F488002

General Info

Members Datasets Scaffolds Average Seq Length
1006 651 629 251

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1012258|Ga0058692_10122583
Length 269
Sequence LSSGQDGNTPAQSMWIGIISLFPEMFSAITEYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQVGVCELATSEKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGKQASAEEDSFSEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQAKLLKEFQKEFRRQHNDDGQSGQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231007 Pseudomonas sp. GM18 Isolate Nodule
10 2511231008 Pseudomonas sp. GM21 Isolate Nodule
11 2511231010 Pseudomonas sp. GM25 Isolate Nodule
12 2511231011 Pseudomonas sp. GM30 Isolate Nodule
13 2511231012 Pseudomonas sp. GM33 Isolate Nodule
14 2511231014 Pseudomonas sp. GM48 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
24 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
25 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
26 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
27 2547132181 Kosakonia sacchari SP1 Isolate Stem
28 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
29 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
30 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
31 2561511199 Enterobacter sp. R4-368 Isolate Nodule
32 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
33 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
34 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
35 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
36 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
37 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
38 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
39 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
40 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
41 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
42 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
43 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
44 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
45 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
46 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
47 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
48 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
49 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
50 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
51 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
52 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
53 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
54 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
55 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
56 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
57 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
63 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
64 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
65 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
66 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
67 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
68 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
69 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
70 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
71 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
72 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
73 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
74 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
75 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
76 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
77 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
78 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
79 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
80 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
81 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
82 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
83 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
84 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
85 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
86 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
87 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
88 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
89 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
90 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
91 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
92 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
93 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
94 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
95 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
96 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
97 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
98 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
99 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
100 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
101 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
102 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
103 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
104 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
105 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
106 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
107 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
108 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
109 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
110 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
111 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
112 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
113 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
114 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
115 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
116 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
117 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
118 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
119 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
120 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
121 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
122 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
123 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
124 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
125 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
126 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
127 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
128 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
129 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
130 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
131 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
132 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
133 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
134 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
135 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
136 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
137 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
138 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
139 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
140 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
141 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
142 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
143 2636415599 Klebsiella variicola DX120E Isolate Unclassified
144 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
145 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
146 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
147 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
148 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
149 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
150 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
151 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
152 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
153 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
154 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
155 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
156 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
157 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
158 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
159 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
160 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
161 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
162 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
163 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
164 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
165 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
166 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
167 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
168 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
169 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
170 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
171 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
172 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
173 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
174 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
175 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
176 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
177 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
178 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
179 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
180 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
181 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
182 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
183 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
184 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
185 2751185917 Enterobacter sp. HK169 Isolate Unclassified
186 2765235841 Pseudomonas putida AA7 Isolate Unclassified
187 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
188 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
189 2773857670 Pseudomonas sp. 478 Isolate Unclassified
190 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
191 2773857673 Pseudomonas sp. 443 Isolate Unclassified
192 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
193 2775507074 Klebsiella sp. D5A Isolate Unclassified
194 2784132063 Pseudomonas sp. 424 Isolate Unclassified
195 2784132072 Pseudomonas sp. 460 Isolate Unclassified
196 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
197 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
198 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
199 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
200 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
201 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
202 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
203 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
204 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
205 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
206 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
207 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
208 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
209 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
210 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
211 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
212 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
213 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
214 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
215 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
216 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
217 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
218 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
219 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
220 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
221 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
222 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
223 2821118458 Enterobacter asburiae 609 Isolate Unclassified
224 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
225 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
226 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
227 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
228 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
229 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
230 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
231 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
232 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
233 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
234 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
235 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
236 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
237 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
238 2847085930 Erwinia persicina B64 Isolate Bulb
239 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
240 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
241 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
242 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
243 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
244 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
245 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
246 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
247 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
248 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
249 2865014394 Pantoea sp. R-71966 Isolate Unclassified
250 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
251 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
252 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
253 2876601092 Pantoea endophytica 596 Isolate Unclassified
254 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
255 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
256 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
257 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
258 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
259 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
260 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
261 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
262 2904504865 Serratia marcescens 1822 Isolate Unclassified
263 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
264 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
265 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
266 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
267 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
268 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
269 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
270 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
271 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
272 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
273 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
274 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
275 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
276 2919150387 Rahnella aceris 1817 Isolate Unclassified
277 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
