Ga0105243_103002301 182
56 3300009551 Ga0105238_10069168 Ga0105238_100691683 182
57 3300013306 Ga0163162_10067804 Ga0163162_100678043 182
58 3300014497 Ga0182008_10001559 Ga0182008_100015592 182
59 3300014969 Ga0157376_10347528 Ga0157376_103475282 182
60 3300025903 Ga0207680_10531639 Ga0207680_105316391 182
61 3300026121 Ga0207683_10027372 Ga0207683_100273723 182
62 3300028381 Ga0268264_10448102 Ga0268264_104481021 182
63 3300042011 Ga0439454_010708 Ga0439454_010708_446_1036 182
64 3300042115 Ga0450911_000644 Ga0450911_000644_6747_7388 182
65 3300042437 Ga0439444_0032122 Ga0439444_0032122_179_769 182
66 3300042438 Ga0439459_0001027 Ga0439459_0001027_2743_3333 182
67 3300044694 Ga0466963_0137690 Ga0466963_0137690_380_970 182
68 3300046530 Ga0495654_0216126 Ga0495654_0216126_64_732 182
69 3300046674 Ga0495588_0015532 Ga0495588_0015532_1955_2629 182
70 3300046678 Ga0495599_0230575 Ga0495599_0230575_373_1047 182
71 3300047447 Ga0495685_024705 Ga0495685_024705_963_1637 182
72 3300048903 Ga0496100_0109502 Ga0496100_0109502_338_1012 182
73 3300048905 Ga0496102_0009515 Ga0496102_0009515_3465_4139 182
74 3300048906 Ga0496103_0144151 Ga0496103_0144151_409_1083 182
75 3300048907 Ga0496104_0036397 Ga0496104_0036397_922_1596 182
76 3300048908 Ga0496105_0008753 Ga0496105_0008753_3021_3695 182
77 3300048909 Ga0496106_0066014 Ga0496106_0066014_1182_1856 182
78 3300048910 Ga0496107_0178773 Ga0496107_0178773_804_1478 182
79 3300050496 nmdc:mga07m45_106256_c1 nmdc:mga07m45_106256_c1_298_888 182
80 3300053079 Ga0500610_0192048 Ga0500610_0192048_214_885 182
81 3300005331 Ga0070670_100063865 Ga0070670_1000638653 183
82 3300009176 Ga0105242_10005758 Ga0105242_100057588 183
83 3300014969 Ga0157376_10148922 Ga0157376_101489221 183
84 3300025925 Ga0207650_10051055 Ga0207650_100510552 183
85 3300025934 Ga0207686_10028152 Ga0207686_100281523 183
86 3300042004 Ga0439445_0032560 Ga0439445_0032560_704_1345 183
87 3300042142 Ga0450905_017413 Ga0450905_017413_357_998 183
88 3300048924 Ga0496121_0035725 Ga0496121_0035725_3342_3983 183
89 3300048928 Ga0496125_0019249 Ga0496125_0019249_3282_3923 183
90 3300005456 Ga0070678_100069507 Ga0070678_1000695072 184
91 3300005843 Ga0068860_100697296 Ga0068860_1006972961 184
92 3300006353 Ga0075370_10066418 Ga0075370_100664182 184
93 3300014497 Ga0182008_10014383 Ga0182008_100143833 184
94 3300015262 Ga0182007_10015862 Ga0182007_100158623 184
95 3300015265 Ga0182005_1042169 Ga0182005_10421692 184
96 3300017792 Ga0163161_10087107 Ga0163161_100871072 184
97 3300031548 Ga0307408_100044047 Ga0307408_1000440472 184
98 3300031911 Ga0307412_10310861 Ga0307412_103108612 184
99 3300032002 Ga0307416_100016007 Ga0307416_1000160072 184
100 3300041406 Ga0439439_0002668 Ga0439439_0002668_2044_2721 184
101 3300041999 Ga0439433_0010895 Ga0439433_0010895_509_1186 184
102 3300042006 Ga0439432_016399 Ga0439432_016399_827_1504 184
103 3300042007 Ga0439449_0001501 Ga0439449_0001501_3416_4093 184
104 3300042010 Ga0439452_042579 Ga0439452_042579_249_926 184
105 3300042015 Ga0439462_0000171 Ga0439462_0000171_2890_3567 184
106 3300042123 Ga0450921_006309 Ga0450921_006309_73_750 184
107 3300042131 Ga0450894_003448 Ga0450894_003448_739_1416 184
108 3300042145 Ga0450906_005728 Ga0450906_005728_1090_1767 184
109 3300042184 Ga0450908_013237 Ga0450908_013237_58_735 184
110 3300042185 Ga0450909_000723 Ga0450909_000723_144_821 184
111 3300046475 Ga0495639_0066058 Ga0495639_0066058_446_1120 184
112 3300046528 Ga0495642_0074367 Ga0495642_0074367_326_1000 184
113 3300046559 Ga0495667_0338377 Ga0495667_0338377_108_782 184
114 3300047673 Ga0495593_0121852 Ga0495593_0121852_626_1300 184
115 3300048912 Ga0496109_0081831 Ga0496109_0081831_714_1388 184
116 3300005577 Ga0068857_100593300 Ga0068857_1005933002 185
117 3300030731 Ga0316177_1131827 Ga0316177_11318271 185
118 3300030732 Ga0316176_1054729 Ga0316176_10547293 185
119 3300030735 Ga0316178_1095890 Ga0316178_10958903 185
120 3300030736 Ga0316180_1144680 Ga0316180_11446802 185
121 3300030742 Ga0316183_1018820 Ga0316183_10188201 185
122 3300030744 Ga0316181_1035092 Ga0316181_10350922 185
123 3300030745 Ga0316182_1051023 Ga0316182_10510232 185
124 3300031251 Ga0265327_10021540 Ga0265327_100215402 185
125 3300031548 Ga0307408_100391752 Ga0307408_1003917522 185
126 3300031824 Ga0307413_10259491 Ga0307413_102594912 185
127 3300031852 Ga0307410_10085331 Ga0307410_100853312 185
128 3300031901 Ga0307406_10091731 Ga0307406_100917312 185
129 3300031911 Ga0307412_10175396 Ga0307412_101753962 185
130 3300032002 Ga0307416_101288601 Ga0307416_1012886011 185
131 3300032004 Ga0307414_10117931 Ga0307414_101179312 185
132 3300041404 Ga0439436_0000549 Ga0439436_0000549_8073_8747 185
133 3300041406 Ga0439439_0026041 Ga0439439_0026041_643_1317 185
134 3300041410 Ga0439461_0046482 Ga0439461_0046482_34_708 185
135 3300041411 Ga0439466_0002413 Ga0439466_0002413_3705_4379 185
136 3300041999 Ga0439433_0004489 Ga0439433_0004489_499_1173 185
137 3300042004 Ga0439445_0002343 Ga0439445_0002343_1373_2047 185
138 3300042006 Ga0439432_006747 Ga0439432_006747_2390_3064 185
139 3300042007 Ga0439449_0000718 Ga0439449_0000718_10066_10740 185
140 3300042010 Ga0439452_001555 Ga0439452_001555_6911_7585 185
141 3300042014 Ga0439457_005434 Ga0439457_005434_2215_2889 185
142 3300042015 Ga0439462_0006709 Ga0439462_0006709_589_1263 185
143 3300042156 Ga0439446_0001776 Ga0439446_0001776_760_1434 185
144 3300042435 Ga0439434_0002712 Ga0439434_0002712_246_920 185
145 3300048928 Ga0496125_0053548 Ga0496125_0053548_2239_2877 185
146 3300049575 Ga0501039_0789557 Ga0501039_0789557_103_726 185
147 iso_pu_bacteria 2643221609 2644062285 185
148 iso_pu_bacteria 2643221611 2644071472 185
149 iso_pu_bacteria 2738543012 2739245894 185
150 iso_pu_bacteria 2816332133 2816470590 185
151 3300003781 Ga0055536_1003029 Ga0055536_10030296 186
152 3300003792 Ga0055540_1002682 Ga0055540_10026826 186
153 3300025292 Ga0209676_1001130 Ga0209676_10011304 186
154 3300025303 Ga0209051_1000392 Ga0209051_100039234 186
155 3300025304 Ga0209257_1011209 Ga0209257_10112093 186
156 3300034817 Ga0373948_0024625 Ga0373948_0024625_355_981 186
157 3300035092 Ga0373952_0001218 Ga0373952_0001218_1667_2293 186
158 3300041443 Ga0451789_0108685 Ga0451789_0108685_24_695 186
159 3300042127 Ga0450890_007040 Ga0450890_007040_114_779 186
160 3300053136 Ga0500559_0002632 Ga0500559_0002632_4206_4877 186
161 3300053140 Ga0500573_0021700 Ga0500573_0021700_2946_3617 186
162 3300005834 Ga0068851_10061209 Ga0068851_100612092 187
163 3300005841 Ga0068863_100136515 Ga0068863_1001365152 187
164 3300006048 Ga0075363_100102923 Ga0075363_1001029232 187
165 3300006051 Ga0075364_10263172 Ga0075364_102631722 187
166 3300006058 Ga0075432_10002230 Ga0075432_100022306 187
167 3300006177 Ga0075362_10007390 Ga0075362_100073902 187
168 3300006353 Ga0075370_10221471 Ga0075370_102214712 187
169 3300013307 Ga0157372_10344546 Ga0157372_103445462 187
170 3300017792 Ga0163161_10002188 Ga0163161_1000218812 187
171 3300026088 Ga0207641_10064970 Ga0207641_100649703 187
172 3300026095 Ga0207676_10414567 Ga0207676_104145672 187
173 3300026142 Ga0207698_10960517 Ga0207698_109605171 187
174 3300028794 Ga0307515_10072181 Ga0307515_100721811 187
175 3300031456 Ga0307513_10000038 Ga0307513_1000003892 187
176 3300031456 Ga0307513_10123040 Ga0307513_101230402 187
177 3300031911 Ga0307412_10136298 Ga0307412_101362982 187
178 3300032005 Ga0307411_10250348 Ga0307411_102503482 187
179 3300042125 Ga0450923_014989 Ga0450923_014989_738_1415 187
180 3300050489 nmdc:mga03683_1511_c2 nmdc:mga03683_1511_c2_3411_4088 187
181 3300005328 Ga0070676_10246805 Ga0070676_102468052 188
182 3300005330 Ga0070690_100018410 Ga0070690_1000184102 188
183 3300005334 Ga0068869_100015323 Ga0068869_1000153232 188
184 3300005347 Ga0070668_100004017 Ga0070668_1000040173 188
185 3300005353 Ga0070669_100207733 Ga0070669_1002077332 188
186 3300005353 Ga0070669_100225936 Ga0070669_1002259362 188
187 3300005354 Ga0070675_100304651 Ga0070675_1003046512 188
188 3300005356 Ga0070674_100047294 Ga0070674_1000472942 188
189 3300005364 Ga0070673_100137460 Ga0070673_1001374601 188
190 3300005365 Ga0070688_100136286 Ga0070688_1001362861 188
