F488025
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 334 | 2014 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10098670|Ga0070691_100986702 |
| Length | 143 |
| Sequence | MPRTRVETRARARVLQALYAWDLRGAGHGNESLERVAHRIWDDLAVPADERQFAKPLVDDLSRRGSVLDAELADVTTNWRLERLGVVERSVLRLAAVELDRGETPPRVVIQEAVHLAERYGSARSAKFVNGVVDALARRMGRM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 300 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 314 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 318 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 98.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070691_10098670 | 3300005341 | Bacteria | 1448 |
| 2 | Ga0065707_10161369 | 3300005295 | Bacteria | 1560 |
| 3 | Ga0070658_11456609 | 3300005327 | Bacteria | 594 |
| 4 | Ga0070676_10184983 | 3300005328 | Bacteria | 1357 |
| 5 | Ga0070676_10201880 | 3300005328 | Bacteria | 1304 |
| 6 | Ga0070676_10507863 | 3300005328 | Unclassified | 857 |
| 7 | Ga0070676_10775867 | 3300005328 | Unclassified | 705 |
| 8 | Ga0070683_100003005 | 3300005329 | Bacteria | 13536 |
| 9 | Ga0070683_100006639 | 3300005329 | Bacteria | 9715 |
| 10 | Ga0070683_100018701 | 3300005329 | Bacteria | 6140 |
| 11 | Ga0070683_100037308 | 3300005329 | Bacteria | 4448 |
| 12 | Ga0070683_100060072 | 3300005329 | Bacteria | 3532 |
| 13 | Ga0070683_100072562 | 3300005329 | Bacteria | 3213 |
| 14 | Ga0070683_100081261 | 3300005329 | Unclassified | 3034 |
| 15 | Ga0070683_100087370 | 3300005329 | Bacteria | 2924 |
| 16 | Ga0070683_100123356 | 3300005329 | Bacteria | 2448 |
| 17 | Ga0070683_100349657 | 3300005329 | Bacteria | 1408 |
| 18 | Ga0070683_100360294 | 3300005329 | Bacteria | 1385 |
| 19 | Ga0070683_100834436 | 3300005329 | Bacteria | 884 |
| 20 | Ga0070690_100107344 | 3300005330 | Bacteria | 1858 |
| 21 | Ga0070690_100812054 | 3300005330 | Bacteria | 726 |
| 22 | Ga0070670_100008193 | 3300005331 | Bacteria | 8898 |
| 23 | Ga0070670_100013576 | 3300005331 | Bacteria | 6981 |
| 24 | Ga0070670_100024394 | 3300005331 | Bacteria | 5200 |
| 25 | Ga0070670_100099324 | 3300005331 | Bacteria | 2505 |
| 26 | Ga0070670_100110248 | 3300005331 | Bacteria | 2371 |
| 27 | Ga0070670_100572995 | 3300005331 | Bacteria | 1008 |
| 28 | Ga0070677_10312447 | 3300005333 | Bacteria | 802 |
| 29 | Ga0070677_10320335 | 3300005333 | Bacteria | 794 |
| 30 | Ga0068869_100024550 | 3300005334 | Bacteria | 4175 |
| 31 | Ga0068869_100457511 | 3300005334 | Bacteria | 1059 |
| 32 | Ga0070666_10610954 | 3300005335 | Bacteria | 796 |
| 33 | Ga0070680_100000010 | 3300005336 | Bacteria | 97194 |
| 34 | Ga0070680_100001244 | 3300005336 | Bacteria | 18369 |
| 35 | Ga0070680_100002198 | 3300005336 | Bacteria | 14375 |
| 36 | Ga0070680_100065992 | 3300005336 | Bacteria | 2967 |
| 37 | Ga0070680_100101359 | 3300005336 | Bacteria | 2390 |
| 38 | Ga0070680_100144809 | 3300005336 | Unclassified | 1993 |
| 39 | Ga0070682_100005851 | 3300005337 | Bacteria | 6871 |
| 40 | Ga0068868_100097569 | 3300005338 | Bacteria | 2375 |
| 41 | Ga0068868_101268022 | 3300005338 | Bacteria | 683 |
| 42 | Ga0068868_101482455 | 3300005338 | Bacteria | 635 |
| 43 | Ga0068868_102007124 | 3300005338 | Unclassified | 549 |
| 44 | Ga0070660_100013102 | 3300005339 | Bacteria | 5937 |
| 45 | Ga0070660_100213620 | 3300005339 | Bacteria | 1566 |
| 46 | Ga0070660_100341143 | 3300005339 | Unclassified | 1233 |
| 47 | Ga0070660_100443812 | 3300005339 | Bacteria | 1076 |
| 48 | Ga0070660_100520287 | 3300005339 | Unclassified | 991 |
| 49 | Ga0070689_100007804 | 3300005340 | Bacteria | 7498 |
| 50 | Ga0070689_100008541 | 3300005340 | Bacteria | 7218 |
| 51 | Ga0070691_10239665 | 3300005341 | Bacteria | 968 |
| 52 | Ga0070687_100007591 | 3300005343 | Bacteria | 4533 |
| 53 | Ga0070687_100165672 | 3300005343 | Bacteria | 1311 |
| 54 | Ga0070687_100484935 | 3300005343 | Bacteria | 829 |
| 55 | Ga0070661_100000718 | 3300005344 | Bacteria | 24252 |
| 56 | Ga0070661_100004963 | 3300005344 | Bacteria | 9164 |
| 57 | Ga0070692_10061750 | 3300005345 | Unclassified | 1976 |
| 58 | Ga0070692_10477950 | 3300005345 | Bacteria | 803 |
| 59 | Ga0070692_10718893 | 3300005345 | Unclassified | 674 |
| 60 | Ga0070692_11268061 | 3300005345 | Unclassified | 527 |
| 61 | Ga0070668_100002904 | 3300005347 | Bacteria | 12655 |
| 62 | Ga0070668_100162739 | 3300005347 | Bacteria | 1811 |
| 63 | Ga0070668_100239932 | 3300005347 | Unclassified | 1501 |
| 64 | Ga0070669_100005880 | 3300005353 | Bacteria | 8848 |
| 65 | Ga0070669_100220885 | 3300005353 | Bacteria | 1498 |
| 66 | Ga0070669_100337553 | 3300005353 | Unclassified | 1220 |
| 67 | Ga0070675_100001661 | 3300005354 | Bacteria | 16438 |
| 68 | Ga0070675_100002764 | 3300005354 | Bacteria | 13193 |
| 69 | Ga0070675_100009557 | 3300005354 | Bacteria | 7544 |
| 70 | Ga0070675_100154937 | 3300005354 | Unclassified | 1967 |
| 71 | Ga0070675_100193655 | 3300005354 | Bacteria | 1762 |
| 72 | Ga0070675_100770332 | 3300005354 | Bacteria | 879 |
| 73 | Ga0070671_100040591 | 3300005355 | Bacteria | 3866 |
| 74 | Ga0070671_100099236 | 3300005355 | Bacteria | 2442 |
| 75 | Ga0070671_100353757 | 3300005355 | Bacteria | 1254 |
| 76 | Ga0070671_100467457 | 3300005355 | Bacteria | 1083 |
| 77 | Ga0070674_100050713 | 3300005356 | Bacteria | 2857 |
| 78 | Ga0070674_100199681 | 3300005356 | Bacteria | 1543 |
| 79 | Ga0070674_101124385 | 3300005356 | Bacteria | 694 |
| 80 | Ga0070674_102102307 | 3300005356 | Bacteria | 515 |
| 81 | Ga0070673_100058178 | 3300005364 | Bacteria | 3055 |
| 82 | Ga0070673_100391728 | 3300005364 | Bacteria | 1241 |
| 83 | Ga0070673_100393515 | 3300005364 | Bacteria | 1238 |
| 84 | Ga0070673_101423427 | 3300005364 | Unclassified | 653 |
| 85 | Ga0070688_100015175 | 3300005365 | Bacteria | 4375 |
| 86 | Ga0070688_100266703 | 3300005365 | Unclassified | 1225 |
| 87 | Ga0070659_100121361 | 3300005366 | Bacteria | 2117 |
| 88 | Ga0070659_100135133 | 3300005366 | Bacteria | 2005 |
| 89 | Ga0070659_101365979 | 3300005366 | Bacteria | 629 |
| 90 | Ga0070667_100351372 | 3300005367 | Unclassified | 1335 |
| 91 | Ga0070667_101205299 | 3300005367 | Bacteria | 709 |
| 92 | Ga0070667_101290710 | 3300005367 | Bacteria | 684 |
| 93 | Ga0070667_102128324 | 3300005367 | Bacteria | 528 |
| 94 | Ga0070703_10386841 | 3300005406 | Bacteria | 606 |
| 95 | Ga0070709_10054487 | 3300005434 | Bacteria | 2521 |
| 96 | Ga0070709_10173725 | 3300005434 | Bacteria | 1508 |
| 97 | Ga0070714_100221021 | 3300005435 | Bacteria | 1741 |
| 98 | Ga0070714_100375234 | 3300005435 | Archaea | 1340 |
| 99 | Ga0070714_100448572 | 3300005435 | Bacteria | 1225 |
| 100 | Ga0070713_100030808 | 3300005436 | Bacteria | 4266 |
| 101 | Ga0070713_100030943 | 3300005436 | Bacteria | 4256 |
| 102 | Ga0070713_100091302 | 3300005436 | Bacteria | 2620 |
| 103 | Ga0070713_100359837 | 3300005436 | Bacteria | 1352 |
| 104 | Ga0070713_101691965 | 3300005436 | Bacteria | 614 |
| 105 | Ga0070701_10165847 | 3300005438 | Unclassified | 1283 |
| 106 | Ga0070711_100131091 | 3300005439 | Bacteria | 1867 |
| 107 | Ga0070711_100276675 | 3300005439 | Unclassified | 1326 |
| 108 | Ga0070711_100922915 | 3300005439 | Bacteria | 746 |
| 109 | Ga0070705_100086266 | 3300005440 | Bacteria | 1943 |
| 110 | Ga0070700_100075919 | 3300005441 | Bacteria | 2157 |
| 111 | Ga0070694_100298920 | 3300005444 | Bacteria | 1233 |
| 112 | Ga0070694_100897850 | 3300005444 | Bacteria | 731 |
| 113 | Ga0070708_100000024 | 3300005445 | Bacteria | 104177 |
| 114 | Ga0070708_101390621 | 3300005445 | Bacteria | 655 |
| 115 | Ga0070663_100021686 | 3300005455 | Bacteria | 4277 |
| 116 | Ga0070663_101700365 | 3300005455 | Bacteria | 564 |
| 117 | Ga0070662_100004241 | 3300005457 | Bacteria | 9041 |
| 118 | Ga0070662_100288355 | 3300005457 | Bacteria | 1330 |
| 119 | Ga0070662_100455325 | 3300005457 | Bacteria | 1062 |
| 120 | Ga0070662_100533070 | 3300005457 | Bacteria | 982 |
| 121 | Ga0070681_10000119 | 3300005458 | Bacteria | 59101 |
| 122 | Ga0070681_10001192 | 3300005458 | Bacteria | 22531 |
| 123 | Ga0070681_10003947 | 3300005458 | Bacteria | 13974 |
| 124 | Ga0070681_10006844 | 3300005458 | Bacteria | 11097 |
| 125 | Ga0070681_10146904 | 3300005458 | Unclassified | 2286 |
| 126 | Ga0070681_10169947 | 3300005458 | Bacteria | 2102 |
| 127 | Ga0070681_10245758 | 3300005458 | Bacteria | 1702 |
| 128 | Ga0070681_10377191 | 3300005458 | Bacteria | 1329 |
| 129 | Ga0068867_100122006 | 3300005459 | Bacteria | 2016 |
| 130 | Ga0068867_100187485 | 3300005459 | Bacteria | 1648 |
| 131 | Ga0068867_101665022 | 3300005459 | Bacteria | 597 |
| 132 | Ga0070685_10105725 | 3300005466 | Bacteria | 1725 |
| 133 | Ga0070685_10177782 | 3300005466 | Bacteria | 1368 |
| 134 | Ga0070685_10214523 | 3300005466 | Bacteria | 1258 |
| 135 | Ga0070706_100542603 | 3300005467 | Unclassified | 1082 |
| 136 | Ga0070707_100258878 | 3300005468 | Bacteria | 1693 |
| 137 | Ga0070698_100026323 | 3300005471 | Bacteria | 6054 |
| 138 | Ga0070699_100057715 | 3300005518 | Bacteria | 3362 |
| 139 | Ga0070699_101005482 | 3300005518 | Bacteria | 765 |
| 140 | Ga0070679_100000066 | 3300005530 | Bacteria | 78387 |
| 141 | Ga0070679_100001382 | 3300005530 | Bacteria | 21375 |
| 142 | Ga0070679_100003354 | 3300005530 | Bacteria | 14675 |
| 143 | Ga0070679_100022174 | 3300005530 | Bacteria | 6206 |
| 144 | Ga0070679_100051426 | 3300005530 | Bacteria | 4104 |
| 145 | Ga0070679_100082331 | 3300005530 | Bacteria | 3208 |
| 146 | Ga0070679_100095999 | 3300005530 | Bacteria | 2952 |
| 147 | Ga0070679_100106723 | 3300005530 | Unclassified | 2786 |
| 148 | Ga0070679_100204195 | 3300005530 | Bacteria | 1941 |
| 149 | Ga0070679_100292261 | 3300005530 | Bacteria | 1581 |
| 150 | Ga0070679_100364889 | 3300005530 | Bacteria | 1391 |
| 151 | Ga0070679_100580905 | 3300005530 | Unclassified | 1064 |
| 152 | Ga0070679_100651309 | 3300005530 | Bacteria | 996 |
| 153 | Ga0070679_100902328 | 3300005530 | Bacteria | 827 |
| 154 | Ga0070679_100925204 | 3300005530 | Bacteria | 815 |
| 155 | Ga0070684_100004002 | 3300005535 | Bacteria | 11153 |
| 156 | Ga0070684_100005381 | 3300005535 | Bacteria | 9807 |
| 157 | Ga0070684_100009052 | 3300005535 | Bacteria | 7826 |
| 158 | Ga0070684_100013493 | 3300005535 | Bacteria | 6591 |
| 159 | Ga0070684_100018173 | 3300005535 | Bacteria | 5787 |
| 160 | Ga0070684_100018757 | 3300005535 | Bacteria | 5707 |
| 161 | Ga0070684_100024204 | 3300005535 | Bacteria | 5090 |
| 162 | Ga0070684_100044388 | 3300005535 | Bacteria | 3845 |
| 163 | Ga0070684_100107664 | 3300005535 | Bacteria | 2497 |
| 164 | Ga0070684_100114541 | 3300005535 | Bacteria | 2420 |
| 165 | Ga0070684_100259482 | 3300005535 | Bacteria | 1590 |
| 166 | Ga0070684_100489475 | 3300005535 | Bacteria | 1139 |
| 167 | Ga0070684_100561297 | 3300005535 | Bacteria | 1060 |
| 168 | Ga0070684_100744035 | 3300005535 | Bacteria | 915 |
| 169 | Ga0070684_101453818 | 3300005535 | Bacteria | 646 |
| 170 | Ga0070684_101937115 | 3300005535 | Unclassified | 556 |
| 171 | Ga0068853_101123433 | 3300005539 | Bacteria | 758 |
| 172 | Ga0070672_100004646 | 3300005543 | Bacteria | 8998 |
| 173 | Ga0070672_100024942 | 3300005543 | Bacteria | 4427 |
| 174 | Ga0070672_100055813 | 3300005543 | Bacteria | 3095 |
| 175 | Ga0070672_100111109 | 3300005543 | Bacteria | 2234 |
| 176 | Ga0070672_100198072 | 3300005543 | Bacteria | 1679 |
| 177 | Ga0070672_100398899 | 3300005543 | Bacteria | 1179 |
| 178 | Ga0070686_100175943 | 3300005544 | Bacteria | 1517 |
| 179 | Ga0070695_100001852 | 3300005545 | Bacteria | 11939 |
| 180 | Ga0070696_100000107 | 3300005546 | Bacteria | 42492 |
| 181 | Ga0070693_100005385 | 3300005547 | Bacteria | 6138 |
| 182 | Ga0070693_100006308 | 3300005547 | Bacteria | 5747 |
| 183 | Ga0070693_100059733 | 3300005547 | Bacteria | 2211 |
| 184 | Ga0070665_100024001 | 3300005548 | Bacteria | 6140 |
| 185 | Ga0070665_100042373 | 3300005548 | Bacteria | 4575 |
| 186 | Ga0070665_100131887 | 3300005548 | Bacteria | 2501 |
| 187 | Ga0070704_100859033 | 3300005549 | Bacteria | 814 |
| 188 | Ga0068855_100002271 | 3300005563 | Bacteria | 23735 |
| 189 | Ga0068855_100029474 | 3300005563 | Bacteria | 6560 |
| 190 | Ga0068855_100035463 | 3300005563 | Bacteria | 5941 |
| 191 | Ga0068855_100044173 | 3300005563 | Bacteria | 5275 |