278 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
279 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
280 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
281 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
282 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
283 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
284 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
285 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
286 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
287 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
288 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
289 2927143783 Rahnella sp. 2050 Isolate Unclassified
290 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
291 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
292 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
293 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
294 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
295 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
296 2932406140 Serratia sp. 2723 Isolate Rhizosphere
297 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
298 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
299 2937539931 Pantoea sp. LS15 Isolate Unclassified
300 2937967321 Serratia sp. YC16 Isolate Unclassified
301 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
302 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
303 2939577877 Serratia sp. 509 Isolate Rhizosphere
304 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
305 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
306 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
307 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
308 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
309 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
310 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
311 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
312 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
313 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
314 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
315 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
316 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
317 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
318 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
319 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
320 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
321 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
322 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
323 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
324 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
325 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
326 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
327 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
328 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
329 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
330 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
331 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
332 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
333 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
334 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
335 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
336 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
337 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
338 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
339 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
340 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
341 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
342 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
343 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
344 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
345 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
346 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
347 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
348 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
349 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
350 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
351 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
352 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
353 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
354 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
355 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
356 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
357 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
358 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
359 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
360 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
361 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
362 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
363 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
364 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
365 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
366 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
367 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
368 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
369 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
370 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
371 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
372 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
373 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
374 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
375 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
376 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
377 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
378 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
379 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
380 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
381 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
382 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
383 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
384 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
385 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
386 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
387 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
388 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
389 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
390 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
391 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
392 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
393 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
394 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
395 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
396 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
397 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
398 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
399 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
400 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
401 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
402 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
403 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
404 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
405 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
406 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
407 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
408 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
409 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
410 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
411 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
412 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
413 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
414 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
415 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
416 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
418 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
419 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
420 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
421 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
422 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
423 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
425 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
426 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
429 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
430 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
432 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
433 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
435 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
436 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
437 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
438 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
439 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
441 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
442 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
466 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
467 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
471 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
472 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
473 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
474 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
475 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
476 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
478 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
479 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
480 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
481 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
482 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
483 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
484 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
485 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
486 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
487 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
488 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
489 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
490 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
492 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
493 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
494 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
495 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
496 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
497 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
498 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
499 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
500 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
501 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
502 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
503 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
504 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
505 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
506 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
507 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
508 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
509 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
510 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
511 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
512 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
513 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
514 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
515 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
516 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
517 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
518 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
519 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
520 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
521 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
522 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
523 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
524 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
525 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
526 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
527 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
528 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
529 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
530 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
531 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
532 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
533 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
534 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
535 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
536 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
537 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
538 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
539 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
540 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
541 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
542 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
543 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
544 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
545 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
546 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
547 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
548 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
549 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
550 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
551 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
552 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
553 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
554 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
555 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
556 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
557 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
558 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
559 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
560 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
561 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
562 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
563 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
564 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
565 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
566 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
567 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
568 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
569 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
570 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
571 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
572 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
573 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
574 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