191 3300005440 Ga0070705_100243445 Ga0070705_1002434452 188
192 3300005441 Ga0070700_100709808 Ga0070700_1007098081 188
193 3300005456 Ga0070678_100123760 Ga0070678_1001237602 188
194 3300005459 Ga0068867_100996351 Ga0068867_1009963511 188
195 3300005543 Ga0070672_100113226 Ga0070672_1001132262 188
196 3300005544 Ga0070686_100033639 Ga0070686_1000336393 188
197 3300005548 Ga0070665_100731851 Ga0070665_1007318511 188
198 3300005615 Ga0070702_100163520 Ga0070702_1001635202 188
199 3300005617 Ga0068859_100179498 Ga0068859_1001794981 188
200 3300005618 Ga0068864_100176227 Ga0068864_1001762272 188
201 3300005718 Ga0068866_10043026 Ga0068866_100430262 188
202 3300005719 Ga0068861_100026899 Ga0068861_1000268994 188
203 3300005840 Ga0068870_10202311 Ga0068870_102023112 188
204 3300005841 Ga0068863_100321307 Ga0068863_1003213071 188
205 3300005842 Ga0068858_100149379 Ga0068858_1001493792 188
206 3300005843 Ga0068860_100385300 Ga0068860_1003853002 188
207 3300005844 Ga0068862_100171528 Ga0068862_1001715282 188
208 3300006195 Ga0075366_10034976 Ga0075366_100349763 188
209 3300006237 Ga0097621_100016802 Ga0097621_1000168022 188
210 3300006358 Ga0068871_100005265 Ga0068871_1000052654 188
211 3300006881 Ga0068865_100122158 Ga0068865_1001221582 188
212 3300006931 Ga0097620_100179503 Ga0097620_1001795031 188
213 3300009094 Ga0111539_10114865 Ga0111539_101148652 188
214 3300009148 Ga0105243_10274632 Ga0105243_102746322 188
215 3300009176 Ga0105242_10025335 Ga0105242_100253355 188
216 3300009177 Ga0105248_10275410 Ga0105248_102754101 188
217 3300009553 Ga0105249_10058498 Ga0105249_100584984 188
218 3300013297 Ga0157378_10009053 Ga0157378_100090532 188
219 3300013306 Ga0163162_10182650 Ga0163162_101826502 188
220 3300014326 Ga0157380_10020902 Ga0157380_100209023 188
221 3300014326 Ga0157380_10176299 Ga0157380_101762992 188
222 3300017792 Ga0163161_10053505 Ga0163161_100535054 188
223 3300025908 Ga0207643_10172960 Ga0207643_101729602 188
224 3300025923 Ga0207681_10090369 Ga0207681_100903693 188
225 3300025923 Ga0207681_10183315 Ga0207681_101833152 188
226 3300025940 Ga0207691_10034391 Ga0207691_100343915 188
227 3300025942 Ga0207689_10030686 Ga0207689_100306862 188
228 3300025972 Ga0207668_10002332 Ga0207668_100023329 188
229 3300026035 Ga0207703_10453555 Ga0207703_104535552 188
230 3300026075 Ga0207708_10367729 Ga0207708_103677292 188
231 3300026089 Ga0207648_10065432 Ga0207648_100654324 188
232 3300026118 Ga0207675_100023959 Ga0207675_1000239596 188
233 3300026121 Ga0207683_10003717 Ga0207683_1000371712 188
234 3300028380 Ga0268265_10572170 Ga0268265_105721701 188
235 3300041405 Ga0439438_042041 Ga0439438_042041_276_953 188
236 3300042438 Ga0439459_0016864 Ga0439459_0016864_163_840 188
237 3300050511 nmdc:mga08y16_85090_c1 nmdc:mga08y16_85090_c1_900_1583 188
238 3300005331 Ga0070670_100000664 Ga0070670_10000066415 189
239 3300005334 Ga0068869_100000984 Ga0068869_1000009844 189
240 3300005338 Ga0068868_100057089 Ga0068868_1000570893 189
241 3300005340 Ga0070689_100233122 Ga0070689_1002331222 189
242 3300005347 Ga0070668_100016923 Ga0070668_1000169234 189
243 3300005353 Ga0070669_100004906 Ga0070669_1000049066 189
244 3300005364 Ga0070673_100004029 Ga0070673_1000040296 189
245 3300005367 Ga0070667_100018346 Ga0070667_1000183461 189
246 3300005459 Ga0068867_100006238 Ga0068867_1000062383 189
247 3300005549 Ga0070704_100194730 Ga0070704_1001947302 189
248 3300005577 Ga0068857_100037720 Ga0068857_1000377205 189
249 3300005578 Ga0068854_100322627 Ga0068854_1003226271 189
250 3300005617 Ga0068859_100005130 Ga0068859_1000051303 189
251 3300005618 Ga0068864_100002166 Ga0068864_1000021666 189
252 3300005719 Ga0068861_100001567 Ga0068861_1000015678 189
253 3300005840 Ga0068870_10034754 Ga0068870_100347543 189
254 3300005841 Ga0068863_100002459 Ga0068863_10000245910 189
255 3300005841 Ga0068863_100394656 Ga0068863_1003946562 189
256 3300005842 Ga0068858_100008257 Ga0068858_1000082573 189
257 3300005843 Ga0068860_100002129 Ga0068860_1000021293 189
258 3300005844 Ga0068862_100004308 Ga0068862_1000043081 189
259 3300006051 Ga0075364_10277863 Ga0075364_102778632 189
260 3300006058 Ga0075432_10153313 Ga0075432_101533132 189
261 3300006177 Ga0075362_10146377 Ga0075362_101463772 189
262 3300006178 Ga0075367_10039303 Ga0075367_100393032 189
263 3300006195 Ga0075366_10006939 Ga0075366_100069396 189
264 3300006237 Ga0097621_100369779 Ga0097621_1003697791 189
265 3300006358 Ga0068871_100402945 Ga0068871_1004029451 189
266 3300006881 Ga0068865_100140568 Ga0068865_1001405682 189
267 3300006931 Ga0097620_100005130 Ga0097620_1000051303 189
268 3300006948 Ga0099826_10030609 Ga0099826_100306093 189
269 3300009177 Ga0105248_10021876 Ga0105248_100218762 189
270 3300009553 Ga0105249_10703870 Ga0105249_107038702 189
271 3300011119 Ga0105246_10270839 Ga0105246_102708392 189
272 3300013297 Ga0157378_10139525 Ga0157378_101395252 189
273 3300013308 Ga0157375_10391763 Ga0157375_103917631 189
274 3300014968 Ga0157379_10000871 Ga0157379_1000087115 189
275 3300025903 Ga0207680_10085375 Ga0207680_100853752 189
276 3300025923 Ga0207681_10006754 Ga0207681_100067546 189
277 3300025935 Ga0207709_10132097 Ga0207709_101320972 189
278 3300025942 Ga0207689_10000258 Ga0207689_1000025830 189
279 3300025960 Ga0207651_10004733 Ga0207651_100047336 189
280 3300025961 Ga0207712_10529287 Ga0207712_105292871 189
281 3300025972 Ga0207668_10108435 Ga0207668_101084352 189
282 3300025986 Ga0207658_10006421 Ga0207658_100064212 189
283 3300026035 Ga0207703_10002766 Ga0207703_100027663 189
284 3300026088 Ga0207641_10037009 Ga0207641_100370092 189
285 3300026088 Ga0207641_10272864 Ga0207641_102728641 189
286 3300026089 Ga0207648_10000667 Ga0207648_1000066728 189
287 3300026089 Ga0207648_10048370 Ga0207648_100483703 189
288 3300026095 Ga0207676_10009106 Ga0207676_100091062 189
289 3300026116 Ga0207674_10023530 Ga0207674_100235302 189
290 3300026116 Ga0207674_10805160 Ga0207674_108051601 189
291 3300026118 Ga0207675_100002057 Ga0207675_10000205710 189
292 3300028380 Ga0268265_10018243 Ga0268265_100182433 189
293 3300028381 Ga0268264_10003471 Ga0268264_100034713 189
294 3300031548 Ga0307408_100000795 Ga0307408_10000079518 189
295 3300031548 Ga0307408_100028947 Ga0307408_1000289472 189
296 3300031649 Ga0307514_10015687 Ga0307514_100156874 189
297 3300031731 Ga0307405_10001567 Ga0307405_100015677 189
298 3300031731 Ga0307405_10155217 Ga0307405_101552172 189
299 3300031824 Ga0307413_10013062 Ga0307413_100130623 189
300 3300031852 Ga0307410_10000388 Ga0307410_100003887 189
301 3300031852 Ga0307410_10226403 Ga0307410_102264032 189
302 3300031901 Ga0307406_10001760 Ga0307406_100017609 189
303 3300031901 Ga0307406_10014344 Ga0307406_100143443 189
304 3300031903 Ga0307407_10016334 Ga0307407_100163343 189
305 3300031911 Ga0307412_10001020 Ga0307412_100010202 189
306 3300031995 Ga0307409_100013393 Ga0307409_1000133933 189
307 3300031995 Ga0307409_101000689 Ga0307409_1010006891 189
308 3300032002 Ga0307416_100236630 Ga0307416_1002366302 189
309 3300032004 Ga0307414_10040606 Ga0307414_100406064 189
310 3300032004 Ga0307414_10159379 Ga0307414_101593792 189
311 3300032005 Ga0307411_10000093 Ga0307411_100000934 189
312 3300032126 Ga0307415_100000580 Ga0307415_1000005805 189
313 3300041413 Ga0439465_0018186 Ga0439465_0018186_947_1615 189
314 3300042002 Ga0439442_019309 Ga0439442_019309_404_1072 189
315 3300042006 Ga0439432_042946 Ga0439432_042946_34_672 189
316 3300042123 Ga0450921_001550 Ga0450921_001550_131_799 189
317 3300042125 Ga0450923_002679 Ga0450923_002679_1731_2399 189
318 3300042145 Ga0450906_029529 Ga0450906_029529_187_855 189
319 3300042185 Ga0450909_028578 Ga0450909_028578_24_692 189
320 3300042435 Ga0439434_0043207 Ga0439434_0043207_80_748 189
321 3300046660 Ga0495625_0001007 Ga0495625_0001007_14364_15032 189
322 3300048905 Ga0496102_0014776 Ga0496102_0014776_643_1296 189
323 3300048906 Ga0496103_0139926 Ga0496103_0139926_96_749 189
324 3300048908 Ga0496105_0239505 Ga0496105_0239505_538_1155 189
325 3300048911 Ga0496108_0114058 Ga0496108_0114058_1626_2279 189
326 3300048912 Ga0496109_0489352 Ga0496109_0489352_96_749 189