| 192 | Ga0068855_100112581 | 3300005563 | Unclassified | 3123 |
| 193 | Ga0068855_100177339 | 3300005563 | Bacteria | 2410 |
| 194 | Ga0068855_100207201 | 3300005563 | Bacteria | 2205 |
| 195 | Ga0068855_100279104 | 3300005563 | Unclassified | 1856 |
| 196 | Ga0070664_100024285 | 3300005564 | Bacteria | 5013 |
| 197 | Ga0070664_100028779 | 3300005564 | Bacteria | 4626 |
| 198 | Ga0070664_100070686 | 3300005564 | Bacteria | 2989 |
| 199 | Ga0070664_100112948 | 3300005564 | Bacteria | 2373 |
| 200 | Ga0070664_100587712 | 3300005564 | Bacteria | 1032 |
| 201 | Ga0070664_100993477 | 3300005564 | Bacteria | 789 |
| 202 | Ga0068857_100004704 | 3300005577 | Bacteria | 11572 |
| 203 | Ga0068857_100007641 | 3300005577 | Bacteria | 9312 |
| 204 | Ga0068857_100031506 | 3300005577 | Bacteria | 4686 |
| 205 | Ga0068857_100227703 | 3300005577 | Bacteria | 1704 |
| 206 | Ga0068857_100426635 | 3300005577 | Bacteria | 1237 |
| 207 | Ga0068854_100036943 | 3300005578 | Bacteria | 3425 |
| 208 | Ga0068854_100060899 | 3300005578 | Bacteria | 2732 |
| 209 | Ga0068854_100400284 | 3300005578 | Unclassified | 1136 |
| 210 | Ga0068856_100002006 | 3300005614 | Bacteria | 21232 |
| 211 | Ga0068856_100014375 | 3300005614 | Bacteria | 7652 |
| 212 | Ga0068856_100306661 | 3300005614 | Bacteria | 1605 |
| 213 | Ga0068856_100540809 | 3300005614 | Bacteria | 1186 |
| 214 | Ga0068856_100583622 | 3300005614 | Bacteria | 1139 |
| 215 | Ga0070702_100000558 | 3300005615 | Bacteria | 13581 |
| 216 | Ga0070702_100505854 | 3300005615 | Bacteria | 888 |
| 217 | Ga0070702_100647727 | 3300005615 | Bacteria | 798 |
| 218 | Ga0068852_100056243 | 3300005616 | Bacteria | 3399 |
| 219 | Ga0068852_100070498 | 3300005616 | Bacteria | 3067 |
| 220 | Ga0068852_100137233 | 3300005616 | Bacteria | 2259 |
| 221 | Ga0068852_100261243 | 3300005616 | Bacteria | 1663 |
| 222 | Ga0068852_100297469 | 3300005616 | Bacteria | 1561 |
| 223 | Ga0068852_101899728 | 3300005616 | Bacteria | 618 |
| 224 | Ga0068859_100005085 | 3300005617 | Bacteria | 13363 |
| 225 | Ga0068859_100149005 | 3300005617 | Bacteria | 2415 |
| 226 | Ga0068859_100163144 | 3300005617 | Bacteria | 2308 |
| 227 | Ga0068859_100181353 | 3300005617 | Bacteria | 2188 |
| 228 | Ga0068864_100008399 | 3300005618 | Bacteria | 8521 |
| 229 | Ga0068864_100412577 | 3300005618 | Bacteria | 1285 |
| 230 | Ga0068864_100747008 | 3300005618 | Unclassified | 958 |
| 231 | Ga0068864_100979167 | 3300005618 | Bacteria | 838 |
| 232 | Ga0068866_10020415 | 3300005718 | Bacteria | 3035 |
| 233 | Ga0068861_100018071 | 3300005719 | Bacteria | 5014 |
| 234 | Ga0068861_100210345 | 3300005719 | Unclassified | 1638 |
| 235 | Ga0068861_101127837 | 3300005719 | Bacteria | 755 |
| 236 | Ga0068851_10014534 | 3300005834 | Bacteria | 3739 |
| 237 | Ga0068851_10381733 | 3300005834 | Bacteria | 826 |
| 238 | Ga0068851_10759847 | 3300005834 | Unclassified | 600 |
| 239 | Ga0068870_10002264 | 3300005840 | Bacteria | 7991 |
| 240 | Ga0068863_100027989 | 3300005841 | Bacteria | 5380 |
| 241 | Ga0068863_100404912 | 3300005841 | Bacteria | 1335 |
| 242 | Ga0068858_100217157 | 3300005842 | Bacteria | 1810 |
| 243 | Ga0068858_100300978 | 3300005842 | Bacteria | 1530 |
| 244 | Ga0068858_100563195 | 3300005842 | Bacteria | 1104 |
| 245 | Ga0068858_101248404 | 3300005842 | Bacteria | 731 |
| 246 | Ga0068860_100008276 | 3300005843 | Bacteria | 10352 |
| 247 | Ga0068860_100425592 | 3300005843 | Bacteria | 1317 |
| 248 | Ga0068860_100444386 | 3300005843 | Bacteria | 1288 |
| 249 | Ga0068860_100520186 | 3300005843 | Bacteria | 1190 |
| 250 | Ga0068860_100961318 | 3300005843 | Bacteria | 871 |
| 251 | Ga0068862_100000563 | 3300005844 | Bacteria | 38630 |
| 252 | Ga0068862_101749494 | 3300005844 | Unclassified | 630 |
| 253 | Ga0081455_10102484 | 3300005937 | Bacteria | 2294 |
| 254 | Ga0081539_10025928 | 3300005985 | Bacteria | 3757 |
| 255 | Ga0070717_10226216 | 3300006028 | Bacteria | 1646 |
| 256 | Ga0075432_10236554 | 3300006058 | Bacteria | 736 |
| 257 | Ga0070716_100219679 | 3300006173 | Unclassified | 1276 |
| 258 | Ga0070712_100085162 | 3300006175 | Bacteria | 2300 |
| 259 | Ga0070712_101005185 | 3300006175 | Bacteria | 722 |
| 260 | Ga0097621_100093902 | 3300006237 | Unclassified | 2514 |
| 261 | Ga0097621_101031780 | 3300006237 | Bacteria | 770 |
| 262 | Ga0068871_100004583 | 3300006358 | Bacteria | 9638 |
| 263 | Ga0068871_100466846 | 3300006358 | Bacteria | 1133 |
| 264 | Ga0068871_101547865 | 3300006358 | Unclassified | 627 |
| 265 | Ga0075428_100092576 | 3300006844 | Bacteria | 3296 |
| 266 | Ga0075428_100113741 | 3300006844 | Bacteria | 2949 |
| 267 | Ga0075428_100179897 | 3300006844 | Bacteria | 2289 |
| 268 | Ga0075428_102291204 | 3300006844 | Bacteria | 556 |
| 269 | Ga0075430_100002009 | 3300006846 | Bacteria | 16757 |
| 270 | Ga0075430_100030641 | 3300006846 | Bacteria | 4569 |
| 271 | Ga0075430_100144063 | 3300006846 | Bacteria | 1984 |
| 272 | Ga0075431_100258154 | 3300006847 | Bacteria | 1769 |
| 273 | Ga0075431_100995824 | 3300006847 | Bacteria | 805 |
| 274 | Ga0075431_101265898 | 3300006847 | Bacteria | 699 |
| 275 | Ga0075433_10341834 | 3300006852 | Bacteria | 1323 |
| 276 | Ga0075433_10350794 | 3300006852 | Bacteria | 1304 |
| 277 | Ga0075434_100010409 | 3300006871 | Bacteria | 8717 |
| 278 | Ga0075434_100046915 | 3300006871 | Bacteria | 4287 |
| 279 | Ga0075434_101538784 | 3300006871 | Bacteria | 674 |
| 280 | Ga0075429_100126334 | 3300006880 | Bacteria | 2236 |
| 281 | Ga0075429_100927824 | 3300006880 | Bacteria | 762 |
| 282 | Ga0075429_101434138 | 3300006880 | Bacteria | 601 |
| 283 | Ga0075429_101590640 | 3300006880 | Bacteria | 568 |
| 284 | Ga0068865_100046810 | 3300006881 | Bacteria | 2969 |
| 285 | Ga0068865_100241507 | 3300006881 | Bacteria | 1421 |
| 286 | Ga0068865_100275189 | 3300006881 | Unclassified | 1338 |
| 287 | Ga0068865_100382634 | 3300006881 | Bacteria | 1148 |
| 288 | Ga0075436_100253759 | 3300006914 | Bacteria | 1253 |
| 289 | Ga0075436_100323121 | 3300006914 | Bacteria | 1109 |
| 290 | Ga0097620_100005085 | 3300006931 | Bacteria | 13363 |
| 291 | Ga0097620_100149011 | 3300006931 | Bacteria | 2415 |
| 292 | Ga0097620_100163145 | 3300006931 | Bacteria | 2308 |
| 293 | Ga0097620_100181353 | 3300006931 | Bacteria | 2188 |
| 294 | Ga0075435_100121689 | 3300007076 | Bacteria | 2178 |
| 295 | Ga0075435_100184411 | 3300007076 | Bacteria | 1765 |
| 296 | Ga0075435_100881385 | 3300007076 | Bacteria | 780 |
| 297 | Ga0105240_10008352 | 3300009093 | Bacteria | 14818 |
| 298 | Ga0105240_10093779 | 3300009093 | Bacteria | 3663 |
| 299 | Ga0105240_10252842 | 3300009093 | Bacteria | 2037 |
| 300 | Ga0105240_10562426 | 3300009093 | Bacteria | 1260 |
| 301 | Ga0105240_11983360 | 3300009093 | Bacteria | 605 |
| 302 | Ga0105240_12242666 | 3300009093 | Bacteria | 566 |
| 303 | Ga0111539_10059089 | 3300009094 | Bacteria | 4548 |
| 304 | Ga0111539_10104303 | 3300009094 | Bacteria | 3327 |
| 305 | Ga0111539_10257248 | 3300009094 | Bacteria | 2033 |
| 306 | Ga0111539_11607006 | 3300009094 | Bacteria | 754 |
| 307 | Ga0105245_10043332 | 3300009098 | Bacteria | 4013 |
| 308 | Ga0105245_10253328 | 3300009098 | Bacteria | 1711 |
| 309 | Ga0105245_10416074 | 3300009098 | Unclassified | 1346 |
| 310 | Ga0105247_10720607 | 3300009101 | Bacteria | 753 |
| 311 | Ga0114129_10185082 | 3300009147 | Bacteria | 2831 |
| 312 | Ga0114129_10503412 | 3300009147 | Bacteria | 1582 |
| 313 | Ga0114129_10693441 | 3300009147 | Bacteria | 1310 |
| 314 | Ga0114129_13076773 | 3300009147 | Unclassified | 546 |
| 315 | Ga0105243_10746736 | 3300009148 | Unclassified | 959 |
| 316 | Ga0105241_10088523 | 3300009174 | Bacteria | 2438 |
| 317 | Ga0105241_12126452 | 3300009174 | Unclassified | 555 |
| 318 | Ga0105242_10019013 | 3300009176 | Bacteria | 5381 |
| 319 | Ga0105242_10030994 | 3300009176 | Bacteria | 4270 |
| 320 | Ga0105242_11960803 | 3300009176 | Bacteria | 627 |
| 321 | Ga0105248_10003619 | 3300009177 | Bacteria | 17144 |
| 322 | Ga0105248_10297188 | 3300009177 | Bacteria | 1818 |
| 323 | Ga0105248_10446995 | 3300009177 | Bacteria | 1456 |
| 324 | Ga0105248_11362782 | 3300009177 | Unclassified | 802 |
| 325 | Ga0105248_11762419 | 3300009177 | Bacteria | 702 |
| 326 | Ga0105248_11762422 | 3300009177 | Bacteria | 702 |
| 327 | Ga0105237_10288517 | 3300009545 | Unclassified | 1644 |
| 328 | Ga0105237_10294259 | 3300009545 | Bacteria | 1626 |
| 329 | Ga0105238_10094974 | 3300009551 | Bacteria | 2969 |
| 330 | Ga0105238_10426134 | 3300009551 | Bacteria | 1322 |
| 331 | Ga0105238_11639692 | 3300009551 | Bacteria | 674 |
| 332 | Ga0105249_10000662 | 3300009553 | Bacteria | 31249 |
| 333 | Ga0105249_10005645 | 3300009553 | Bacteria | 10826 |
| 334 | Ga0105249_10231719 | 3300009553 | Unclassified | 1822 |
| 335 | Ga0105249_10525725 | 3300009553 | Bacteria | 1231 |
| 336 | Ga0105239_10020462 | 3300010375 | Bacteria | 7299 |
| 337 | Ga0105239_10201718 | 3300010375 | Bacteria | 2228 |
| 338 | Ga0105246_10003077 | 3300011119 | Bacteria | 10132 |
| 339 | Ga0105246_10488226 | 3300011119 | Bacteria | 1043 |
| 340 | Ga0105246_12322269 | 3300011119 | Unclassified | 524 |
| 341 | Ga0157373_10362135 | 3300013100 | Unclassified | 1035 |
| 342 | Ga0157373_10617030 | 3300013100 | Bacteria | 790 |
| 343 | Ga0157371_10019008 | 3300013102 | Bacteria | 5073 |
| 344 | Ga0157370_10006918 | 3300013104 | Bacteria | 12400 |
| 345 | Ga0157370_10071438 | 3300013104 | Bacteria | 3274 |
| 346 | Ga0157370_10177717 | 3300013104 | Bacteria | 1978 |
| 347 | Ga0157370_10254104 | 3300013104 | Bacteria | 1625 |
| 348 | Ga0157370_10814751 | 3300013104 | Bacteria | 849 |
| 349 | Ga0157370_11294331 | 3300013104 | Unclassified | 657 |
| 350 | Ga0157370_11676993 | 3300013104 | Bacteria | 571 |
| 351 | Ga0157369_10016784 | 3300013105 | Bacteria | 8229 |
| 352 | Ga0157369_10064963 | 3300013105 | Bacteria | 3929 |
| 353 | Ga0157369_10114736 | 3300013105 | Unclassified | 2861 |
| 354 | Ga0157369_10157391 | 3300013105 | Bacteria | 2399 |
| 355 | Ga0157369_10415708 | 3300013105 | Bacteria | 1394 |
| 356 | Ga0157369_10534031 | 3300013105 | Bacteria | 1213 |
| 357 | Ga0157369_11476352 | 3300013105 | Bacteria | 692 |
| 358 | Ga0157374_10124192 | 3300013296 | Bacteria | 2494 |
| 359 | Ga0157374_10731429 | 3300013296 | Bacteria | 1004 |
| 360 | Ga0157374_10732424 | 3300013296 | Bacteria | 1003 |
| 361 | Ga0157374_11176938 | 3300013296 | Unclassified | 788 |
| 362 | Ga0157378_10420716 | 3300013297 | Bacteria | 1320 |
| 363 | Ga0157378_11749135 | 3300013297 | Bacteria | 669 |
| 364 | Ga0157378_12272852 | 3300013297 | Bacteria | 594 |
| 365 | Ga0163162_10025388 | 3300013306 | Bacteria | 5853 |
| 366 | Ga0163162_12116313 | 3300013306 | Unclassified | 645 |
| 367 | Ga0157372_10009596 | 3300013307 | Bacteria | 10286 |
| 368 | Ga0157372_10048721 | 3300013307 | Bacteria | 4710 |
| 369 | Ga0157372_10276622 | 3300013307 | Bacteria | 1951 |
| 370 | Ga0157372_10285001 | 3300013307 | Bacteria | 1921 |
| 371 | Ga0157372_10613637 | 3300013307 | Bacteria | 1268 |
| 372 | Ga0157372_11390943 | 3300013307 | Bacteria | 809 |
| 373 | Ga0157372_11554840 | 3300013307 | Unclassified | 762 |
| 374 | Ga0157375_10013241 | 3300013308 | Bacteria | 7332 |
| 375 | Ga0157375_10048547 | 3300013308 | Bacteria | 4153 |
| 376 | Ga0157375_10051129 | 3300013308 | Bacteria | 4057 |
| 377 | Ga0157375_10182808 | 3300013308 | Bacteria | 2249 |
| 378 | Ga0163163_10005601 | 3300014325 | Bacteria | 10880 |
| 379 | Ga0163163_10022697 | 3300014325 | Bacteria | 5946 |
| 380 | Ga0163163_12491909 | 3300014325 | Unclassified | 575 |
| 381 | Ga0163163_13245102 | 3300014325 | Unclassified | 507 |
| 382 | Ga0157380_10013451 | 3300014326 | Bacteria | 5966 |
| 383 | Ga0157380_10425188 | 3300014326 | Unclassified | 1268 |
| 384 | Ga0157377_10824664 | 3300014745 | Bacteria | 686 |
| 385 | Ga0157376_10012034 | 3300014969 | Bacteria | 6404 |
| 386 | Ga0163161_10005930 | 3300017792 | Bacteria | 8468 |
| 387 | Ga0197907_10726826 | 3300020069 | Bacteria | 634 |
| 388 | Ga0206352_11082439 | 3300020078 | Unclassified | 694 |
| 389 | Ga0206353_10541956 | 3300020082 | Bacteria | 693 |
| 390 | Ga0213876_10001912 | 3300021384 | Bacteria | 12505 |
| 391 | Ga0213876_10022865 | 3300021384 | Bacteria | 3303 |