575 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
576 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
577 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
578 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
579 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
580 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
581 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
582 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
583 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
584 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
585 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
586 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
587 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
588 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
589 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
590 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
591 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
592 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
602 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
603 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
604 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
605 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
608 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
609 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
610 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
611 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
612 640753048 Serratia proteamaculans 568 Isolate Endosphere
613 8004592986 Serratia sp. S119 Isolate Unclassified
614 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
615 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
616 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
617 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
618 8018221730 Enterobacter sp. CM29 Isolate Unclassified
619 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
620 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
621 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
622 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
623 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
624 8052494512 Pseudomonas putida LD6 Isolate Unclassified
625 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
626 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
627 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
628 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
629 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
630 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
631 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
632 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
633 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
634 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
635 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
636 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
637 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
638 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
639 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
640 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
641 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
642 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
643 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
644 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
645 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
646 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
647 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
648 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
649 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
650 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
651 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.04
Metatranscriptomes 2.49
Isolates 37.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0.1
Endosphere 6.36
Nodule 3.58
Rhizoplane 13.02
Rhizosphere 56.06
Stem 0.1
Stem Tuber 0.5
Unclassified 19.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_908 2124908027 Bacteria 7011
2 JGI24741J21665_1007693 3300001915 Bacteria 2077
3 JGI24739J22299_10000495 3300001989 Bacteria 13927
4 JGI25154J39366_1004064 3300002738 Bacteria 2769
5 JGI25163J39215_1000022 3300002771 Bacteria 73877
6 JGI25164J39214_1000008 3300002772 Bacteria 311285
7 JGI25164J39214_1000100 3300002772 Bacteria 84404
8 JGI25152J39213_1000802 3300002773 Bacteria 15735
9 JGI25165J46597_1000207 3300003214 Bacteria 84404
10 rootH2_10027710 3300003320 Bacteria 31950
11 rootL2_10202333 3300003322 Bacteria 1935
12 Ga0055538_1000014 3300003751 Bacteria 311285
13 Ga0055538_1000028 3300003751 Bacteria 215806
14 Ga0055539_1000020 3300003752 Bacteria 311285
15 Ga0055539_1000037 3300003752 Bacteria 215806
16 Ga0055533_1000027 3300003756 Bacteria 311285
17 Ga0055533_1000047 3300003756 Bacteria 215806
18 Ga0055532_1000129 3300003758 Bacteria 74882
19 Ga0055525_1000032 3300003759 Bacteria 311285
20 Ga0055525_1000443 3300003759 Bacteria 23895
21 Ga0055536_1003337 3300003781 Bacteria 8684
22 Ga0055536_1011775 3300003781 Bacteria 3308
23 Ga0055530_10007005 3300003791 Bacteria 4861
24 Ga0055530_10030977 3300003791 Bacteria 1410
25 Ga0055531_10006469 3300003794 Bacteria 6649
26 Ga0055541_1000014 3300003841 Bacteria 311285
27 Ga0055541_1000025 3300003841 Bacteria 215806
28 Ga0058692_1006453 3300003856 Bacteria 3217
29 Ga0058692_1012258 3300003856 Bacteria 2038
30 Ga0058692_1017030 3300003856 Bacteria 1601
31 Ga0058860_10094053 3300004801 Bacteria 1955
32 Ga0058860_10169596 3300004801 Bacteria 1593
33 Ga0058860_10195578 3300004801 Bacteria 1446
34 Ga0058860_12165330 3300004801 Bacteria 2117
35 Ga0058860_12187468 3300004801 Bacteria 2008
36 Ga0065703_1020270 3300005272 Bacteria 1919
37 Ga0065714_10000238 3300005288 Bacteria 6927
38 Ga0065714_10081923 3300005288 Bacteria 2342
39 Ga0065714_10087702 3300005288 Bacteria 2047
40 Ga0065704_10000888 3300005289 Bacteria 11210
41 Ga0065704_10002842 3300005289 Bacteria 14551
42 Ga0065704_10004084 3300005289 Bacteria 6154
43 Ga0065704_10026246 3300005289 Bacteria 1447
44 Ga0065704_10090186 3300005289 Bacteria 2806
45 Ga0065704_10139924 3300005289 Bacteria 1528
46 Ga0065712_10003691 3300005290 Bacteria 6497
47 Ga0065712_10067863 3300005290 Bacteria 24476
48 Ga0065712_10079070 3300005290 Bacteria 3257
49 Ga0065715_10133975 3300005293 Bacteria 1959
50 Ga0070661_100000022 3300005344 Bacteria 127714
51 Ga0070669_100001703 3300005353 Bacteria 15924
52 Ga0070669_100005661 3300005353 Bacteria 9020
53 Ga0070694_100087223 3300005444 Bacteria 2182
54 Ga0070662_100000041 3300005457 Bacteria 72879
55 Ga0070662_100004331 3300005457 Bacteria 8964
56 Ga0070698_100135638 3300005471 Bacteria 2415
57 Ga0068853_100007800 3300005539 Bacteria 8583
58 Ga0070696_100279255 3300005546 Bacteria 1273
59 Ga0070665_100007341 3300005548 Bacteria 11210
60 Ga0070665_100010625 3300005548 Bacteria 9318
61 Ga0070665_100083166 3300005548 Bacteria 3206
62 Ga0070664_100000646 3300005564 Bacteria 26728
63 Ga0068857_100073160 3300005577 Bacteria 3053
64 Ga0068857_100216748 3300005577 Bacteria 1748
65 Ga0068854_100020986 3300005578 Bacteria 4427
66 Ga0070702_100155902 3300005615 Bacteria 1471
67 Ga0068859_100015807 3300005617 Bacteria 7582
68 Ga0068851_10000044 3300005834 Bacteria 83228
69 Ga0068851_10012067 3300005834 Bacteria 4068
70 Ga0068851_10064435 3300005834 Bacteria 1884
71 Ga0081538_10087104 3300005981 Bacteria 1632
72 Ga0075364_10007670 3300006051 Bacteria 6419
73 Ga0075364_10020296 3300006051 Bacteria 4178
74 Ga0075364_10326818 3300006051 Bacteria 1044
75 Ga0070715_10018108 3300006163 Bacteria 2679
76 Ga0075367_10416592 3300006178 Bacteria 850
77 Ga0075434_100202485 3300006871 Bacteria 2005
78 Ga0097620_100015807 3300006931 Bacteria 7582
79 Ga0099823_1000054 3300006944 Bacteria 55085
80 Ga0079104_1000720 3300006946 Bacteria 29806
81 Ga0079104_1000769 3300006946 Bacteria 27495
82 Ga0079104_1002016 3300006946 Bacteria 11849
83 Ga0079104_1015557 3300006946 Bacteria 2250
84 Ga0079104_1020880 3300006946 Bacteria 1793
85 Ga0079104_1027141 3300006946 Bacteria 1471
86 Ga0099794_10005207 3300007265 Bacteria 5198
87 Ga0105251_10000151 3300009011 Bacteria 70872
88 Ga0105251_10000156 3300009011 Bacteria 69639
89 Ga0105251_10001256 3300009011 Bacteria 21931
90 Ga0105251_10007540 3300009011 Bacteria 6684
91 Ga0105251_10029112 3300009011 Bacteria 2785
92 Ga0105251_10050570 3300009011 Bacteria 1985
93 Ga0105251_10057196 3300009011 Bacteria 1843
94 Ga0105251_10059849 3300009011 Bacteria 1795
95 Ga0105251_10126641 3300009011 Bacteria 1159
96 Ga0105251_10158084 3300009011 Bacteria 1022
97 Ga0105244_10000272 3300009036 Bacteria 52218
98 Ga0105244_10000338 3300009036 Bacteria 44031
99 Ga0105244_10000932 3300009036 Bacteria 24659
100 Ga0105244_10002378 3300009036 Bacteria 14261
101 Ga0105244_10003891 3300009036 Bacteria 10503
102 Ga0105244_10004865 3300009036 Bacteria 9106
103 Ga0105244_10010841 3300009036 Bacteria 5503
104 Ga0105244_10049440 3300009036 Bacteria 2149
105 Ga0105244_10075100 3300009036 Bacteria 1680
106 Ga0105244_10115292 3300009036 Bacteria 1304
107 Ga0105244_10126386 3300009036 Bacteria 1235
108 Ga0105244_10141536 3300009036 Bacteria 1157
109 Ga0105244_10182263 3300009036 Bacteria 995
110 Ga0105244_10189344 3300009036 Bacteria 973
111 Ga0105250_10000042 3300009092 Bacteria 130495
112 Ga0105250_10000542 3300009092 Bacteria 26010
113 Ga0105250_10000611 3300009092 Bacteria 23296
114 Ga0105250_10001268 3300009092 Bacteria 13907
115 Ga0105250_10001773 3300009092 Bacteria 11331
116 Ga0105250_10003580 3300009092 Bacteria 7317
117 Ga0105250_10039616 3300009092 Bacteria 1889
118 Ga0105250_10094222 3300009092 Bacteria 1220
119 Ga0105250_10130066 3300009092 Bacteria 1039
120 Ga0105245_10155601 3300009098 Bacteria 2165
121 Ga0105247_10000301 3300009101 Bacteria 44602
122 Ga0105247_10469645 3300009101 Bacteria 911
123 Ga0105243_10010660 3300009148 Bacteria 6971
124 Ga0105243_10024754 3300009148 Bacteria 4582
125 Ga0105243_10238632 3300009148 Bacteria 1616
126 Ga0105243_10242685 3300009148 Bacteria 1604
127 Ga0105243_10361702 3300009148 Bacteria 1336
128 Ga0105241_10000008 3300009174 Bacteria 334281
129 Ga0105242_10007385 3300009176 Bacteria 8463
130 Ga0105242_10201976 3300009176 Bacteria 1766
131 Ga0105248_10027748 3300009177 Bacteria 6305
132 Ga0105237_10001243 3300009545 Bacteria 33994
133 Ga0105237_10174419 3300009545 Bacteria 2150
134 Ga0130087_1027949 3300009828 Bacteria 1890
135 Ga0105246_10056158 3300011119 Bacteria 2720
136 Ga0157373_10000463 3300013100 Bacteria 32226
137 Ga0157373_10063629 3300013100 Bacteria 2612
138 Ga0157373_10064357 3300013100 Bacteria 2596
139 Ga0157373_10146750 3300013100 Bacteria 1659
140 Ga0157373_10155477 3300013100 Bacteria 1609
141 Ga0157371_10001001 3300013102 Bacteria 31233
142 Ga0157371_10001008 3300013102 Bacteria 31048
143 Ga0157371_10002245 3300013102 Bacteria 18658
144 Ga0157371_10023605 3300013102 Bacteria 4498
145 Ga0157370_10002229 3300013104 Bacteria 23584
146 Ga0157370_10002252 3300013104 Bacteria 23438
147 Ga0157370_10004489 3300013104 Bacteria 15991
148 Ga0157370_10006004 3300013104 Bacteria 13513
149 Ga0157370_10033837 3300013104 Bacteria 4981
150 Ga0157370_10045091 3300013104 Bacteria 4233
151 Ga0157369_10000956 3300013105 Bacteria 36674
152 Ga0157369_10038217 3300013105 Bacteria 5248
153 Ga0163162_10044620 3300013306 Bacteria 4440
154 Ga0163162_10163690 3300013306 Bacteria 2347
155 Ga0163162_10279941 3300013306 Bacteria 1800
156 Ga0157372_10004322 3300013307 Bacteria 15189
157 Ga0157372_10008877 3300013307 Bacteria 10675
158 Ga0157372_10070044 3300013307 Bacteria 3945
159 Ga0157372_10152976 3300013307 Bacteria 2663
160 Ga0157372_10512069 3300013307 Bacteria 1399
161 Ga0157372_10551068 3300013307 Bacteria 1344
162 Ga0157380_10371786 3300014326 Bacteria 1346
163 Ga0157380_10855410 3300014326 Bacteria 932
164 Ga0182008_10001425 3300014497 Bacteria 16033
165 Ga0182006_1000069 3300015261 Bacteria 140097
166 Ga0183366_1002 3300015679 Bacteria 791639
167 Ga0183370_1002 3300015680 Bacteria 791639
168 Ga0183369_1002 3300015685 Bacteria 791621
169 Ga0183368_1005 3300015687 Bacteria 791621
170 Ga0163161_10000002 3300017792 Bacteria 411983
171 Ga0163161_10051926 3300017792 Bacteria 2971
172 Ga0163161_10060323 3300017792 Bacteria 2761
173 Ga0206356_11158939 3300020070 Bacteria 1733
174 Ga0206351_10013078 3300020077 Bacteria 2566
175 Ga0206352_10402763 3300020078 Bacteria 2145
176 Ga0206354_10196568 3300020081 Bacteria 1734
177 Ga0206354_10826925 3300020081 Bacteria 1891
178 Ga0154015_1698326 3300020610 Bacteria 1607
179 Ga0213876_10000444 3300021384 Bacteria 33655
180 Ga0224712_10079925 3300022467 Bacteria 1347
181 Ga0256714_107509 3300023304 Bacteria 2224
182 Ga0256744_141414 3300023309 Bacteria 1240
183 Ga0209435_100363 3300025206 Bacteria 10243
184 Ga0209760_100086 3300025207 Bacteria 74006
185 Ga0209760_100463 3300025207 Bacteria 9076
186 Ga0209784_100030 3300025224 Bacteria 327457
187 Ga0209784_100032 3300025224 Bacteria 314079
188 Ga0209566_100034 3300025225 Bacteria 327457
189 Ga0209566_100036 3300025225 Bacteria 314079
190 Ga0209674_100052 3300025226 Bacteria 327457
191 Ga0209674_100054 3300025226 Bacteria 314079
192 Ga0209147_100055 3300025229 Bacteria 262412
193 Ga0209563_100054 3300025230 Bacteria 327457
194 Ga0209563_100055 3300025230 Bacteria 314079
195 Ga0207427_100001 3300025231 Bacteria 1410763
196 Ga0207427_100035 3300025231 Bacteria 311526
197 Ga0209437_100003 3300025233 Bacteria 1517827
198 Ga0209437_100068 3300025233 Bacteria 311526
199 Ga0209437_100110 3300025233 Bacteria 215040
200 Ga0209258_100231 3300025242 Bacteria 104255
201 Ga0207425_1019345 3300025245 Bacteria 1467
202 Ga0209646_1000331 3300025246 Bacteria 35689
203 Ga0209677_100032 3300025253 Bacteria 327457
204 Ga0209677_100033 3300025253 Bacteria 314079
205 Ga0209759_1010939 3300025256 Bacteria 2620
206 Ga0209129_1000103 3300025258 Bacteria 161305
207 Ga0209233_1000007 3300025261 Bacteria 1411234
208 Ga0209565_1038113 3300025263 Bacteria 906
209 Ga0209675_1006388 3300025291 Bacteria 4738
210 Ga0209676_1000078 3300025292 Bacteria 296293
211 Ga0209676_1000503 3300025292 Bacteria 61955
212 Ga0209050_1000041 3300025298 Bacteria 408004
213 Ga0209050_1000060 3300025298 Bacteria 321699
214 Ga0209050_1000425 3300025298 Bacteria 77756
215 Ga0209051_1000037 3300025303 Bacteria 321747
216 Ga0209051_1000061 3300025303 Bacteria 253485
217 Ga0209051_1000085 3300025303 Bacteria 189973
218 Ga0209257_1000635 3300025304 Bacteria 56286
219 Ga0209257_1011547 3300025304 Bacteria 4235
220 Ga0207656_10000022 3300025321 Bacteria 106345
221 Ga0207656_10004274 3300025321 Bacteria 4978
222 Ga0207696_1000008 3300025711 Bacteria 568181
223 Ga0207696_1000009 3300025711 Bacteria 564405
224 Ga0207696_1000027 3300025711 Bacteria 412783
225 Ga0207696_1000032 3300025711 Bacteria 380071
226 Ga0207696_1000034 3300025711 Bacteria 350426
227 Ga0207696_1000129 3300025711 Bacteria 133308
228 Ga0207696_1000187 3300025711 Bacteria 96247
229 Ga0207696_1000262 3300025711 Bacteria 67626
230 Ga0207696_1000278 3300025711 Bacteria 60620
231 Ga0207696_1001031 3300025711 Bacteria 16601
232 Ga0207696_1001146 3300025711 Bacteria 15233