327 3300050490 nmdc:mga03n38_32329_c1 nmdc:mga03n38_32329_c1_479_1147 189
328 3300050493 nmdc:mga0k408_8200_c1 nmdc:mga0k408_8200_c1_2618_3286 189
329 3300003781 Ga0055536_1006353 Ga0055536_10063532 190
330 3300003791 Ga0055530_10004556 Ga0055530_100045562 190
331 3300003792 Ga0055540_1005224 Ga0055540_10052242 190
332 3300003794 Ga0055531_10007985 Ga0055531_100079852 190
333 3300005328 Ga0070676_10241127 Ga0070676_102411272 190
334 3300005331 Ga0070670_100054285 Ga0070670_1000542853 190
335 3300005331 Ga0070670_100109562 Ga0070670_1001095623 190
336 3300005335 Ga0070666_10036643 Ga0070666_100366432 190
337 3300005335 Ga0070666_10186152 Ga0070666_101861521 190
338 3300005338 Ga0068868_100035704 Ga0068868_1000357044 190
339 3300005347 Ga0070668_100001133 Ga0070668_1000011334 190
340 3300005347 Ga0070668_100366929 Ga0070668_1003669292 190
341 3300005353 Ga0070669_100057425 Ga0070669_1000574253 190
342 3300005353 Ga0070669_100733498 Ga0070669_1007334981 190
343 3300005354 Ga0070675_100000235 Ga0070675_10000023515 190
344 3300005354 Ga0070675_100549752 Ga0070675_1005497521 190
345 3300005355 Ga0070671_100003028 Ga0070671_10000302812 190
346 3300005355 Ga0070671_100017030 Ga0070671_1000170302 190
347 3300005355 Ga0070671_100044249 Ga0070671_1000442492 190
348 3300005356 Ga0070674_100002199 Ga0070674_10000219910 190
349 3300005364 Ga0070673_100002358 Ga0070673_1000023589 190
350 3300005364 Ga0070673_100168910 Ga0070673_1001689102 190
351 3300005364 Ga0070673_100335291 Ga0070673_1003352912 190
352 3300005367 Ga0070667_100002692 Ga0070667_1000026921 190
353 3300005367 Ga0070667_100063570 Ga0070667_1000635704 190
354 3300005367 Ga0070667_100090414 Ga0070667_1000904141 190
355 3300005367 Ga0070667_100291921 Ga0070667_1002919212 190
356 3300005367 Ga0070667_100700595 Ga0070667_1007005951 190
357 3300005438 Ga0070701_10270240 Ga0070701_102702401 190
358 3300005441 Ga0070700_100245619 Ga0070700_1002456191 190
359 3300005445 Ga0070708_100000773 Ga0070708_1000007736 190
360 3300005455 Ga0070663_100001362 Ga0070663_1000013626 190
361 3300005455 Ga0070663_100230523 Ga0070663_1002305231 190
362 3300005456 Ga0070678_100001357 Ga0070678_1000013571 190
363 3300005457 Ga0070662_100049784 Ga0070662_1000497843 190
364 3300005457 Ga0070662_100106673 Ga0070662_1001066732 190
365 3300005457 Ga0070662_100205882 Ga0070662_1002058822 190
366 3300005459 Ga0068867_100003026 Ga0068867_1000030266 190
367 3300005539 Ga0068853_100014134 Ga0068853_1000141346 190
368 3300005543 Ga0070672_100033175 Ga0070672_1000331755 190
369 3300005548 Ga0070665_100004180 Ga0070665_10000418014 190
370 3300005548 Ga0070665_100077702 Ga0070665_1000777022 190
371 3300005548 Ga0070665_100158765 Ga0070665_1001587652 190
372 3300005548 Ga0070665_100988369 Ga0070665_1009883691 190
373 3300005564 Ga0070664_100020447 Ga0070664_1000204474 190
374 3300005564 Ga0070664_100040211 Ga0070664_1000402113 190
375 3300005615 Ga0070702_100128683 Ga0070702_1001286832 190
376 3300005616 Ga0068852_100024496 Ga0068852_1000244964 190
377 3300005616 Ga0068852_100746476 Ga0068852_1007464762 190
378 3300005617 Ga0068859_101327400 Ga0068859_1013274001 190
379 3300005618 Ga0068864_100291088 Ga0068864_1002910882 190
380 3300005719 Ga0068861_100112565 Ga0068861_1001125652 190
381 3300005719 Ga0068861_100163184 Ga0068861_1001631842 190
382 3300005719 Ga0068861_100197533 Ga0068861_1001975332 190
383 3300005719 Ga0068861_101036623 Ga0068861_1010366231 190
384 3300005834 Ga0068851_10018615 Ga0068851_100186153 190
385 3300005840 Ga0068870_10004622 Ga0068870_100046225 190
386 3300005841 Ga0068863_100008456 Ga0068863_1000084569 190
387 3300005842 Ga0068858_100018525 Ga0068858_1000185255 190
388 3300005843 Ga0068860_100014571 Ga0068860_1000145712 190
389 3300005843 Ga0068860_100050601 Ga0068860_1000506014 190
390 3300006237 Ga0097621_100191196 Ga0097621_1001911962 190
391 3300006353 Ga0075370_10209610 Ga0075370_102096102 190
392 3300006358 Ga0068871_100057888 Ga0068871_1000578883 190
393 3300006358 Ga0068871_100103581 Ga0068871_1001035812 190
394 3300006931 Ga0097620_101327762 Ga0097620_1013277621 190
395 3300009101 Ga0105247_10265201 Ga0105247_102652012 190
396 3300009148 Ga0105243_10091035 Ga0105243_100910352 190
397 3300009176 Ga0105242_10156117 Ga0105242_101561172 190
398 3300009177 Ga0105248_10088427 Ga0105248_100884273 190
399 3300009177 Ga0105248_10384699 Ga0105248_103846991 190
400 3300009545 Ga0105237_10144947 Ga0105237_101449472 190
401 3300009551 Ga0105238_10431980 Ga0105238_104319801 190
402 3300013297 Ga0157378_10030194 Ga0157378_100301942 190
403 3300013297 Ga0157378_10081747 Ga0157378_100817473 190
404 3300013306 Ga0163162_10141504 Ga0163162_101415042 190
405 3300013306 Ga0163162_11565598 Ga0163162_115655981 190
406 3300013308 Ga0157375_10000781 Ga0157375_1000078110 190
407 3300013308 Ga0157375_10009140 Ga0157375_100091405 190
408 3300013308 Ga0157375_10033977 Ga0157375_100339773 190
409 3300013308 Ga0157375_10326415 Ga0157375_103264151 190
410 3300014325 Ga0163163_10135307 Ga0163163_101353073 190
411 3300014325 Ga0163163_10171958 Ga0163163_101719583 190
412 3300014325 Ga0163163_10216213 Ga0163163_102162133 190
413 3300014325 Ga0163163_10256732 Ga0163163_102567322 190
414 3300014326 Ga0157380_10078238 Ga0157380_100782383 190
415 3300014497 Ga0182008_10001493 Ga0182008_100014934 190
416 3300014968 Ga0157379_10002711 Ga0157379_100027113 190
417 3300014969 Ga0157376_10815265 Ga0157376_108152652 190
418 3300015261 Ga0182006_1002058 Ga0182006_10020589 190
419 3300015262 Ga0182007_10003158 Ga0182007_100031584 190
420 3300017792 Ga0163161_10122246 Ga0163161_101222462 190
421 3300025292 Ga0209676_1003633 Ga0209676_10036334 190
422 3300025298 Ga0209050_1001905 Ga0209050_10019056 190
423 3300025303 Ga0209051_1000984 Ga0209051_10009846 190
424 3300025304 Ga0209257_1004781 Ga0209257_10047816 190
425 3300025321 Ga0207656_10031148 Ga0207656_100311482 190
426 3300025728 Ga0207655_1002097 Ga0207655_10020979 190
427 3300025893 Ga0207682_10000165 Ga0207682_1000016524 190
428 3300025899 Ga0207642_10070692 Ga0207642_100706922 190
429 3300025900 Ga0207710_10266071 Ga0207710_102660711 190
430 3300025903 Ga0207680_10002735 Ga0207680_100027357 190
431 3300025903 Ga0207680_10053024 Ga0207680_100530242 190
432 3300025903 Ga0207680_10120018 Ga0207680_101200182 190
433 3300025907 Ga0207645_10000045 Ga0207645_1000004556 190
434 3300025907 Ga0207645_10037385 Ga0207645_100373852 190
435 3300025908 Ga0207643_10030341 Ga0207643_100303412 190
436 3300025914 Ga0207671_10204961 Ga0207671_102049612 190
437 3300025920 Ga0207649_10036109 Ga0207649_100361092 190
438 3300025923 Ga0207681_10030082 Ga0207681_100300822 190
439 3300025923 Ga0207681_10244260 Ga0207681_102442602 190
440 3300025924 Ga0207694_10181287 Ga0207694_101812872 190
441 3300025925 Ga0207650_10067025 Ga0207650_100670251 190
442 3300025926 Ga0207659_10001999 Ga0207659_1000199912 190
443 3300025926 Ga0207659_10157041 Ga0207659_101570412 190
444 3300025931 Ga0207644_10009759 Ga0207644_100097595 190
445 3300025931 Ga0207644_10182744 Ga0207644_101827442 190
446 3300025933 Ga0207706_10070215 Ga0207706_100702152 190
447 3300025933 Ga0207706_10234349 Ga0207706_102343492 190
448 3300025934 Ga0207686_10497364 Ga0207686_104973642 190
449 3300025935 Ga0207709_10000955 Ga0207709_1000095513 190
450 3300025937 Ga0207669_10003418 Ga0207669_100034184 190
451 3300025938 Ga0207704_10039976 Ga0207704_100399762 190
452 3300025940 Ga0207691_10000279 Ga0207691_1000027914 190
453 3300025940 Ga0207691_10048202 Ga0207691_100482025 190
454 3300025940 Ga0207691_10086305 Ga0207691_100863053 190
455 3300025940 Ga0207691_10477071 Ga0207691_104770712 190
456 3300025941 Ga0207711_10059109 Ga0207711_100591093 190
457 3300025945 Ga0207679_10021574 Ga0207679_100215742 190
458 3300025960 Ga0207651_10002260 Ga0207651_100022609 190
459 3300025960 Ga0207651_10158122 Ga0207651_101581222 190
460 3300025972 Ga0207668_10004878 Ga0207668_100048785 190
461 3300025972 Ga0207668_10068451 Ga0207668_100684512 190
462 3300025981 Ga0207640_10451727 Ga0207640_104517271 190
463 3300025986 Ga0207658_10012186 Ga0207658_100121864 190
464 3300025986 Ga0207658_10032895 Ga0207658_100328954 190