| 392 | Ga0213876_10093938 | 3300021384 | Bacteria | 1589 |
| 393 | Ga0207697_10018619 | 3300025315 | Bacteria | 2847 |
| 394 | Ga0207656_10042548 | 3300025321 | Bacteria | 1933 |
| 395 | Ga0207656_10139904 | 3300025321 | Bacteria | 1140 |
| 396 | Ga0207692_10321723 | 3300025898 | Bacteria | 947 |
| 397 | Ga0207692_10394304 | 3300025898 | Bacteria | 862 |
| 398 | Ga0207692_10496671 | 3300025898 | Bacteria | 774 |
| 399 | Ga0207642_10044176 | 3300025899 | Bacteria | 1970 |
| 400 | Ga0207680_10597216 | 3300025903 | Bacteria | 789 |
| 401 | Ga0207647_10573406 | 3300025904 | Bacteria | 624 |
| 402 | Ga0207685_10856839 | 3300025905 | Bacteria | 503 |
| 403 | Ga0207699_10009835 | 3300025906 | Bacteria | 4779 |
| 404 | Ga0207645_10006068 | 3300025907 | Bacteria | 8689 |
| 405 | Ga0207645_10123635 | 3300025907 | Bacteria | 1681 |
| 406 | Ga0207645_10162494 | 3300025907 | Bacteria | 1461 |
| 407 | Ga0207645_10449847 | 3300025907 | Bacteria | 869 |
| 408 | Ga0207643_10005373 | 3300025908 | Bacteria | 6857 |
| 409 | Ga0207643_10496023 | 3300025908 | Bacteria | 780 |
| 410 | Ga0207705_10005450 | 3300025909 | Bacteria | 9518 |
| 411 | Ga0207705_10112688 | 3300025909 | Bacteria | 2011 |
| 412 | Ga0207705_10527532 | 3300025909 | Bacteria | 918 |
| 413 | Ga0207705_10670235 | 3300025909 | Bacteria | 807 |
| 414 | Ga0207705_10791389 | 3300025909 | Bacteria | 736 |
| 415 | Ga0207705_11402422 | 3300025909 | Unclassified | 531 |
| 416 | Ga0207654_10017653 | 3300025911 | Bacteria | 3736 |
| 417 | Ga0207707_10001516 | 3300025912 | Bacteria | 21421 |
| 418 | Ga0207707_10002653 | 3300025912 | Bacteria | 15992 |
| 419 | Ga0207707_10003275 | 3300025912 | Bacteria | 14385 |
| 420 | Ga0207707_10004812 | 3300025912 | Bacteria | 11842 |
| 421 | Ga0207707_10038608 | 3300025912 | Bacteria | 4172 |
| 422 | Ga0207707_10075922 | 3300025912 | Bacteria | 2933 |
| 423 | Ga0207707_10314016 | 3300025912 | Bacteria | 1354 |
| 424 | Ga0207707_10333666 | 3300025912 | Bacteria | 1308 |
| 425 | Ga0207707_10630127 | 3300025912 | Unclassified | 905 |
| 426 | Ga0207707_10967488 | 3300025912 | Unclassified | 700 |
| 427 | Ga0207695_10002624 | 3300025913 | Bacteria | 26302 |
| 428 | Ga0207695_10008489 | 3300025913 | Bacteria | 12844 |
| 429 | Ga0207695_10079773 | 3300025913 | Bacteria | 3316 |
| 430 | Ga0207695_10292286 | 3300025913 | Bacteria | 1522 |
| 431 | Ga0207695_10958223 | 3300025913 | Bacteria | 735 |
| 432 | Ga0207693_10004234 | 3300025915 | Bacteria | 12168 |
| 433 | Ga0207693_10075408 | 3300025915 | Bacteria | 2641 |
| 434 | Ga0207693_10515634 | 3300025915 | Bacteria | 933 |
| 435 | Ga0207663_10342088 | 3300025916 | Bacteria | 1130 |
| 436 | Ga0207663_10363882 | 3300025916 | Unclassified | 1098 |
| 437 | Ga0207663_10786914 | 3300025916 | Bacteria | 757 |
| 438 | Ga0207663_10836416 | 3300025916 | Bacteria | 734 |
| 439 | Ga0207660_10000015 | 3300025917 | Bacteria | 79088 |
| 440 | Ga0207660_10001459 | 3300025917 | Bacteria | 15885 |
| 441 | Ga0207660_10003814 | 3300025917 | Bacteria | 9820 |
| 442 | Ga0207660_10007775 | 3300025917 | Bacteria | 6940 |
| 443 | Ga0207660_10026745 | 3300025917 | Bacteria | 3931 |
| 444 | Ga0207660_10028138 | 3300025917 | Bacteria | 3843 |
| 445 | Ga0207660_10052558 | 3300025917 | Bacteria | 2901 |
| 446 | Ga0207660_10524409 | 3300025917 | Unclassified | 962 |
| 447 | Ga0207660_11443450 | 3300025917 | Unclassified | 557 |
| 448 | Ga0207662_10001456 | 3300025918 | Bacteria | 11485 |
| 449 | Ga0207662_10120510 | 3300025918 | Bacteria | 1645 |
| 450 | Ga0207662_10134332 | 3300025918 | Bacteria | 1563 |
| 451 | Ga0207662_10762752 | 3300025918 | Bacteria | 680 |
| 452 | Ga0207657_10006253 | 3300025919 | Bacteria | 12383 |
| 453 | Ga0207657_10019361 | 3300025919 | Bacteria | 6466 |
| 454 | Ga0207657_10282228 | 3300025919 | Unclassified | 1318 |
| 455 | Ga0207657_10387631 | 3300025919 | Unclassified | 1100 |
| 456 | Ga0207657_10863599 | 3300025919 | Bacteria | 698 |
| 457 | Ga0207649_10004268 | 3300025920 | Bacteria | 7780 |
| 458 | Ga0207649_10018741 | 3300025920 | Bacteria | 3943 |
| 459 | Ga0207649_10040118 | 3300025920 | Unclassified | 2843 |
| 460 | Ga0207649_10089698 | 3300025920 | Bacteria | 2010 |
| 461 | Ga0207652_10000184 | 3300025921 | Bacteria | 66070 |
| 462 | Ga0207652_10002383 | 3300025921 | Bacteria | 15874 |
| 463 | Ga0207652_10012115 | 3300025921 | Bacteria | 6964 |
| 464 | Ga0207652_10014510 | 3300025921 | Bacteria | 6383 |
| 465 | Ga0207652_10036295 | 3300025921 | Bacteria | 4167 |
| 466 | Ga0207652_10234777 | 3300025921 | Bacteria | 1653 |
| 467 | Ga0207652_10317459 | 3300025921 | Bacteria | 1407 |
| 468 | Ga0207652_10555086 | 3300025921 | Unclassified | 1032 |
| 469 | Ga0207652_11186305 | 3300025921 | Bacteria | 665 |
| 470 | Ga0207652_11493103 | 3300025921 | Bacteria | 580 |
| 471 | Ga0207652_11663911 | 3300025921 | Bacteria | 543 |
| 472 | Ga0207681_10008681 | 3300025923 | Bacteria | 6204 |
| 473 | Ga0207681_10037843 | 3300025923 | Bacteria | 3192 |
| 474 | Ga0207681_10329779 | 3300025923 | Unclassified | 1216 |
| 475 | Ga0207681_10622847 | 3300025923 | Bacteria | 893 |
| 476 | Ga0207694_10479143 | 3300025924 | Bacteria | 1041 |
| 477 | Ga0207650_10054126 | 3300025925 | Bacteria | 2976 |
| 478 | Ga0207650_10141914 | 3300025925 | Bacteria | 1889 |
| 479 | Ga0207650_10194831 | 3300025925 | Unclassified | 1621 |
| 480 | Ga0207659_10019929 | 3300025926 | Bacteria | 4424 |
| 481 | Ga0207659_10020893 | 3300025926 | Bacteria | 4336 |
| 482 | Ga0207659_10069935 | 3300025926 | Bacteria | 2558 |
| 483 | Ga0207659_10076638 | 3300025926 | Bacteria | 2459 |
| 484 | Ga0207687_10019639 | 3300025927 | Bacteria | 4478 |
| 485 | Ga0207687_10448826 | 3300025927 | Unclassified | 1069 |
| 486 | Ga0207687_11368447 | 3300025927 | Bacteria | 608 |
| 487 | Ga0207700_10011250 | 3300025928 | Bacteria | 5697 |
| 488 | Ga0207700_10088125 | 3300025928 | Bacteria | 2442 |
| 489 | Ga0207700_10298730 | 3300025928 | Bacteria | 1390 |
| 490 | Ga0207700_10341538 | 3300025928 | Bacteria | 1302 |
| 491 | Ga0207664_10144254 | 3300025929 | Bacteria | 2017 |
| 492 | Ga0207664_10916843 | 3300025929 | Bacteria | 786 |
| 493 | Ga0207644_10036812 | 3300025931 | Bacteria | 3438 |
| 494 | Ga0207644_10125762 | 3300025931 | Bacteria | 1957 |
| 495 | Ga0207644_10148129 | 3300025931 | Bacteria | 1814 |
| 496 | Ga0207644_10279859 | 3300025931 | Bacteria | 1339 |
| 497 | Ga0207644_10924711 | 3300025931 | Unclassified | 731 |
| 498 | Ga0207690_10129961 | 3300025932 | Bacteria | 1842 |
| 499 | Ga0207690_10643128 | 3300025932 | Bacteria | 868 |
| 500 | Ga0207690_10889282 | 3300025932 | Unclassified | 738 |
| 501 | Ga0207706_10000155 | 3300025933 | Bacteria | 75598 |
| 502 | Ga0207706_10116253 | 3300025933 | Bacteria | 2353 |
| 503 | Ga0207706_10158414 | 3300025933 | Unclassified | 1991 |
| 504 | Ga0207706_10288781 | 3300025933 | Bacteria | 1430 |
| 505 | Ga0207686_10049547 | 3300025934 | Bacteria | 2608 |
| 506 | Ga0207686_10213318 | 3300025934 | Bacteria | 1389 |
| 507 | Ga0207686_10871248 | 3300025934 | Bacteria | 725 |
| 508 | Ga0207670_10280588 | 3300025936 | Bacteria | 1298 |
| 509 | Ga0207670_10705747 | 3300025936 | Unclassified | 835 |
| 510 | Ga0207669_10073921 | 3300025937 | Bacteria | 2153 |
| 511 | Ga0207669_10185705 | 3300025937 | Bacteria | 1495 |
| 512 | Ga0207669_10229065 | 3300025937 | Bacteria | 1370 |
| 513 | Ga0207669_10625112 | 3300025937 | Bacteria | 878 |
| 514 | Ga0207704_10138206 | 3300025938 | Bacteria | 1700 |
| 515 | Ga0207704_10145296 | 3300025938 | Bacteria | 1665 |
| 516 | Ga0207704_10507694 | 3300025938 | Bacteria | 973 |
| 517 | Ga0207665_10406610 | 3300025939 | Unclassified | 1037 |
| 518 | Ga0207691_10001667 | 3300025940 | Bacteria | 21972 |
| 519 | Ga0207691_10002873 | 3300025940 | Bacteria | 16783 |
| 520 | Ga0207691_10051864 | 3300025940 | Bacteria | 3748 |
| 521 | Ga0207691_10139020 | 3300025940 | Bacteria | 2141 |
| 522 | Ga0207691_11122477 | 3300025940 | Bacteria | 654 |
| 523 | Ga0207711_10757893 | 3300025941 | Bacteria | 905 |
| 524 | Ga0207711_11502106 | 3300025941 | Bacteria | 617 |
| 525 | Ga0207711_11882489 | 3300025941 | Bacteria | 541 |
| 526 | Ga0207689_10002528 | 3300025942 | Bacteria | 16994 |
| 527 | Ga0207689_10026578 | 3300025942 | Bacteria | 4849 |
| 528 | Ga0207661_10001218 | 3300025944 | Bacteria | 17203 |
| 529 | Ga0207661_10001484 | 3300025944 | Bacteria | 15869 |
| 530 | Ga0207661_10004594 | 3300025944 | Bacteria | 9674 |
| 531 | Ga0207661_10004649 | 3300025944 | Bacteria | 9615 |
| 532 | Ga0207661_10011055 | 3300025944 | Bacteria | 6525 |
| 533 | Ga0207661_10019812 | 3300025944 | Bacteria | 5020 |
| 534 | Ga0207661_10056723 | 3300025944 | Bacteria | 3145 |
| 535 | Ga0207661_10057672 | 3300025944 | Bacteria | 3123 |
| 536 | Ga0207661_10086825 | 3300025944 | Bacteria | 2597 |
| 537 | Ga0207661_10089726 | 3300025944 | Bacteria | 2558 |
| 538 | Ga0207661_10202010 | 3300025944 | Unclassified | 1748 |
| 539 | Ga0207661_10280904 | 3300025944 | Bacteria | 1488 |
| 540 | Ga0207661_10619201 | 3300025944 | Unclassified | 994 |
| 541 | Ga0207661_10632104 | 3300025944 | Bacteria | 983 |
| 542 | Ga0207661_10693848 | 3300025944 | Bacteria | 936 |
| 543 | Ga0207661_10840032 | 3300025944 | Unclassified | 845 |
| 544 | Ga0207661_10876169 | 3300025944 | Bacteria | 827 |
| 545 | Ga0207661_11809068 | 3300025944 | Unclassified | 556 |
| 546 | Ga0207679_10001557 | 3300025945 | Bacteria | 14345 |
| 547 | Ga0207679_10002457 | 3300025945 | Bacteria | 11407 |
| 548 | Ga0207679_10032647 | 3300025945 | Bacteria | 3658 |
| 549 | Ga0207679_10046534 | 3300025945 | Bacteria | 3145 |
| 550 | Ga0207679_10050550 | 3300025945 | Bacteria | 3039 |
| 551 | Ga0207679_10146929 | 3300025945 | Bacteria | 1913 |
| 552 | Ga0207667_10001901 | 3300025949 | Bacteria | 26210 |
| 553 | Ga0207667_10033607 | 3300025949 | Bacteria | 5512 |
| 554 | Ga0207667_10040067 | 3300025949 | Bacteria | 4988 |
| 555 | Ga0207667_10049996 | 3300025949 | Bacteria | 4412 |
| 556 | Ga0207667_10082007 | 3300025949 | Bacteria | 3341 |
| 557 | Ga0207667_10176894 | 3300025949 | Unclassified | 2192 |
| 558 | Ga0207667_10250655 | 3300025949 | Bacteria | 1811 |
| 559 | Ga0207667_10476486 | 3300025949 | Bacteria | 1267 |
| 560 | Ga0207651_10108725 | 3300025960 | Bacteria | 2076 |
| 561 | Ga0207651_10258539 | 3300025960 | Bacteria | 1428 |
| 562 | Ga0207651_10463646 | 3300025960 | Unclassified | 1089 |
| 563 | Ga0207712_10006052 | 3300025961 | Bacteria | 7630 |
| 564 | Ga0207712_10006933 | 3300025961 | Bacteria | 7148 |
| 565 | Ga0207712_10167280 | 3300025961 | Bacteria | 1715 |
| 566 | Ga0207668_10004444 | 3300025972 | Bacteria | 8236 |
| 567 | Ga0207668_10011351 | 3300025972 | Bacteria | 5409 |
| 568 | Ga0207668_11162267 | 3300025972 | Bacteria | 693 |
| 569 | Ga0207640_10000855 | 3300025981 | Bacteria | 17272 |
| 570 | Ga0207640_10086429 | 3300025981 | Unclassified | 2159 |
| 571 | Ga0207640_10458805 | 3300025981 | Unclassified | 1052 |
| 572 | Ga0207658_10089769 | 3300025986 | Bacteria | 2380 |
| 573 | Ga0207658_10226104 | 3300025986 | Bacteria | 1577 |
| 574 | Ga0207677_10012944 | 3300026023 | Bacteria | 4818 |
| 575 | Ga0207677_10098817 | 3300026023 | Bacteria | 2142 |
| 576 | Ga0207677_10676275 | 3300026023 | Bacteria | 913 |
| 577 | Ga0207703_10031029 | 3300026035 | Bacteria | 4225 |
| 578 | Ga0207703_10343474 | 3300026035 | Bacteria | 1372 |
| 579 | Ga0207703_10369089 | 3300026035 | Bacteria | 1325 |
| 580 | Ga0207703_10427283 | 3300026035 | Bacteria | 1234 |
| 581 | Ga0207639_10544287 | 3300026041 | Bacteria | 1065 |
| 582 | Ga0207639_10647510 | 3300026041 | Unclassified | 977 |
| 583 | Ga0207639_11576363 | 3300026041 | Bacteria | 616 |
| 584 | Ga0207678_10000599 | 3300026067 | Bacteria | 33054 |
| 585 | Ga0207678_10016108 | 3300026067 | Bacteria | 6565 |
| 586 | Ga0207678_10735244 | 3300026067 | Bacteria | 869 |
| 587 | Ga0207708_10283676 | 3300026075 | Bacteria | 1343 |
| 588 | Ga0207702_10004386 | 3300026078 | Bacteria | 12569 |
| 589 | Ga0207702_10029854 | 3300026078 | Bacteria | 4539 |
| 590 | Ga0207702_10258013 | 3300026078 | Bacteria | 1640 |
| 591 | Ga0207702_10342502 | 3300026078 | Bacteria | 1428 |
| 592 | Ga0207641_10006591 | 3300026088 | Bacteria | 9756 |
| 593 | Ga0207641_10292521 | 3300026088 | Bacteria | 1536 |