233 Ga0207696_1001494 3300025711 Bacteria 12582
234 Ga0207696_1002195 3300025711 Bacteria 9785
235 Ga0207696_1003240 3300025711 Bacteria 7510
236 Ga0207696_1006426 3300025711 Bacteria 4741
237 Ga0207696_1006575 3300025711 Bacteria 4668
238 Ga0207655_1000020 3300025728 Bacteria 524503
239 Ga0207655_1000054 3300025728 Bacteria 281894
240 Ga0207655_1000103 3300025728 Bacteria 185076
241 Ga0207655_1000357 3300025728 Bacteria 64976
242 Ga0207655_1000408 3300025728 Bacteria 59188
243 Ga0207655_1000569 3300025728 Bacteria 45865
244 Ga0207655_1000721 3300025728 Bacteria 37520
245 Ga0207655_1000752 3300025728 Bacteria 36357
246 Ga0207655_1000828 3300025728 Bacteria 33376
247 Ga0207655_1001231 3300025728 Bacteria 24607
248 Ga0207655_1001348 3300025728 Bacteria 23067
249 Ga0207655_1006303 3300025728 Bacteria 7886
250 Ga0207655_1007027 3300025728 Bacteria 7370
251 Ga0207655_1007625 3300025728 Bacteria 6990
252 Ga0207655_1007768 3300025728 Bacteria 6914
253 Ga0207655_1014196 3300025728 Bacteria 4519
254 Ga0207655_1017833 3300025728 Bacteria 3810
255 Ga0207655_1024660 3300025728 Bacteria 2942
256 Ga0207655_1036293 3300025728 Bacteria 2188
257 Ga0207655_1077163 3300025728 Bacteria 1216
258 Ga0207713_1000014 3300025735 Bacteria 432450
259 Ga0207713_1000028 3300025735 Bacteria 309074
260 Ga0207713_1000123 3300025735 Bacteria 122033
261 Ga0207713_1000129 3300025735 Bacteria 116027
262 Ga0207713_1000163 3300025735 Bacteria 98277
263 Ga0207713_1000223 3300025735 Bacteria 76591
264 Ga0207713_1001297 3300025735 Bacteria 20559
265 Ga0207713_1004295 3300025735 Bacteria 9287
266 Ga0207713_1005559 3300025735 Bacteria 7855
267 Ga0207713_1005686 3300025735 Bacteria 7740
268 Ga0207713_1006908 3300025735 Bacteria 6819
269 Ga0207713_1007366 3300025735 Bacteria 6507
270 Ga0207713_1008261 3300025735 Bacteria 6017
271 Ga0207713_1009429 3300025735 Bacteria 5501
272 Ga0207713_1033358 3300025735 Bacteria 2250
273 Ga0207713_1037467 3300025735 Bacteria 2067
274 Ga0207713_1049253 3300025735 Bacteria 1691
275 Ga0207710_10000061 3300025900 Bacteria 166665
276 Ga0207685_10039892 3300025905 Bacteria 1746
277 Ga0207654_10000009 3300025911 Bacteria 334291
278 Ga0207695_10164949 3300025913 Bacteria 2144
279 Ga0207671_10000034 3300025914 Bacteria 245048
280 Ga0207671_10109162 3300025914 Bacteria 2103
281 Ga0207649_10000006 3300025920 Bacteria 349180
282 Ga0207681_10000978 3300025923 Bacteria 18677
283 Ga0207681_10390162 3300025923 Bacteria 1122
284 Ga0207650_10000092 3300025925 Bacteria 116489
285 Ga0207706_10003133 3300025933 Bacteria 15889
286 Ga0207706_10061623 3300025933 Bacteria 3303
287 Ga0207686_10001893 3300025934 Bacteria 11588
288 Ga0207686_10032842 3300025934 Bacteria 3092
289 Ga0207709_10004825 3300025935 Bacteria 7725
290 Ga0207709_10014581 3300025935 Bacteria 4343
291 Ga0207709_10050415 3300025935 Bacteria 2545
292 Ga0207709_10060080 3300025935 Bacteria 2369
293 Ga0207669_10245343 3300025937 Bacteria 1330
294 Ga0207689_10305707 3300025942 Bacteria 1318
295 Ga0207679_10000010 3300025945 Bacteria 349180
296 Ga0207668_10007234 3300025972 Bacteria 6591
297 Ga0207639_10005461 3300026041 Bacteria 8587
298 Ga0207708_10361060 3300026075 Bacteria 1194
299 Ga0207674_10088438 3300026116 Bacteria 3091
300 Ga0207674_10103126 3300026116 Bacteria 2832
301 Ga0209281_1000010 3300027111 Bacteria 726106
302 Ga0209281_1000049 3300027111 Bacteria 322274
303 Ga0209281_1000054 3300027111 Bacteria 309505
304 Ga0209281_1000056 3300027111 Bacteria 307619
305 Ga0209281_1000371 3300027111 Bacteria 72619
306 Ga0209281_1000505 3300027111 Bacteria 51792
307 Ga0209281_1000576 3300027111 Bacteria 43355
308 Ga0209281_1000683 3300027111 Bacteria 35391
309 Ga0209281_1001352 3300027111 Bacteria 15206
310 Ga0209281_1013772 3300027111 Bacteria 1733
311 Ga0209281_1022875 3300027111 Bacteria 1192
312 Ga0209389_1000002 3300027296 Bacteria 333932
313 Ga0209371_1000013 3300027312 Bacteria 691516
314 Ga0209371_1000049 3300027312 Bacteria 279132
315 Ga0209371_1000572 3300027312 Bacteria 33334
316 Ga0209371_1000582 3300027312 Bacteria 32834
317 Ga0209371_1000935 3300027312 Bacteria 22868
318 Ga0209371_1001075 3300027312 Bacteria 20453
319 Ga0209371_1001276 3300027312 Bacteria 17779
320 Ga0209371_1002216 3300027312 Bacteria 11275
321 Ga0209371_1002307 3300027312 Bacteria 10875
322 Ga0209371_1002649 3300027312 Bacteria 9758
323 Ga0209371_1002734 3300027312 Bacteria 9478
324 Ga0209371_1014808 3300027312 Bacteria 2121
325 Ga0209371_1018024 3300027312 Bacteria 1809
326 Ga0209371_1022298 3300027312 Bacteria 1516
327 Ga0209981_1003851 3300027378 Bacteria 1954
328 Ga0209981_1006084 3300027378 Bacteria 1612
329 Ga0209984_1009488 3300027424 Bacteria 1238
330 Ga0209999_1007990 3300027543 Bacteria 1903
331 Ga0210002_1012214 3300027617 Bacteria 1332
332 Ga0209983_1004310 3300027665 Bacteria 2998
333 Ga0209971_1042692 3300027682 Bacteria 1092
334 Ga0209966_1003526 3300027695 Bacteria 2635
335 Ga0207428_10151233 3300027907 Bacteria 1767
336 Ga0268266_10000211 3300028379 Bacteria 101045
337 Ga0268266_10052890 3300028379 Bacteria 3488
338 Ga0311001_1010284 3300029277 Bacteria 2088
339 Ga0268256_1000014 3300030500 Bacteria 691435
340 Ga0268256_1000031 3300030500 Bacteria 425730
341 Ga0268256_1000227 3300030500 Bacteria 60732
342 Ga0268256_1000499 3300030500 Bacteria 33334
343 Ga0268256_1001137 3300030500 Bacteria 17252
344 Ga0268256_1001942 3300030500 Bacteria 11316
345 Ga0268256_1002473 3300030500 Bacteria 9388
346 Ga0268256_1003008 3300030500 Bacteria 7959
347 Ga0268256_1005389 3300030500 Bacteria 5025
348 Ga0268256_1019845 3300030500 Bacteria 1827
349 Ga0268256_1020097 3300030500 Bacteria 1809
350 Ga0316177_1087706 3300030731 Bacteria 2844
351 Ga0316183_1016295 3300030742 Bacteria 4569
352 Ga0265328_10000016 3300031239 Bacteria 132959
353 Ga0307408_100298698 3300031548 Bacteria 1348
354 Ga0307408_100392243 3300031548 Bacteria 1190
355 Ga0316575_10000446 3300031665 Bacteria 11788
356 Ga0316575_10011572 3300031665 Bacteria 3267
357 Ga0316579_10000802 3300031691 Bacteria 10838
358 Ga0316579_10022759 3300031691 Bacteria 2806
359 Ga0316579_10197790 3300031691 Bacteria 972
360 Ga0265314_10121058 3300031711 Bacteria 1647
361 Ga0307413_10060321 3300031824 Bacteria 2335
362 Ga0307412_10413110 3300031911 Bacteria 1102
363 Ga0307416_100350680 3300032002 Bacteria 1493
364 Ga0316585_10004730 3300032137 Bacteria 3813
365 Ga0316593_10000082 3300032168 Bacteria 11664
366 Ga0316593_10014396 3300032168 Bacteria 2358
367 Ga0316593_10024525 3300032168 Bacteria 1913
368 Ga0316593_10026492 3300032168 Bacteria 1854
369 Ga0316593_10032846 3300032168 Bacteria 1697
370 Ga0316593_10067079 3300032168 Bacteria 1236
371 Ga0373936_0117312 3300035113 Bacteria 1134
372 Ga0316574_0222461 3300035398 Bacteria 1209
373 Ga0373935_0065766 3300035692 Bacteria 2327
374 Ga0373935_0313854 3300035692 Bacteria 1111
375 Ga0373927_0038654 3300035695 Bacteria 3098
376 Ga0373937_0345012 3300036401 Bacteria 1410
377 Ga0316582_0002520 3300036647 Bacteria 8642
378 Ga0316584_0304221 3300036712 Bacteria 1154
379 Ga0373925_0041279 3300037068 Bacteria 3420
380 Ga0316581_0073803 3300037588 Bacteria 1048
381 Ga0400483_105112 3300039062 Bacteria 1430
382 Ga0400483_213263 3300039062 Bacteria 16387
383 Ga0436365_1801698 3300039437 Bacteria 33582
384 Ga0439436_0000220 3300041404 Bacteria 13690
385 Ga0439438_000042 3300041405 Bacteria 63992
386 Ga0439438_003009 3300041405 Bacteria 6954
387 Ga0439438_004922 3300041405 Bacteria 5004
388 Ga0439438_004959 3300041405 Bacteria 4977
389 Ga0439438_007456 3300041405 Bacteria 3738
390 Ga0439438_008294 3300041405 Bacteria 3462
391 Ga0439447_000338 3300041407 Bacteria 16822
392 Ga0439447_001723 3300041407 Bacteria 8011
393 Ga0439447_005050 3300041407 Bacteria 4441
394 Ga0439447_005875 3300041407 Bacteria 4038
395 Ga0439466_0000004 3300041411 Bacteria 462654
396 Ga0439466_0003385 3300041411 Bacteria 6198
397 Ga0451789_0093147 3300041443 Bacteria 1635
398 Ga0451797_1445638 3300041453 Bacteria 1648
399 Ga0451805_097769 3300041461 Bacteria 1588
400 Ga0451807_0192210 3300041486 Bacteria 1196
401 Ga0451835_0706369 3300041492 Bacteria 1294
402 Ga0451853_0953173 3300041512 Bacteria 2207
403 Ga0451853_1281195 3300041512 Bacteria 1006
404 Ga0452268_32449 3300041907 Bacteria 1374
405 Ga0439431_0003975 3300041997 Bacteria 3255
406 Ga0439441_002360 3300042001 Bacteria 2651
407 Ga0439443_024958 3300042003 Bacteria 961
408 Ga0439432_003406 3300042006 Bacteria 5902
409 Ga0439432_008690 3300042006 Bacteria 3560
410 Ga0439432_014747 3300042006 Bacteria 2643
411 Ga0439432_028853 3300042006 Bacteria 1805
412 Ga0439452_000009 3300042010 Bacteria 569493
413 Ga0439452_000013 3300042010 Bacteria 364058
414 Ga0439452_000094 3300042010 Bacteria 75452
415 Ga0439452_000121 3300042010 Bacteria 60858
416 Ga0439455_0044352 3300042012 Bacteria 1147
417 Ga0439456_008965 3300042013 Bacteria 2067
418 Ga0439463_003608 3300042016 Bacteria 3902
419 Ga0450911_000317 3300042115 Bacteria 17456
420 Ga0450923_009020 3300042125 Bacteria 1733
421 Ga0450900_001029 3300042136 Bacteria 2556
422 Ga0450902_004495 3300042137 Bacteria 2078
423 Ga0450904_000557 3300042139 Bacteria 7024
424 Ga0450905_013876 3300042142 Bacteria 1144
425 Ga0450907_000648 3300042146 Bacteria 9158
426 Ga0439446_0002391 3300042156 Bacteria 4496
427 Ga0439446_0002561 3300042156 Bacteria 4380
428 Ga0439435_0000397 3300042436 Bacteria 6743
429 Ga0439459_0002610 3300042438 Bacteria 2792
430 Ga0439464_0002684 3300042439 Bacteria 4413
431 Ga0439460_0000842 3300042461 Bacteria 6983
432 Ga0450893_0002336 3300042532 Bacteria 2946
433 Ga0450893_0015838 3300042532 Bacteria 1273
434 Ga0466981_0000032 3300044669 Bacteria 65341
435 Ga0495627_000177 3300046453 Bacteria 72359
436 Ga0495627_005014 3300046453 Bacteria 5420
437 Ga0495591_000222 3300046458 Bacteria 56621
438 Ga0495591_000590 3300046458 Bacteria 27551
439 Ga0495591_001740 3300046458 Bacteria 12974
440 Ga0495591_005309 3300046458 Bacteria 5996
441 Ga0495591_037354 3300046458 Bacteria 1406
442 Ga0495650_0000008 3300046471 Bacteria 688246
443 Ga0495650_0000059 3300046471 Bacteria 296253
444 Ga0495650_0000120 3300046471 Bacteria 184191
445 Ga0495605_0000235 3300046474 Bacteria 67625
446 Ga0495605_0026549 3300046474 Bacteria 3009
447 Ga0495584_0003803 3300046491 Bacteria 8213
448 Ga0495585_0023719 3300046492 Bacteria 3520
449 Ga0495594_0002336 3300046499 Bacteria 9871
450 Ga0495596_0009946 3300046500 Bacteria 4166
451 Ga0495607_0000756 3300046501 Bacteria 30975
452 Ga0495607_0038294 3300046501 Bacteria 2873
453 Ga0495583_0000389 3300046506 Bacteria 67583
454 Ga0495606_0008629 3300046507 Bacteria 8804
455 Ga0495610_0014899 3300046512 Bacteria 4545
456 Ga0495620_0000003 3300046515 Bacteria 345923
457 Ga0495620_0000900 3300046515 Bacteria 18247
458 Ga0495632_0003399 3300046519 Bacteria 11334
459 Ga0495632_0039573 3300046519 Bacteria 2379
460 Ga0495643_0006448 3300046522 Bacteria 7731
461 Ga0495643_0025859 3300046522 Bacteria 3318
462 Ga0495644_0009743 3300046523 Bacteria 3700
463 Ga0495644_0102312 3300046523 Bacteria 1084
464 Ga0495648_0009903 3300046524 Bacteria 7319
465 Ga0495648_0057910 3300046524 Bacteria 2320
466 Ga0495648_0068718 3300046524 Bacteria 2065
467 Ga0495654_0000148 3300046530 Bacteria 72863
468 Ga0495654_0000218 3300046530 Bacteria 53756
469 Ga0495654_0001237 3300046530 Bacteria 18027
470 Ga0495654_0007590 3300046530 Bacteria 6043
471 Ga0495654_0008728 3300046530 Bacteria 5583
472 Ga0495654_0041929 3300046530 Bacteria 2275
473 Ga0495654_0072730 3300046530 Bacteria 1626
474 Ga0495609_0000006 3300046538 Bacteria 431833
475 Ga0495609_0000296 3300046538 Bacteria 46065
476 Ga0495621_0036552 3300046539 Bacteria 1705
477 Ga0495633_0000309 3300046558 Bacteria 55647
478 Ga0495611_0208408 3300046648 Bacteria 911
479 Ga0495625_0119230 3300046660 Bacteria 1797
480 Ga0495661_0000224 3300046665 Bacteria 65089
481 Ga0495661_0000366 3300046665 Bacteria 49025
482 Ga0495588_0172530 3300046674 Bacteria 1143
483 Ga0495670_0012315 3300046691 Bacteria 4204
484 Ga0495671_0001722 3300046692 Bacteria 14204
485 Ga0495671_0024447 3300046692 Bacteria 3146
486 Ga0495649_0001477 3300046694 Bacteria 17652
487 Ga0495649_0037603 3300046694 Bacteria 2656
488 Ga0495649_0112441 3300046694 Bacteria 1443
489 Ga0495589_0000023 3300046794 Bacteria 195535
490 Ga0495660_0000019 3300046810 Bacteria 311047
491 Ga0495660_0000063 3300046810 Bacteria 129364
492 Ga0495660_0013204 3300046810 Bacteria 4785
493 Ga0495660_0041034 3300046810 Bacteria 2564
494 Ga0495660_0055764 3300046810 Bacteria 2138
495 Ga0495672_0000003 3300047320 Bacteria 728845
496 Ga0495672_0000025 3300047320 Bacteria 365425
497 Ga0495672_0000145 3300047320 Bacteria 104177
498 Ga0495672_0016757 3300047320 Bacteria 4920
499 Ga0495676_0031220 3300047321 Bacteria 4509
500 Ga0495676_0071324 3300047321 Bacteria 2670
501 Ga0495683_0000105 3300047323 Bacteria 87050
502 Ga0495683_0000201 3300047323 Bacteria 56536
503 Ga0495683_0007108 3300047323 Bacteria 6074
504 Ga0495679_000263 3300047446 Bacteria 43748
505 Ga0495679_000535 3300047446 Bacteria 26692
506 Ga0495679_001169 3300047446 Bacteria 15629
507 Ga0495679_011720 3300047446 Bacteria 3369
508 Ga0495673_0000011 3300047469 Bacteria 674140
509 Ga0495673_0000176 3300047469 Bacteria 103274
510 Ga0495673_0003561 3300047469 Bacteria 10246
511 Ga0495681_0047979 3300047470 Bacteria 2028
512 Ga0495626_0000413 3300048091 Bacteria 43901
513 Ga0496100_0030607 3300048903 Bacteria 3340
514 Ga0496100_0034666 3300048903 Bacteria 3169
515 Ga0496101_0000624 3300048904 Bacteria 21525
516 Ga0496102_0113265 3300048905 Bacteria 2530
517 Ga0496104_0017702 3300048907 Bacteria 6495
518 Ga0496104_0040576 3300048907 Bacteria 4363
519 Ga0496105_0032860 3300048908 Bacteria 4258
520 Ga0496105_0070984 3300048908 Bacteria 2878
521 Ga0496113_0074743 3300048916 Bacteria 2584
522 Ga0496114_0010183 3300048917 Bacteria 7481
523 Ga0496114_0843286 3300048917 Bacteria 796
524 Ga0496116_0000015 3300048919 Bacteria 560702
525 Ga0496116_0000096 3300048919 Bacteria 202230
526 Ga0496116_0001120 3300048919 Bacteria 32049
527 Ga0496116_0004381 3300048919 Bacteria 13500
528 Ga0496116_0005667 3300048919 Bacteria 11501
529 Ga0496116_0042872 3300048919 Bacteria 3088
530 Ga0496116_0052156 3300048919 Bacteria 2711
531 Ga0496116_0115965 3300048919 Bacteria 1561
532 Ga0496117_0000043 3300048920 Bacteria 309583
533 Ga0496117_0002805 3300048920 Bacteria 21246
534 Ga0496117_0003581 3300048920 Bacteria 17927
535 Ga0496117_0036499 3300048920 Bacteria 3676
536 Ga0496117_0052208 3300048920 Bacteria 2881
537 Ga0496117_0058545 3300048920 Bacteria 2667
538 Ga0496117_0070014 3300048920 Bacteria 2359
539 Ga0496117_0114350 3300048920 Bacteria 1673
540 Ga0496118_0000075 3300048921 Bacteria 196228
541 Ga0496118_0003147 3300048921 Bacteria 21106
542 Ga0496118_0006965 3300048921 Bacteria 12205
543 Ga0496118_0024462 3300048921 Bacteria 5208
544 Ga0496118_0024561 3300048921 Bacteria 5196
545 Ga0496118_0085790 3300048921 Bacteria 2190
546 Ga0496118_0094132 3300048921 Bacteria 2049
547 Ga0496118_0185699 3300048921 Bacteria 1250
548 Ga0496119_0000207 3300048922 Bacteria 83748
549 Ga0496119_0000355 3300048922 Bacteria 64264
550 Ga0496119_0003086 3300048922 Bacteria 17573
551 Ga0496119_0003653 3300048922 Bacteria 15793
552 Ga0496119_0004492 3300048922 Bacteria 13869