465 3300025986 Ga0207658_10038643 Ga0207658_100386432 190
466 3300026023 Ga0207677_10003411 Ga0207677_100034119 190
467 3300026023 Ga0207677_10311076 Ga0207677_103110762 190
468 3300026035 Ga0207703_10026514 Ga0207703_100265143 190
469 3300026041 Ga0207639_10058518 Ga0207639_100585182 190
470 3300026067 Ga0207678_10017290 Ga0207678_100172902 190
471 3300026067 Ga0207678_10269352 Ga0207678_102693521 190
472 3300026075 Ga0207708_10080168 Ga0207708_100801682 190
473 3300026088 Ga0207641_10024408 Ga0207641_100244085 190
474 3300026088 Ga0207641_10035790 Ga0207641_100357902 190
475 3300026089 Ga0207648_10001435 Ga0207648_1000143519 190
476 3300026089 Ga0207648_10760263 Ga0207648_107602631 190
477 3300026095 Ga0207676_10077358 Ga0207676_100773582 190
478 3300026095 Ga0207676_10627973 Ga0207676_106279731 190
479 3300026095 Ga0207676_10773242 Ga0207676_107732422 190
480 3300026118 Ga0207675_100151102 Ga0207675_1001511023 190
481 3300026118 Ga0207675_100151553 Ga0207675_1001515532 190
482 3300026121 Ga0207683_10000003 Ga0207683_1000000343 190
483 3300026142 Ga0207698_10716584 Ga0207698_107165841 190
484 3300028379 Ga0268266_10006480 Ga0268266_100064803 190
485 3300028379 Ga0268266_10092762 Ga0268266_100927623 190
486 3300028379 Ga0268266_10194128 Ga0268266_101941282 190
487 3300028380 Ga0268265_10237539 Ga0268265_102375392 190
488 3300028381 Ga0268264_10054237 Ga0268264_100542372 190
489 3300028381 Ga0268264_10320925 Ga0268264_103209252 190
490 3300031911 Ga0307412_10057513 Ga0307412_100575132 190
491 3300035691 Ga0373931_0111404 Ga0373931_0111404_849_1496 190
492 3300046525 Ga0495663_0125654 Ga0495663_0125654_90_764 190
493 3300046615 Ga0495656_0000173 Ga0495656_0000173_1801_2475 190
494 3300048090 Ga0495615_0004467 Ga0495615_0004467_918_1592 190
495 3300048917 Ga0496114_0098988 Ga0496114_0098988_1584_2258 190
496 3300048920 Ga0496117_0023008 Ga0496117_0023008_2940_3611 190
497 3300048921 Ga0496118_0012382 Ga0496118_0012382_5025_5696 190
498 3300048927 Ga0496124_0095575 Ga0496124_0095575_355_1026 190
499 3300048928 Ga0496125_0037448 Ga0496125_0037448_691_1362 190
500 3300049759 Ga0501262_000071 Ga0501262_000071_11555_12220 190
501 3300050494 nmdc:mga06z11_170836_c1 nmdc:mga06z11_170836_c1_177_848 190
502 3300050496 nmdc:mga07m45_61284_c1 nmdc:mga07m45_61284_c1_1266_1937 190
503 iso_pu_bacteria 2939631187 2939634093 190
504 3300005335 Ga0070666_10019587 Ga0070666_100195873 191
505 3300005340 Ga0070689_100470872 Ga0070689_1004708722 191
506 3300005347 Ga0070668_100085563 Ga0070668_1000855632 191
507 3300005356 Ga0070674_100339262 Ga0070674_1003392622 191
508 3300005367 Ga0070667_100130060 Ga0070667_1001300603 191
509 3300005367 Ga0070667_100267749 Ga0070667_1002677492 191
510 3300005434 Ga0070709_10112924 Ga0070709_101129242 191
511 3300005456 Ga0070678_100004731 Ga0070678_1000047312 191
512 3300005456 Ga0070678_100489495 Ga0070678_1004894951 191
513 3300005459 Ga0068867_100447731 Ga0068867_1004477312 191
514 3300005466 Ga0070685_10437976 Ga0070685_104379761 191
515 3300005471 Ga0070698_100050333 Ga0070698_1000503332 191
516 3300005530 Ga0070679_100612385 Ga0070679_1006123852 191
517 3300005539 Ga0068853_100332237 Ga0068853_1003322372 191
518 3300005543 Ga0070672_100032742 Ga0070672_1000327423 191
519 3300005548 Ga0070665_100010735 Ga0070665_10001073510 191
520 3300005564 Ga0070664_100029213 Ga0070664_1000292133 191
521 3300005614 Ga0068856_100026992 Ga0068856_1000269925 191
522 3300005616 Ga0068852_100210387 Ga0068852_1002103872 191
523 3300005841 Ga0068863_100028700 Ga0068863_1000287002 191
524 3300005843 Ga0068860_100148128 Ga0068860_1001481281 191
525 3300006237 Ga0097621_100206227 Ga0097621_1002062272 191
526 3300006237 Ga0097621_100670258 Ga0097621_1006702582 191
527 3300006358 Ga0068871_100803823 Ga0068871_1008038231 191
528 3300006871 Ga0075434_100114823 Ga0075434_1001148233 191
529 3300006871 Ga0075434_100655680 Ga0075434_1006556801 191
530 3300006881 Ga0068865_100363561 Ga0068865_1003635611 191
531 3300007076 Ga0075435_100310710 Ga0075435_1003107102 191
532 3300009093 Ga0105240_10347509 Ga0105240_103475092 191
533 3300009177 Ga0105248_10414372 Ga0105248_104143721 191
534 3300009545 Ga0105237_10242721 Ga0105237_102427212 191
535 3300009551 Ga0105238_10061064 Ga0105238_100610642 191
536 3300009553 Ga0105249_10224426 Ga0105249_102244263 191
537 3300010375 Ga0105239_10171933 Ga0105239_101719332 191
538 3300013104 Ga0157370_10045835 Ga0157370_100458352 191
539 3300013105 Ga0157369_10002892 Ga0157369_1000289210 191
540 3300013297 Ga0157378_10680016 Ga0157378_106800161 191
541 3300013308 Ga0157375_10241803 Ga0157375_102418032 191
542 3300014968 Ga0157379_10394773 Ga0157379_103947732 191
543 3300014968 Ga0157379_10716643 Ga0157379_107166432 191
544 3300014969 Ga0157376_10022890 Ga0157376_100228904 191
545 3300025903 Ga0207680_10114712 Ga0207680_101147122 191
546 3300025913 Ga0207695_10287526 Ga0207695_102875262 191
547 3300025914 Ga0207671_10126117 Ga0207671_101261172 191
548 3300025924 Ga0207694_10301474 Ga0207694_103014742 191
549 3300025941 Ga0207711_10143534 Ga0207711_101435343 191
550 3300025945 Ga0207679_10461456 Ga0207679_104614562 191
551 3300025960 Ga0207651_10508839 Ga0207651_105088391 191
552 3300025981 Ga0207640_10077818 Ga0207640_100778182 191
553 3300025986 Ga0207658_10021840 Ga0207658_100218402 191
554 3300025986 Ga0207658_10474753 Ga0207658_104747532 191
555 3300026078 Ga0207702_10013354 Ga0207702_100133545 191
556 3300026088 Ga0207641_10304160 Ga0207641_103041601 191
557 3300026089 Ga0207648_10028568 Ga0207648_100285685 191
558 3300026121 Ga0207683_10005506 Ga0207683_100055065 191
559 3300026142 Ga0207698_10389250 Ga0207698_103892502 191
560 3300027695 Ga0209966_1021715 Ga0209966_10217151 191
561 3300027717 Ga0209998_10023613 Ga0209998_100236131 191
562 3300027876 Ga0209974_10017806 Ga0209974_100178061 191
563 3300028380 Ga0268265_10172771 Ga0268265_101727712 191
564 3300028381 Ga0268264_10017610 Ga0268264_100176105 191
565 3300035172 Ga0373955_0323253 Ga0373955_0323253_91_732 191
566 3300035692 Ga0373935_0389151 Ga0373935_0389151_141_782 191
567 3300035724 Ga0373933_0279409 Ga0373933_0279409_408_1049 191
568 3300036401 Ga0373937_0246627 Ga0373937_0246627_133_774 191
569 3300037068 Ga0373925_0080141 Ga0373925_0080141_676_1317 191
570 3300046453 Ga0495627_005263 Ga0495627_005263_3926_4597 191
571 3300046515 Ga0495620_0008396 Ga0495620_0008396_354_1025 191
572 3300046520 Ga0495637_0007697 Ga0495637_0007697_4168_4839 191
573 3300046660 Ga0495625_0112354 Ga0495625_0112354_1161_1832 191
574 3300046665 Ga0495661_0084956 Ga0495661_0084956_621_1292 191
575 3300046692 Ga0495671_0024654 Ga0495671_0024654_269_940 191
576 3300048927 Ga0496124_0097393 Ga0496124_0097393_1501_2181 191
577 3300050511 nmdc:mga08y16_237728_c1 nmdc:mga08y16_237728_c1_174_815 191
578 3300050512 nmdc:mga0n895_81956_c2 nmdc:mga0n895_81956_c2_703_1350 191
579 3300050513 nmdc:mga0rr50_113462_c1 nmdc:mga0rr50_113462_c1_1386_2033 191
580 3300053079 Ga0500610_0000979 Ga0500610_0000979_8534_9205 191
581 3300053087 Ga0500643_033127 Ga0500643_033127_764_1435 191
582 3300053109 Ga0500569_091221 Ga0500569_091221_77_748 191
583 3300053117 Ga0500593_001195 Ga0500593_001195_4091_4762 191
584 3300053158 Ga0500627_0000717 Ga0500627_0000717_3632_4303 191
585 iso_pu_bacteria 2547132374 2548499110 191
586 iso_pu_bacteria 2643221570 2643867687 191
587 iso_pu_bacteria 2643221652 2644293282 191
588 iso_pu_bacteria 2643221717 2644648566 191
589 iso_pu_bacteria 2990710928 2990714005 191
590 3300001991 JGI24743J22301_10060382 JGI24743J22301_100603821 192
591 3300002076 JGI24749J21850_1010698 JGI24749J21850_10106982 192
592 3300002077 JGI24744J21845_10036270 JGI24744J21845_100362701 192
593 3300002239 JGI24034J26672_10005856 JGI24034J26672_100058563 192
594 3300002459 JGI24751J29686_10015244 JGI24751J29686_100152442 192
595 3300005327 Ga0070658_10016361 Ga0070658_100163615 192
596 3300005329 Ga0070683_100004377 Ga0070683_10000437710 192
597 3300005329 Ga0070683_100146971 Ga0070683_1001469712 192
598 3300005330 Ga0070690_100013195 Ga0070690_1000131952 192
599 3300005333 Ga0070677_10021558 Ga0070677_100215583 192