| 594 | Ga0207641_10394327 | 3300026088 | Bacteria | 1328 |
| 595 | Ga0207641_11715897 | 3300026088 | Bacteria | 630 |
| 596 | Ga0207641_11830717 | 3300026088 | Bacteria | 609 |
| 597 | Ga0207648_10065900 | 3300026089 | Bacteria | 3158 |
| 598 | Ga0207648_10246714 | 3300026089 | Bacteria | 1591 |
| 599 | Ga0207648_10355401 | 3300026089 | Bacteria | 1321 |
| 600 | Ga0207648_10879672 | 3300026089 | Bacteria | 836 |
| 601 | Ga0207676_10002872 | 3300026095 | Bacteria | 12275 |
| 602 | Ga0207676_10089456 | 3300026095 | Bacteria | 2523 |
| 603 | Ga0207676_10970484 | 3300026095 | Bacteria | 836 |
| 604 | Ga0207676_11586543 | 3300026095 | Unclassified | 652 |
| 605 | Ga0207674_10000809 | 3300026116 | Bacteria | 40695 |
| 606 | Ga0207674_10001550 | 3300026116 | Bacteria | 29596 |
| 607 | Ga0207674_10001551 | 3300026116 | Bacteria | 29595 |
| 608 | Ga0207674_10017983 | 3300026116 | Bacteria | 7700 |
| 609 | Ga0207674_10215512 | 3300026116 | Bacteria | 1868 |
| 610 | Ga0207674_10333841 | 3300026116 | Unclassified | 1466 |
| 611 | Ga0207675_100001026 | 3300026118 | Bacteria | 27652 |
| 612 | Ga0207675_100027744 | 3300026118 | Bacteria | 5274 |
| 613 | Ga0207675_100597011 | 3300026118 | Bacteria | 1107 |
| 614 | Ga0207675_101181945 | 3300026118 | Bacteria | 785 |
| 615 | Ga0207675_102145828 | 3300026118 | Unclassified | 574 |
| 616 | Ga0207683_10547854 | 3300026121 | Bacteria | 1069 |
| 617 | Ga0207698_10043855 | 3300026142 | Bacteria | 3355 |
| 618 | Ga0207698_10111950 | 3300026142 | Bacteria | 2290 |
| 619 | Ga0207698_10120689 | 3300026142 | Bacteria | 2218 |
| 620 | Ga0207698_10360190 | 3300026142 | Bacteria | 1377 |
| 621 | Ga0207698_10846827 | 3300026142 | Unclassified | 919 |
| 622 | Ga0207428_10339844 | 3300027907 | Unclassified | 1106 |
| 623 | Ga0207428_11249476 | 3300027907 | Bacteria | 516 |
| 624 | Ga0268266_10529570 | 3300028379 | Bacteria | 1127 |
| 625 | Ga0268266_10558907 | 3300028379 | Bacteria | 1097 |
| 626 | Ga0268266_11632600 | 3300028379 | Unclassified | 620 |
| 627 | Ga0268265_10003561 | 3300028380 | Bacteria | 11130 |
| 628 | Ga0268265_10025393 | 3300028380 | Bacteria | 4204 |
| 629 | Ga0268264_10080463 | 3300028381 | Bacteria | 2782 |
| 630 | Ga0268264_10295360 | 3300028381 | Bacteria | 1523 |
| 631 | Ga0316182_1300009 | 3300030745 | Unclassified | 678 |
| 632 | Ga0307408_100007301 | 3300031548 | Bacteria | 7310 |
| 633 | Ga0307408_100007627 | 3300031548 | Bacteria | 7156 |
| 634 | Ga0307408_100015459 | 3300031548 | Bacteria | 5081 |
| 635 | Ga0307408_100030814 | 3300031548 | Bacteria | 3727 |
| 636 | Ga0307408_100038412 | 3300031548 | Bacteria | 3378 |
| 637 | Ga0307408_100066551 | 3300031548 | Bacteria | 2647 |
| 638 | Ga0307408_101270954 | 3300031548 | Bacteria | 689 |
| 639 | Ga0307405_10000555 | 3300031731 | Bacteria | 14193 |
| 640 | Ga0307405_10000716 | 3300031731 | Bacteria | 12887 |
| 641 | Ga0307405_10010082 | 3300031731 | Bacteria | 4875 |
| 642 | Ga0307405_10018218 | 3300031731 | Bacteria | 3870 |
| 643 | Ga0307405_10230220 | 3300031731 | Bacteria | 1366 |
| 644 | Ga0307405_10986500 | 3300031731 | Bacteria | 718 |
| 645 | Ga0307413_10000588 | 3300031824 | Bacteria | 12205 |
| 646 | Ga0307413_10007247 | 3300031824 | Bacteria | 5133 |
| 647 | Ga0307413_10017348 | 3300031824 | Bacteria | 3746 |
| 648 | Ga0307413_10045631 | 3300031824 | Bacteria | 2599 |
| 649 | Ga0307413_10118010 | 3300031824 | Bacteria | 1790 |
| 650 | Ga0307413_10645044 | 3300031824 | Bacteria | 873 |
| 651 | Ga0307413_10728899 | 3300031824 | Bacteria | 826 |
| 652 | Ga0307413_11282263 | 3300031824 | Unclassified | 640 |
| 653 | Ga0307410_10023857 | 3300031852 | Bacteria | 3812 |
| 654 | Ga0307410_10032229 | 3300031852 | Bacteria | 3370 |
| 655 | Ga0307410_10116608 | 3300031852 | Bacteria | 1940 |
| 656 | Ga0307410_10277727 | 3300031852 | Bacteria | 1313 |
| 657 | Ga0307410_11121054 | 3300031852 | Bacteria | 683 |
| 658 | Ga0307410_11131310 | 3300031852 | Unclassified | 680 |
| 659 | Ga0307406_10014247 | 3300031901 | Bacteria | 4571 |
| 660 | Ga0307406_10030153 | 3300031901 | Bacteria | 3290 |
| 661 | Ga0307406_10076492 | 3300031901 | Bacteria | 2211 |
| 662 | Ga0307406_10125018 | 3300031901 | Bacteria | 1795 |
| 663 | Ga0307406_10235175 | 3300031901 | Bacteria | 1371 |
| 664 | Ga0307406_10864436 | 3300031901 | Bacteria | 767 |
| 665 | Ga0307407_10000905 | 3300031903 | Bacteria | 10014 |
| 666 | Ga0307407_10001245 | 3300031903 | Bacteria | 9059 |
| 667 | Ga0307407_10027406 | 3300031903 | Bacteria | 3031 |
| 668 | Ga0307407_10046125 | 3300031903 | Bacteria | 2466 |
| 669 | Ga0307407_10083257 | 3300031903 | Bacteria | 1940 |
| 670 | Ga0307407_10090777 | 3300031903 | Bacteria | 1872 |
| 671 | Ga0307407_10134783 | 3300031903 | Bacteria | 1585 |
| 672 | Ga0307407_10413324 | 3300031903 | Bacteria | 971 |
| 673 | Ga0307407_10483680 | 3300031903 | Bacteria | 904 |
| 674 | Ga0307407_10687125 | 3300031903 | Bacteria | 770 |
| 675 | Ga0307407_11312343 | 3300031903 | Unclassified | 568 |
| 676 | Ga0307407_11440268 | 3300031903 | Archaea | 544 |
| 677 | Ga0307412_10003493 | 3300031911 | Bacteria | 8735 |
| 678 | Ga0307412_10008514 | 3300031911 | Bacteria | 5861 |
| 679 | Ga0307412_10010351 | 3300031911 | Bacteria | 5369 |
| 680 | Ga0307412_10435197 | 3300031911 | Bacteria | 1076 |
| 681 | Ga0307412_10451443 | 3300031911 | Bacteria | 1059 |
| 682 | Ga0307412_10564312 | 3300031911 | Bacteria | 958 |
| 683 | Ga0307412_10833493 | 3300031911 | Bacteria | 803 |
| 684 | Ga0307409_100000084 | 3300031995 | Bacteria | 33710 |
| 685 | Ga0307409_100020768 | 3300031995 | Bacteria | 4484 |
| 686 | Ga0307409_100053080 | 3300031995 | Bacteria | 3112 |
| 687 | Ga0307409_100060427 | 3300031995 | Bacteria | 2955 |
| 688 | Ga0307409_100288071 | 3300031995 | Bacteria | 1521 |
| 689 | Ga0307409_100865716 | 3300031995 | Unclassified | 915 |
| 690 | Ga0307409_101082266 | 3300031995 | Bacteria | 822 |
| 691 | Ga0307416_100000582 | 3300032002 | Bacteria | 18751 |
| 692 | Ga0307416_100012575 | 3300032002 | Bacteria | 5711 |
| 693 | Ga0307416_100077208 | 3300032002 | Bacteria | 2796 |
| 694 | Ga0307416_100099356 | 3300032002 | Unclassified | 2527 |
| 695 | Ga0307416_100456172 | 3300032002 | Unclassified | 1332 |
| 696 | Ga0307416_100696835 | 3300032002 | Bacteria | 1104 |
| 697 | Ga0307416_100737684 | 3300032002 | Bacteria | 1077 |
| 698 | Ga0307416_101262729 | 3300032002 | Bacteria | 844 |
| 699 | Ga0307414_10004059 | 3300032004 | Bacteria | 7894 |
| 700 | Ga0307414_10014529 | 3300032004 | Bacteria | 4725 |
| 701 | Ga0307414_10022555 | 3300032004 | Bacteria | 3974 |
| 702 | Ga0307414_10191270 | 3300032004 | Bacteria | 1656 |
| 703 | Ga0307414_10331842 | 3300032004 | Bacteria | 1299 |
| 704 | Ga0307414_10821010 | 3300032004 | Bacteria | 849 |
| 705 | Ga0307414_11207903 | 3300032004 | Unclassified | 700 |
| 706 | Ga0307411_10000070 | 3300032005 | Bacteria | 31137 |
| 707 | Ga0307411_10000266 | 3300032005 | Bacteria | 17168 |
| 708 | Ga0307411_10000464 | 3300032005 | Bacteria | 14014 |
| 709 | Ga0307411_10204686 | 3300032005 | Bacteria | 1519 |
| 710 | Ga0307411_10258591 | 3300032005 | Bacteria | 1373 |
| 711 | Ga0307411_10651967 | 3300032005 | Unclassified | 912 |
| 712 | Ga0307415_100000761 | 3300032126 | Bacteria | 14552 |
| 713 | Ga0307415_100009913 | 3300032126 | Bacteria | 5369 |
| 714 | Ga0307415_100012688 | 3300032126 | Bacteria | 4882 |
| 715 | Ga0307415_100015722 | 3300032126 | Bacteria | 4491 |
| 716 | Ga0307415_100023890 | 3300032126 | Bacteria | 3805 |
| 717 | Ga0307415_100191538 | 3300032126 | Bacteria | 1614 |
| 718 | Ga0307415_100344899 | 3300032126 | Bacteria | 1251 |
| 719 | Ga0307415_102223110 | 3300032126 | Bacteria | 537 |
| 720 | Ga0373930_0017809 | 3300034816 | Bacteria | 1359 |
| 721 | Ga0373958_0020215 | 3300034819 | Bacteria | 1224 |
| 722 | Ga0373926_0000731 | 3300035083 | Bacteria | 9111 |
| 723 | Ga0373928_0157749 | 3300035084 | Bacteria | 632 |
| 724 | Ga0373934_0002803 | 3300035086 | Bacteria | 6387 |
| 725 | Ga0373934_0005416 | 3300035086 | Bacteria | 4727 |
| 726 | Ga0373934_0038278 | 3300035086 | Bacteria | 1888 |
| 727 | Ga0373944_0003960 | 3300035089 | Bacteria | 3835 |
| 728 | Ga0373949_0276157 | 3300035090 | Bacteria | 527 |
| 729 | Ga0373923_0029407 | 3300035111 | Unclassified | 2203 |
| 730 | Ga0373923_0431343 | 3300035111 | Unclassified | 637 |
| 731 | Ga0373936_0016227 | 3300035113 | Bacteria | 2864 |
| 732 | Ga0373936_0279750 | 3300035113 | Bacteria | 750 |
| 733 | Ga0373945_0028758 | 3300035116 | Unclassified | 1949 |
| 734 | Ga0373945_0230591 | 3300035116 | Bacteria | 777 |
| 735 | Ga0373953_0060636 | 3300035117 | Bacteria | 1546 |
| 736 | Ga0373954_0043444 | 3300035118 | Bacteria | 2096 |
| 737 | Ga0373954_0053079 | 3300035118 | Bacteria | 1905 |
| 738 | Ga0373954_0076903 | 3300035118 | Bacteria | 1591 |
| 739 | Ga0373956_0028816 | 3300035119 | Bacteria | 2417 |
| 740 | Ga0373956_0256509 | 3300035119 | Unclassified | 831 |
| 741 | Ga0373957_0026351 | 3300035120 | Bacteria | 2102 |
| 742 | Ga0373960_0063195 | 3300035121 | Bacteria | 1128 |
| 743 | Ga0373943_0006602 | 3300035170 | Bacteria | 5201 |
| 744 | Ga0373943_0101543 | 3300035170 | Bacteria | 1505 |
| 745 | Ga0373943_0595148 | 3300035170 | Unclassified | 651 |
| 746 | Ga0373946_0003748 | 3300035171 | Bacteria | 5393 |
| 747 | Ga0373946_0625829 | 3300035171 | Unclassified | 559 |
| 748 | Ga0373955_0080512 | 3300035172 | Bacteria | 1839 |
| 749 | Ga0373955_0381314 | 3300035172 | Bacteria | 856 |
| 750 | Ga0373962_0098266 | 3300035242 | Bacteria | 910 |
| 751 | Ga0373962_0375562 | 3300035242 | Bacteria | 518 |
| 752 | Ga0373924_0115105 | 3300035410 | Bacteria | 1164 |
| 753 | Ga0373924_0337664 | 3300035410 | Bacteria | 671 |
| 754 | Ga0373931_0062432 | 3300035691 | Bacteria | 2011 |
| 755 | Ga0373935_0008417 | 3300035692 | Bacteria | 6173 |
| 756 | Ga0373935_0324839 | 3300035692 | Bacteria | 1092 |
| 757 | Ga0373935_0701475 | 3300035692 | Bacteria | 744 |
| 758 | Ga0373927_0008404 | 3300035695 | Bacteria | 6945 |
| 759 | Ga0373927_0030770 | 3300035695 | Bacteria | 3501 |
| 760 | Ga0373927_0176367 | 3300035695 | Unclassified | 1401 |
| 761 | Ga0373933_0009104 | 3300035724 | Bacteria | 5419 |
| 762 | Ga0373933_0062452 | 3300035724 | Bacteria | 2250 |
| 763 | Ga0373933_0084571 | 3300035724 | Bacteria | 1949 |
| 764 | Ga0373947_0002620 | 3300035725 | Bacteria | 10799 |
| 765 | Ga0373947_0368623 | 3300035725 | Bacteria | 965 |
| 766 | Ga0373947_0664772 | 3300035725 | Unclassified | 710 |
| 767 | Ga0373947_0732707 | 3300035725 | Bacteria | 674 |
| 768 | Ga0373937_0000920 | 3300036401 | Bacteria | 24955 |
| 769 | Ga0373937_0033999 | 3300036401 | Bacteria | 4634 |
| 770 | Ga0373937_0149749 | 3300036401 | Bacteria | 2185 |
| 771 | Ga0373937_0424720 | 3300036401 | Bacteria | 1262 |
| 772 | Ga0373937_1394624 | 3300036401 | Unclassified | 648 |
| 773 | Ga0373925_0002987 | 3300037068 | Bacteria | 13332 |
| 774 | Ga0373925_0123997 | 3300037068 | Bacteria | 2008 |
| 775 | Ga0373925_1080594 | 3300037068 | Unclassified | 660 |
| 776 | Ga0373925_1730911 | 3300037068 | Bacteria | 510 |
| 777 | Ga0395899_0033159 | 3300037312 | Bacteria | 3879 |
| 778 | Ga0395905_0004652 | 3300037471 | Bacteria | 14191 |
| 779 | Ga0395905_0149430 | 3300037471 | Bacteria | 2198 |
| 780 | Ga0395901_0005373 | 3300038443 | Bacteria | 12953 |
| 781 | Ga0436365_0164142 | 3300039437 | Bacteria | 22278 |
| 782 | Ga0436365_0382940 | 3300039437 | Unclassified | 2238 |
| 783 | Ga0436365_0557665 | 3300039437 | Bacteria | 789 |
| 784 | Ga0436365_1631599 | 3300039437 | Bacteria | 6924 |
| 785 | Ga0439439_0031717 | 3300041406 | Bacteria | 1348 |
| 786 | Ga0450895_029278 | 3300042132 | Unclassified | 533 |
| 787 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 788 | Ga0466969_0141879 | 3300044656 | Bacteria | 1110 |
| 789 | Ga0466965_0198325 | 3300044683 | Bacteria | 1064 |
| 790 | Ga0466966_0011886 | 3300044684 | Bacteria | 5767 |
| 791 | Ga0466961_0346223 | 3300044693 | Bacteria | 905 |
| 792 | Ga0466971_0298743 | 3300044719 | Bacteria | 773 |
| 793 | Ga0466957_0130132 | 3300044842 | Bacteria | 1612 |
| 794 | Ga0466957_0442932 | 3300044842 | Bacteria | 894 |
| 795 | Ga0466957_0517363 | 3300044842 | Bacteria | 829 |
| 796 | Ga0466959_0040470 | 3300045049 | Bacteria | 3443 |