553 Ga0496119_0009362 3300048922 Bacteria 8422
554 Ga0496119_0022030 3300048922 Bacteria 4579
555 Ga0496119_0110181 3300048922 Bacteria 1529
556 Ga0496120_0002244 3300048923 Bacteria 20193
557 Ga0496120_0002287 3300048923 Bacteria 19874
558 Ga0496120_0002586 3300048923 Bacteria 18012
559 Ga0496120_0003799 3300048923 Bacteria 13310
560 Ga0496120_0004827 3300048923 Bacteria 11031
561 Ga0496120_0011502 3300048923 Bacteria 6081
562 Ga0496120_0017896 3300048923 Bacteria 4579
563 Ga0496120_0034663 3300048923 Bacteria 3021
564 Ga0496120_0128423 3300048923 Bacteria 1301
565 Ga0496121_0003934 3300048924 Bacteria 20565
566 Ga0496121_0162610 3300048924 Bacteria 1630
567 Ga0496122_0000170 3300048925 Bacteria 154389
568 Ga0496122_0000213 3300048925 Bacteria 129218
569 Ga0496122_0001232 3300048925 Bacteria 43246
570 Ga0496122_0002533 3300048925 Bacteria 25730
571 Ga0496122_0006705 3300048925 Bacteria 13101
572 Ga0496122_0075834 3300048925 Bacteria 2369
573 Ga0496122_0092780 3300048925 Bacteria 2051
574 Ga0496122_0246962 3300048925 Bacteria 1001
575 Ga0496123_0000058 3300048926 Bacteria 226832
576 Ga0496123_0000177 3300048926 Bacteria 129218
577 Ga0496123_0001000 3300048926 Bacteria 43259
578 Ga0496123_0003285 3300048926 Bacteria 18323
579 Ga0496123_0005016 3300048926 Bacteria 13549
580 Ga0496123_0005959 3300048926 Bacteria 12003
581 Ga0496123_0215385 3300048926 Bacteria 972
582 Ga0496123_0240750 3300048926 Bacteria 898
583 Ga0496124_0000026 3300048927 Bacteria 385387
584 Ga0496124_0000058 3300048927 Bacteria 242191
585 Ga0496124_0000246 3300048927 Bacteria 104777
586 Ga0496124_0000496 3300048927 Bacteria 67552
587 Ga0496124_0003737 3300048927 Bacteria 18344
588 Ga0496124_0004258 3300048927 Bacteria 16840
589 Ga0496124_0026202 3300048927 Bacteria 5262
590 Ga0496124_0036782 3300048927 Bacteria 4264
591 Ga0496124_0112630 3300048927 Bacteria 2187
592 Ga0496125_0001072 3300048928 Bacteria 42178
593 Ga0496125_0003468 3300048928 Bacteria 19086
594 Ga0496125_0004263 3300048928 Bacteria 16642
595 Ga0496125_0006018 3300048928 Bacteria 13270
596 Ga0496125_0015281 3300048928 Bacteria 7431
597 Ga0496125_0077588 3300048928 Bacteria 2559
598 Ga0496125_0100461 3300048928 Bacteria 2132
599 Ga0496126_0009982 3300048929 Bacteria 10024
600 Ga0496126_0010751 3300048929 Bacteria 9556
601 Ga0496126_0027891 3300048929 Bacteria 5386
602 Ga0496126_0321621 3300048929 Bacteria 1271
603 Ga0495678_000134 3300049459 Bacteria 88060
604 Ga0495678_001292 3300049459 Bacteria 20223
605 Ga0495678_110098 3300049459 Bacteria 940
606 Ga0495682_0000017 3300049460 Bacteria 233333
607 Ga0495682_0000424 3300049460 Bacteria 29663
608 Ga0501319_002409 3300049535 Bacteria 1182
609 Ga0501031_0167030 3300049568 Bacteria 1438
610 Ga0501033_0081147 3300049570 Bacteria 2379
611 Ga0501034_0000370 3300049571 Bacteria 76588
612 Ga0501034_0147031 3300049571 Bacteria 2334
613 Ga0501039_0050285 3300049575 Bacteria 3224
614 Ga0501040_0039070 3300049576 Bacteria 3227
615 Ga0501040_0373063 3300049576 Bacteria 1023
616 Ga0501041_0204072 3300049577 Bacteria 1239
617 Ga0501046_0284194 3300049580 Bacteria 1211
618 Ga0501047_0317461 3300049581 Bacteria 1398
619 Ga0501068_0065564 3300049584 Bacteria 2211
620 Ga0501071_0137832 3300049587 Bacteria 1816
621 Ga0501075_0069211 3300049591 Bacteria 2667
622 Ga0501081_0373077 3300049743 Bacteria 1053
623 Ga0501035_0035332 3300049822 Bacteria 4536
624 Ga0501044_0003067 3300049823 Bacteria 18910
625 Ga0501226_000079 3300049853 Bacteria 29272
626 nmdc:mga00v17_46703_c1 3300050491 Bacteria 2621
627 nmdc:mga00v17_50996_c1 3300050491 Bacteria 2516
628 Ga0500643_057712 3300053087 Bacteria 1095
629 Ga0500621_000048 3300053126 Bacteria 15257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100279255 Ga0070696_1002792552 228
2 3300005444 Ga0070694_100087223 Ga0070694_1000872233 230
3 iso_pu_bacteria 2547132416 2548652251 232
4 iso_pu_bacteria 2881609920 2881613914 232
5 3300009092 Ga0105250_10000042 Ga0105250_10000042104 233
6 3300003322 rootL2_10202333 rootL2_102023334 234
7 3300053087 Ga0500643_057712 Ga0500643_057712_162_869 234
8 3300023309 Ga0256744_141414 Ga0256744_1414141 235
9 3300009036 Ga0105244_10000338 Ga0105244_1000033818 236
10 3300009092 Ga0105250_10000542 Ga0105250_1000054216 236
11 3300046694 Ga0495649_0112441 Ga0495649_0112441_112_846 236
12 3300048917 Ga0496114_0843286 Ga0496114_0843286_74_784 236
13 3300048927 Ga0496124_0004258 Ga0496124_0004258_14076_14810 236
14 3300025942 Ga0207689_10305707 Ga0207689_103057071 239
15 3300031911 Ga0307412_10413110 Ga0307412_104131102 239
16 iso_pu_bacteria 2609459761 2609914486 240
17 iso_pu_bacteria 2648501241 2649121388 240
18 iso_pu_bacteria 2651869818 2652974494 240
19 iso_pu_bacteria 2706794495 2707100043 240
20 iso_pu_bacteria 2846540461 2846541030 240
21 iso_pu_bacteria 2904504865 2904506870 240
22 iso_pu_bacteria 2919493220 2919495659 240
23 iso_pu_bacteria 2919497567 2919498747 240
24 iso_pu_bacteria 2919543075 2919544626 240
25 iso_pu_bacteria 2923525760 2923527013 240
26 iso_pu_bacteria 2932406140 2932410329 240
27 iso_pu_bacteria 2939577877 2939582407 240
28 iso_pu_bacteria 2945874760 2945876461 240
29 iso_pu_bacteria 2510065053 2510284006 241
30 iso_pu_bacteria 2510065055 2510293321 241
31 iso_pu_bacteria 2510065058 2510312813 241
32 iso_pu_bacteria 2537561728 2538425749 241
33 iso_pu_bacteria 2565956521 2566035415 241
34 iso_pu_bacteria 2773857672 2774131952 241
35 iso_pu_bacteria 2854601825 2854603779 241
36 iso_pu_bacteria 2855195626 2855198273 241
37 iso_pu_bacteria 2858466076 2858467993 241
38 iso_pu_bacteria 2871272651 2871275863 241
39 iso_pu_bacteria 2871282230 2871283770 241
40 iso_pu_bacteria 2974298342 2974301377 241
41 iso_pu_bacteria 2984499530 2984503856 241
42 3300005471 Ga0070698_100135638 Ga0070698_1001356382 242
43 3300049570 Ga0501033_0081147 Ga0501033_0081147_889_1632 242
44 3300049581 Ga0501047_0317461 Ga0501047_0317461_507_1250 242
45 3300049822 Ga0501035_0035332 Ga0501035_0035332_2268_3011 242
46 3300049823 Ga0501044_0003067 Ga0501044_0003067_7802_8545 242
47 iso_pu_bacteria 2908669403 2908672231 242
48 iso_pu_bacteria 2917832318 2917836072 242
49 iso_pu_bacteria 2919125081 2919128221 242
50 iso_pu_bacteria 2984504281 2984507561 242
51 iso_pu_bacteria 8016728285 8016730309 242
52 3300005615 Ga0070702_100155902 Ga0070702_1001559022 243
53 3300005617 Ga0068859_100015807 Ga0068859_10001580711 243
54 3300006163 Ga0070715_10018108 Ga0070715_100181083 243
55 3300006178 Ga0075367_10416592 Ga0075367_104165922 243
56 3300006931 Ga0097620_100015807 Ga0097620_1000158072 243
57 3300007265 Ga0099794_10005207 Ga0099794_100052072 243
58 3300014326 Ga0157380_10371786 Ga0157380_103717862 243
59 3300014326 Ga0157380_10855410 Ga0157380_108554101 243
60 3300025905 Ga0207685_10039892 Ga0207685_100398922 243
61 3300025934 Ga0207686_10032842 Ga0207686_100328425 243
62 3300026075 Ga0207708_10361060 Ga0207708_103610602 243
63 3300027682 Ga0209971_1042692 Ga0209971_10426922 243
64 3300031665 Ga0316575_10000446 Ga0316575_1000044611 243
65 3300031691 Ga0316579_10000802 Ga0316579_100008027 243
66 3300031691 Ga0316579_10022759 Ga0316579_100227594 243
67 3300032137 Ga0316585_10004730 Ga0316585_100047302 243
68 3300032168 Ga0316593_10000082 Ga0316593_100000827 243
69 3300032168 Ga0316593_10024525 Ga0316593_100245253 243
70 3300035113 Ga0373936_0117312 Ga0373936_0117312_205_945 243
71 3300035692 Ga0373935_0065766 Ga0373935_0065766_1538_2278 243
72 3300035695 Ga0373927_0038654 Ga0373927_0038654_1460_2200 243
73 3300036401 Ga0373937_0345012 Ga0373937_0345012_227_967 243
74 3300037068 Ga0373925_0041279 Ga0373925_0041279_1306_2046 243
75 3300041492 Ga0451835_0706369 Ga0451835_0706369_415_1158 243
76 3300042003 Ga0439443_024958 Ga0439443_024958_133_876 243
77 3300042436 Ga0439435_0000397 Ga0439435_0000397_5495_6232 243
78 3300042461 Ga0439460_0000842 Ga0439460_0000842_6024_6761 243
79 3300042532 Ga0450893_0015838 Ga0450893_0015838_368_1105 243
80 3300049575 Ga0501039_0050285 Ga0501039_0050285_634_1371 243
81 3300049576 Ga0501040_0039070 Ga0501040_0039070_2342_3079 243
82 3300049576 Ga0501040_0373063 Ga0501040_0373063_110_853 243
83 3300049577 Ga0501041_0204072 Ga0501041_0204072_77_814 243
84 3300049580 Ga0501046_0284194 Ga0501046_0284194_194_931 243
85 3300049584 Ga0501068_0065564 Ga0501068_0065564_806_1543 243
86 3300049587 Ga0501071_0137832 Ga0501071_0137832_249_986 243
87 3300049591 Ga0501075_0069211 Ga0501075_0069211_1180_1917 243
88 3300049743 Ga0501081_0373077 Ga0501081_0373077_273_1010 243
89 iso_pu_bacteria 2506520007 2506576817 243
90 iso_pu_bacteria 2506520008 2506581955 243
91 iso_pu_bacteria 2508501071 2508850784 243
92 iso_pu_bacteria 2511231156 2511823048 243
93 iso_pu_bacteria 2547132181 2547698711 243
94 iso_pu_bacteria 2554235234 2555258217 243
95 iso_pu_bacteria 2561511199 2562463920 243
96 iso_pu_bacteria 2585427591 2585826114 243
97 iso_pu_bacteria 2585427592 2585831898 243
98 iso_pu_bacteria 2599185169 2599412824 243
99 iso_pu_bacteria 2600255254 2601525706 243
100 iso_pu_bacteria 2600255255 2601528002 243
101 iso_pu_bacteria 2600255256 2601533313 243
102 iso_pu_bacteria 2600255257 2601538677 243
103 iso_pu_bacteria 2600255280 2601614836 243
104 iso_pu_bacteria 2600255281 2601620239 243
105 iso_pu_bacteria 2600255287 2601646007 243
106 iso_pu_bacteria 2600255288 2601648641 243
107 iso_pu_bacteria 2600255289 2601652891 243
108 iso_pu_bacteria 2600255290 2601658992 243
109 iso_pu_bacteria 2600255291 2601666003 243
110 iso_pu_bacteria 2600255298 2601698964 243
111 iso_pu_bacteria 2600255299 2601703872 243
112 iso_pu_bacteria 2600255300 2601705542 243
113 iso_pu_bacteria 2600255301 2601711131 243
114 iso_pu_bacteria 2600255302 2601716145 243
115 iso_pu_bacteria 2600255303 2601723806 243
116 iso_pu_bacteria 2600255304 2601726551 243
117 iso_pu_bacteria 2600255305 2601731091 243
118 iso_pu_bacteria 2600255306 2601736107 243
119 iso_pu_bacteria 2600255307 2601743428 243
120 iso_pu_bacteria 2600255309 2601754214 243
121 iso_pu_bacteria 2600255310 2601757026 243
122 iso_pu_bacteria 2600255311 2601761519 243
123 iso_pu_bacteria 2600255392 2602021160 243
124 iso_pu_bacteria 2602042046 2603641669 243
125 iso_pu_bacteria 2602042047 2603643761 243
126 iso_pu_bacteria 2602042052 2603658942 243
127 iso_pu_bacteria 2602042053 2603663730 243
128 iso_pu_bacteria 2602042066 2603701035 243
129 iso_pu_bacteria 2602042067 2603704294 243
130 iso_pu_bacteria 2602042103 2603838489 243
131 iso_pu_bacteria 2602042104 2603844255 243
132 iso_pu_bacteria 2602042105 2603848640 243
133 iso_pu_bacteria 2602042106 2603853713 243
134 iso_pu_bacteria 2602042109 2603865057 243
135 iso_pu_bacteria 2602042110 2603871766 243
136 iso_pu_bacteria 2602042111 2603879323 243
137 iso_pu_bacteria 2603880178 2606048955 243
138 iso_pu_bacteria 2603880184 2606068156 243
139 iso_pu_bacteria 2603880202 2606146632 243
140 iso_pu_bacteria 2603880211 2606176360 243
141 iso_pu_bacteria 2636415599 2637223818 243
142 iso_pu_bacteria 2654587920 2656276213 243
143 iso_pu_bacteria 2667528172 2671104022 243
144 iso_pu_bacteria 2667528173 2671109666 243
145 iso_pu_bacteria 2671180115 2671588421 243
146 iso_pu_bacteria 2675903046 2676409573 243
147 iso_pu_bacteria 2681812866 2681998543 243
148 iso_pu_bacteria 2681812869 2682007650 243
149 iso_pu_bacteria 2687453601 2689443212 243
150 iso_pu_bacteria 2711768156 2712472645 243
151 iso_pu_bacteria 2751185917 2753857184 243
152 iso_pu_bacteria 2765235842 2765590283 243
153 iso_pu_bacteria 2772190666 2772437369 243
154 iso_pu_bacteria 2775506706 2775539775 243
155 iso_pu_bacteria 2775507074 2777020098 243
156 iso_pu_bacteria 2791354903 2791925379 243
157 iso_pu_bacteria 2791355010 2792314319 243
158 iso_pu_bacteria 2791355275 2793404511 243
159 iso_pu_bacteria 2806310673 2807177571 243
160 iso_pu_bacteria 2808606373 2808906921 243
161 iso_pu_bacteria 2811995292 2813727523 243
162 iso_pu_bacteria 2814123068 2814695068 243
163 iso_pu_bacteria 2821118458 2821120144 243
164 iso_pu_bacteria 2823373977 2823378567 243
165 iso_pu_bacteria 2825651385 2825653697 243
166 iso_pu_bacteria 2844425489 2844428623 243
167 iso_pu_bacteria 2844528606 2844530387 243
168 iso_pu_bacteria 2847797336 2847798566 243
169 iso_pu_bacteria 2852103415 2852105679 243
170 iso_pu_bacteria 2865014394 2865016256 243
171 iso_pu_bacteria 2869551831 2869552618 243
172 iso_pu_bacteria 2884086401 2884087554 243
173 iso_pu_bacteria 2888366609 2888367416 243
174 iso_pu_bacteria 2888373701 2888374892 243
175 iso_pu_bacteria 2891670763 2891673387 243
176 iso_pu_bacteria 2904474040 2904478086 243
177 iso_pu_bacteria 2904513164 2904518166 243
178 iso_pu_bacteria 2919108558 2919113936 243
179 iso_pu_bacteria 2919150387 2919153950 243
180 iso_pu_bacteria 2919481497 2919482827 243
181 iso_pu_bacteria 2923586266 2923591768 243
182 iso_pu_bacteria 2923634449 2923636183 243
183 iso_pu_bacteria 2927143783 2927147487 243
184 iso_pu_bacteria 2927833300 2927837327 243
185 iso_pu_bacteria 2935625433 2935629178 243
186 iso_pu_bacteria 2937539931 2937543932 243
187 iso_pu_bacteria 2937967321 2937970586 243
188 iso_pu_bacteria 2939568625 2939570927 243
189 iso_pu_bacteria 2939573065 2939577357 243
190 iso_pu_bacteria 2939607340 2939609948 243
191 iso_pu_bacteria 2939617950 2939621782 243
192 iso_pu_bacteria 2939642701 2939645037 243
193 iso_pu_bacteria 2969079654 2969080829 243
194 iso_pu_bacteria 2971820967 2971822225 243
195 iso_pu_bacteria 2974310843 2974315514 243
196 iso_pu_bacteria 2974435778 2974439686 243
197 iso_pu_bacteria 2984559226 2984563290 243
198 iso_pu_bacteria 2984595703 2984596025 243
199 iso_pu_bacteria 3000376612 3000378062 243
200 iso_pu_bacteria 640753048 640936369 243
201 iso_pu_bacteria 8004592986 8004597681 243
202 iso_pu_bacteria 8011350971 8011354296 243
203 iso_pu_bacteria 8015394850 8015399069 243
204 iso_pu_bacteria 8018221730 8018222666 243
205 iso_pu_bacteria 8018405270 8018405299 243
206 iso_pu_bacteria 8019504834 8019508900 243
207 iso_pu_bacteria 8054844752 8054847735 243
208 iso_pu_bacteria 8054849141 8054851566 243
209 iso_pu_bacteria 8055087960 8055088487 243
210 iso_pu_bacteria 8055092621 8055096855 243
211 iso_pu_bacteria 8055097453 8055098206 243
212 iso_pu_bacteria 8055693939 8055694754 243
213 iso_pu_bacteria 8057160832 8057163339 243
214 iso_pu_bacteria 8057304971 8057305436 243
215 3300004801 Ga0058860_12165330 Ga0058860_121653303 244
216 3300004801 Ga0058860_12187468 Ga0058860_121874683 244
217 3300005288 Ga0065714_10087702 Ga0065714_100877022 244
218 3300006871 Ga0075434_100202485 Ga0075434_1002024853 244
219 3300009011 Ga0105251_10001256 Ga0105251_100012566 244
220 3300009036 Ga0105244_10126386 Ga0105244_101263862 244
221 3300009036 Ga0105244_10189344 Ga0105244_101893442 244
222 3300009092 Ga0105250_10003580 Ga0105250_100035807 244
223 3300021384 Ga0213876_10000444 Ga0213876_1000044429 244
224 3300025711 Ga0207696_1000027 Ga0207696_10000277 244
225 3300025711 Ga0207696_1001031 Ga0207696_100103112 244
226 3300025728 Ga0207655_1014196 Ga0207655_10141966 244
227 3300025735 Ga0207713_1007366 Ga0207713_10073664 244
228 3300031239 Ga0265328_10000016 Ga0265328_1000001620 244
229 3300031665 Ga0316575_10011572 Ga0316575_100115723 244
230 3300031691 Ga0316579_10197790 Ga0316579_101977902 244