600 3300005334 Ga0068869_100003158 Ga0068869_1000031585 192
601 3300005335 Ga0070666_10383672 Ga0070666_103836721 192
602 3300005336 Ga0070680_100442391 Ga0070680_1004423911 192
603 3300005338 Ga0068868_100058057 Ga0068868_1000580572 192
604 3300005339 Ga0070660_100004401 Ga0070660_1000044013 192
605 3300005339 Ga0070660_100025476 Ga0070660_1000254762 192
606 3300005339 Ga0070660_100073271 Ga0070660_1000732712 192
607 3300005340 Ga0070689_100379647 Ga0070689_1003796471 192
608 3300005343 Ga0070687_100001531 Ga0070687_1000015317 192
609 3300005343 Ga0070687_100139739 Ga0070687_1001397392 192
610 3300005344 Ga0070661_100002630 Ga0070661_10000263010 192
611 3300005344 Ga0070661_100009245 Ga0070661_1000092452 192
612 3300005344 Ga0070661_100079356 Ga0070661_1000793563 192
613 3300005345 Ga0070692_10493962 Ga0070692_104939621 192
614 3300005353 Ga0070669_100157405 Ga0070669_1001574051 192
615 3300005353 Ga0070669_100442967 Ga0070669_1004429671 192
616 3300005355 Ga0070671_100016559 Ga0070671_1000165594 192
617 3300005364 Ga0070673_100044482 Ga0070673_1000444823 192
618 3300005364 Ga0070673_100134801 Ga0070673_1001348012 192
619 3300005364 Ga0070673_100767715 Ga0070673_1007677151 192
620 3300005365 Ga0070688_100026897 Ga0070688_1000268972 192
621 3300005365 Ga0070688_100463764 Ga0070688_1004637641 192
622 3300005366 Ga0070659_100010089 Ga0070659_1000100893 192
623 3300005366 Ga0070659_100031851 Ga0070659_1000318514 192
624 3300005366 Ga0070659_100197482 Ga0070659_1001974822 192
625 3300005367 Ga0070667_100063102 Ga0070667_1000631021 192
626 3300005438 Ga0070701_10027616 Ga0070701_100276162 192
627 3300005440 Ga0070705_100245475 Ga0070705_1002454752 192
628 3300005455 Ga0070663_100023461 Ga0070663_1000234613 192
629 3300005455 Ga0070663_100079964 Ga0070663_1000799641 192
630 3300005455 Ga0070663_100824421 Ga0070663_1008244211 192
631 3300005457 Ga0070662_100001027 Ga0070662_10000102714 192
632 3300005458 Ga0070681_10217116 Ga0070681_102171162 192
633 3300005466 Ga0070685_10021853 Ga0070685_100218534 192
634 3300005530 Ga0070679_100350030 Ga0070679_1003500302 192
635 3300005535 Ga0070684_100109046 Ga0070684_1001090462 192
636 3300005539 Ga0068853_100033311 Ga0068853_1000333113 192
637 3300005539 Ga0068853_100053997 Ga0068853_1000539972 192
638 3300005543 Ga0070672_100008441 Ga0070672_1000084412 192
639 3300005543 Ga0070672_100029890 Ga0070672_1000298901 192
640 3300005544 Ga0070686_100064667 Ga0070686_1000646673 192
641 3300005548 Ga0070665_100116676 Ga0070665_1001166762 192
642 3300005563 Ga0068855_100000446 Ga0068855_10000044647 192
643 3300005563 Ga0068855_100082535 Ga0068855_1000825352 192
644 3300005563 Ga0068855_101076282 Ga0068855_1010762821 192
645 3300005564 Ga0070664_100012372 Ga0070664_1000123726 192
646 3300005564 Ga0070664_100012737 Ga0070664_1000127375 192
647 3300005564 Ga0070664_100178692 Ga0070664_1001786922 192
648 3300005564 Ga0070664_100220374 Ga0070664_1002203742 192
649 3300005577 Ga0068857_100182759 Ga0068857_1001827592 192
650 3300005578 Ga0068854_100026774 Ga0068854_1000267742 192
651 3300005614 Ga0068856_100003250 Ga0068856_1000032502 192
652 3300005616 Ga0068852_100022774 Ga0068852_1000227742 192
653 3300005616 Ga0068852_100029844 Ga0068852_1000298441 192
654 3300005616 Ga0068852_100123993 Ga0068852_1001239932 192
655 3300005616 Ga0068852_100173763 Ga0068852_1001737632 192
656 3300005617 Ga0068859_100020012 Ga0068859_1000200123 192
657 3300005617 Ga0068859_100300016 Ga0068859_1003000161 192
658 3300005618 Ga0068864_100002013 Ga0068864_1000020138 192
659 3300005618 Ga0068864_100176871 Ga0068864_1001768712 192
660 3300005618 Ga0068864_100764330 Ga0068864_1007643301 192
661 3300005719 Ga0068861_100128998 Ga0068861_1001289982 192
662 3300005834 Ga0068851_10013177 Ga0068851_100131772 192
663 3300005834 Ga0068851_10105043 Ga0068851_101050432 192
664 3300005840 Ga0068870_10144590 Ga0068870_101445902 192
665 3300005842 Ga0068858_100196322 Ga0068858_1001963221 192
666 3300006237 Ga0097621_100102903 Ga0097621_1001029031 192
667 3300006237 Ga0097621_100133706 Ga0097621_1001337062 192
668 3300006237 Ga0097621_100940884 Ga0097621_1009408841 192
669 3300006358 Ga0068871_100453811 Ga0068871_1004538112 192
670 3300006931 Ga0097620_100020012 Ga0097620_1000200123 192
671 3300006931 Ga0097620_100300030 Ga0097620_1003000301 192
672 3300009148 Ga0105243_10009495 Ga0105243_100094953 192
673 3300010375 Ga0105239_10426776 Ga0105239_104267761 192
674 3300011119 Ga0105246_10078722 Ga0105246_100787222 192
675 3300013100 Ga0157373_10001349 Ga0157373_1000134915 192
676 3300013100 Ga0157373_10245829 Ga0157373_102458292 192
677 3300013102 Ga0157371_10000787 Ga0157371_1000078714 192
678 3300013102 Ga0157371_10393340 Ga0157371_103933401 192
679 3300013104 Ga0157370_10011558 Ga0157370_100115584 192
680 3300013104 Ga0157370_10016713 Ga0157370_100167137 192
681 3300013296 Ga0157374_10272014 Ga0157374_102720141 192
682 3300013306 Ga0163162_10320934 Ga0163162_103209341 192
683 3300013307 Ga0157372_10009210 Ga0157372_100092103 192
684 3300013307 Ga0157372_10052329 Ga0157372_100523295 192
685 3300013307 Ga0157372_10145117 Ga0157372_101451171 192
686 3300013307 Ga0157372_10464124 Ga0157372_104641241 192
687 3300013308 Ga0157375_10251633 Ga0157375_102516332 192
688 3300013308 Ga0157375_11016383 Ga0157375_110163831 192
689 3300014325 Ga0163163_10007489 Ga0163163_100074892 192
690 3300014968 Ga0157379_10037583 Ga0157379_100375835 192
691 3300025315 Ga0207697_10000102 Ga0207697_1000010224 192
692 3300025321 Ga0207656_10132904 Ga0207656_101329041 192
693 3300025901 Ga0207688_10000286 Ga0207688_1000028614 192
694 3300025903 Ga0207680_10008569 Ga0207680_100085694 192
695 3300025904 Ga0207647_10101368 Ga0207647_101013681 192
696 3300025907 Ga0207645_10000437 Ga0207645_1000043724 192
697 3300025907 Ga0207645_10159068 Ga0207645_101590682 192
698 3300025908 Ga0207643_10001528 Ga0207643_1000152812 192
699 3300025917 Ga0207660_10157013 Ga0207660_101570133 192
700 3300025917 Ga0207660_10447117 Ga0207660_104471172 192
701 3300025918 Ga0207662_10006635 Ga0207662_100066356 192
702 3300025919 Ga0207657_10006421 Ga0207657_100064212 192
703 3300025919 Ga0207657_10027114 Ga0207657_100271142 192
704 3300025919 Ga0207657_10027676 Ga0207657_100276762 192
705 3300025920 Ga0207649_10005560 Ga0207649_100055603 192
706 3300025920 Ga0207649_10167970 Ga0207649_101679702 192
707 3300025921 Ga0207652_10096020 Ga0207652_100960202 192
708 3300025923 Ga0207681_10089930 Ga0207681_100899302 192
709 3300025925 Ga0207650_10002517 Ga0207650_100025172 192
710 3300025931 Ga0207644_10009310 Ga0207644_100093104 192
711 3300025931 Ga0207644_10378861 Ga0207644_103788612 192
712 3300025932 Ga0207690_10000485 Ga0207690_1000048516 192
713 3300025932 Ga0207690_10665547 Ga0207690_106655471 192
714 3300025933 Ga0207706_10000023 Ga0207706_1000002348 192
715 3300025933 Ga0207706_10000774 Ga0207706_100007746 192
716 3300025933 Ga0207706_10074987 Ga0207706_100749873 192
717 3300025935 Ga0207709_10002740 Ga0207709_100027406 192
718 3300025936 Ga0207670_10342238 Ga0207670_103422381 192
719 3300025940 Ga0207691_10019010 Ga0207691_100190103 192
720 3300025942 Ga0207689_10000356 Ga0207689_100003565 192
721 3300025942 Ga0207689_10506489 Ga0207689_105064891 192
722 3300025944 Ga0207661_10289401 Ga0207661_102894012 192
723 3300025945 Ga0207679_10007168 Ga0207679_100071686 192
724 3300025945 Ga0207679_10091838 Ga0207679_100918382 192
725 3300025945 Ga0207679_10349099 Ga0207679_103490991 192
726 3300025949 Ga0207667_10004129 Ga0207667_1000412911 192
727 3300025949 Ga0207667_10303021 Ga0207667_103030212 192
728 3300025960 Ga0207651_10326950 Ga0207651_103269501 192
729 3300025972 Ga0207668_10539384 Ga0207668_105393842 192
730 3300025981 Ga0207640_10004855 Ga0207640_100048555 192
731 3300025981 Ga0207640_10167070 Ga0207640_101670702 192
732 3300025986 Ga0207658_10102385 Ga0207658_101023852 192
733 3300025986 Ga0207658_10360044 Ga0207658_103600442 192
734 3300026023 Ga0207677_10124469 Ga0207677_101244691 192
735 3300026023 Ga0207677_10296732 Ga0207677_102967322 192
736 3300026035 Ga0207703_10059806 Ga0207703_100598062 192