| 797 | Ga0451576_0055803 | 3300045051 | Bacteria | 4132 |
| 798 | Ga0451576_0276497 | 3300045051 | Bacteria | 1756 |
| 799 | Ga0451576_0391300 | 3300045051 | Bacteria | 1457 |
| 800 | Ga0451576_0655212 | 3300045051 | Bacteria | 1103 |
| 801 | Ga0466958_0535409 | 3300045836 | Unclassified | 761 |
| 802 | Ga0466967_0056646 | 3300045976 | Bacteria | 3457 |
| 803 | Ga0466967_0255342 | 3300045976 | Bacteria | 1676 |
| 804 | Ga0466967_0604856 | 3300045976 | Unclassified | 1082 |
| 805 | Ga0466967_1015998 | 3300045976 | Bacteria | 826 |
| 806 | Ga0466967_1587697 | 3300045976 | Bacteria | 652 |
| 807 | Ga0466967_1773225 | 3300045976 | Unclassified | 614 |
| 808 | Ga0466967_1817781 | 3300045976 | Unclassified | 606 |
| 809 | Ga0495592_0257222 | 3300046454 | Bacteria | 1151 |
| 810 | Ga0495603_0002982 | 3300046455 | Bacteria | 10011 |
| 811 | Ga0495629_0039952 | 3300046459 | Bacteria | 3301 |
| 812 | Ga0495629_0155454 | 3300046459 | Bacteria | 1589 |
| 813 | Ga0495629_0347489 | 3300046459 | Bacteria | 1012 |
| 814 | Ga0495638_0240635 | 3300046460 | Bacteria | 1002 |
| 815 | Ga0495651_0073556 | 3300046462 | Bacteria | 2593 |
| 816 | Ga0495651_0225112 | 3300046462 | Bacteria | 1295 |
| 817 | Ga0495651_0566988 | 3300046462 | Bacteria | 719 |
| 818 | Ga0495653_0024876 | 3300046463 | Bacteria | 4818 |
| 819 | Ga0495653_0230975 | 3300046463 | Bacteria | 1238 |
| 820 | Ga0495580_0005679 | 3300046472 | Bacteria | 10261 |
| 821 | Ga0495580_0028551 | 3300046472 | Bacteria | 4055 |
| 822 | Ga0495580_0077080 | 3300046472 | Bacteria | 2325 |
| 823 | Ga0495580_0294492 | 3300046472 | Bacteria | 1106 |
| 824 | Ga0495582_0005504 | 3300046473 | Bacteria | 7053 |
| 825 | Ga0495582_0009433 | 3300046473 | Bacteria | 5375 |
| 826 | Ga0495582_0030283 | 3300046473 | Bacteria | 2971 |
| 827 | Ga0495582_0050168 | 3300046473 | Bacteria | 2299 |
| 828 | Ga0495639_0000704 | 3300046475 | Bacteria | 15302 |
| 829 | Ga0495639_0017820 | 3300046475 | Bacteria | 3086 |
| 830 | Ga0495639_0020610 | 3300046475 | Bacteria | 2881 |
| 831 | Ga0495639_0121391 | 3300046475 | Bacteria | 1247 |
| 832 | Ga0495662_0157871 | 3300046476 | Unclassified | 1117 |
| 833 | Ga0495664_0018129 | 3300046477 | Bacteria | 4027 |
| 834 | Ga0495664_0020162 | 3300046477 | Bacteria | 3843 |
| 835 | Ga0495594_0008344 | 3300046499 | Bacteria | 5336 |
| 836 | Ga0495594_0042092 | 3300046499 | Bacteria | 2501 |
| 837 | Ga0495594_0063694 | 3300046499 | Bacteria | 2043 |
| 838 | Ga0495594_0122584 | 3300046499 | Bacteria | 1470 |
| 839 | Ga0495594_0170187 | 3300046499 | Bacteria | 1239 |
| 840 | Ga0495594_0208334 | 3300046499 | Unclassified | 1115 |
| 841 | Ga0495583_0432504 | 3300046506 | Bacteria | 516 |
| 842 | Ga0495608_0054704 | 3300046511 | Unclassified | 2638 |
| 843 | Ga0495608_0198297 | 3300046511 | Bacteria | 1266 |
| 844 | Ga0495618_0062510 | 3300046514 | Bacteria | 2363 |
| 845 | Ga0495618_0342577 | 3300046514 | Bacteria | 922 |
| 846 | Ga0495628_0005937 | 3300046516 | Bacteria | 10685 |
| 847 | Ga0495628_0028438 | 3300046516 | Bacteria | 4542 |
| 848 | Ga0495628_0099546 | 3300046516 | Unclassified | 2245 |
| 849 | Ga0495630_0011249 | 3300046517 | Bacteria | 6473 |
| 850 | Ga0495630_0014259 | 3300046517 | Bacteria | 5787 |
| 851 | Ga0495630_0049255 | 3300046517 | Bacteria | 3153 |
| 852 | Ga0495630_0148847 | 3300046517 | Bacteria | 1781 |
| 853 | Ga0495666_0028263 | 3300046526 | Bacteria | 2759 |
| 854 | Ga0495652_0016375 | 3300046529 | Bacteria | 6632 |
| 855 | Ga0495652_0095286 | 3300046529 | Bacteria | 2425 |
| 856 | Ga0495652_0389631 | 3300046529 | Bacteria | 989 |
| 857 | Ga0495665_0001067 | 3300046531 | Bacteria | 14571 |
| 858 | Ga0495665_0009112 | 3300046531 | Bacteria | 5379 |
| 859 | Ga0495665_0043714 | 3300046531 | Bacteria | 2382 |
| 860 | Ga0495665_0056079 | 3300046531 | Bacteria | 2080 |
| 861 | Ga0495665_0134220 | 3300046531 | Bacteria | 1295 |
| 862 | Ga0495640_0105197 | 3300046533 | Bacteria | 1849 |
| 863 | Ga0495640_0110048 | 3300046533 | Bacteria | 1801 |
| 864 | Ga0495640_0560091 | 3300046533 | Bacteria | 692 |
| 865 | Ga0495586_0007235 | 3300046535 | Bacteria | 5922 |
| 866 | Ga0495586_0026809 | 3300046535 | Bacteria | 3084 |
| 867 | Ga0495586_0112724 | 3300046535 | Bacteria | 1514 |
| 868 | Ga0495586_0175254 | 3300046535 | Bacteria | 1212 |
| 869 | Ga0495587_0000778 | 3300046536 | Bacteria | 21285 |
| 870 | Ga0495587_0013473 | 3300046536 | Bacteria | 5138 |
| 871 | Ga0495645_0000693 | 3300046543 | Bacteria | 23140 |
| 872 | Ga0495645_0055755 | 3300046543 | Bacteria | 2870 |
| 873 | Ga0495645_0077562 | 3300046543 | Bacteria | 2388 |
| 874 | Ga0495667_0002391 | 3300046559 | Bacteria | 12549 |
| 875 | Ga0495667_0004170 | 3300046559 | Bacteria | 9731 |
| 876 | Ga0495667_0067029 | 3300046559 | Unclassified | 2346 |
| 877 | Ga0495667_0107442 | 3300046559 | Bacteria | 1803 |
| 878 | Ga0495634_0203966 | 3300046642 | Bacteria | 1227 |
| 879 | Ga0495634_0435633 | 3300046642 | Bacteria | 775 |
| 880 | Ga0495635_0077311 | 3300046663 | Bacteria | 2280 |
| 881 | Ga0495635_0137549 | 3300046663 | Bacteria | 1664 |
| 882 | Ga0495635_0203948 | 3300046663 | Unclassified | 1340 |
| 883 | Ga0495659_0103394 | 3300046664 | Unclassified | 1106 |
| 884 | Ga0495588_0001415 | 3300046674 | Bacteria | 10249 |
| 885 | Ga0495657_0037580 | 3300046675 | Bacteria | 3336 |
| 886 | Ga0495657_0118245 | 3300046675 | Bacteria | 1672 |
| 887 | Ga0495657_0390013 | 3300046675 | Bacteria | 820 |
| 888 | Ga0495599_0004117 | 3300046678 | Bacteria | 8585 |
| 889 | Ga0495599_0007818 | 3300046678 | Bacteria | 6489 |
| 890 | Ga0495599_0013143 | 3300046678 | Bacteria | 5116 |
| 891 | Ga0495599_0039663 | 3300046678 | Bacteria | 2958 |
| 892 | Ga0495599_0547115 | 3300046678 | Bacteria | 678 |
| 893 | Ga0495623_0002993 | 3300046679 | Bacteria | 11115 |
| 894 | Ga0495623_0057341 | 3300046679 | Bacteria | 2450 |
| 895 | Ga0495623_0063340 | 3300046679 | Bacteria | 2315 |
| 896 | Ga0495646_0022193 | 3300046680 | Bacteria | 4005 |
| 897 | Ga0495646_0054639 | 3300046680 | Bacteria | 2401 |
| 898 | Ga0495647_0018198 | 3300046681 | Bacteria | 2498 |
| 899 | Ga0495658_0001668 | 3300046683 | Bacteria | 11553 |
| 900 | Ga0495658_0009450 | 3300046683 | Bacteria | 4862 |
| 901 | Ga0495658_0052737 | 3300046683 | Bacteria | 2308 |
| 902 | Ga0495658_0086483 | 3300046683 | Bacteria | 1850 |
| 903 | Ga0495658_0277926 | 3300046683 | Bacteria | 1056 |
| 904 | Ga0495613_0005287 | 3300046689 | Bacteria | 9700 |
| 905 | Ga0495613_0161297 | 3300046689 | Bacteria | 1595 |
| 906 | Ga0495613_0203897 | 3300046689 | Bacteria | 1393 |
| 907 | Ga0495613_0347750 | 3300046689 | Bacteria | 1019 |
| 908 | Ga0495600_0003030 | 3300046809 | Bacteria | 9812 |
| 909 | Ga0495600_0100075 | 3300046809 | Bacteria | 1889 |
| 910 | Ga0495581_0000809 | 3300047315 | Bacteria | 16635 |
| 911 | Ga0495581_0040872 | 3300047315 | Bacteria | 2682 |
| 912 | Ga0495581_0090604 | 3300047315 | Bacteria | 1774 |
| 913 | Ga0495581_0329640 | 3300047315 | Bacteria | 891 |
| 914 | Ga0495604_0005420 | 3300047317 | Bacteria | 10117 |
| 915 | Ga0495604_0109056 | 3300047317 | Bacteria | 2021 |
| 916 | Ga0495604_0215386 | 3300047317 | Bacteria | 1325 |
| 917 | Ga0495636_0014162 | 3300047318 | Bacteria | 3172 |
| 918 | Ga0495636_0248711 | 3300047318 | Bacteria | 822 |
| 919 | Ga0495674_0026894 | 3300047319 | Bacteria | 5262 |
| 920 | Ga0495674_0222365 | 3300047319 | Bacteria | 1560 |
| 921 | Ga0495674_0981607 | 3300047319 | Bacteria | 648 |
| 922 | Ga0495680_0081361 | 3300047322 | Bacteria | 2445 |
| 923 | Ga0495680_0778875 | 3300047322 | Unclassified | 626 |
| 924 | Ga0495680_0908841 | 3300047322 | Bacteria | 568 |
| 925 | Ga0495675_0007063 | 3300047444 | Bacteria | 6909 |
| 926 | Ga0495675_0014647 | 3300047444 | Bacteria | 4954 |
| 927 | Ga0495675_0022648 | 3300047444 | Bacteria | 4006 |
| 928 | Ga0495675_0046723 | 3300047444 | Bacteria | 2756 |
| 929 | Ga0495675_0370253 | 3300047444 | Bacteria | 840 |
| 930 | Ga0495677_0203892 | 3300047445 | Unclassified | 769 |
| 931 | Ga0495684_0005933 | 3300047471 | Bacteria | 9491 |
| 932 | Ga0495684_0078334 | 3300047471 | Bacteria | 2508 |
| 933 | Ga0495684_0100031 | 3300047471 | Bacteria | 2192 |
| 934 | Ga0495593_0002738 | 3300047673 | Bacteria | 10610 |
| 935 | Ga0495593_0147872 | 3300047673 | Unclassified | 1189 |
| 936 | Ga0495602_0003786 | 3300048088 | Bacteria | 15729 |
| 937 | Ga0495602_0038810 | 3300048088 | Bacteria | 4397 |
| 938 | Ga0495614_0000708 | 3300048089 | Bacteria | 14038 |
| 939 | Ga0496105_0040012 | 3300048908 | Bacteria | 3865 |
| 940 | Ga0496106_0794497 | 3300048909 | Bacteria | 751 |
| 941 | Ga0496108_0149253 | 3300048911 | Bacteria | 2017 |
| 942 | Ga0496108_0228326 | 3300048911 | Bacteria | 1618 |
| 943 | Ga0496110_0165529 | 3300048913 | Bacteria | 2005 |
| 944 | Ga0496112_0021609 | 3300048915 | Bacteria | 6121 |
| 945 | Ga0496112_0932052 | 3300048915 | Unclassified | 790 |
| 946 | Ga0496113_0240167 | 3300048916 | Bacteria | 1445 |
| 947 | Ga0496113_0666729 | 3300048916 | Bacteria | 831 |
| 948 | Ga0501291_147775 | 3300049514 | Bacteria | 529 |
| 949 | Ga0501297_033491 | 3300049520 | Bacteria | 694 |
| 950 | Ga0501303_064748 | 3300049526 | Unclassified | 506 |
| 951 | Ga0501033_0005653 | 3300049570 | Bacteria | 9877 |
| 952 | Ga0501033_0887971 | 3300049570 | Unclassified | 599 |
| 953 | Ga0501034_0003782 | 3300049571 | Bacteria | 17079 |
| 954 | Ga0501034_0847520 | 3300049571 | Bacteria | 804 |
| 955 | Ga0501037_0119222 | 3300049573 | Bacteria | 1898 |
| 956 | Ga0501037_0641028 | 3300049573 | Bacteria | 711 |
| 957 | Ga0501038_0022503 | 3300049574 | Bacteria | 5647 |
| 958 | Ga0501038_1093391 | 3300049574 | Unclassified | 582 |
| 959 | Ga0501043_0500052 | 3300049579 | Bacteria | 908 |
| 960 | Ga0501047_0028977 | 3300049581 | Bacteria | 5340 |
| 961 | Ga0501047_0331201 | 3300049581 | Bacteria | 1361 |
| 962 | Ga0501070_0056463 | 3300049586 | Bacteria | 3255 |
| 963 | Ga0501070_0676416 | 3300049586 | Bacteria | 818 |
| 964 | Ga0501073_0073029 | 3300049589 | Bacteria | 2389 |
| 965 | Ga0501076_0407172 | 3300049592 | Bacteria | 1119 |
| 966 | Ga0501233_270351 | 3300049668 | Unclassified | 517 |
| 967 | Ga0501235_234369 | 3300049669 | Bacteria | 508 |
| 968 | Ga0501243_075548 | 3300049675 | Bacteria | 647 |
| 969 | Ga0501249_194440 | 3300049679 | Unclassified | 530 |
| 970 | Ga0501255_038730 | 3300049684 | Bacteria | 692 |
| 971 | Ga0501225_0194827 | 3300049705 | Bacteria | 640 |
| 972 | Ga0501229_057486 | 3300049706 | Bacteria | 586 |
| 973 | Ga0501268_081768 | 3300049765 | Bacteria | 668 |
| 974 | Ga0501035_0075368 | 3300049822 | Bacteria | 2984 |
| 975 | Ga0501044_0004890 | 3300049823 | Bacteria | 14973 |
| 976 | Ga0501044_0711529 | 3300049823 | Bacteria | 889 |
| 977 | Ga0501044_0900121 | 3300049823 | Bacteria | 760 |
| 978 | nmdc:mga05p37_2013510_c1 | 3300050507 | Unclassified | 546 |
| 979 | nmdc:mga05p37_372174_c1 | 3300050507 | Unclassified | 1676 |
| 980 | nmdc:mga09592_1264139_c1 | 3300050508 | Bacteria | 608 |
| 981 | nmdc:mga09592_17168_c1 | 3300050508 | Bacteria | 5927 |
| 982 | nmdc:mga09592_289428_c1 | 3300050508 | Bacteria | 1420 |
| 983 | nmdc:mga09592_590340_c1 | 3300050508 | Bacteria | 952 |
| 984 | nmdc:mga0qj67_156649_c1 | 3300050509 | Bacteria | 1849 |
| 985 | nmdc:mga0qj67_3124_c1 | 3300050509 | Bacteria | 11922 |
| 986 | nmdc:mga0qj67_41364_c1 | 3300050509 | Bacteria | 3625 |
| 987 | nmdc:mga06r32_1064804_c1 | 3300050510 | Bacteria | 759 |
| 988 | nmdc:mga06r32_1222605_c1 | 3300050510 | Bacteria | 697 |
| 989 | nmdc:mga06r32_254767_c1 | 3300050510 | Bacteria | 1743 |
| 990 | nmdc:mga06r32_54786_c1 | 3300050510 | Bacteria | 3824 |
| 991 | nmdc:mga06r32_627717_c1 | 3300050510 | Bacteria | 1044 |
| 992 | nmdc:mga06r32_967020_c1 | 3300050510 | Bacteria | 805 |
| 993 | nmdc:mga08y16_2027641_c1 | 3300050511 | Unclassified | 524 |
| 994 | nmdc:mga08y16_62586_c1 | 3300050511 | Bacteria | 3886 |
| 995 | nmdc:mga08y16_907469_c1 | 3300050511 | Bacteria | 867 |
| 996 | nmdc:mga0n895_48397_c1 | 3300050512 | Bacteria | 4161 |
| 997 | nmdc:mga0rr50_155565_c1 | 3300050513 | Bacteria | 1851 |
| 998 | nmdc:mga0rr50_1749892_c1 | 3300050513 | Bacteria | 523 |
| 999 | nmdc:mga08x19_364364_c1 | 3300050514 | Unclassified | 1010 |