231 3300031711 Ga0265314_10121058 Ga0265314_101210581 244
232 3300032168 Ga0316593_10014396 Ga0316593_100143962 244
233 3300032168 Ga0316593_10026492 Ga0316593_100264922 244
234 3300032168 Ga0316593_10067079 Ga0316593_100670792 244
235 3300035692 Ga0373935_0313854 Ga0373935_0313854_112_858 244
236 3300036647 Ga0316582_0002520 Ga0316582_0002520_1717_2472 244
237 3300037588 Ga0316581_0073803 Ga0316581_0073803_107_862 244
238 3300039062 Ga0400483_213263 Ga0400483_213263_2189_2932 244
239 3300039437 Ga0436365_1801698 Ga0436365_1801698_11580_12317 244
240 3300046530 Ga0495654_0072730 Ga0495654_0072730_585_1334 244
241 3300046674 Ga0495588_0172530 Ga0495588_0172530_290_1039 244
242 3300047320 Ga0495672_0000145 Ga0495672_0000145_11969_12718 244
243 3300047446 Ga0495679_001169 Ga0495679_001169_13975_14724 244
244 3300048923 Ga0496120_0002287 Ga0496120_0002287_11021_11785 244
245 3300048926 Ga0496123_0005959 Ga0496123_0005959_11037_11774 244
246 3300048927 Ga0496124_0003737 Ga0496124_0003737_6558_7322 244
247 3300009011 Ga0105251_10007540 Ga0105251_100075404 245
248 3300013100 Ga0157373_10146750 Ga0157373_101467502 245
249 3300013102 Ga0157371_10023605 Ga0157371_100236056 245
250 3300013105 Ga0157369_10038217 Ga0157369_100382176 245
251 3300022467 Ga0224712_10079925 Ga0224712_100799252 245
252 3300025728 Ga0207655_1077163 Ga0207655_10771632 245
253 3300025735 Ga0207713_1033358 Ga0207713_10333583 245
254 3300031824 Ga0307413_10060321 Ga0307413_100603213 246
255 3300048919 Ga0496116_0001120 Ga0496116_0001120_14914_15684 246
256 iso_pu_bacteria 2511231004 2511253962 246
257 iso_pu_bacteria 2511231007 2511274248 246
258 iso_pu_bacteria 2511231008 2511277052 246
259 iso_pu_bacteria 2511231010 2511289983 246
260 iso_pu_bacteria 2511231011 2511297646 246
261 iso_pu_bacteria 2511231012 2511300622 246
262 iso_pu_bacteria 2511231014 2511315597 246
263 iso_pu_bacteria 2511231016 2511329238 246
264 iso_pu_bacteria 2511231017 2511332375 246
265 iso_pu_bacteria 2511231018 2511336604 246
266 iso_pu_bacteria 2511231019 2511346054 246
267 iso_pu_bacteria 2511231020 2511352767 246
268 iso_pu_bacteria 2511231021 2511355797 246
269 iso_pu_bacteria 2511231022 2511362578 246
270 iso_pu_bacteria 2511231024 2511375311 246
271 iso_pu_bacteria 2554235231 2555247755 246
272 iso_pu_bacteria 2597489888 2597865781 246
273 iso_pu_bacteria 2597489889 2597871597 246
274 iso_pu_bacteria 2599185155 2599328390 246
275 iso_pu_bacteria 2599185160 2599355057 246
276 iso_pu_bacteria 2599185161 2599361119 246
277 iso_pu_bacteria 2599185162 2599367441 246
278 iso_pu_bacteria 2599185163 2599374231 246
279 iso_pu_bacteria 2599185164 2599380163 246
280 iso_pu_bacteria 2599185165 2599386610 246
281 iso_pu_bacteria 2599185166 2599393089 246
282 iso_pu_bacteria 2599185167 2599399866 246
283 iso_pu_bacteria 2599185168 2599404856 246
284 iso_pu_bacteria 2599185179 2599452649 246
285 iso_pu_bacteria 2599185181 2599461891 246
286 iso_pu_bacteria 2599185182 2599467066 246
287 iso_pu_bacteria 2599185186 2599491016 246
288 iso_pu_bacteria 2599185188 2599501154 246
289 iso_pu_bacteria 2599185189 2599508266 246
290 iso_pu_bacteria 2599185190 2599514320 246
291 iso_pu_bacteria 2599185191 2599521556 246
292 iso_pu_bacteria 2599185248 2599770775 246
293 iso_pu_bacteria 2599185288 2599881914 246
294 iso_pu_bacteria 2599185289 2599886653 246
295 iso_pu_bacteria 2599185290 2599893696 246
296 iso_pu_bacteria 2599185291 2599897022 246
297 iso_pu_bacteria 2599185300 2599934710 246
298 iso_pu_bacteria 2599185302 2599943024 246
299 iso_pu_bacteria 2599185303 2599951688 246
300 iso_pu_bacteria 2599185304 2599953937 246
301 iso_pu_bacteria 2599185305 2599959447 246
302 iso_pu_bacteria 2599185306 2599968032 246
303 iso_pu_bacteria 2599185307 2599974213 246
304 iso_pu_bacteria 2599185308 2599979245 246
305 iso_pu_bacteria 2599185309 2599985320 246
306 iso_pu_bacteria 2599185310 2599987244 246
307 iso_pu_bacteria 2599185311 2599995446 246
308 iso_pu_bacteria 2599185312 2599999927 246
309 iso_pu_bacteria 2599185313 2600008814 246
310 iso_pu_bacteria 2599185314 2600013130 246
311 iso_pu_bacteria 2599185315 2600016642 246
312 iso_pu_bacteria 2599185316 2600025337 246
313 iso_pu_bacteria 2599185317 2600029607 246
314 iso_pu_bacteria 2599185319 2600041348 246
315 iso_pu_bacteria 2599185320 2600045571 246
316 iso_pu_bacteria 2599185321 2600056612 246
317 iso_pu_bacteria 2599185323 2600063853 246
318 iso_pu_bacteria 2599185324 2600074154 246
319 iso_pu_bacteria 2599185325 2600079818 246
320 iso_pu_bacteria 2599185356 2600214513 246
321 iso_pu_bacteria 2600254930 2600358285 246
322 iso_pu_bacteria 2600255283 2601626344 246
323 iso_pu_bacteria 2600255296 2601692771 246
324 iso_pu_bacteria 2600255313 2601774782 246
325 iso_pu_bacteria 2600255318 2601800090 246
326 iso_pu_bacteria 2603880185 2606074645 246
327 iso_pu_bacteria 2603880199 2606127508 246
328 iso_pu_bacteria 2619619299 2621297756 246
329 iso_pu_bacteria 2623620443 2624478837 246
330 iso_pu_bacteria 2623620446 2624494120 246
331 iso_pu_bacteria 2643221565 2643842464 246
332 iso_pu_bacteria 2643221571 2643873642 246
333 iso_pu_bacteria 2643221589 2643955326 246
334 iso_pu_bacteria 2643221602 2644023678 246
335 iso_pu_bacteria 2643221633 2644188146 246
336 iso_pu_bacteria 2643221650 2644281571 246
337 iso_pu_bacteria 2643221713 2644623436 246
338 iso_pu_bacteria 2651869719 2652548216 246
339 iso_pu_bacteria 2667528170 2671094479 246
340 iso_pu_bacteria 2667528171 2671097658 246
341 iso_pu_bacteria 2667528176 2671127908 246
342 iso_pu_bacteria 2675903420 2677897942 246
343 iso_pu_bacteria 2675903515 2678261579 246
344 iso_pu_bacteria 2713897149 2715757554 246
345 iso_pu_bacteria 2721755607 2723250513 246
346 iso_pu_bacteria 2738541265 2738670892 246
347 iso_pu_bacteria 2738541271 2738689872 246
348 iso_pu_bacteria 2738541282 2738749286 246
349 iso_pu_bacteria 2738541294 2738811304 246
350 iso_pu_bacteria 2738541303 2738858327 246
351 iso_pu_bacteria 2738541309 2738898664 246
352 iso_pu_bacteria 2738543004 2739196581 246
353 iso_pu_bacteria 2738543015 2739257560 246
354 iso_pu_bacteria 2738543016 2739265646 246
355 iso_pu_bacteria 2738543020 2739286505 246
356 iso_pu_bacteria 2738543021 2739291818 246
357 iso_pu_bacteria 2744054620 2745007928 246
358 iso_pu_bacteria 2765235841 2765582247 246
359 iso_pu_bacteria 2773857670 2774122183 246
360 iso_pu_bacteria 2773857673 2774136684 246
361 iso_pu_bacteria 2784132063 2784260436 246
362 iso_pu_bacteria 2784132072 2784314428 246
363 iso_pu_bacteria 2791355520 2794594376 246
364 iso_pu_bacteria 2806310737 2807409883 246
365 iso_pu_bacteria 2806310745 2807458231 246
366 iso_pu_bacteria 2808606361 2808854100 246
367 iso_pu_bacteria 2808606376 2808923391 246
368 iso_pu_bacteria 2808606377 2808928738 246
369 iso_pu_bacteria 2808606378 2808934132 246
370 iso_pu_bacteria 2808606380 2808945334 246
371 iso_pu_bacteria 2808606381 2808950859 246
372 iso_pu_bacteria 2808606382 2808956662 246
373 iso_pu_bacteria 2808606383 2808962467 246
374 iso_pu_bacteria 2808606385 2808980209 246
375 iso_pu_bacteria 2808606388 2808995968 246
376 iso_pu_bacteria 2808606389 2808997492 246
377 iso_pu_bacteria 2808606445 2809215778 246
378 iso_pu_bacteria 2811994881 2812370900 246
379 iso_pu_bacteria 2816332298 2817493110 246
380 iso_pu_bacteria 2818991456 2819658394 246
381 iso_pu_bacteria 2818991464 2819702741 246
382 iso_pu_bacteria 2826581358 2826584152 246
383 iso_pu_bacteria 2834028612 2834034207 246
384 iso_pu_bacteria 2842805378 2842808874 246
385 iso_pu_bacteria 2842815866 2842820918 246
386 iso_pu_bacteria 2842826826 2842829738 246
387 iso_pu_bacteria 2842837860 2842843190 246
388 iso_pu_bacteria 2842849001 2842849673 246
389 iso_pu_bacteria 2842854478 2842857252 246
390 iso_pu_bacteria 2844665904 2844668559 246
391 iso_pu_bacteria 2852612431 2852612505 246
392 iso_pu_bacteria 2852657418 2852662704 246
393 iso_pu_bacteria 2852667396 2852669759 246
394 iso_pu_bacteria 2860339153 2860340619 246
395 iso_pu_bacteria 2860867994 2860872196 246
396 iso_pu_bacteria 2878029506 2878030801 246
397 iso_pu_bacteria 2880230671 2880231716 246
398 iso_pu_bacteria 2904518522 2904520750 246
399 iso_pu_bacteria 2904550169 2904553078 246
400 iso_pu_bacteria 2908446538 2908451701 246
401 iso_pu_bacteria 2912963787 2912964895 246
402 iso_pu_bacteria 2913036834 2913037920 246
403 iso_pu_bacteria 2916178963 2916180227 246
404 iso_pu_bacteria 2917070673 2917071819 246
405 iso_pu_bacteria 2919063839 2919064693 246
406 iso_pu_bacteria 2919155634 2919160184 246
407 iso_pu_bacteria 2919456309 2919458264 246
408 iso_pu_bacteria 2919697872 2919699964 246
409 iso_pu_bacteria 2923519811 2923525005 246
410 iso_pu_bacteria 2929144301 2929145372 246
411 iso_pu_bacteria 2929189879 2929194310 246
412 iso_pu_bacteria 2931369376 2931371288 246
413 iso_pu_bacteria 2931390751 2931395582 246
414 iso_pu_bacteria 2931396565 2931399478 246
415 iso_pu_bacteria 2935353572 2935353992 246
416 iso_pu_bacteria 2939636861 2939637046 246
417 iso_pu_bacteria 2939651529 2939653253 246
418 iso_pu_bacteria 2945928738 2945931747 246
419 iso_pu_bacteria 2945961074 2945961384 246
420 iso_pu_bacteria 2946006987 2946007830 246
421 iso_pu_bacteria 2946027586 2946032795 246
422 iso_pu_bacteria 2947233263 2947233554 246
423 iso_pu_bacteria 2988728565 2988732916 246
424 iso_pu_bacteria 2990196909 2990200576 246
425 iso_pu_bacteria 3007511990 3007512443 246
426 iso_pu_bacteria 3007619802 3007624334 246
427 iso_pu_bacteria 3007718800 3007721430 246
428 iso_pu_bacteria 3007803356 3007803761 246
429 iso_pu_bacteria 3007866637 3007871270 246
430 iso_pu_bacteria 3007872151 3007876204 246
431 iso_pu_bacteria 637000220 637318436 246
432 iso_pu_bacteria 8019769354 8019773305 246
433 iso_pu_bacteria 8019775933 8019776630 246
434 iso_pu_bacteria 8052494512 8052495698 246
435 iso_pu_bacteria 8054285046 8054286175 246
436 iso_pu_bacteria 8054347763 8054351137 246
437 iso_pu_bacteria 8054503363 8054508096 246
438 iso_pu_bacteria 8054929484 8054929508 246
439 iso_pu_bacteria 8055817908 8055823049 246
440 iso_pu_bacteria 8055878733 8055883259 246
441 iso_pu_bacteria 8056115690 8056120234 246
442 iso_pu_bacteria 8056120720 8056121916 246
443 iso_pu_bacteria 8056125926 8056130798 246
444 iso_pu_bacteria 8056131705 8056136463 246
445 iso_pu_bacteria 8056137416 8056141858 246
446 iso_pu_bacteria 8056143049 8056147909 246
447 iso_pu_bacteria 8056148874 8056153493 246
448 iso_pu_bacteria 8056155041 8056155572 246
449 iso_pu_bacteria 8056161164 8056162716 246
450 iso_pu_bacteria 8056172158 8056176116 246
451 iso_pu_bacteria 8056177738 8056183413 246
452 iso_pu_bacteria 8056569372 8056569718 246
453 iso_pu_bacteria 8057798959 8057803333 246
454 3300002771 JGI25163J39215_1000022 JGI25163J39215_100002246 247
455 3300002772 JGI25164J39214_1000008 JGI25164J39214_100000834 247
456 3300002773 JGI25152J39213_1000802 JGI25152J39213_100080216 247
457 3300003320 rootH2_10027710 rootH2_1002771024 247
458 3300003751 Ga0055538_1000014 Ga0055538_100001434 247
459 3300003752 Ga0055539_1000020 Ga0055539_1000020264 247
460 3300003756 Ga0055533_1000027 Ga0055533_100002734 247
461 3300003759 Ga0055525_1000032 Ga0055525_1000032264 247
462 3300003841 Ga0055541_1000014 Ga0055541_1000014264 247
463 3300004801 Ga0058860_10169596 Ga0058860_101695962 247
464 3300004801 Ga0058860_10195578 Ga0058860_101955782 247
465 3300005272 Ga0065703_1020270 Ga0065703_10202703 247
466 3300005289 Ga0065704_10000888 Ga0065704_100008882 247
467 3300005289 Ga0065704_10002842 Ga0065704_1000284214 247
468 3300005289 Ga0065704_10004084 Ga0065704_100040841 247
469 3300005289 Ga0065704_10026246 Ga0065704_100262461 247
470 3300005289 Ga0065704_10139924 Ga0065704_101399242 247
471 3300005548 Ga0070665_100007341 Ga0070665_10000734114 247
472 3300005577 Ga0068857_100073160 Ga0068857_1000731604 247
473 3300005834 Ga0068851_10012067 Ga0068851_100120674 247
474 3300005834 Ga0068851_10064435 Ga0068851_100644352 247
475 3300006051 Ga0075364_10007670 Ga0075364_100076707 247
476 3300006051 Ga0075364_10326818 Ga0075364_103268182 247
477 3300006946 Ga0079104_1000720 Ga0079104_100072019 247
478 3300006946 Ga0079104_1000769 Ga0079104_10007692 247
479 3300006946 Ga0079104_1015557 Ga0079104_10155574 247
480 3300006946 Ga0079104_1020880 Ga0079104_10208801 247
481 3300006946 Ga0079104_1027141 Ga0079104_10271412 247
482 3300009011 Ga0105251_10057196 Ga0105251_100571963 247
483 3300009011 Ga0105251_10059849 Ga0105251_100598493 247
484 3300009011 Ga0105251_10126641 Ga0105251_101266411 247
485 3300009011 Ga0105251_10158084 Ga0105251_101580842 247
486 3300009036 Ga0105244_10000932 Ga0105244_1000093232 247
487 3300009036 Ga0105244_10002378 Ga0105244_1000237813 247
488 3300009036 Ga0105244_10003891 Ga0105244_1000389113 247
489 3300009036 Ga0105244_10049440 Ga0105244_100494402 247
490 3300009036 Ga0105244_10075100 Ga0105244_100751003 247
491 3300009036 Ga0105244_10141536 Ga0105244_101415362 247
492 3300009036 Ga0105244_10182263 Ga0105244_101822632 247
493 3300009092 Ga0105250_10000611 Ga0105250_1000061110 247
494 3300009092 Ga0105250_10001268 Ga0105250_100012687 247
495 3300009092 Ga0105250_10001773 Ga0105250_100017732 247
496 3300009092 Ga0105250_10094222 Ga0105250_100942222 247
497 3300009092 Ga0105250_10130066 Ga0105250_101300662 247
498 3300009101 Ga0105247_10000301 Ga0105247_1000030123 247
499 3300009148 Ga0105243_10010660 Ga0105243_100106608 247
500 3300009148 Ga0105243_10238632 Ga0105243_102386323 247
501 3300009174 Ga0105241_10000008 Ga0105241_10000008290 247
502 3300009545 Ga0105237_10001243 Ga0105237_1000124315 247
503 3300009545 Ga0105237_10174419 Ga0105237_101744193 247
504 3300009828 Ga0130087_1027949 Ga0130087_10279492 247
505 3300011119 Ga0105246_10056158 Ga0105246_100561583 247
506 3300013100 Ga0157373_10000463 Ga0157373_1000046329 247
507 3300013100 Ga0157373_10155477 Ga0157373_101554772 247
508 3300013102 Ga0157371_10001008 Ga0157371_100010086 247
509 3300013104 Ga0157370_10002229 Ga0157370_1000222921 247
510 3300013104 Ga0157370_10004489 Ga0157370_1000448917 247
511 3300013104 Ga0157370_10006004 Ga0157370_100060043 247
512 3300013105 Ga0157369_10000956 Ga0157369_100009564 247
513 3300013306 Ga0163162_10044620 Ga0163162_100446205 247
514 3300013306 Ga0163162_10279941 Ga0163162_102799412 247
515 3300013307 Ga0157372_10008877 Ga0157372_100088775 247
516 3300013307 Ga0157372_10512069 Ga0157372_105120692 247
517 3300014497 Ga0182008_10001425 Ga0182008_100014256 247
518 3300015261 Ga0182006_1000069 Ga0182006_100006915 247
519 3300015679 Ga0183366_1002 Ga0183366_100218 247
520 3300015680 Ga0183370_1002 Ga0183370_100218 247
521 3300015685 Ga0183369_1002 Ga0183369_100218 247
522 3300015687 Ga0183368_1005 Ga0183368_100518 247
523 3300017792 Ga0163161_10000002 Ga0163161_10000002341 247
524 3300020070 Ga0206356_11158939 Ga0206356_111589391 247
525 3300020077 Ga0206351_10013078 Ga0206351_100130784 247
526 3300020078 Ga0206352_10402763 Ga0206352_104027632 247
527 3300020081 Ga0206354_10196568 Ga0206354_101965682 247
528 3300020610 Ga0154015_1698326 Ga0154015_16983262 247
529 3300023304 Ga0256714_107509 Ga0256714_1075093 247
530 3300025207 Ga0209760_100086 Ga0209760_10008634 247
531 3300025224 Ga0209784_100030 Ga0209784_10003034 247