737 3300026041 Ga0207639_10002492 Ga0207639_1000249210 192
738 3300026041 Ga0207639_10483254 Ga0207639_104832541 192
739 3300026067 Ga0207678_10074000 Ga0207678_100740001 192
740 3300026075 Ga0207708_10000864 Ga0207708_1000086412 192
741 3300026078 Ga0207702_10000523 Ga0207702_100005236 192
742 3300026095 Ga0207676_10027357 Ga0207676_100273572 192
743 3300026095 Ga0207676_10336916 Ga0207676_103369161 192
744 3300026116 Ga0207674_10219375 Ga0207674_102193752 192
745 3300026116 Ga0207674_10396910 Ga0207674_103969102 192
746 3300026118 Ga0207675_100007608 Ga0207675_1000076089 192
747 3300026118 Ga0207675_100032799 Ga0207675_1000327995 192
748 3300026121 Ga0207683_10004027 Ga0207683_1000402712 192
749 3300026142 Ga0207698_10058979 Ga0207698_100589792 192
750 3300026142 Ga0207698_10063574 Ga0207698_100635742 192
751 3300026142 Ga0207698_10128256 Ga0207698_101282562 192
752 3300026142 Ga0207698_10188136 Ga0207698_101881363 192
753 3300027614 Ga0209970_1021239 Ga0209970_10212392 192
754 3300027665 Ga0209983_1001514 Ga0209983_10015144 192
755 3300027876 Ga0209974_10015348 Ga0209974_100153482 192
756 3300031235 Ga0265330_10002123 Ga0265330_1000212311 192
757 3300031238 Ga0265332_10001981 Ga0265332_100019815 192
758 3300031242 Ga0265329_10003194 Ga0265329_100031944 192
759 3300031250 Ga0265331_10003705 Ga0265331_100037056 192
760 3300031251 Ga0265327_10003393 Ga0265327_1000339310 192
761 3300031344 Ga0265316_10018501 Ga0265316_100185015 192
762 3300031595 Ga0265313_10054495 Ga0265313_100544952 192
763 3300031712 Ga0265342_10006293 Ga0265342_100062933 192
764 3300031901 Ga0307406_10260293 Ga0307406_102602932 192
765 3300031911 Ga0307412_10007471 Ga0307412_100074715 192
766 3300035111 Ga0373923_0092136 Ga0373923_0092136_136_786 192
767 3300035120 Ga0373957_0185065 Ga0373957_0185065_94_744 192
768 3300035172 Ga0373955_0213488 Ga0373955_0213488_52_702 192
769 3300035410 Ga0373924_0091205 Ga0373924_0091205_519_1169 192
770 3300036401 Ga0373937_0080973 Ga0373937_0080973_2293_2943 192
771 3300037466 Ga0395898_0010634 Ga0395898_0010634_5922_6599 192
772 3300038443 Ga0395901_0404985 Ga0395901_0404985_573_1250 192
773 3300041491 Ga0451833_1230188 Ga0451833_1230188_201_875 192
774 3300046537 Ga0495598_0089592 Ga0495598_0089592_323_988 192
775 3300048903 Ga0496100_0141066 Ga0496100_0141066_748_1413 192
776 3300048904 Ga0496101_0008759 Ga0496101_0008759_5925_6590 192
777 3300048904 Ga0496101_0115314 Ga0496101_0115314_652_1302 192
778 3300048905 Ga0496102_0033317 Ga0496102_0033317_117_767 192
779 3300048907 Ga0496104_0281717 Ga0496104_0281717_142_807 192
780 3300048908 Ga0496105_0105152 Ga0496105_0105152_396_1061 192
781 3300048909 Ga0496106_0002076 Ga0496106_0002076_12540_13190 192
782 3300048909 Ga0496106_0083861 Ga0496106_0083861_322_987 192
783 3300048910 Ga0496107_0037822 Ga0496107_0037822_1623_2273 192
784 3300048910 Ga0496107_0537095 Ga0496107_0537095_170_835 192
785 3300048910 Ga0496107_0627113 Ga0496107_0627113_86_736 192
786 3300048911 Ga0496108_0191551 Ga0496108_0191551_1044_1709 192
787 3300048913 Ga0496110_0011634 Ga0496110_0011634_5918_6583 192
788 3300048913 Ga0496110_0261858 Ga0496110_0261858_159_809 192
789 3300048914 Ga0496111_0120593 Ga0496111_0120593_625_1290 192
790 3300048914 Ga0496111_0653545 Ga0496111_0653545_81_731 192
791 3300053121 Ga0500607_004546 Ga0500607_004546_4297_4968 192
792 3300003773 Ga0055537_1000250 Ga0055537_100025031 193
793 3300003784 Ga0055534_1000016 Ga0055534_1000016139 193
794 3300003790 Ga0055528_1000429 Ga0055528_100042912 193
795 3300006177 Ga0075362_10094089 Ga0075362_100940892 193
796 3300006178 Ga0075367_10006590 Ga0075367_100065902 193
797 3300006353 Ga0075370_10025457 Ga0075370_100254573 193
798 3300006948 Ga0099826_10000894 Ga0099826_1000089412 193
799 3300014969 Ga0157376_10564218 Ga0157376_105642181 193
800 3300025263 Ga0209565_1000098 Ga0209565_100009839 193
801 3300025273 Ga0209673_1000058 Ga0209673_1000058212 193
802 3300025291 Ga0209675_1000010 Ga0209675_100001054 193
803 3300025294 Ga0209025_1034891 Ga0209025_10348912 193
804 3300027666 Ga0209282_1000362 Ga0209282_100036210 193
805 3300041486 Ga0451807_1548440 Ga0451807_1548440_203_925 193
806 3300044683 Ga0466965_0146971 Ga0466965_0146971_459_1133 193
807 3300044901 Ga0466960_0008038 Ga0466960_0008038_261_935 193
808 3300048925 Ga0496122_0055704 Ga0496122_0055704_1962_2639 193
809 3300048926 Ga0496123_0086477 Ga0496123_0086477_532_1209 193
810 3300048927 Ga0496124_0176589 Ga0496124_0176589_123_800 193
811 3300050490 nmdc:mga03n38_60683_c1 nmdc:mga03n38_60683_c1_532_1206 193
812 3300050493 nmdc:mga0k408_15116_c1 nmdc:mga0k408_15116_c1_740_1414 193
813 3300050496 nmdc:mga07m45_26743_c1 nmdc:mga07m45_26743_c1_692_1366 193
814 3300050516 nmdc:mga0sz30_240354_c1 nmdc:mga0sz30_240354_c1_74_754 193
815 3300053136 Ga0500559_0175136 Ga0500559_0175136_321_992 193
816 iso_pu_bacteria 2881101125 2881103369 193
817 3300005331 Ga0070670_100011387 Ga0070670_1000113876 194
818 3300005355 Ga0070671_100366398 Ga0070671_1003663981 194
819 3300005618 Ga0068864_100001839 Ga0068864_1000018399 194
820 3300005618 Ga0068864_100073958 Ga0068864_1000739583 194
821 3300005841 Ga0068863_100042608 Ga0068863_1000426084 194
822 3300006880 Ga0075429_100031290 Ga0075429_1000312905 194
823 3300014325 Ga0163163_10019390 Ga0163163_100193905 194
824 3300025273 Ga0209673_1002131 Ga0209673_100213110 194
825 3300025925 Ga0207650_10047981 Ga0207650_100479814 194
826 3300025925 Ga0207650_10128554 Ga0207650_101285543 194
827 3300025931 Ga0207644_10297098 Ga0207644_102970982 194
828 3300026088 Ga0207641_10004011 Ga0207641_100040113 194
829 3300026095 Ga0207676_10004021 Ga0207676_100040213 194
830 3300026095 Ga0207676_10017450 Ga0207676_100174505 194
831 3300048912 Ga0496109_0348468 Ga0496109_0348468_179_904 194
832 3300048915 Ga0496112_0124087 Ga0496112_0124087_601_1326 194
833 3300050508 nmdc:mga09592_3416_c1 nmdc:mga09592_3416_c1_7172_7798 194
834 3300050509 nmdc:mga0qj67_46701_c1 nmdc:mga0qj67_46701_c1_1066_1692 194
835 3300005289 Ga0065704_10370634 Ga0065704_103706341 195
836 3300006195 Ga0075366_10018033 Ga0075366_100180332 195
837 3300006353 Ga0075370_10028330 Ga0075370_100283302 195
838 3300027252 Ga0209973_1000393 Ga0209973_10003932 195
839 3300027876 Ga0209974_10001817 Ga0209974_100018174 195
840 3300028794 Ga0307515_10000084 Ga0307515_10000084209 195
841 3300031456 Ga0307513_10000029 Ga0307513_10000029137 195
842 3300031456 Ga0307513_10006829 Ga0307513_100068295 195
843 3300031548 Ga0307408_100045466 Ga0307408_1000454662 195
844 3300031649 Ga0307514_10003041 Ga0307514_1000304112 195
845 3300031901 Ga0307406_10002039 Ga0307406_100020395 195
846 3300041451 Ga0451791_0536485 Ga0451791_0536485_712_1359 195
847 3300046558 Ga0495633_0001069 Ga0495633_0001069_2977_3609 195
848 3300048925 Ga0496122_0268808 Ga0496122_0268808_287_919 195
849 3300048926 Ga0496123_0114023 Ga0496123_0114023_136_768 195
850 3300048927 Ga0496124_0239005 Ga0496124_0239005_523_1164 195
851 3300048928 Ga0496125_0025807 Ga0496125_0025807_2854_3495 195
852 3300050493 nmdc:mga0k408_50285_c1 nmdc:mga0k408_50285_c1_1167_1805 195
853 3300050496 nmdc:mga07m45_63901_c1 nmdc:mga07m45_63901_c1_506_1144 195
854 3300053093 Ga0500651_0009638 Ga0500651_0009638_4754_5398 195
855 iso_pu_bacteria 2643221628 2644162130 196
856 iso_pu_bacteria 2842677519 2842680551 196
857 iso_pu_bacteria 2904449895 2904450803 196
858 iso_pu_bacteria 2904456579 2904459697 196
859 iso_pu_bacteria 2919462493 2919462667 196
860 iso_pu_bacteria 2929520902 2929521521 196
861 iso_pu_bacteria 2945945610 2945949535 196
862 iso_pu_bacteria 2945972063 2945973579 196
863 iso_pu_bacteria 2954767861 2954770805 196
864 3300005367 Ga0070667_100088808 Ga0070667_1000888082 197
865 3300005548 Ga0070665_100012532 Ga0070665_1000125323 197
866 3300011119 Ga0105246_10559291 Ga0105246_105592911 197
867 3300014969 Ga0157376_10497982 Ga0157376_104979822 197
868 3300017792 Ga0163161_10020791 Ga0163161_100207913 197
869 3300028379 Ga0268266_10450444 Ga0268266_104504442 197
870 3300046460 Ga0495638_0039490 Ga0495638_0039490_1625_2332 197
871 3300046513 Ga0495616_0002386 Ga0495616_0002386_2275_2982 197