| 1000 | nmdc:mga08x19_421724_c1 | 3300050514 | Bacteria | 937 |
| 1001 | nmdc:mga0a205_550671_c1 | 3300050515 | Bacteria | 1009 |
| 1002 | Ga0495601_0081842 | 3300053077 | Bacteria | 2072 |
| 1003 | Ga0495612_0042344 | 3300053078 | Bacteria | 1858 |
| 1004 | Ga0495595_0020340 | 3300053084 | Bacteria | 2889 |
| 1005 | Ga0495619_0053792 | 3300053085 | Bacteria | 2664 |
| 1006 | Ga0495619_0409331 | 3300053085 | Bacteria | 936 |
| 1007 | Ga0590074_064157 | 3300059423 | Bacteria | 686 |
| 1008 | Ga0070691_10098670 | |||
| 1009 | Ga0065707_10161369 | |||
| 1010 | Ga0070658_11456609 | |||
| 1011 | Ga0070676_10184983 | |||
| 1012 | Ga0070676_10201880 | |||
| 1013 | Ga0070676_10507863 | |||
| 1014 | Ga0070676_10775867 | |||
| 1015 | Ga0070683_100003005 | |||
| 1016 | Ga0070683_100006639 | |||
| 1017 | Ga0070683_100018701 | |||
| 1018 | Ga0070683_100037308 | |||
| 1019 | Ga0070683_100060072 | |||
| 1020 | Ga0070683_100072562 | |||
| 1021 | Ga0070683_100081261 | |||
| 1022 | Ga0070683_100087370 | |||
| 1023 | Ga0070683_100123356 | |||
| 1024 | Ga0070683_100349657 | |||
| 1025 | Ga0070683_100360294 | |||
| 1026 | Ga0070683_100834436 | |||
| 1027 | Ga0070690_100107344 | |||
| 1028 | Ga0070690_100812054 | |||
| 1029 | Ga0070670_100008193 | |||
| 1030 | Ga0070670_100013576 | |||
| 1031 | Ga0070670_100024394 | |||
| 1032 | Ga0070670_100099324 | |||
| 1033 | Ga0070670_100110248 | |||
| 1034 | Ga0070670_100572995 | |||
| 1035 | Ga0070677_10312447 | |||
| 1036 | Ga0070677_10320335 | |||
| 1037 | Ga0068869_100024550 | |||
| 1038 | Ga0068869_100457511 | |||
| 1039 | Ga0070666_10610954 | |||
| 1040 | Ga0070680_100000010 | |||
| 1041 | Ga0070680_100001244 | |||
| 1042 | Ga0070680_100002198 | |||
| 1043 | Ga0070680_100065992 | |||
| 1044 | Ga0070680_100101359 | |||
| 1045 | Ga0070680_100144809 | |||
| 1046 | Ga0070682_100005851 | |||
| 1047 | Ga0068868_100097569 | |||
| 1048 | Ga0068868_101268022 | |||
| 1049 | Ga0068868_101482455 | |||
| 1050 | Ga0068868_102007124 | |||
| 1051 | Ga0070660_100013102 | |||
| 1052 | Ga0070660_100213620 | |||
| 1053 | Ga0070660_100341143 | |||
| 1054 | Ga0070660_100443812 | |||
| 1055 | Ga0070660_100520287 | |||
| 1056 | Ga0070689_100007804 | |||
| 1057 | Ga0070689_100008541 | |||
| 1058 | Ga0070691_10239665 | |||
| 1059 | Ga0070687_100007591 | |||
| 1060 | Ga0070687_100165672 | |||
| 1061 | Ga0070687_100484935 | |||
| 1062 | Ga0070661_100000718 | |||
| 1063 | Ga0070661_100004963 | |||
| 1064 | Ga0070692_10061750 | |||
| 1065 | Ga0070692_10477950 | |||
| 1066 | Ga0070692_10718893 | |||
| 1067 | Ga0070692_11268061 | |||
| 1068 | Ga0070668_100002904 | |||
| 1069 | Ga0070668_100162739 | |||
| 1070 | Ga0070668_100239932 | |||
| 1071 | Ga0070669_100005880 | |||
| 1072 | Ga0070669_100220885 | |||
| 1073 | Ga0070669_100337553 | |||
| 1074 | Ga0070675_100001661 | |||
| 1075 | Ga0070675_100002764 | |||
| 1076 | Ga0070675_100009557 | |||
| 1077 | Ga0070675_100154937 | |||
| 1078 | Ga0070675_100193655 | |||
| 1079 | Ga0070675_100770332 | |||
| 1080 | Ga0070671_100040591 | |||
| 1081 | Ga0070671_100099236 | |||
| 1082 | Ga0070671_100353757 | |||
| 1083 | Ga0070671_100467457 | |||
| 1084 | Ga0070674_100050713 | |||
| 1085 | Ga0070674_100199681 | |||
| 1086 | Ga0070674_101124385 | |||
| 1087 | Ga0070674_102102307 | |||
| 1088 | Ga0070673_100058178 | |||
| 1089 | Ga0070673_100391728 | |||
| 1090 | Ga0070673_100393515 | |||
| 1091 | Ga0070673_101423427 | |||
| 1092 | Ga0070688_100015175 | |||
| 1093 | Ga0070688_100266703 | |||
| 1094 | Ga0070659_100121361 | |||
| 1095 | Ga0070659_100135133 | |||
| 1096 | Ga0070659_101365979 | |||
| 1097 | Ga0070667_100351372 | |||
| 1098 | Ga0070667_101205299 | |||
| 1099 | Ga0070667_101290710 | |||
| 1100 | Ga0070667_102128324 | |||
| 1101 | Ga0070703_10386841 | |||
| 1102 | Ga0070709_10054487 | |||
| 1103 | Ga0070709_10173725 | |||
| 1104 | Ga0070714_100221021 | |||
| 1105 | Ga0070714_100375234 | |||
| 1106 | Ga0070714_100448572 | |||
| 1107 | Ga0070713_100030808 | |||
| 1108 | Ga0070713_100030943 | |||
| 1109 | Ga0070713_100091302 | |||
| 1110 | Ga0070713_100359837 | |||
| 1111 | Ga0070713_101691965 | |||
| 1112 | Ga0070701_10165847 | |||
| 1113 | Ga0070711_100131091 | |||
| 1114 | Ga0070711_100276675 | |||
| 1115 | Ga0070711_100922915 | |||
| 1116 | Ga0070705_100086266 | |||
| 1117 | Ga0070700_100075919 | |||
| 1118 | Ga0070694_100298920 | |||
| 1119 | Ga0070694_100897850 | |||
| 1120 | Ga0070708_100000024 | |||
| 1121 | Ga0070708_101390621 | |||
| 1122 | Ga0070663_100021686 | |||
| 1123 | Ga0070663_101700365 | |||
| 1124 | Ga0070662_100004241 | |||
| 1125 | Ga0070662_100288355 | |||
| 1126 | Ga0070662_100455325 | |||
| 1127 | Ga0070662_100533070 | |||
| 1128 | Ga0070681_10000119 | |||
| 1129 | Ga0070681_10001192 | |||
| 1130 | Ga0070681_10003947 | |||
| 1131 | Ga0070681_10006844 | |||
| 1132 | Ga0070681_10146904 | |||
| 1133 | Ga0070681_10169947 | |||
| 1134 | Ga0070681_10245758 | |||
| 1135 | Ga0070681_10377191 | |||
| 1136 | Ga0068867_100122006 | |||
| 1137 | Ga0068867_100187485 | |||
| 1138 | Ga0068867_101665022 | |||
| 1139 | Ga0070685_10105725 | |||
| 1140 | Ga0070685_10177782 | |||
| 1141 | Ga0070685_10214523 | |||
| 1142 | Ga0070706_100542603 | |||
| 1143 | Ga0070707_100258878 | |||
| 1144 | Ga0070698_100026323 | |||
| 1145 | Ga0070699_100057715 | |||
| 1146 | Ga0070699_101005482 | |||
| 1147 | Ga0070679_100000066 | |||
| 1148 | Ga0070679_100001382 | |||
| 1149 | Ga0070679_100003354 | |||
| 1150 | Ga0070679_100022174 | |||
| 1151 | Ga0070679_100051426 | |||
| 1152 | Ga0070679_100082331 | |||
| 1153 | Ga0070679_100095999 | |||
| 1154 | Ga0070679_100106723 | |||
| 1155 | Ga0070679_100204195 | |||
| 1156 | Ga0070679_100292261 | |||
| 1157 | Ga0070679_100364889 | |||
| 1158 | Ga0070679_100580905 | |||
| 1159 | Ga0070679_100651309 | |||
| 1160 | Ga0070679_100902328 | |||
| 1161 | Ga0070679_100925204 | |||
| 1162 | Ga0070684_100004002 | |||
| 1163 | Ga0070684_100005381 | |||
| 1164 | Ga0070684_100009052 | |||
| 1165 | Ga0070684_100013493 | |||
| 1166 | Ga0070684_100018173 | |||
| 1167 | Ga0070684_100018757 | |||
| 1168 | Ga0070684_100024204 | |||
| 1169 | Ga0070684_100044388 | |||
| 1170 | Ga0070684_100107664 | |||
| 1171 | Ga0070684_100114541 | |||
| 1172 | Ga0070684_100259482 | |||
| 1173 | Ga0070684_100489475 | |||
| 1174 | Ga0070684_100561297 | |||
| 1175 | Ga0070684_100744035 | |||
| 1176 | Ga0070684_101453818 | |||
| 1177 | Ga0070684_101937115 | |||
| 1178 | Ga0068853_101123433 | |||
| 1179 | Ga0070672_100004646 | |||
| 1180 | Ga0070672_100024942 | |||
| 1181 | Ga0070672_100055813 | |||
| 1182 | Ga0070672_100111109 | |||
| 1183 | Ga0070672_100198072 | |||
| 1184 | Ga0070672_100398899 | |||
| 1185 | Ga0070686_100175943 | |||
| 1186 | Ga0070695_100001852 | |||
| 1187 | Ga0070696_100000107 | |||
| 1188 | Ga0070693_100005385 | |||
| 1189 | Ga0070693_100006308 | |||
| 1190 | Ga0070693_100059733 | |||
| 1191 | Ga0070665_100024001 | |||
| 1192 | Ga0070665_100042373 | |||
| 1193 | Ga0070665_100131887 | |||
| 1194 | Ga0070704_100859033 | |||
| 1195 | Ga0068855_100002271 | |||
| 1196 | Ga0068855_100029474 | |||
| 1197 | Ga0068855_100035463 | |||
| 1198 | Ga0068855_100044173 | |||
| 1199 | Ga0068855_100112581 | |||
| 1200 | Ga0068855_100177339 | |||
| 1201 | Ga0068855_100207201 | |||
| 1202 | Ga0068855_100279104 | |||
| 1203 | Ga0070664_100024285 | |||
| 1204 | Ga0070664_100028779 | |||
| 1205 | Ga0070664_100070686 | |||
| 1206 | Ga0070664_100112948 | |||
| 1207 | Ga0070664_100587712 | |||
| 1208 | Ga0070664_100993477 | |||
| 1209 | Ga0068857_100004704 | |||
| 1210 | Ga0068857_100007641 | |||
| 1211 | Ga0068857_100031506 | |||
| 1212 | Ga0068857_100227703 | |||
| 1213 | Ga0068857_100426635 | |||
| 1214 | Ga0068854_100036943 | |||
| 1215 | Ga0068854_100060899 | |||
| 1216 | Ga0068854_100400284 | |||
| 1217 | Ga0068856_100002006 | |||
| 1218 | Ga0068856_100014375 | |||
| 1219 | Ga0068856_100306661 | |||
| 1220 | Ga0068856_100540809 | |||
| 1221 | Ga0068856_100583622 | |||
| 1222 | Ga0070702_100000558 | |||
| 1223 | Ga0070702_100505854 | |||
| 1224 | Ga0070702_100647727 | |||
| 1225 | Ga0068852_100056243 | |||
| 1226 | Ga0068852_100070498 | |||
| 1227 | Ga0068852_100137233 | |||
| 1228 | Ga0068852_100261243 | |||
| 1229 | Ga0068852_100297469 | |||
| 1230 | Ga0068852_101899728 | |||
| 1231 | Ga0068859_100005085 | |||
| 1232 | Ga0068859_100149005 | |||
| 1233 | Ga0068859_100163144 | |||
| 1234 | Ga0068859_100181353 | |||
| 1235 | Ga0068864_100008399 | |||
| 1236 | Ga0068864_100412577 | |||
| 1237 | Ga0068864_100747008 | |||
| 1238 | Ga0068864_100979167 | |||
| 1239 | Ga0068866_10020415 | |||
| 1240 | Ga0068861_100018071 | |||
| 1241 | Ga0068861_100210345 | |||
| 1242 | Ga0068861_101127837 | |||
| 1243 | Ga0068851_10014534 | |||
| 1244 | Ga0068851_10381733 | |||
| 1245 | Ga0068851_10759847 | |||
| 1246 | Ga0068870_10002264 | |||
| 1247 | Ga0068863_100027989 | |||
| 1248 | Ga0068863_100404912 | |||
| 1249 | Ga0068858_100217157 | |||
| 1250 | Ga0068858_100300978 | |||
| 1251 | Ga0068858_100563195 | |||
| 1252 | Ga0068858_101248404 | |||
| 1253 | Ga0068860_100008276 | |||
| 1254 | Ga0068860_100425592 | |||
| 1255 | Ga0068860_100444386 | |||
| 1256 | Ga0068860_100520186 | |||
| 1257 | Ga0068860_100961318 | |||
| 1258 | Ga0068862_100000563 | |||
| 1259 | Ga0068862_101749494 | |||
| 1260 | Ga0081455_10102484 | |||
| 1261 | Ga0081539_10025928 | |||
| 1262 | Ga0070717_10226216 | |||
| 1263 | Ga0075432_10236554 | |||
| 1264 | Ga0070716_100219679 | |||
| 1265 | Ga0070712_100085162 | |||
| 1266 | Ga0070712_101005185 | |||
| 1267 | Ga0097621_100093902 | |||
| 1268 | Ga0097621_101031780 | |||
| 1269 | Ga0068871_100004583 | |||
| 1270 | Ga0068871_100466846 | |||
| 1271 | Ga0068871_101547865 | |||
| 1272 | Ga0075428_100092576 | |||
| 1273 | Ga0075428_100113741 | |||
| 1274 | Ga0075428_100179897 | |||
| 1275 | Ga0075428_102291204 | |||
| 1276 | Ga0075430_100002009 | |||
| 1277 | Ga0075430_100030641 | |||
| 1278 | Ga0075430_100144063 | |||
| 1279 | Ga0075431_100258154 | |||
| 1280 | Ga0075431_100995824 | |||
| 1281 | Ga0075431_101265898 | |||
| 1282 | Ga0075433_10341834 | |||
| 1283 | Ga0075433_10350794 | |||
| 1284 | Ga0075434_100010409 | |||
| 1285 | Ga0075434_100046915 | |||
| 1286 | Ga0075434_101538784 | |||
| 1287 | Ga0075429_100126334 | |||
| 1288 | Ga0075429_100927824 | |||
| 1289 | Ga0075429_101434138 | |||
| 1290 | Ga0075429_101590640 | |||
| 1291 | Ga0068865_100046810 | |||
| 1292 | Ga0068865_100241507 | |||
| 1293 | Ga0068865_100275189 | |||
| 1294 | Ga0068865_100382634 | |||
| 1295 | Ga0075436_100253759 | |||
| 1296 | Ga0075436_100323121 | |||
| 1297 | Ga0097620_100005085 | |||
| 1298 | Ga0097620_100149011 | |||
| 1299 | Ga0097620_100163145 | |||
| 1300 | Ga0097620_100181353 | |||
| 1301 | Ga0075435_100121689 | |||
| 1302 | Ga0075435_100184411 | |||
| 1303 | Ga0075435_100881385 | |||
| 1304 | Ga0105240_10008352 | |||
| 1305 | Ga0105240_10093779 | |||
| 1306 | Ga0105240_10252842 | |||
| 1307 | Ga0105240_10562426 | |||
| 1308 | Ga0105240_11983360 | |||
| 1309 | Ga0105240_12242666 | |||
| 1310 | Ga0111539_10059089 | |||
| 1311 | Ga0111539_10104303 | |||
| 1312 | Ga0111539_10257248 | |||
| 1313 | Ga0111539_11607006 | |||
| 1314 | Ga0105245_10043332 | |||
| 1315 | Ga0105245_10253328 | |||
| 1316 | Ga0105245_10416074 | |||
| 1317 | Ga0105247_10720607 | |||
| 1318 | Ga0114129_10185082 | |||
| 1319 | Ga0114129_10503412 | |||
| 1320 | Ga0114129_10693441 | |||
| 1321 | Ga0114129_13076773 | |||
| 1322 | Ga0105243_10746736 | |||
| 1323 | Ga0105241_10088523 | |||
| 1324 | Ga0105241_12126452 | |||
| 1325 | Ga0105242_10019013 | |||
| 1326 | Ga0105242_10030994 | |||
| 1327 | Ga0105242_11960803 | |||
| 1328 | Ga0105248_10003619 | |||
| 1329 | Ga0105248_10297188 | |||
| 1330 | Ga0105248_10446995 | |||
| 1331 | Ga0105248_11362782 | |||
| 1332 | Ga0105248_11762419 | |||
| 1333 | Ga0105248_11762422 | |||
| 1334 | Ga0105237_10288517 | |||
| 1335 | Ga0105237_10294259 | |||
| 1336 | Ga0105238_10094974 | |||
| 1337 | Ga0105238_10426134 | |||
| 1338 | Ga0105238_11639692 | |||
| 1339 | Ga0105249_10000662 | |||
| 1340 | Ga0105249_10005645 | |||
| 1341 | Ga0105249_10231719 | |||
| 1342 | Ga0105249_10525725 | |||
| 1343 | Ga0105239_10020462 | |||
| 1344 | Ga0105239_10201718 | |||
| 1345 | Ga0105246_10003077 | |||