532 3300025225 Ga0209566_100034 Ga0209566_10003434 247
533 3300025226 Ga0209674_100052 Ga0209674_10005234 247
534 3300025230 Ga0209563_100054 Ga0209563_10005434 247
535 3300025231 Ga0207427_100035 Ga0207427_10003534 247
536 3300025233 Ga0209437_100068 Ga0209437_10006834 247
537 3300025253 Ga0209677_100032 Ga0209677_10003234 247
538 3300025258 Ga0209129_1000103 Ga0209129_1000103124 247
539 3300025321 Ga0207656_10004274 Ga0207656_100042745 247
540 3300025711 Ga0207696_1000008 Ga0207696_100000814 247
541 3300025711 Ga0207696_1000009 Ga0207696_100000934 247
542 3300025711 Ga0207696_1000278 Ga0207696_100027861 247
543 3300025711 Ga0207696_1001146 Ga0207696_100114610 247
544 3300025711 Ga0207696_1001494 Ga0207696_100149414 247
545 3300025711 Ga0207696_1003240 Ga0207696_10032403 247
546 3300025728 Ga0207655_1000020 Ga0207655_1000020467 247
547 3300025728 Ga0207655_1000054 Ga0207655_100005414 247
548 3300025728 Ga0207655_1000103 Ga0207655_100010318 247
549 3300025728 Ga0207655_1000569 Ga0207655_100056917 247
550 3300025728 Ga0207655_1000721 Ga0207655_100072113 247
551 3300025728 Ga0207655_1000752 Ga0207655_100075214 247
552 3300025728 Ga0207655_1001231 Ga0207655_100123113 247
553 3300025728 Ga0207655_1006303 Ga0207655_10063034 247
554 3300025735 Ga0207713_1000123 Ga0207713_100012388 247
555 3300025735 Ga0207713_1000129 Ga0207713_1000129123 247
556 3300025735 Ga0207713_1000223 Ga0207713_100022381 247
557 3300025735 Ga0207713_1001297 Ga0207713_10012977 247
558 3300025735 Ga0207713_1008261 Ga0207713_10082617 247
559 3300025900 Ga0207710_10000061 Ga0207710_1000006135 247
560 3300025911 Ga0207654_10000009 Ga0207654_10000009290 247
561 3300025913 Ga0207695_10164949 Ga0207695_101649492 247
562 3300025935 Ga0207709_10050415 Ga0207709_100504154 247
563 3300026116 Ga0207674_10088438 Ga0207674_100884384 247
564 3300027111 Ga0209281_1000054 Ga0209281_1000054270 247
565 3300027111 Ga0209281_1000056 Ga0209281_1000056280 247
566 3300027111 Ga0209281_1000371 Ga0209281_100037167 247
567 3300027111 Ga0209281_1000505 Ga0209281_100050562 247
568 3300027111 Ga0209281_1000576 Ga0209281_100057614 247
569 3300027111 Ga0209281_1000683 Ga0209281_10006832 247
570 3300027111 Ga0209281_1001352 Ga0209281_10013525 247
571 3300027111 Ga0209281_1013772 Ga0209281_10137723 247
572 3300027111 Ga0209281_1022875 Ga0209281_10228752 247
573 3300027312 Ga0209371_1000013 Ga0209371_100001319 247
574 3300027312 Ga0209371_1000049 Ga0209371_100004911 247
575 3300027312 Ga0209371_1000582 Ga0209371_10005826 247
576 3300027312 Ga0209371_1000935 Ga0209371_10009352 247
577 3300027312 Ga0209371_1002216 Ga0209371_100221613 247
578 3300027312 Ga0209371_1018024 Ga0209371_10180241 247
579 3300027312 Ga0209371_1022298 Ga0209371_10222982 247
580 3300028379 Ga0268266_10000211 Ga0268266_1000021189 247
581 3300030500 Ga0268256_1000014 Ga0268256_1000014658 247
582 3300030500 Ga0268256_1000031 Ga0268256_1000031375 247
583 3300030500 Ga0268256_1000227 Ga0268256_100022739 247
584 3300030500 Ga0268256_1001942 Ga0268256_100194213 247
585 3300030500 Ga0268256_1020097 Ga0268256_10200973 247
586 3300035398 Ga0316574_0222461 Ga0316574_0222461_41_793 247
587 3300036712 Ga0316584_0304221 Ga0316584_0304221_385_1137 247
588 3300041405 Ga0439438_000042 Ga0439438_000042_11808_12572 247
589 3300041405 Ga0439438_004959 Ga0439438_004959_2747_3517 247
590 3300041405 Ga0439438_007456 Ga0439438_007456_483_1250 247
591 3300041405 Ga0439438_008294 Ga0439438_008294_1132_1896 247
592 3300041407 Ga0439447_000338 Ga0439447_000338_11116_11880 247
593 3300041407 Ga0439447_005050 Ga0439447_005050_1010_1774 247
594 3300041407 Ga0439447_005875 Ga0439447_005875_1362_2132 247
595 3300041411 Ga0439466_0000004 Ga0439466_0000004_11099_11863 247
596 3300041486 Ga0451807_0192210 Ga0451807_0192210_281_1045 247
597 3300041512 Ga0451853_0953173 Ga0451853_0953173_145_912 247
598 3300041512 Ga0451853_1281195 Ga0451853_1281195_228_992 247
599 3300041907 Ga0452268_32449 Ga0452268_32449_428_1201 247
600 3300042006 Ga0439432_008690 Ga0439432_008690_571_1338 247
601 3300042006 Ga0439432_028853 Ga0439432_028853_677_1441 247
602 3300042010 Ga0439452_000013 Ga0439452_000013_348542_349309 247
603 3300042010 Ga0439452_000094 Ga0439452_000094_74269_75036 247
604 3300042010 Ga0439452_000121 Ga0439452_000121_32258_33028 247
605 3300042012 Ga0439455_0044352 Ga0439455_0044352_257_1000 247
606 3300042013 Ga0439456_008965 Ga0439456_008965_577_1350 247
607 3300042016 Ga0439463_003608 Ga0439463_003608_1140_1904 247
608 3300042115 Ga0450911_000317 Ga0450911_000317_4872_5615 247
609 3300042136 Ga0450900_001029 Ga0450900_001029_995_1762 247
610 3300042137 Ga0450902_004495 Ga0450902_004495_44_787 247
611 3300042139 Ga0450904_000557 Ga0450904_000557_1411_2154 247
612 3300042146 Ga0450907_000648 Ga0450907_000648_1393_2157 247
613 3300042156 Ga0439446_0002561 Ga0439446_0002561_388_1131 247
614 3300042438 Ga0439459_0002610 Ga0439459_0002610_1341_2084 247
615 3300042439 Ga0439464_0002684 Ga0439464_0002684_2049_2813 247
616 3300042532 Ga0450893_0002336 Ga0450893_0002336_798_1541 247
617 3300044669 Ga0466981_0000032 Ga0466981_0000032_13966_14733 247
618 3300046453 Ga0495627_000177 Ga0495627_000177_58398_59165 247
619 3300046458 Ga0495591_000222 Ga0495591_000222_52232_52996 247
620 3300046458 Ga0495591_000590 Ga0495591_000590_16079_16846 247
621 3300046458 Ga0495591_037354 Ga0495591_037354_164_928 247
622 3300046471 Ga0495650_0000059 Ga0495650_0000059_295132_295899 247
623 3300046471 Ga0495650_0000120 Ga0495650_0000120_25826_26599 247
624 3300046500 Ga0495596_0009946 Ga0495596_0009946_1274_2038 247
625 3300046519 Ga0495632_0039573 Ga0495632_0039573_1264_2037 247
626 3300046522 Ga0495643_0025859 Ga0495643_0025859_1462_2226 247
627 3300046524 Ga0495648_0068718 Ga0495648_0068718_1108_1872 247
628 3300046530 Ga0495654_0000148 Ga0495654_0000148_16253_17020 247
629 3300046530 Ga0495654_0001237 Ga0495654_0001237_12492_13256 247
630 3300046794 Ga0495589_0000023 Ga0495589_0000023_28062_28829 247
631 3300046810 Ga0495660_0000063 Ga0495660_0000063_102724_103497 247
632 3300047320 Ga0495672_0000025 Ga0495672_0000025_353470_354234 247
633 3300047446 Ga0495679_011720 Ga0495679_011720_1173_1937 247
634 3300047469 Ga0495673_0000176 Ga0495673_0000176_16044_16811 247
635 3300048903 Ga0496100_0030607 Ga0496100_0030607_1575_2339 247
636 3300048903 Ga0496100_0034666 Ga0496100_0034666_1926_2690 247
637 3300048904 Ga0496101_0000624 Ga0496101_0000624_10031_10795 247
638 3300048905 Ga0496102_0113265 Ga0496102_0113265_1695_2459 247
639 3300048907 Ga0496104_0017702 Ga0496104_0017702_355_1122 247
640 3300048907 Ga0496104_0040576 Ga0496104_0040576_2085_2858 247
641 3300048908 Ga0496105_0032860 Ga0496105_0032860_1700_2464 247
642 3300048908 Ga0496105_0070984 Ga0496105_0070984_355_1122 247
643 3300048916 Ga0496113_0074743 Ga0496113_0074743_1042_1809 247
644 3300048919 Ga0496116_0000015 Ga0496116_0000015_29512_30279 247
645 3300048919 Ga0496116_0000096 Ga0496116_0000096_25716_26489 247
646 3300048919 Ga0496116_0005667 Ga0496116_0005667_373_1140 247
647 3300048919 Ga0496116_0042872 Ga0496116_0042872_2115_2879 247
648 3300048919 Ga0496116_0052156 Ga0496116_0052156_958_1722 247
649 3300048919 Ga0496116_0115965 Ga0496116_0115965_698_1465 247
650 3300048920 Ga0496117_0002805 Ga0496117_0002805_1199_1966 247
651 3300048920 Ga0496117_0003581 Ga0496117_0003581_16084_16857 247
652 3300048920 Ga0496117_0036499 Ga0496117_0036499_373_1140 247
653 3300048920 Ga0496117_0052208 Ga0496117_0052208_1129_1899 247
654 3300048920 Ga0496117_0070014 Ga0496117_0070014_1457_2221 247
655 3300048921 Ga0496118_0024462 Ga0496118_0024462_4192_4959 247
656 3300048921 Ga0496118_0085790 Ga0496118_0085790_278_1048 247
657 3300048921 Ga0496118_0094132 Ga0496118_0094132_704_1471 247
658 3300048921 Ga0496118_0185699 Ga0496118_0185699_180_944 247
659 3300048922 Ga0496119_0000355 Ga0496119_0000355_32276_33046 247
660 3300048922 Ga0496119_0003653 Ga0496119_0003653_6568_7332 247
661 3300048922 Ga0496119_0004492 Ga0496119_0004492_10745_11509 247
662 3300048922 Ga0496119_0009362 Ga0496119_0009362_7145_7912 247
663 3300048922 Ga0496119_0022030 Ga0496119_0022030_3412_4179 247
664 3300048922 Ga0496119_0110181 Ga0496119_0110181_666_1433 247
665 3300048923 Ga0496120_0002244 Ga0496120_0002244_11062_11826 247
666 3300048923 Ga0496120_0002586 Ga0496120_0002586_8329_9093 247
667 3300048923 Ga0496120_0011502 Ga0496120_0011502_4679_5452 247
668 3300048923 Ga0496120_0017896 Ga0496120_0017896_3412_4179 247
669 3300048923 Ga0496120_0034663 Ga0496120_0034663_1393_2163 247
670 3300048923 Ga0496120_0128423 Ga0496120_0128423_217_984 247
671 3300048924 Ga0496121_0003934 Ga0496121_0003934_8702_9466 247
672 3300048924 Ga0496121_0162610 Ga0496121_0162610_614_1381 247
673 3300048925 Ga0496122_0000170 Ga0496122_0000170_46709_47476 247
674 3300048925 Ga0496122_0000213 Ga0496122_0000213_25856_26629 247
675 3300048925 Ga0496122_0006705 Ga0496122_0006705_12237_13004 247
676 3300048925 Ga0496122_0075834 Ga0496122_0075834_1046_1810 247
677 3300048925 Ga0496122_0246962 Ga0496122_0246962_181_951 247
678 3300048926 Ga0496123_0000058 Ga0496123_0000058_179140_179907 247
679 3300048926 Ga0496123_0000177 Ga0496123_0000177_102590_103363 247
680 3300048926 Ga0496123_0003285 Ga0496123_0003285_6836_7600 247
681 3300048926 Ga0496123_0240750 Ga0496123_0240750_98_865 247
682 3300048927 Ga0496124_0000026 Ga0496124_0000026_8869_9642 247
683 3300048927 Ga0496124_0000058 Ga0496124_0000058_228297_229064 247
684 3300048927 Ga0496124_0000246 Ga0496124_0000246_98142_98906 247
685 3300048927 Ga0496124_0000496 Ga0496124_0000496_65346_66116 247
686 3300048927 Ga0496124_0026202 Ga0496124_0026202_453_1217 247
687 3300048927 Ga0496124_0036782 Ga0496124_0036782_3061_3828 247
688 3300048928 Ga0496125_0001072 Ga0496125_0001072_30353_31120 247
689 3300048928 Ga0496125_0004263 Ga0496125_0004263_12038_12811 247
690 3300048928 Ga0496125_0006018 Ga0496125_0006018_1425_2189 247
691 3300048928 Ga0496125_0077588 Ga0496125_0077588_1678_2445 247
692 3300048928 Ga0496125_0100461 Ga0496125_0100461_241_1011 247
693 3300048929 Ga0496126_0009982 Ga0496126_0009982_7361_8131 247
694 3300048929 Ga0496126_0010751 Ga0496126_0010751_467_1240 247
695 3300048929 Ga0496126_0027891 Ga0496126_0027891_848_1612 247
696 3300048929 Ga0496126_0321621 Ga0496126_0321621_330_1094 247
697 3300049459 Ga0495678_110098 Ga0495678_110098_150_914 247
698 3300049853 Ga0501226_000079 Ga0501226_000079_4844_5587 247
699 3300050491 nmdc:mga00v17_46703_c1 nmdc:mga00v17_46703_c1_1388_2155 247
700 iso_pu_bacteria 2919688452 2919689991 247
701 3300005981 Ga0081538_10087104 Ga0081538_100871042 248
702 3300009098 Ga0105245_10155601 Ga0105245_101556013 248
703 3300009176 Ga0105242_10007385 Ga0105242_100073855 248
704 3300027378 Ga0209981_1003851 Ga0209981_10038513 248
705 3300027695 Ga0209966_1003526 Ga0209966_10035264 248
706 3300031548 Ga0307408_100298698 Ga0307408_1002986981 248
707 3300032002 Ga0307416_100350680 Ga0307416_1003506803 248
708 3300042001 Ga0439441_002360 Ga0439441_002360_1452_2204 248
709 3300046539 Ga0495621_0036552 Ga0495621_0036552_119_889 248
710 3300049568 Ga0501031_0167030 Ga0501031_0167030_221_979 248
711 3300001915 JGI24741J21665_1007693 JGI24741J21665_10076932 250
712 3300002738 JGI25154J39366_1004064 JGI25154J39366_10040644 250
713 3300003751 Ga0055538_1000028 Ga0055538_100002819 250
714 3300003752 Ga0055539_1000037 Ga0055539_100003719 250
715 3300003756 Ga0055533_1000047 Ga0055533_100004719 250
716 3300003758 Ga0055532_1000129 Ga0055532_100012953 250
717 3300003759 Ga0055525_1000443 Ga0055525_10004433 250
718 3300003781 Ga0055536_1003337 Ga0055536_10033373 250
719 3300003781 Ga0055536_1011775 Ga0055536_10117754 250
720 3300003791 Ga0055530_10007005 Ga0055530_100070054 250
721 3300003791 Ga0055530_10030977 Ga0055530_100309772 250
722 3300003794 Ga0055531_10006469 Ga0055531_100064697 250
723 3300003841 Ga0055541_1000025 Ga0055541_100002519 250
724 3300004801 Ga0058860_10094053 Ga0058860_100940533 250
725 3300005288 Ga0065714_10000238 Ga0065714_100002388 250
726 3300005288 Ga0065714_10081923 Ga0065714_100819233 250
727 3300005289 Ga0065704_10090186 Ga0065704_100901862 250
728 3300005290 Ga0065712_10003691 Ga0065712_100036916 250
729 3300005290 Ga0065712_10067863 Ga0065712_1006786314 250
730 3300005290 Ga0065712_10079070 Ga0065712_100790702 250
731 3300005293 Ga0065715_10133975 Ga0065715_101339752 250
732 3300005344 Ga0070661_100000022 Ga0070661_10000002270 250
733 3300005353 Ga0070669_100005661 Ga0070669_1000056614 250
734 3300006944 Ga0099823_1000054 Ga0099823_100005435 250
735 3300006946 Ga0079104_1002016 Ga0079104_10020162 250
736 3300009011 Ga0105251_10000151 Ga0105251_1000015124 250
737 3300009011 Ga0105251_10000156 Ga0105251_1000015618 250
738 3300009011 Ga0105251_10050570 Ga0105251_100505702 250
739 3300009036 Ga0105244_10000272 Ga0105244_100002723 250
740 3300009036 Ga0105244_10010841 Ga0105244_100108416 250
741 3300009036 Ga0105244_10115292 Ga0105244_101152922 250
742 3300009101 Ga0105247_10469645 Ga0105247_104696451 250
743 3300009148 Ga0105243_10024754 Ga0105243_100247545 250
744 3300009148 Ga0105243_10242685 Ga0105243_102426853 250
745 3300009148 Ga0105243_10361702 Ga0105243_103617022 250
746 3300013100 Ga0157373_10064357 Ga0157373_100643572 250
747 3300013104 Ga0157370_10002252 Ga0157370_1000225220 250
748 3300013104 Ga0157370_10033837 Ga0157370_100338376 250
749 3300013104 Ga0157370_10045091 Ga0157370_100450915 250
750 3300013307 Ga0157372_10004322 Ga0157372_1000432215 250
751 3300013307 Ga0157372_10070044 Ga0157372_100700444 250
752 3300017792 Ga0163161_10060323 Ga0163161_100603234 250
753 3300025206 Ga0209435_100363 Ga0209435_1003635 250
754 3300025207 Ga0209760_100463 Ga0209760_1004631 250
755 3300025224 Ga0209784_100032 Ga0209784_100032194 250
756 3300025225 Ga0209566_100036 Ga0209566_100036194 250
757 3300025226 Ga0209674_100054 Ga0209674_100054194 250
758 3300025229 Ga0209147_100055 Ga0209147_100055194 250
759 3300025230 Ga0209563_100055 Ga0209563_100055112 250
760 3300025231 Ga0207427_100001 Ga0207427_100001249 250
761 3300025233 Ga0209437_100003 Ga0209437_1000031123 250
762 3300025242 Ga0209258_100231 Ga0209258_1002318 250
763 3300025245 Ga0207425_1019345 Ga0207425_10193452 250
764 3300025246 Ga0209646_1000331 Ga0209646_10003314 250
765 3300025253 Ga0209677_100033 Ga0209677_100033194 250
766 3300025256 Ga0209759_1010939 Ga0209759_10109392 250
767 3300025261 Ga0209233_1000007 Ga0209233_1000007249 250
768 3300025263 Ga0209565_1038113 Ga0209565_10381131 250
769 3300025291 Ga0209675_1006388 Ga0209675_10063884 250
770 3300025292 Ga0209676_1000078 Ga0209676_1000078266 250
771 3300025292 Ga0209676_1000503 Ga0209676_100050359 250
772 3300025298 Ga0209050_1000041 Ga0209050_100004129 250
773 3300025298 Ga0209050_1000060 Ga0209050_100006080 250
774 3300025298 Ga0209050_1000425 Ga0209050_100042568 250
775 3300025303 Ga0209051_1000037 Ga0209051_100003781 250
776 3300025303 Ga0209051_1000061 Ga0209051_100006180 250
777 3300025303 Ga0209051_1000085 Ga0209051_100008529 250
778 3300025304 Ga0209257_1000635 Ga0209257_100063529 250
779 3300025304 Ga0209257_1011547 Ga0209257_10115475 250
780 3300025711 Ga0207696_1000032 Ga0207696_1000032175 250
781 3300025711 Ga0207696_1000034 Ga0207696_1000034285 250
782 3300025711 Ga0207696_1000129 Ga0207696_100012915 250
783 3300025711 Ga0207696_1000262 Ga0207696_100026262 250
784 3300025711 Ga0207696_1006426 Ga0207696_10064263 250
785 3300025711 Ga0207696_1006575 Ga0207696_10065753 250
786 3300025728 Ga0207655_1000357 Ga0207655_100035729 250
787 3300025728 Ga0207655_1000408 Ga0207655_100040823 250
788 3300025728 Ga0207655_1000828 Ga0207655_100082817 250
789 3300025728 Ga0207655_1007625 Ga0207655_10076252 250
790 3300025728 Ga0207655_1007768 Ga0207655_10077684 250
791 3300025728 Ga0207655_1024660 Ga0207655_10246604 250
792 3300025735 Ga0207713_1000014 Ga0207713_1000014148 250
793 3300025735 Ga0207713_1000163 Ga0207713_100016323 250
794 3300025735 Ga0207713_1004295 Ga0207713_10042959 250
795 3300025735 Ga0207713_1005559 Ga0207713_10055597 250
796 3300025735 Ga0207713_1005686 Ga0207713_10056868 250
797 3300025735 Ga0207713_1009429 Ga0207713_10094296 250
798 3300025735 Ga0207713_1037467 Ga0207713_10374673 250
799 3300025735 Ga0207713_1049253 Ga0207713_10492533 250
800 3300025923 Ga0207681_10390162 Ga0207681_103901621 250
801 3300025925 Ga0207650_10000092 Ga0207650_1000009277 250
802 3300025935 Ga0207709_10004825 Ga0207709_100048257 250
803 3300025935 Ga0207709_10014581 Ga0207709_100145814 250
804 3300025935 Ga0207709_10060080 Ga0207709_100600803 250
805 3300026041 Ga0207639_10005461 Ga0207639_100054613 250
806 3300027111 Ga0209281_1000010 Ga0209281_1000010159 250
807 3300027111 Ga0209281_1000049 Ga0209281_1000049243 250
808 3300027296 Ga0209389_1000002 Ga0209389_1000002295 250
809 3300027312 Ga0209371_1000572 Ga0209371_100057215 250
810 3300027378 Ga0209981_1006084 Ga0209981_10060843 250
811 3300027617 Ga0210002_1012214 Ga0210002_10122142 250
812 3300027665 Ga0209983_1004310 Ga0209983_10043104 250
813 3300027907 Ga0207428_10151233 Ga0207428_101512333 250
814 3300030500 Ga0268256_1000499 Ga0268256_100049915 250
815 3300030742 Ga0316183_1016295 Ga0316183_10162955 250
816 3300031548 Ga0307408_100392243 Ga0307408_1003922432 250
817 3300032168 Ga0316593_10032846 Ga0316593_100328461 250
818 3300039062 Ga0400483_105112 Ga0400483_105112_443_1243 250
819 3300041404 Ga0439436_0000220 Ga0439436_0000220_7164_7916 250
820 3300041405 Ga0439438_003009 Ga0439438_003009_2199_2951 250
821 3300041405 Ga0439438_004922 Ga0439438_004922_1429_2181 250
822 3300041407 Ga0439447_001723 Ga0439447_001723_1532_2284 250
823 3300041411 Ga0439466_0003385 Ga0439466_0003385_3410_4162 250
824 3300041997 Ga0439431_0003975 Ga0439431_0003975_1157_1909 250
825 3300042006 Ga0439432_003406 Ga0439432_003406_5137_5889 250
826 3300042125 Ga0450923_009020 Ga0450923_009020_453_1205 250
827 3300042142 Ga0450905_013876 Ga0450905_013876_313_1065 250
828 3300042156 Ga0439446_0002391 Ga0439446_0002391_1825_2577 250
829 3300046453 Ga0495627_005014 Ga0495627_005014_3316_4068 250
830 3300046458 Ga0495591_001740 Ga0495591_001740_8817_9572 250
831 3300046458 Ga0495591_005309 Ga0495591_005309_993_1745 250
832 3300046471 Ga0495650_0000008 Ga0495650_0000008_674307_675062 250
833 3300046474 Ga0495605_0000235 Ga0495605_0000235_38699_39451 250
834 3300046474 Ga0495605_0026549 Ga0495605_0026549_572_1327 250
835 3300046491 Ga0495584_0003803 Ga0495584_0003803_5504_6259 250
836 3300046492 Ga0495585_0023719 Ga0495585_0023719_2755_3507 250
837 3300046499 Ga0495594_0002336 Ga0495594_0002336_89_841 250
838 3300046501 Ga0495607_0000756 Ga0495607_0000756_2050_2802 250
839 3300046501 Ga0495607_0038294 Ga0495607_0038294_1156_1911 250
840 3300046506 Ga0495583_0000389 Ga0495583_0000389_38744_39496 250
841 3300046507 Ga0495606_0008629 Ga0495606_0008629_1914_2666 250
842 3300046512 Ga0495610_0014899 Ga0495610_0014899_900_1652 250
843 3300046515 Ga0495620_0000003 Ga0495620_0000003_81074_81826 250
844 3300046515 Ga0495620_0000900 Ga0495620_0000900_17381_18133 250
845 3300046519 Ga0495632_0003399 Ga0495632_0003399_10201_10953 250
846 3300046522 Ga0495643_0006448 Ga0495643_0006448_5710_6462 250
847 3300046523 Ga0495644_0009743 Ga0495644_0009743_1764_2519 250
848 3300046523 Ga0495644_0102312 Ga0495644_0102312_275_1027 250
849 3300046524 Ga0495648_0009903 Ga0495648_0009903_6428_7180 250
850 3300046524 Ga0495648_0057910 Ga0495648_0057910_32_787 250
851 3300046530 Ga0495654_0000218 Ga0495654_0000218_13134_13889 250
852 3300046530 Ga0495654_0007590 Ga0495654_0007590_4947_5699 250
853 3300046530 Ga0495654_0008728 Ga0495654_0008728_1367_2119 250
854 3300046530 Ga0495654_0041929 Ga0495654_0041929_1219_1971 250
855 3300046538 Ga0495609_0000006 Ga0495609_0000006_324999_325751 250
856 3300046538 Ga0495609_0000296 Ga0495609_0000296_17138_17890 250
857 3300046558 Ga0495633_0000309 Ga0495633_0000309_38741_39493 250
858 3300046648 Ga0495611_0208408 Ga0495611_0208408_127_879 250
859 3300046660 Ga0495625_0119230 Ga0495625_0119230_440_1192 250
860 3300046665 Ga0495661_0000224 Ga0495661_0000224_47325_48077 250
861 3300046665 Ga0495661_0000366 Ga0495661_0000366_32785_33537 250
862 3300046691 Ga0495670_0012315 Ga0495670_0012315_724_1476 250
863 3300046692 Ga0495671_0001722 Ga0495671_0001722_6045_6800 250
864 3300046692 Ga0495671_0024447 Ga0495671_0024447_1619_2371 250
865 3300046694 Ga0495649_0001477 Ga0495649_0001477_1362_2114 250
866 3300046694 Ga0495649_0037603 Ga0495649_0037603_1582_2334 250
867 3300046810 Ga0495660_0000019 Ga0495660_0000019_297081_297836 250
868 3300046810 Ga0495660_0013204 Ga0495660_0013204_112_864 250
869 3300046810 Ga0495660_0041034 Ga0495660_0041034_1479_2231 250
870 3300046810 Ga0495660_0055764 Ga0495660_0055764_1043_1795 250
871 3300047320 Ga0495672_0000003 Ga0495672_0000003_13252_14007 250
872 3300047320 Ga0495672_0016757 Ga0495672_0016757_2943_3695 250
873 3300047321 Ga0495676_0031220 Ga0495676_0031220_993_1748 250
874 3300047321 Ga0495676_0071324 Ga0495676_0071324_1220_1972 250
875 3300047323 Ga0495683_0000105 Ga0495683_0000105_29647_30399 250
876 3300047323 Ga0495683_0000201 Ga0495683_0000201_16343_17095 250
877 3300047323 Ga0495683_0007108 Ga0495683_0007108_338_1093 250
878 3300047446 Ga0495679_000263 Ga0495679_000263_20054_20806 250
879 3300047446 Ga0495679_000535 Ga0495679_000535_569_1321 250
880 3300047469 Ga0495673_0000011 Ga0495673_0000011_660283_661038 250
881 3300047469 Ga0495673_0003561 Ga0495673_0003561_9365_10117 250
882 3300047470 Ga0495681_0047979 Ga0495681_0047979_1030_1782 250
883 3300048091 Ga0495626_0000413 Ga0495626_0000413_336_1088 250
884 3300048917 Ga0496114_0010183 Ga0496114_0010183_6648_7400 250
885 3300048920 Ga0496117_0114350 Ga0496117_0114350_526_1278 250
886 3300048921 Ga0496118_0024561 Ga0496118_0024561_44_796 250
887 3300048922 Ga0496119_0000207 Ga0496119_0000207_13998_14750 250
888 3300048923 Ga0496120_0003799 Ga0496120_0003799_5710_6462 250
889 3300048925 Ga0496122_0001232 Ga0496122_0001232_41691_42443 250
890 3300048925 Ga0496122_0002533 Ga0496122_0002533_20072_20824 250
891 3300048925 Ga0496122_0092780 Ga0496122_0092780_141_893 250
892 3300048926 Ga0496123_0001000 Ga0496123_0001000_817_1569 250
893 3300048926 Ga0496123_0005016 Ga0496123_0005016_12013_12765 250
894 3300048926 Ga0496123_0215385 Ga0496123_0215385_163_915 250
895 3300048928 Ga0496125_0003468 Ga0496125_0003468_4808_5560 250
896 3300048928 Ga0496125_0015281 Ga0496125_0015281_3048_3800 250
897 3300049459 Ga0495678_000134 Ga0495678_000134_47795_48547 250
898 3300049459 Ga0495678_001292 Ga0495678_001292_5266_6021 250
899 3300049460 Ga0495682_0000017 Ga0495682_0000017_219326_220081 250
900 3300049460 Ga0495682_0000424 Ga0495682_0000424_13557_14309 250
901 3300049535 Ga0501319_002409 Ga0501319_002409_350_1102 250
902 3300049571 Ga0501034_0000370 Ga0501034_0000370_102_854 250
903 3300049571 Ga0501034_0147031 Ga0501034_0147031_802_1554 250
904 3300053126 Ga0500621_000048 Ga0500621_000048_1295_2050 250
905 iso_pu_bacteria 2599185212 2599613885 253
906 iso_pu_bacteria 2599185318 2600035501 253
907 iso_pu_bacteria 2599185322 2600058478 253
908 3300009036 Ga0105244_10004865 Ga0105244_1000486512 254
909 3300013307 Ga0157372_10551068 Ga0157372_105510682 254
910 3300025728 Ga0207655_1001348 Ga0207655_100134816 254
911 3300048922 Ga0496119_0003086 Ga0496119_0003086_1684_2475 255
912 3300048923 Ga0496120_0004827 Ga0496120_0004827_9966_10757 255
913 iso_pu_bacteria 2847085930 2847086115 255
914 iso_pu_bacteria 2511231025 2511382085 256
915 iso_pu_bacteria 2511231035 2511437459 256
916 iso_pu_bacteria 2599185299 2599928897 256
917 iso_pu_bacteria 2608642108 2608670909 256
918 iso_pu_bacteria 2648501693 2650897506 256
919 iso_pu_bacteria 2684622997 2686354882 256
920 iso_pu_bacteria 2808606414 2809126404 256
921 iso_pu_bacteria 2939602548 2939604492 256
922 iso_pu_bacteria 2945951305 2945951813 256
923 iso_pu_bacteria 2978975091 2978978350 256
924 iso_pu_bacteria 2984494565 2984495385 256
925 iso_pu_bacteria 2990261002 2990265095 256
926 2124908027 MRS2a_Contig_908 MRS2a_00750040 257
927 3300001989 JGI24739J22299_10000495 JGI24739J22299_100004956 257
928 3300002772 JGI25164J39214_1000100 JGI25164J39214_100010028 257
929 3300003214 JGI25165J46597_1000207 JGI25165J46597_100020728 257
930 3300003856 Ga0058692_1006453 Ga0058692_10064531 257
931 3300003856 Ga0058692_1012258 Ga0058692_10122583 257
932 3300003856 Ga0058692_1017030 Ga0058692_10170302 257
933 3300005353 Ga0070669_100001703 Ga0070669_10000170314 257
934 3300005457 Ga0070662_100000041 Ga0070662_10000004153 257
935 3300005457 Ga0070662_100004331 Ga0070662_10000433110 257
936 3300005539 Ga0068853_100007800 Ga0068853_1000078003 257
937 3300005548 Ga0070665_100010625 Ga0070665_1000106252 257
938 3300005548 Ga0070665_100083166 Ga0070665_1000831663 257
939 3300005564 Ga0070664_100000646 Ga0070664_1000006463 257
940 3300005577 Ga0068857_100216748 Ga0068857_1002167482 257
941 3300005578 Ga0068854_100020986 Ga0068854_1000209865 257
942 3300005834 Ga0068851_10000044 Ga0068851_1000004466 257
943 3300006051 Ga0075364_10020296 Ga0075364_100202964 257
944 3300009011 Ga0105251_10029112 Ga0105251_100291123 257
945 3300009092 Ga0105250_10039616 Ga0105250_100396162 257
946 3300009176 Ga0105242_10201976 Ga0105242_102019763 257
947 3300009177 Ga0105248_10027748 Ga0105248_100277485 257
948 3300013100 Ga0157373_10063629 Ga0157373_100636292 257
949 3300013102 Ga0157371_10001001 Ga0157371_1000100123 257
950 3300013102 Ga0157371_10002245 Ga0157371_1000224517 257
951 3300013306 Ga0163162_10163690 Ga0163162_101636902 257
952 3300013307 Ga0157372_10152976 Ga0157372_101529762 257
953 3300017792 Ga0163161_10051926 Ga0163161_100519264 257
954 3300020081 Ga0206354_10826925 Ga0206354_108269252 257
955 3300025233 Ga0209437_100110 Ga0209437_10011011 257
956 3300025321 Ga0207656_10000022 Ga0207656_1000002236 257
957 3300025711 Ga0207696_1000187 Ga0207696_100018791 257
958 3300025711 Ga0207696_1002195 Ga0207696_100219510 257
959 3300025728 Ga0207655_1007027 Ga0207655_10070278 257
960 3300025728 Ga0207655_1017833 Ga0207655_10178332 257
961 3300025728 Ga0207655_1036293 Ga0207655_10362932 257
962 3300025735 Ga0207713_1000028 Ga0207713_1000028281 257
963 3300025735 Ga0207713_1006908 Ga0207713_10069086 257
964 3300025914 Ga0207671_10000034 Ga0207671_1000003467 257
965 3300025914 Ga0207671_10109162 Ga0207671_101091623 257
966 3300025920 Ga0207649_10000006 Ga0207649_10000006187 257
967 3300025923 Ga0207681_10000978 Ga0207681_1000097818 257
968 3300025933 Ga0207706_10003133 Ga0207706_100031333 257
969 3300025933 Ga0207706_10061623 Ga0207706_100616233 257
970 3300025934 Ga0207686_10001893 Ga0207686_100018936 257
971 3300025937 Ga0207669_10245343 Ga0207669_102453432 257
972 3300025945 Ga0207679_10000010 Ga0207679_10000010187 257
973 3300025972 Ga0207668_10007234 Ga0207668_100072347 257
974 3300026116 Ga0207674_10103126 Ga0207674_101031263 257
975 3300027312 Ga0209371_1001075 Ga0209371_10010754 257
976 3300027312 Ga0209371_1001276 Ga0209371_100127617 257
977 3300027312 Ga0209371_1002307 Ga0209371_100230716 257
978 3300027312 Ga0209371_1002649 Ga0209371_10026492 257
979 3300027312 Ga0209371_1002734 Ga0209371_10027348 257
980 3300027312 Ga0209371_1014808 Ga0209371_10148082 257
981 3300027424 Ga0209984_1009488 Ga0209984_10094882 257
982 3300027543 Ga0209999_1007990 Ga0209999_10079902 257
983 3300028379 Ga0268266_10052890 Ga0268266_100528902 257
984 3300029277 Ga0311001_1010284 Ga0311001_10102842 257
985 3300030500 Ga0268256_1001137 Ga0268256_100113714 257
986 3300030500 Ga0268256_1002473 Ga0268256_10024738 257
987 3300030500 Ga0268256_1003008 Ga0268256_10030088 257
988 3300030500 Ga0268256_1005389 Ga0268256_10053894 257
989 3300030500 Ga0268256_1019845 Ga0268256_10198453 257
990 3300030731 Ga0316177_1087706 Ga0316177_10877064 257
991 3300041443 Ga0451789_0093147 Ga0451789_0093147_414_1187 257
992 3300041453 Ga0451797_1445638 Ga0451797_1445638_34_807 257
993 3300041461 Ga0451805_097769 Ga0451805_097769_393_1166 257
994 3300042006 Ga0439432_014747 Ga0439432_014747_146_946 257
995 3300042010 Ga0439452_000009 Ga0439452_000009_11874_12674 257
996 3300048919 Ga0496116_0004381 Ga0496116_0004381_11909_12709 257
997 3300048920 Ga0496117_0000043 Ga0496117_0000043_11085_11888 257
998 3300048920 Ga0496117_0058545 Ga0496117_0058545_847_1647 257
999 3300048921 Ga0496118_0000075 Ga0496118_0000075_11085_11888 257
1000 3300048921 Ga0496118_0003147 Ga0496118_0003147_11192_11995 257
1001 3300048921 Ga0496118_0006965 Ga0496118_0006965_7883_8683 257
1002 3300048927 Ga0496124_0112630 Ga0496124_0112630_495_1295 257
1003 3300050491 nmdc:mga00v17_50996_c1 nmdc:mga00v17_50996_c1_512_1315 257
1004 iso_pu_bacteria 2876601092 2876601593 257
1005 iso_pu_bacteria 8016733728 8016734739 257
1006 iso_pu_bacteria 8019499862 8019503798 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

35

234

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3knu-assembly1.cif.gz_B crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.79 12 218
3knu-assembly1.cif.gz_A crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7865 12 222
4mcb-assembly1.cif.gz_A h.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide 0.7855 12 227
3knu-assembly2.cif.gz_C crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7836 12 218
4mcc-assembly1.cif.gz_A hintrmd in complex with n-[4-(aminomethyl)benzyl]-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide 0.7804 12 227
ID Description Score Start End Superfamily
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9255 11 172 3.40.1280.10
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9057 10 172 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9053 10 168 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9041 11 172 3.40.1280.10
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8901 10 172 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A509BR58-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9321 12 172 GO:0002939
GO:0005829
GO:0052906
AF-A0A418H6T7-F1-model_v4 deleted 0.9247 12 160
AF-A0A730N7J1-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9232 12 139 GO:0002939
GO:0005829
GO:0052906
AF-A0A509BR58-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9211 12 172 GO:0002939
GO:0005829
GO:0052906
AF-A0A661TIM6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9204 12 171 GO:0002939
GO:0005829
GO:0052906

Feature Viewer

pLDDT pTM Quality
84.55 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map