872 3300046515 Ga0495620_0043110 Ga0495620_0043110_228_935 197
873 3300046518 Ga0495631_0003838 Ga0495631_0003838_3402_4109 197
874 3300046520 Ga0495637_0066254 Ga0495637_0066254_14_694 197
875 3300046522 Ga0495643_0017713 Ga0495643_0017713_2243_2899 197
876 3300046530 Ga0495654_0029156 Ga0495654_0029156_739_1446 197
877 3300046539 Ga0495621_0027512 Ga0495621_0027512_888_1595 197
878 3300046557 Ga0495622_0021877 Ga0495622_0021877_183_890 197
879 3300046660 Ga0495625_0069985 Ga0495625_0069985_59_766 197
880 3300048925 Ga0496122_0038114 Ga0496122_0038114_2155_2862 197
881 3300048926 Ga0496123_0133230 Ga0496123_0133230_16_723 197
882 3300048929 Ga0496126_0106125 Ga0496126_0106125_1224_1931 197
883 3300053093 Ga0500651_0000057 Ga0500651_0000057_22008_22715 197
884 3300053108 Ga0500562_016023 Ga0500562_016023_311_1018 197
885 3300053116 Ga0500592_002926 Ga0500592_002926_1725_2405 197
886 3300053118 Ga0500594_0000713 Ga0500594_0000713_3527_4234 197
887 3300053128 Ga0500626_047139 Ga0500626_047139_420_1100 197
888 3300053134 Ga0500658_0000652 Ga0500658_0000652_10828_11535 197
889 3300053134 Ga0500658_0002198 Ga0500658_0002198_2736_3443 197
890 3300053136 Ga0500559_0032833 Ga0500559_0032833_1014_1694 197
891 3300053139 Ga0500568_0003720 Ga0500568_0003720_3376_4083 197
892 3300053153 Ga0500616_0021639 Ga0500616_0021639_2413_3120 197
893 iso_pu_bacteria 2904541872 2904548028 197
894 iso_pu_bacteria 2929160207 2929161577 197
895 3300005356 Ga0070674_100056661 Ga0070674_1000566612 198
896 3300005456 Ga0070678_100068267 Ga0070678_1000682671 198
897 3300006881 Ga0068865_100379138 Ga0068865_1003791381 198
898 3300009036 Ga0105244_10085085 Ga0105244_100850851 198
899 3300025937 Ga0207669_10072813 Ga0207669_100728132 198
900 3300026121 Ga0207683_10220513 Ga0207683_102205132 198
901 3300046690 Ga0495624_0146923 Ga0495624_0146923_274_963 198
902 3300046691 Ga0495670_0053506 Ga0495670_0053506_760_1449 198
903 3300047321 Ga0495676_0030589 Ga0495676_0030589_2804_3520 198
904 3300047673 Ga0495593_0053810 Ga0495593_0053810_1284_2000 198
905 3300048089 Ga0495614_0006224 Ga0495614_0006224_517_1233 198
906 3300053087 Ga0500643_016325 Ga0500643_016325_1000_1689 198
907 3300053107 Ga0500560_059017 Ga0500560_059017_328_1017 198
908 3300053110 Ga0500571_000050 Ga0500571_000050_4596_5312 198
909 3300053120 Ga0500597_005016 Ga0500597_005016_2531_3220 198
910 3300053122 Ga0500608_016553 Ga0500608_016553_838_1554 198
911 3300053133 Ga0500655_003462 Ga0500655_003462_726_1415 198
912 3300053161 Ga0500634_0063981 Ga0500634_0063981_856_1545 198
913 3300053162 Ga0500638_012573 Ga0500638_012573_984_1673 198
914 3300053177 Ga0500636_0127796 Ga0500636_0127796_410_1126 198
915 3300013100 Ga0157373_10030606 Ga0157373_100306062 199
916 iso_pu_bacteria 2643221672 2644396094 199
917 iso_pu_bacteria 2738543019 2739279702 199
918 iso_pu_bacteria 2818991446 2819601185 199
919 iso_pu_bacteria 2842733646 2842736445 199
920 iso_pu_bacteria 2885192300 2885197020 199
921 iso_pu_bacteria 2899924645 2899927468 199
922 iso_pu_bacteria 2928037797 2928042620 199
923 iso_pu_bacteria 2928044640 2928048953 199
924 iso_pu_bacteria 2928051484 2928051503 199
925 iso_pu_bacteria 2928064002 2928068715 199
926 iso_pu_bacteria 2928084124 2928087047 199
927 3300003578 Ga0006562J51391_1094937 Ga0006562J51391_10949371 200
928 3300003578 Ga0006562J51391_1094939 Ga0006562J51391_10949393 200
929 3300006177 Ga0075362_10035412 Ga0075362_100354122 200
930 3300006186 Ga0075369_10010977 Ga0075369_100109773 200
931 3300006353 Ga0075370_10010040 Ga0075370_100100404 200
932 3300013100 Ga0157373_10043408 Ga0157373_100434082 200
933 3300014497 Ga0182008_10009662 Ga0182008_100096625 200
934 3300015261 Ga0182006_1037727 Ga0182006_10377272 200
935 3300015262 Ga0182007_10086993 Ga0182007_100869931 200
936 3300025303 Ga0209051_1001474 Ga0209051_100147414 200
937 3300048928 Ga0496125_0111091 Ga0496125_0111091_170_838 200
938 3300050489 nmdc:mga03683_10580_c1 nmdc:mga03683_10580_c1_2291_2959 200
939 3300002773 JGI25152J39213_1014596 JGI25152J39213_10145961 201
940 3300003187 JGI25151J46595_10014901 JGI25151J46595_100149013 201
941 3300003215 JGI25153J46596_10018126 JGI25153J46596_100181263 201
942 3300003771 Ga0055526_1027606 Ga0055526_10276062 201
943 3300003773 Ga0055537_1011777 Ga0055537_10117772 201
944 3300003775 Ga0055524_1058711 Ga0055524_10587111 201
945 3300003790 Ga0055528_1023605 Ga0055528_10236052 201
946 3300013306 Ga0163162_10184469 Ga0163162_101844692 201
947 3300013308 Ga0157375_10086926 Ga0157375_100869262 201
948 3300046539 Ga0495621_0004441 Ga0495621_0004441_2515_3189 201
949 3300002774 JGI25150J39212_1006276 JGI25150J39212_10062762 202
950 3300002987 JGI25159J45721_1016195 JGI25159J45721_10161951 202
951 3300003323 rootH1_10037348 rootH1_100373482 202
952 3300003354 JGI25160J50197_1013801 JGI25160J50197_10138013 202
953 3300003374 JGI25161J50226_1005621 JGI25161J50226_10056213 202
954 3300003578 Ga0006562J51391_1053276 Ga0006562J51391_10532763 202
955 3300003781 Ga0055536_1009680 Ga0055536_10096802 202
956 3300003784 Ga0055534_1004592 Ga0055534_10045923 202
957 3300003791 Ga0055530_10005015 Ga0055530_100050157 202
958 3300004625 Ga0055543_1040888 Ga0055543_10408881 202
959 3300005262 Ga0065165_1085222 Ga0065165_10852221 202
960 3300005614 Ga0068856_101004519 Ga0068856_1010045191 202
961 3300005834 Ga0068851_10009906 Ga0068851_100099062 202
962 3300013102 Ga0157371_10154657 Ga0157371_101546572 202
963 3300025245 Ga0207425_1007188 Ga0207425_10071882 202
964 3300025258 Ga0209129_1000024 Ga0209129_100002450 202
965 3300025263 Ga0209565_1000603 Ga0209565_10006035 202
966 3300025263 Ga0209565_1006214 Ga0209565_10062142 202
967 3300025273 Ga0209673_1004152 Ga0209673_10041523 202
968 3300025284 Ga0209130_1046283 Ga0209130_10462831 202
969 3300025291 Ga0209675_1007565 Ga0209675_10075652 202
970 3300025292 Ga0209676_1000028 Ga0209676_1000028308 202
971 3300025292 Ga0209676_1000317 Ga0209676_100031722 202
972 3300025294 Ga0209025_1008081 Ga0209025_10080815 202
973 3300025294 Ga0209025_1115608 Ga0209025_11156081 202
974 3300025295 Ga0209564_1000209 Ga0209564_1000209123 202
975 3300025295 Ga0209564_1005094 Ga0209564_10050945 202
976 3300025297 Ga0209758_1013950 Ga0209758_10139503 202
977 3300025298 Ga0209050_1000072 Ga0209050_100007264 202
978 3300025298 Ga0209050_1000786 Ga0209050_100078629 202
979 3300025299 Ga0209256_1001798 Ga0209256_100179816 202
980 3300025299 Ga0209256_1007096 Ga0209256_10070965 202
981 3300025302 Ga0207426_1000038 Ga0207426_1000038410 202
982 3300025302 Ga0207426_1000053 Ga0207426_10000535 202
983 3300025303 Ga0209051_1000015 Ga0209051_1000015237 202
984 3300025303 Ga0209051_1000056 Ga0209051_1000056163 202
985 3300025304 Ga0209257_1000037 Ga0209257_1000037508 202
986 3300025304 Ga0209257_1002615 Ga0209257_100261514 202
987 3300025321 Ga0207656_10005124 Ga0207656_100051242 202
988 3300050496 nmdc:mga07m45_160285_c1 nmdc:mga07m45_160285_c1_276_950 202
989 3300001979 JGI24740J21852_10014074 JGI24740J21852_100140742 203
990 3300002739 JGI25158J39367_1009169 JGI25158J39367_10091692 203
991 3300003758 Ga0055532_1010963 Ga0055532_10109631 203
992 3300003761 Ga0055535_1000940 Ga0055535_100094013 203
993 3300003762 Ga0055542_1000080 Ga0055542_100008050 203
994 3300009093 Ga0105240_10266543 Ga0105240_102665431 203
995 3300013104 Ga0157370_10263071 Ga0157370_102630712 203
996 3300014497 Ga0182008_10107656 Ga0182008_101076562 203
997 3300025228 Ga0209672_103131 Ga0209672_1031312 203
998 3300025229 Ga0209147_100450 Ga0209147_10045021 203
999 3300025242 Ga0209258_100093 Ga0209258_10009361 203
1000 3300025254 Ga0209148_1000007 Ga0209148_10000071028 203
1001 3300026041 Ga0207639_10116562 Ga0207639_101165622 203
1002 3300031251 Ga0265327_10006673 Ga0265327_1000667310 203
1003 3300041452 Ga0451793_0083951 Ga0451793_0083951_336_1025 203
1004 3300048920 Ga0496117_0030845 Ga0496117_0030845_2535_3215 203
1005 3300048921 Ga0496118_0013172 Ga0496118_0013172_4147_4827 203
1006 3300048925 Ga0496122_0181182 Ga0496122_0181182_486_1166 203
1007 3300053121 Ga0500607_129554 Ga0500607_129554_359_1039 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

145

239

0.92

PF00034

Cytochrom_C

Cytochrome c

56

133

0.81

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

54

129

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.9758 39 102
2zzs-assembly1.cif.gz_A crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.9695 39 103
1m70-assembly2.cif.gz_B crystal structure of oxidized recombinant cytochrome c4 from pseudomonas stutzeri 0.9567 39 203
8smr-assembly1.cif.gz_N cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9408 22 203
6q2u-assembly1.cif.gz_A structure of cytochrome c4 from pseudomonas aeruginosa 0.9357 22 203
ID Description Score Start End Superfamily
4o1wD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.984 39 102 1.10.760.10
2zzsM00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9631 39 101 1.10.760.10
3vrdA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9532 39 105 1.10.760.10
1h1oB02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9513 118 202 1.10.760.10
2zzsS00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9485 39 103 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7V2UH10-F1-model_v4 C-type cytochrome 0.999 119 203 GO:0009055
GO:0020037
GO:0046872
AF-C9Y823-F1-model_v4 Cytochrome c4 0.9946 23 203 GO:0005506
GO:0009055
GO:0020037
GO:0042597
AF-A0A521ZL93-F1-model_v4 C-type cytochrome 0.9937 57 203 GO:0009055
GO:0020037
GO:0046872
AF-A0A258REN4-F1-model_v4 Cytochrome c domain-containing protein 0.9891 84 203 GO:0009055
GO:0020037
GO:0046872
AF-C9Y823-F1-model_v4 Cytochrome c4 0.9834 23 203 GO:0005506
GO:0009055
GO:0020037
GO:0042597

Feature Viewer

pLDDT pTM Quality
87.91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map