| 1346 | Ga0105246_10488226 | |||
| 1347 | Ga0105246_12322269 | |||
| 1348 | Ga0157373_10362135 | |||
| 1349 | Ga0157373_10617030 | |||
| 1350 | Ga0157371_10019008 | |||
| 1351 | Ga0157370_10006918 | |||
| 1352 | Ga0157370_10071438 | |||
| 1353 | Ga0157370_10177717 | |||
| 1354 | Ga0157370_10254104 | |||
| 1355 | Ga0157370_10814751 | |||
| 1356 | Ga0157370_11294331 | |||
| 1357 | Ga0157370_11676993 | |||
| 1358 | Ga0157369_10016784 | |||
| 1359 | Ga0157369_10064963 | |||
| 1360 | Ga0157369_10114736 | |||
| 1361 | Ga0157369_10157391 | |||
| 1362 | Ga0157369_10415708 | |||
| 1363 | Ga0157369_10534031 | |||
| 1364 | Ga0157369_11476352 | |||
| 1365 | Ga0157374_10124192 | |||
| 1366 | Ga0157374_10731429 | |||
| 1367 | Ga0157374_10732424 | |||
| 1368 | Ga0157374_11176938 | |||
| 1369 | Ga0157378_10420716 | |||
| 1370 | Ga0157378_11749135 | |||
| 1371 | Ga0157378_12272852 | |||
| 1372 | Ga0163162_10025388 | |||
| 1373 | Ga0163162_12116313 | |||
| 1374 | Ga0157372_10009596 | |||
| 1375 | Ga0157372_10048721 | |||
| 1376 | Ga0157372_10276622 | |||
| 1377 | Ga0157372_10285001 | |||
| 1378 | Ga0157372_10613637 | |||
| 1379 | Ga0157372_11390943 | |||
| 1380 | Ga0157372_11554840 | |||
| 1381 | Ga0157375_10013241 | |||
| 1382 | Ga0157375_10048547 | |||
| 1383 | Ga0157375_10051129 | |||
| 1384 | Ga0157375_10182808 | |||
| 1385 | Ga0163163_10005601 | |||
| 1386 | Ga0163163_10022697 | |||
| 1387 | Ga0163163_12491909 | |||
| 1388 | Ga0163163_13245102 | |||
| 1389 | Ga0157380_10013451 | |||
| 1390 | Ga0157380_10425188 | |||
| 1391 | Ga0157377_10824664 | |||
| 1392 | Ga0157376_10012034 | |||
| 1393 | Ga0163161_10005930 | |||
| 1394 | Ga0197907_10726826 | |||
| 1395 | Ga0206352_11082439 | |||
| 1396 | Ga0206353_10541956 | |||
| 1397 | Ga0213876_10001912 | |||
| 1398 | Ga0213876_10022865 | |||
| 1399 | Ga0213876_10093938 | |||
| 1400 | Ga0207697_10018619 | |||
| 1401 | Ga0207656_10042548 | |||
| 1402 | Ga0207656_10139904 | |||
| 1403 | Ga0207692_10321723 | |||
| 1404 | Ga0207692_10394304 | |||
| 1405 | Ga0207692_10496671 | |||
| 1406 | Ga0207642_10044176 | |||
| 1407 | Ga0207680_10597216 | |||
| 1408 | Ga0207647_10573406 | |||
| 1409 | Ga0207685_10856839 | |||
| 1410 | Ga0207699_10009835 | |||
| 1411 | Ga0207645_10006068 | |||
| 1412 | Ga0207645_10123635 | |||
| 1413 | Ga0207645_10162494 | |||
| 1414 | Ga0207645_10449847 | |||
| 1415 | Ga0207643_10005373 | |||
| 1416 | Ga0207643_10496023 | |||
| 1417 | Ga0207705_10005450 | |||
| 1418 | Ga0207705_10112688 | |||
| 1419 | Ga0207705_10527532 | |||
| 1420 | Ga0207705_10670235 | |||
| 1421 | Ga0207705_10791389 | |||
| 1422 | Ga0207705_11402422 | |||
| 1423 | Ga0207654_10017653 | |||
| 1424 | Ga0207707_10001516 | |||
| 1425 | Ga0207707_10002653 | |||
| 1426 | Ga0207707_10003275 | |||
| 1427 | Ga0207707_10004812 | |||
| 1428 | Ga0207707_10038608 | |||
| 1429 | Ga0207707_10075922 | |||
| 1430 | Ga0207707_10314016 | |||
| 1431 | Ga0207707_10333666 | |||
| 1432 | Ga0207707_10630127 | |||
| 1433 | Ga0207707_10967488 | |||
| 1434 | Ga0207695_10002624 | |||
| 1435 | Ga0207695_10008489 | |||
| 1436 | Ga0207695_10079773 | |||
| 1437 | Ga0207695_10292286 | |||
| 1438 | Ga0207695_10958223 | |||
| 1439 | Ga0207693_10004234 | |||
| 1440 | Ga0207693_10075408 | |||
| 1441 | Ga0207693_10515634 | |||
| 1442 | Ga0207663_10342088 | |||
| 1443 | Ga0207663_10363882 | |||
| 1444 | Ga0207663_10786914 | |||
| 1445 | Ga0207663_10836416 | |||
| 1446 | Ga0207660_10000015 | |||
| 1447 | Ga0207660_10001459 | |||
| 1448 | Ga0207660_10003814 | |||
| 1449 | Ga0207660_10007775 | |||
| 1450 | Ga0207660_10026745 | |||
| 1451 | Ga0207660_10028138 | |||
| 1452 | Ga0207660_10052558 | |||
| 1453 | Ga0207660_10524409 | |||
| 1454 | Ga0207660_11443450 | |||
| 1455 | Ga0207662_10001456 | |||
| 1456 | Ga0207662_10120510 | |||
| 1457 | Ga0207662_10134332 | |||
| 1458 | Ga0207662_10762752 | |||
| 1459 | Ga0207657_10006253 | |||
| 1460 | Ga0207657_10019361 | |||
| 1461 | Ga0207657_10282228 | |||
| 1462 | Ga0207657_10387631 | |||
| 1463 | Ga0207657_10863599 | |||
| 1464 | Ga0207649_10004268 | |||
| 1465 | Ga0207649_10018741 | |||
| 1466 | Ga0207649_10040118 | |||
| 1467 | Ga0207649_10089698 | |||
| 1468 | Ga0207652_10000184 | |||
| 1469 | Ga0207652_10002383 | |||
| 1470 | Ga0207652_10012115 | |||
| 1471 | Ga0207652_10014510 | |||
| 1472 | Ga0207652_10036295 | |||
| 1473 | Ga0207652_10234777 | |||
| 1474 | Ga0207652_10317459 | |||
| 1475 | Ga0207652_10555086 | |||
| 1476 | Ga0207652_11186305 | |||
| 1477 | Ga0207652_11493103 | |||
| 1478 | Ga0207652_11663911 | |||
| 1479 | Ga0207681_10008681 | |||
| 1480 | Ga0207681_10037843 | |||
| 1481 | Ga0207681_10329779 | |||
| 1482 | Ga0207681_10622847 | |||
| 1483 | Ga0207694_10479143 | |||
| 1484 | Ga0207650_10054126 | |||
| 1485 | Ga0207650_10141914 | |||
| 1486 | Ga0207650_10194831 | |||
| 1487 | Ga0207659_10019929 | |||
| 1488 | Ga0207659_10020893 | |||
| 1489 | Ga0207659_10069935 | |||
| 1490 | Ga0207659_10076638 | |||
| 1491 | Ga0207687_10019639 | |||
| 1492 | Ga0207687_10448826 | |||
| 1493 | Ga0207687_11368447 | |||
| 1494 | Ga0207700_10011250 | |||
| 1495 | Ga0207700_10088125 | |||
| 1496 | Ga0207700_10298730 | |||
| 1497 | Ga0207700_10341538 | |||
| 1498 | Ga0207664_10144254 | |||
| 1499 | Ga0207664_10916843 | |||
| 1500 | Ga0207644_10036812 | |||
| 1501 | Ga0207644_10125762 | |||
| 1502 | Ga0207644_10148129 | |||
| 1503 | Ga0207644_10279859 | |||
| 1504 | Ga0207644_10924711 | |||
| 1505 | Ga0207690_10129961 | |||
| 1506 | Ga0207690_10643128 | |||
| 1507 | Ga0207690_10889282 | |||
| 1508 | Ga0207706_10000155 | |||
| 1509 | Ga0207706_10116253 | |||
| 1510 | Ga0207706_10158414 | |||
| 1511 | Ga0207706_10288781 | |||
| 1512 | Ga0207686_10049547 | |||
| 1513 | Ga0207686_10213318 | |||
| 1514 | Ga0207686_10871248 | |||
| 1515 | Ga0207670_10280588 | |||
| 1516 | Ga0207670_10705747 | |||
| 1517 | Ga0207669_10073921 | |||
| 1518 | Ga0207669_10185705 | |||
| 1519 | Ga0207669_10229065 | |||
| 1520 | Ga0207669_10625112 | |||
| 1521 | Ga0207704_10138206 | |||
| 1522 | Ga0207704_10145296 | |||
| 1523 | Ga0207704_10507694 | |||
| 1524 | Ga0207665_10406610 | |||
| 1525 | Ga0207691_10001667 | |||
| 1526 | Ga0207691_10002873 | |||
| 1527 | Ga0207691_10051864 | |||
| 1528 | Ga0207691_10139020 | |||
| 1529 | Ga0207691_11122477 | |||
| 1530 | Ga0207711_10757893 | |||
| 1531 | Ga0207711_11502106 | |||
| 1532 | Ga0207711_11882489 | |||
| 1533 | Ga0207689_10002528 | |||
| 1534 | Ga0207689_10026578 | |||
| 1535 | Ga0207661_10001218 | |||
| 1536 | Ga0207661_10001484 | |||
| 1537 | Ga0207661_10004594 | |||
| 1538 | Ga0207661_10004649 | |||
| 1539 | Ga0207661_10011055 | |||
| 1540 | Ga0207661_10019812 | |||
| 1541 | Ga0207661_10056723 | |||
| 1542 | Ga0207661_10057672 | |||
| 1543 | Ga0207661_10086825 | |||
| 1544 | Ga0207661_10089726 | |||
| 1545 | Ga0207661_10202010 | |||
| 1546 | Ga0207661_10280904 | |||
| 1547 | Ga0207661_10619201 | |||
| 1548 | Ga0207661_10632104 | |||
| 1549 | Ga0207661_10693848 | |||
| 1550 | Ga0207661_10840032 | |||
| 1551 | Ga0207661_10876169 | |||
| 1552 | Ga0207661_11809068 | |||
| 1553 | Ga0207679_10001557 | |||
| 1554 | Ga0207679_10002457 | |||
| 1555 | Ga0207679_10032647 | |||
| 1556 | Ga0207679_10046534 | |||
| 1557 | Ga0207679_10050550 | |||
| 1558 | Ga0207679_10146929 | |||
| 1559 | Ga0207667_10001901 | |||
| 1560 | Ga0207667_10033607 | |||
| 1561 | Ga0207667_10040067 | |||
| 1562 | Ga0207667_10049996 | |||
| 1563 | Ga0207667_10082007 | |||
| 1564 | Ga0207667_10176894 | |||
| 1565 | Ga0207667_10250655 | |||
| 1566 | Ga0207667_10476486 | |||
| 1567 | Ga0207651_10108725 | |||
| 1568 | Ga0207651_10258539 | |||
| 1569 | Ga0207651_10463646 | |||
| 1570 | Ga0207712_10006052 | |||
| 1571 | Ga0207712_10006933 | |||
| 1572 | Ga0207712_10167280 | |||
| 1573 | Ga0207668_10004444 | |||
| 1574 | Ga0207668_10011351 | |||
| 1575 | Ga0207668_11162267 | |||
| 1576 | Ga0207640_10000855 | |||
| 1577 | Ga0207640_10086429 | |||
| 1578 | Ga0207640_10458805 | |||
| 1579 | Ga0207658_10089769 | |||
| 1580 | Ga0207658_10226104 | |||
| 1581 | Ga0207677_10012944 | |||
| 1582 | Ga0207677_10098817 | |||
| 1583 | Ga0207677_10676275 | |||
| 1584 | Ga0207703_10031029 | |||
| 1585 | Ga0207703_10343474 | |||
| 1586 | Ga0207703_10369089 | |||
| 1587 | Ga0207703_10427283 | |||
| 1588 | Ga0207639_10544287 | |||
| 1589 | Ga0207639_10647510 | |||
| 1590 | Ga0207639_11576363 | |||
| 1591 | Ga0207678_10000599 | |||
| 1592 | Ga0207678_10016108 | |||
| 1593 | Ga0207678_10735244 | |||
| 1594 | Ga0207708_10283676 | |||
| 1595 | Ga0207702_10004386 | |||
| 1596 | Ga0207702_10029854 | |||
| 1597 | Ga0207702_10258013 | |||
| 1598 | Ga0207702_10342502 | |||
| 1599 | Ga0207641_10006591 | |||
| 1600 | Ga0207641_10292521 | |||
| 1601 | Ga0207641_10394327 | |||
| 1602 | Ga0207641_11715897 | |||
| 1603 | Ga0207641_11830717 | |||
| 1604 | Ga0207648_10065900 | |||
| 1605 | Ga0207648_10246714 | |||
| 1606 | Ga0207648_10355401 | |||
| 1607 | Ga0207648_10879672 | |||
| 1608 | Ga0207676_10002872 | |||
| 1609 | Ga0207676_10089456 | |||
| 1610 | Ga0207676_10970484 | |||
| 1611 | Ga0207676_11586543 | |||
| 1612 | Ga0207674_10000809 | |||
| 1613 | Ga0207674_10001550 | |||
| 1614 | Ga0207674_10001551 | |||
| 1615 | Ga0207674_10017983 | |||
| 1616 | Ga0207674_10215512 | |||
| 1617 | Ga0207674_10333841 | |||
| 1618 | Ga0207675_100001026 | |||
| 1619 | Ga0207675_100027744 | |||
| 1620 | Ga0207675_100597011 | |||
| 1621 | Ga0207675_101181945 | |||
| 1622 | Ga0207675_102145828 | |||
| 1623 | Ga0207683_10547854 | |||
| 1624 | Ga0207698_10043855 | |||
| 1625 | Ga0207698_10111950 | |||
| 1626 | Ga0207698_10120689 | |||
| 1627 | Ga0207698_10360190 | |||
| 1628 | Ga0207698_10846827 | |||
| 1629 | Ga0207428_10339844 | |||
| 1630 | Ga0207428_11249476 | |||
| 1631 | Ga0268266_10529570 | |||
| 1632 | Ga0268266_10558907 | |||
| 1633 | Ga0268266_11632600 | |||
| 1634 | Ga0268265_10003561 | |||
| 1635 | Ga0268265_10025393 | |||
| 1636 | Ga0268264_10080463 | |||
| 1637 | Ga0268264_10295360 | |||
| 1638 | Ga0316182_1300009 | |||
| 1639 | Ga0307408_100007301 | |||
| 1640 | Ga0307408_100007627 | |||
| 1641 | Ga0307408_100015459 | |||
| 1642 | Ga0307408_100030814 | |||
| 1643 | Ga0307408_100038412 | |||
| 1644 | Ga0307408_100066551 | |||
| 1645 | Ga0307408_101270954 | |||
| 1646 | Ga0307405_10000555 | |||
| 1647 | Ga0307405_10000716 | |||
| 1648 | Ga0307405_10010082 | |||
| 1649 | Ga0307405_10018218 | |||
| 1650 | Ga0307405_10230220 | |||
| 1651 | Ga0307405_10986500 | |||
| 1652 | Ga0307413_10000588 | |||
| 1653 | Ga0307413_10007247 | |||
| 1654 | Ga0307413_10017348 | |||
| 1655 | Ga0307413_10045631 | |||
| 1656 | Ga0307413_10118010 | |||
| 1657 | Ga0307413_10645044 | |||
| 1658 | Ga0307413_10728899 | |||
| 1659 | Ga0307413_11282263 | |||
| 1660 | Ga0307410_10023857 | |||
| 1661 | Ga0307410_10032229 | |||
| 1662 | Ga0307410_10116608 | |||
| 1663 | Ga0307410_10277727 | |||
| 1664 | Ga0307410_11121054 | |||
| 1665 | Ga0307410_11131310 | |||
| 1666 | Ga0307406_10014247 | |||
| 1667 | Ga0307406_10030153 | |||
| 1668 | Ga0307406_10076492 | |||
| 1669 | Ga0307406_10125018 | |||
| 1670 | Ga0307406_10235175 | |||
| 1671 | Ga0307406_10864436 | |||
| 1672 | Ga0307407_10000905 | |||
| 1673 | Ga0307407_10001245 | |||
| 1674 | Ga0307407_10027406 | |||
| 1675 | Ga0307407_10046125 | |||
| 1676 | Ga0307407_10083257 | |||
| 1677 | Ga0307407_10090777 | |||
| 1678 | Ga0307407_10134783 | |||
| 1679 | Ga0307407_10413324 | |||
| 1680 | Ga0307407_10483680 | |||
| 1681 | Ga0307407_10687125 | |||
| 1682 | Ga0307407_11312343 | |||
| 1683 | Ga0307407_11440268 | |||
| 1684 | Ga0307412_10003493 | |||
| 1685 | Ga0307412_10008514 | |||
| 1686 | Ga0307412_10010351 | |||
| 1687 | Ga0307412_10435197 | |||
| 1688 | Ga0307412_10451443 | |||
| 1689 | Ga0307412_10564312 | |||
| 1690 | Ga0307412_10833493 | |||
| 1691 | Ga0307409_100000084 | |||
| 1692 | Ga0307409_100020768 | |||
| 1693 | Ga0307409_100053080 | |||
| 1694 | Ga0307409_100060427 | |||
| 1695 | Ga0307409_100288071 | |||
| 1696 | Ga0307409_100865716 | |||
| 1697 | Ga0307409_101082266 | |||
| 1698 | Ga0307416_100000582 | |||
| 1699 | Ga0307416_100012575 | |||
| 1700 | Ga0307416_100077208 | |||
| 1701 | Ga0307416_100099356 | |||
| 1702 | Ga0307416_100456172 | |||
| 1703 | Ga0307416_100696835 | |||
| 1704 | Ga0307416_100737684 | |||
| 1705 | Ga0307416_101262729 | |||
| 1706 | Ga0307414_10004059 | |||
| 1707 | Ga0307414_10014529 | |||
| 1708 | Ga0307414_10022555 | |||
| 1709 | Ga0307414_10191270 | |||
| 1710 | Ga0307414_10331842 | |||
| 1711 | Ga0307414_10821010 | |||
| 1712 | Ga0307414_11207903 | |||
| 1713 | Ga0307411_10000070 | |||
| 1714 | Ga0307411_10000266 | |||
| 1715 | Ga0307411_10000464 | |||
| 1716 | Ga0307411_10204686 | |||
| 1717 | Ga0307411_10258591 | |||
| 1718 | Ga0307411_10651967 | |||
| 1719 | Ga0307415_100000761 | |||
| 1720 | Ga0307415_100009913 | |||
| 1721 | Ga0307415_100012688 | |||
| 1722 | Ga0307415_100015722 | |||
| 1723 | Ga0307415_100023890 | |||
| 1724 | Ga0307415_100191538 | |||
| 1725 | Ga0307415_100344899 | |||
| 1726 | Ga0307415_102223110 | |||
| 1727 | Ga0373930_0017809 | |||
| 1728 | Ga0373958_0020215 | |||
| 1729 | Ga0373926_0000731 | |||
| 1730 | Ga0373928_0157749 | |||
| 1731 | Ga0373934_0002803 | |||
| 1732 | Ga0373934_0005416 | |||
| 1733 | Ga0373934_0038278 | |||
| 1734 | Ga0373944_0003960 | |||
| 1735 | Ga0373949_0276157 | |||
| 1736 | Ga0373923_0029407 | |||
| 1737 | Ga0373923_0431343 | |||
| 1738 | Ga0373936_0016227 | |||
| 1739 | Ga0373936_0279750 | |||
| 1740 | Ga0373945_0028758 | |||
| 1741 | Ga0373945_0230591 | |||
| 1742 | Ga0373953_0060636 | |||
| 1743 | Ga0373954_0043444 | |||
| 1744 | Ga0373954_0053079 | |||
| 1745 | Ga0373954_0076903 | |||
| 1746 | Ga0373956_0028816 | |||
| 1747 | Ga0373956_0256509 | |||
| 1748 | Ga0373957_0026351 | |||
| 1749 | Ga0373960_0063195 | |||
| 1750 | Ga0373943_0006602 | |||
| 1751 | Ga0373943_0101543 | |||
| 1752 | Ga0373943_0595148 | |||
| 1753 | Ga0373946_0003748 | |||
| 1754 | Ga0373946_0625829 | |||
| 1755 | Ga0373955_0080512 | |||
| 1756 | Ga0373955_0381314 | |||
| 1757 | Ga0373962_0098266 | |||
| 1758 | Ga0373962_0375562 | |||
| 1759 | Ga0373924_0115105 | |||
| 1760 | Ga0373924_0337664 | |||
| 1761 | Ga0373931_0062432 | |||
| 1762 | Ga0373935_0008417 | |||
| 1763 | Ga0373935_0324839 | |||
| 1764 | Ga0373935_0701475 | |||
| 1765 | Ga0373927_0008404 | |||
| 1766 | Ga0373927_0030770 | |||
| 1767 | Ga0373927_0176367 | |||
| 1768 | Ga0373933_0009104 | |||
| 1769 | Ga0373933_0062452 | |||
| 1770 | Ga0373933_0084571 | |||
| 1771 | Ga0373947_0002620 | |||
| 1772 | Ga0373947_0368623 | |||
| 1773 | Ga0373947_0664772 | |||
| 1774 | Ga0373947_0732707 | |||
| 1775 | Ga0373937_0000920 | |||
| 1776 | Ga0373937_0033999 | |||
| 1777 | Ga0373937_0149749 | |||
| 1778 | Ga0373937_0424720 | |||
| 1779 | Ga0373937_1394624 | |||
| 1780 | Ga0373925_0002987 | |||
| 1781 | Ga0373925_0123997 | |||
| 1782 | Ga0373925_1080594 | |||
| 1783 | Ga0373925_1730911 | |||
| 1784 | Ga0395899_0033159 | |||
| 1785 | Ga0395905_0004652 | |||
| 1786 | Ga0395905_0149430 | |||
| 1787 | Ga0395901_0005373 | |||
| 1788 | Ga0436365_0164142 | |||
| 1789 | Ga0436365_0382940 | |||
| 1790 | Ga0436365_0557665 | |||
| 1791 | Ga0436365_1631599 | |||
| 1792 | Ga0439439_0031717 | |||
| 1793 | Ga0450895_029278 | |||
| 1794 | Ga0451577_0000001 | |||
| 1795 | Ga0466969_0141879 | |||
| 1796 | Ga0466965_0198325 | |||
| 1797 | Ga0466966_0011886 | |||
| 1798 | Ga0466961_0346223 | |||
| 1799 | Ga0466971_0298743 | |||
| 1800 | Ga0466957_0130132 | |||
| 1801 | Ga0466957_0442932 | |||
| 1802 | Ga0466957_0517363 | |||
| 1803 | Ga0466959_0040470 | |||
| 1804 | Ga0451576_0055803 | |||
| 1805 | Ga0451576_0276497 | |||
| 1806 | Ga0451576_0391300 | |||
| 1807 | Ga0451576_0655212 | |||
| 1808 | Ga0466958_0535409 | |||
| 1809 | Ga0466967_0056646 | |||
| 1810 | Ga0466967_0255342 | |||
| 1811 | Ga0466967_0604856 | |||
| 1812 | Ga0466967_1015998 | |||
| 1813 | Ga0466967_1587697 | |||
| 1814 | Ga0466967_1773225 | |||
| 1815 | Ga0466967_1817781 | |||
| 1816 | Ga0495592_0257222 | |||
| 1817 | Ga0495603_0002982 | |||
| 1818 | Ga0495629_0039952 | |||
| 1819 | Ga0495629_0155454 | |||
| 1820 | Ga0495629_0347489 | |||
| 1821 | Ga0495638_0240635 | |||
| 1822 | Ga0495651_0073556 | |||
| 1823 | Ga0495651_0225112 | |||
| 1824 | Ga0495651_0566988 | |||
| 1825 | Ga0495653_0024876 | |||
| 1826 | Ga0495653_0230975 | |||
| 1827 | Ga0495580_0005679 | |||
| 1828 | Ga0495580_0028551 | |||
| 1829 | Ga0495580_0077080 | |||
| 1830 | Ga0495580_0294492 | |||
| 1831 | Ga0495582_0005504 | |||
| 1832 | Ga0495582_0009433 | |||
| 1833 | Ga0495582_0030283 | |||
| 1834 | Ga0495582_0050168 | |||
| 1835 | Ga0495639_0000704 | |||
| 1836 | Ga0495639_0017820 | |||
| 1837 | Ga0495639_0020610 | |||
| 1838 | Ga0495639_0121391 | |||
| 1839 | Ga0495662_0157871 | |||
| 1840 | Ga0495664_0018129 | |||
| 1841 | Ga0495664_0020162 | |||
| 1842 | Ga0495594_0008344 | |||
| 1843 | Ga0495594_0042092 | |||
| 1844 | Ga0495594_0063694 | |||
| 1845 | Ga0495594_0122584 | |||
| 1846 | Ga0495594_0170187 | |||
| 1847 | Ga0495594_0208334 | |||
| 1848 | Ga0495583_0432504 | |||
| 1849 | Ga0495608_0054704 | |||
| 1850 | Ga0495608_0198297 | |||
| 1851 | Ga0495618_0062510 | |||
| 1852 | Ga0495618_0342577 | |||
| 1853 | Ga0495628_0005937 | |||
| 1854 | Ga0495628_0028438 | |||
| 1855 | Ga0495628_0099546 | |||
| 1856 | Ga0495630_0011249 | |||
| 1857 | Ga0495630_0014259 | |||
| 1858 | Ga0495630_0049255 | |||
| 1859 | Ga0495630_0148847 | |||
| 1860 | Ga0495666_0028263 | |||
| 1861 | Ga0495652_0016375 | |||
| 1862 | Ga0495652_0095286 | |||
| 1863 | Ga0495652_0389631 | |||
| 1864 | Ga0495665_0001067 | |||
| 1865 | Ga0495665_0009112 | |||
| 1866 | Ga0495665_0043714 | |||
| 1867 | Ga0495665_0056079 | |||
| 1868 | Ga0495665_0134220 | |||
| 1869 | Ga0495640_0105197 | |||
| 1870 | Ga0495640_0110048 | |||
| 1871 | Ga0495640_0560091 | |||
| 1872 | Ga0495586_0007235 | |||
| 1873 | Ga0495586_0026809 | |||
| 1874 | Ga0495586_0112724 | |||
| 1875 | Ga0495586_0175254 | |||
| 1876 | Ga0495587_0000778 | |||
| 1877 | Ga0495587_0013473 | |||
| 1878 | Ga0495645_0000693 | |||
| 1879 | Ga0495645_0055755 | |||
| 1880 | Ga0495645_0077562 | |||
| 1881 | Ga0495667_0002391 | |||
| 1882 | Ga0495667_0004170 | |||
| 1883 | Ga0495667_0067029 | |||
| 1884 | Ga0495667_0107442 | |||
| 1885 | Ga0495634_0203966 | |||
| 1886 | Ga0495634_0435633 | |||
| 1887 | Ga0495635_0077311 | |||
| 1888 | Ga0495635_0137549 | |||
| 1889 | Ga0495635_0203948 | |||
| 1890 | Ga0495659_0103394 | |||
| 1891 | Ga0495588_0001415 | |||
| 1892 | Ga0495657_0037580 | |||
| 1893 | Ga0495657_0118245 | |||
| 1894 | Ga0495657_0390013 | |||
| 1895 | Ga0495599_0004117 | |||
| 1896 | Ga0495599_0007818 | |||
| 1897 | Ga0495599_0013143 | |||
| 1898 | Ga0495599_0039663 | |||
| 1899 | Ga0495599_0547115 | |||
| 1900 | Ga0495623_0002993 | |||
| 1901 | Ga0495623_0057341 | |||
| 1902 | Ga0495623_0063340 | |||
| 1903 | Ga0495646_0022193 | |||
| 1904 | Ga0495646_0054639 | |||
| 1905 | Ga0495647_0018198 | |||
| 1906 | Ga0495658_0001668 | |||
| 1907 | Ga0495658_0009450 | |||
| 1908 | Ga0495658_0052737 | |||
| 1909 | Ga0495658_0086483 | |||
| 1910 | Ga0495658_0277926 | |||
| 1911 | Ga0495613_0005287 | |||
| 1912 | Ga0495613_0161297 | |||
| 1913 | Ga0495613_0203897 | |||
| 1914 | Ga0495613_0347750 | |||
| 1915 | Ga0495600_0003030 | |||
| 1916 | Ga0495600_0100075 | |||
| 1917 | Ga0495581_0000809 | |||
| 1918 | Ga0495581_0040872 | |||
| 1919 | Ga0495581_0090604 | |||
| 1920 | Ga0495581_0329640 | |||
| 1921 | Ga0495604_0005420 | |||
| 1922 | Ga0495604_0109056 | |||
| 1923 | Ga0495604_0215386 | |||
| 1924 | Ga0495636_0014162 | |||
| 1925 | Ga0495636_0248711 | |||
| 1926 | Ga0495674_0026894 | |||
| 1927 | Ga0495674_0222365 | |||
| 1928 | Ga0495674_0981607 | |||
| 1929 | Ga0495680_0081361 | |||
| 1930 | Ga0495680_0778875 | |||
| 1931 | Ga0495680_0908841 | |||
| 1932 | Ga0495675_0007063 | |||
| 1933 | Ga0495675_0014647 | |||
| 1934 | Ga0495675_0022648 | |||
| 1935 | Ga0495675_0046723 | |||
| 1936 | Ga0495675_0370253 | |||
| 1937 | Ga0495677_0203892 | |||
| 1938 | Ga0495684_0005933 | |||
| 1939 | Ga0495684_0078334 | |||
| 1940 | Ga0495684_0100031 | |||
| 1941 | Ga0495593_0002738 | |||
| 1942 | Ga0495593_0147872 | |||
| 1943 | Ga0495602_0003786 | |||
| 1944 | Ga0495602_0038810 | |||
| 1945 | Ga0495614_0000708 | |||
| 1946 | Ga0496105_0040012 | |||
| 1947 | Ga0496106_0794497 | |||
| 1948 | Ga0496108_0149253 | |||
| 1949 | Ga0496108_0228326 | |||
| 1950 | Ga0496110_0165529 | |||
| 1951 | Ga0496112_0021609 | |||
| 1952 | Ga0496112_0932052 | |||
| 1953 | Ga0496113_0240167 | |||
| 1954 | Ga0496113_0666729 | |||
| 1955 | Ga0501291_147775 | |||
| 1956 | Ga0501297_033491 | |||
| 1957 | Ga0501303_064748 | |||
| 1958 | Ga0501033_0005653 | |||
| 1959 | Ga0501033_0887971 | |||
| 1960 | Ga0501034_0003782 | |||
| 1961 | Ga0501034_0847520 | |||
| 1962 | Ga0501037_0119222 | |||
| 1963 | Ga0501037_0641028 | |||
| 1964 | Ga0501038_0022503 | |||
| 1965 | Ga0501038_1093391 | |||
| 1966 | Ga0501043_0500052 | |||
| 1967 | Ga0501047_0028977 | |||
| 1968 | Ga0501047_0331201 | |||
| 1969 | Ga0501070_0056463 | |||
| 1970 | Ga0501070_0676416 | |||
| 1971 | Ga0501073_0073029 | |||
| 1972 | Ga0501076_0407172 | |||
| 1973 | Ga0501233_270351 | |||
| 1974 | Ga0501235_234369 | |||
| 1975 | Ga0501243_075548 | |||
| 1976 | Ga0501249_194440 | |||
| 1977 | Ga0501255_038730 | |||
| 1978 | Ga0501225_0194827 | |||
| 1979 | Ga0501229_057486 | |||
| 1980 | Ga0501268_081768 | |||
| 1981 | Ga0501035_0075368 | |||
| 1982 | Ga0501044_0004890 | |||
| 1983 | Ga0501044_0711529 | |||
| 1984 | Ga0501044_0900121 | |||
| 1985 | nmdc:mga05p37_2013510_c1 | |||
| 1986 | nmdc:mga05p37_372174_c1 | |||
| 1987 | nmdc:mga09592_1264139_c1 | |||
| 1988 | nmdc:mga09592_17168_c1 | |||
| 1989 | nmdc:mga09592_289428_c1 | |||
| 1990 | nmdc:mga09592_590340_c1 | |||
| 1991 | nmdc:mga0qj67_156649_c1 | |||
| 1992 | nmdc:mga0qj67_3124_c1 | |||
| 1993 | nmdc:mga0qj67_41364_c1 | |||
| 1994 | nmdc:mga06r32_1064804_c1 | |||
| 1995 | nmdc:mga06r32_1222605_c1 | |||
| 1996 | nmdc:mga06r32_254767_c1 | |||
| 1997 | nmdc:mga06r32_54786_c1 | |||
| 1998 | nmdc:mga06r32_627717_c1 | |||
| 1999 | nmdc:mga06r32_967020_c1 | |||
| 2000 | nmdc:mga08y16_2027641_c1 | |||
| 2001 | nmdc:mga08y16_62586_c1 | |||
| 2002 | nmdc:mga08y16_907469_c1 | |||
| 2003 | nmdc:mga0n895_48397_c1 | |||
| 2004 | nmdc:mga0rr50_155565_c1 | |||
| 2005 | nmdc:mga0rr50_1749892_c1 | |||
| 2006 | nmdc:mga08x19_364364_c1 | |||
| 2007 | nmdc:mga08x19_421724_c1 | |||
| 2008 | nmdc:mga0a205_550671_c1 | |||
| 2009 | Ga0495601_0081842 | |||
| 2010 | Ga0495612_0042344 | |||
| 2011 | Ga0495595_0020340 | |||
| 2012 | Ga0495619_0053792 | |||
| 2013 | Ga0495619_0409331 | |||
| 2014 | Ga0590074_064157 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eya-assembly1.cif.gz_A | crystal structure of a plectonemic rna supercoil | 0.9149 | 2 | 119 |
| 3r2d-assembly1.cif.gz_A | crystal structure of antitermination factors nusb and nuse in complex with dsrna | 0.9115 | 2 | 118 |
| 1tzx-assembly2.cif.gz_B | t. maritima nusb, p3221 | 0.9091 | 2 | 117 |
| 4eya-assembly1.cif.gz_A | crystal structure of a plectonemic rna supercoil | 0.8799 | 2 | 119 |
| 5lm7-assembly2.cif.gz_D | crystal structure of the lambda n-nus factor complex | 0.8625 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eyaA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9149 | 2 | 119 | 1.10.940.10 |
| 3r2cB00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9128 | 2 | 118 | 1.10.940.10 |
| 1tztA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9084 | 2 | 117 | 1.10.940.10 |
| 4eyaA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8799 | 2 | 119 | 1.10.940.10 |
| 3r2cB00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.871 | 2 | 118 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7T242-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9803 | 2 | 122 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A257RU23-F1-model_v4 | Transcription antitermination factor NusB | 0.9746 | 9 | 122 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A838NSB4-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9675 | 2 | 122 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A353CA03-F1-model_v4 | Transcription antitermination factor NusB | 0.967 | 42 | 120 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A0C1ZQB4-F1-model_v4 | Transcription termination protein NusB | 0.9655 | 36 | 118 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |