F487989

General Info

Members Datasets Scaffolds Average Seq Length
1005 310 2010 124

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0302606|Ga0451576_0302606_742_1185
Length 147
Sequence MRRRLAGARRSCGPWDALMAIEAAGEGTGTRPVRTYRGSCHCGAVTFEIDTDFPELTTCDCSICRRKNALMVKVHESRFRLLTGAASLAEYRFHTMTARHYFCRTCGIYPFHRKRVTPDHFGVNVFCLDDFDPAGIPVRRTIGAGMA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0.2
Rhizoplane 3.28
Rhizosphere 95.22
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0302606 3300045051 Bacteria 1673
2 JGI24739J22299_10212328 3300001989 Bacteria 567
3 JGI24738J21930_10048653 3300002075 Bacteria 863
4 JGI24035J26624_1024959 3300002126 Bacteria 640
5 JGI24034J26672_10050173 3300002239 Bacteria 716
6 JGI24751J29686_10042893 3300002459 Bacteria 935
7 Ga0065712_10125273 3300005290 Bacteria 1616
8 Ga0065712_10449412 3300005290 Bacteria 687
9 Ga0065715_10621509 3300005293 Bacteria 695
10 Ga0065715_10684967 3300005293 Bacteria 661
11 Ga0070658_10015416 3300005327 Bacteria 6115
12 Ga0070658_10037824 3300005327 Bacteria 3891
13 Ga0070658_10700029 3300005327 Bacteria 879
14 Ga0070676_10011751 3300005328 Bacteria 4766
15 Ga0070676_10025732 3300005328 Bacteria 3328
16 Ga0070676_10053860 3300005328 Bacteria 2370
17 Ga0070676_10176203 3300005328 Bacteria 1387
18 Ga0070676_10200655 3300005328 Bacteria 1307
19 Ga0070683_100008661 3300005329 Bacteria 8647
20 Ga0070683_100066700 3300005329 Bacteria 3353
21 Ga0070683_100168839 3300005329 Bacteria 2076
22 Ga0070683_100513673 3300005329 Bacteria 1145
23 Ga0070690_100004706 3300005330 Bacteria 7605
24 Ga0070670_100031661 3300005331 Bacteria 4555
25 Ga0070670_100063299 3300005331 Bacteria 3175
26 Ga0070670_100187766 3300005331 Bacteria 1795
27 Ga0070670_100301745 3300005331 Bacteria 1401
28 Ga0070670_100508328 3300005331 Bacteria 1072
29 Ga0070677_10000368 3300005333 Bacteria 15845
30 Ga0070677_10008003 3300005333 Bacteria 3541
31 Ga0070677_10348836 3300005333 Unclassified 766
32 Ga0068869_100009589 3300005334 Bacteria 6289
33 Ga0068869_100038232 3300005334 Bacteria 3418
34 Ga0068869_100078886 3300005334 Bacteria 2453
35 Ga0068869_100102508 3300005334 Bacteria 2166
36 Ga0068869_100579095 3300005334 Bacteria 946
37 Ga0068869_101192905 3300005334 Unclassified 669
38 Ga0070666_10002822 3300005335 Bacteria 10495
39 Ga0070666_10011842 3300005335 Bacteria 5485
40 Ga0070666_10020013 3300005335 Bacteria 4324
41 Ga0070666_10056906 3300005335 Bacteria 2642
42 Ga0070666_10155472 3300005335 Bacteria 1597
43 Ga0070680_100074872 3300005336 Bacteria 2786
44 Ga0070680_100079171 3300005336 Bacteria 2708
45 Ga0070680_101042730 3300005336 Bacteria 706
46 Ga0070682_100144367 3300005337 Bacteria 1626
47 Ga0070682_100260121 3300005337 Bacteria 1256
48 Ga0070682_100314907 3300005337 Unclassified 1153
49 Ga0068868_100000824 3300005338 Bacteria 21004
50 Ga0068868_100003562 3300005338 Bacteria 10843
51 Ga0068868_100004933 3300005338 Bacteria 9373
52 Ga0068868_100036501 3300005338 Bacteria 3804
53 Ga0068868_100874375 3300005338 Bacteria 815
54 Ga0068868_101345264 3300005338 Bacteria 665
55 Ga0070660_100002758 3300005339 Bacteria 12063
56 Ga0070660_100006654 3300005339 Bacteria 8018
57 Ga0070660_100126945 3300005339 Bacteria 2038
58 Ga0070660_100358709 3300005339 Bacteria 1201
59 Ga0070660_100485537 3300005339 Bacteria 1027
60 Ga0070660_100742854 3300005339 Bacteria 824
61 Ga0070660_100745214 3300005339 Bacteria 822
62 Ga0070689_100011605 3300005340 Bacteria 6315
63 Ga0070689_100059889 3300005340 Bacteria 2959
64 Ga0070689_100159993 3300005340 Bacteria 1820
65 Ga0070689_100559673 3300005340 Bacteria 986
66 Ga0070687_100058286 3300005343 Bacteria 2028
67 Ga0070661_100006417 3300005344 Bacteria 8110
68 Ga0070661_100006954 3300005344 Bacteria 7807
69 Ga0070661_100010090 3300005344 Bacteria 6558
70 Ga0070661_100020787 3300005344 Bacteria 4683
71 Ga0070661_100078734 3300005344 Bacteria 2431
72 Ga0070661_100642110 3300005344 Bacteria 861
73 Ga0070692_10006399 3300005345 Bacteria 5111
74 Ga0070692_10242401 3300005345 Bacteria 1075
75 Ga0070692_10513006 3300005345 Bacteria 779
76 Ga0070668_100001817 3300005347 Bacteria 15523
77 Ga0070668_100001893 3300005347 Bacteria 15297
78 Ga0070668_100003653 3300005347 Bacteria 11348
79 Ga0070668_100006022 3300005347 Bacteria 8995
80 Ga0070668_100298243 3300005347 Bacteria 1351
81 Ga0070668_101007652 3300005347 Bacteria 749
82 Ga0070668_101064763 3300005347 Unclassified 729
83 Ga0070668_101198362 3300005347 Bacteria 688
84 Ga0070669_100002397 3300005353 Bacteria 13564
85 Ga0070669_100007678 3300005353 Bacteria 7711
86 Ga0070669_100178938 3300005353 Bacteria 1658
87 Ga0070669_100207512 3300005353 Bacteria 1544
88 Ga0070669_100368863 3300005353 Bacteria 1169
89 Ga0070669_101866517 3300005353 Unclassified 525
90 Ga0070669_101999868 3300005353 Bacteria 506
91 Ga0070675_100000542 3300005354 Bacteria 25851
92 Ga0070675_100009710 3300005354 Bacteria 7495
93 Ga0070675_100061141 3300005354 Bacteria 3110
94 Ga0070675_100103714 3300005354 Bacteria 2398
95 Ga0070671_100000689 3300005355 Bacteria 24261
96 Ga0070671_100001488 3300005355 Bacteria 17514
97 Ga0070671_100023052 3300005355 Bacteria 5088
98 Ga0070671_100027157 3300005355 Bacteria 4709
99 Ga0070671_100028556 3300005355 Bacteria 4595
100 Ga0070671_100083645 3300005355 Bacteria 2668
101 Ga0070671_100106534 3300005355 Bacteria 2353
102 Ga0070671_100617027 3300005355 Unclassified 938
103 Ga0070671_100654818 3300005355 Bacteria 909
104 Ga0070671_101270281 3300005355 Bacteria 649
105 Ga0070674_100000708 3300005356 Bacteria 16973
106 Ga0070674_100003421 3300005356 Bacteria 8905
107 Ga0070674_100009890 3300005356 Bacteria 5739
108 Ga0070674_100027159 3300005356 Bacteria 3748
109 Ga0070674_100028171 3300005356 Bacteria 3688
110 Ga0070674_100083709 3300005356 Bacteria 2286
111 Ga0070674_100091908 3300005356 Bacteria 2192
112 Ga0070674_100285888 3300005356 Bacteria 1309
113 Ga0070674_101314042 3300005356 Bacteria 645
114 Ga0070673_100000311 3300005364 Bacteria 25555
115 Ga0070673_100003821 3300005364 Bacteria 9450
116 Ga0070673_100006217 3300005364 Bacteria 7749
117 Ga0070673_100012931 3300005364 Bacteria 5750
118 Ga0070673_100165761 3300005364 Bacteria 1882
119 Ga0070673_100178015 3300005364 Bacteria 1819
120 Ga0070673_100778419 3300005364 Bacteria 882
121 Ga0070673_101401172 3300005364 Bacteria 658
122 Ga0070688_100000683 3300005365 Bacteria 16890
123 Ga0070688_100009139 3300005365 Bacteria 5405
124 Ga0070688_100043827 3300005365 Bacteria 2759
125 Ga0070688_100095514 3300005365 Bacteria 1951
126 Ga0070688_100237955 3300005365 Bacteria 1291
127 Ga0070659_100000279 3300005366 Bacteria 39788
128 Ga0070659_100024723 3300005366 Bacteria 4606
129 Ga0070659_100038722 3300005366 Bacteria 3719
130 Ga0070659_100112526 3300005366 Bacteria 2198
131 Ga0070659_100400375 3300005366 Bacteria 1159
132 Ga0070659_101399028 3300005366 Unclassified 622
133 Ga0070667_100014532 3300005367 Bacteria 6505
134 Ga0070667_100021133 3300005367 Bacteria 5407
135 Ga0070667_100027637 3300005367 Bacteria 4720
136 Ga0070667_100033502 3300005367 Bacteria 4294
137 Ga0070667_100037774 3300005367 Bacteria 4049
138 Ga0070667_100391289 3300005367 Bacteria 1264
139 Ga0070667_100671994 3300005367 Bacteria 957
140 Ga0070667_101018090 3300005367 Bacteria 773
141 Ga0070667_101046952 3300005367 Bacteria 762
142 Ga0070667_101805001 3300005367 Bacteria 575
143 Ga0070709_10081076 3300005434 Bacteria 2117
144 Ga0070709_10128397 3300005434 Bacteria 1727
145 Ga0070709_10561263 3300005434 Bacteria 875
146 Ga0070714_100005282 3300005435 Bacteria 9842
147 Ga0070714_100023371 3300005435 Bacteria 5077
148 Ga0070714_100045607 3300005435 Bacteria 3716
149 Ga0070714_100073170 3300005435 Bacteria 2969
150 Ga0070714_100365555 3300005435 Bacteria 1357
151 Ga0070713_100000967 3300005436 Bacteria 18403
152 Ga0070713_100034230 3300005436 Bacteria 4079
153 Ga0070713_100599703 3300005436 Bacteria 1046
154 Ga0070710_10003877 3300005437 Bacteria 7079
155 Ga0070710_10016417 3300005437 Bacteria 3767
156 Ga0070710_10017457 3300005437 Bacteria 3672
157 Ga0070710_10770819 3300005437 Unclassified 685
158 Ga0070711_100004919 3300005439 Bacteria 7930
159 Ga0070711_100029062 3300005439 Bacteria 3644
160 Ga0070711_100075895 3300005439 Bacteria 2381
161 Ga0070711_100182611 3300005439 Bacteria 1607
162 Ga0070705_100184184 3300005440 Bacteria 1417
163 Ga0070705_100346896 3300005440 Bacteria 1081
164 Ga0070705_101349444 3300005440 Bacteria 593
165 Ga0070705_101734523 3300005440 Unclassified 528
166 Ga0070700_100378224 3300005441 Bacteria 1058
167 Ga0070700_100589105 3300005441 Bacteria 869
168 Ga0070700_100973700 3300005441 Bacteria 696
169 Ga0070694_100080752 3300005444 Bacteria 2260
170 Ga0070694_101613194 3300005444 Unclassified 551
171 Ga0070708_100116095 3300005445 Bacteria 2464
172 Ga0070663_100003665 3300005455 Bacteria 8901
173 Ga0070663_100007714 3300005455 Bacteria 6571
174 Ga0070663_100033940 3300005455 Bacteria 3529
175 Ga0070663_100425393 3300005455 Bacteria 1090
176 Ga0070663_100608446 3300005455 Bacteria 920
177 Ga0070678_100001198 3300005456 Bacteria 13787
178 Ga0070678_100002199 3300005456 Bacteria 10605
179 Ga0070678_100017778 3300005456 Bacteria 4588
180 Ga0070678_100050975 3300005456 Bacteria 2997
181 Ga0070678_100088388 3300005456 Bacteria 2369
182 Ga0070678_100098568 3300005456 Bacteria 2260
183 Ga0070678_100185396 3300005456 Bacteria 1707
184 Ga0070678_100237347 3300005456 Bacteria 1523
185 Ga0070678_100764177 3300005456 Bacteria 875
186 Ga0070662_100004036 3300005457 Bacteria 9215
187 Ga0070662_100006017 3300005457 Bacteria 7782
188 Ga0070662_100055097 3300005457 Bacteria 2884
189 Ga0070662_100136048 3300005457 Bacteria 1900
190 Ga0070662_100178378 3300005457 Bacteria 1673
191 Ga0070662_100319477 3300005457 Bacteria 1266
192 Ga0070662_101176078 3300005457 Bacteria 659
193 Ga0070662_101331363 3300005457 Unclassified 618
194 Ga0070681_10005195 3300005458 Bacteria 12567
195 Ga0070681_10149172 3300005458 Bacteria 2266
196 Ga0070681_10728997 3300005458 Bacteria 907
197 Ga0068867_100005598 3300005459 Bacteria 8900
198 Ga0068867_100118159 3300005459 Bacteria 2045
199 Ga0068867_100179325 3300005459 Bacteria 1683
200 Ga0068867_100538429 3300005459 Bacteria 1009
201 Ga0068867_100607671 3300005459 Bacteria 954
202 Ga0068867_101191590 3300005459 Bacteria 699
203 Ga0068867_101933484 3300005459 Bacteria 557
204 Ga0070685_10021304 3300005466 Bacteria 3522
205 Ga0070685_10078772 3300005466 Bacteria 1971
206 Ga0070685_10380035 3300005466 Bacteria 973
207 Ga0070706_100021834 3300005467 Bacteria 5895
208 Ga0070706_100237335 3300005467 Bacteria 1702
209 Ga0070706_100362575 3300005467 Unclassified 1350
210 Ga0070707_100201066 3300005468 Bacteria 1942
211 Ga0070707_101976693 3300005468 Unclassified 551
212 Ga0070698_100805104 3300005471 Unclassified 884
213 Ga0070699_100007323 3300005518 Bacteria 9604
214 Ga0070699_100295663 3300005518 Unclassified 1452
215 Ga0070679_100017406 3300005530 Bacteria 6955
216 Ga0070679_100053473 3300005530 Bacteria 4020
217 Ga0070679_100493594 3300005530 Bacteria 1168
218 Ga0070679_101630062 3300005530 Bacteria 593
219 Ga0070684_100014450 3300005535 Bacteria 6397
220 Ga0070684_100157741 3300005535 Bacteria 2058
221 Ga0070684_100562470 3300005535 Bacteria 1059
222 Ga0070684_100932288 3300005535 Bacteria 814
223 Ga0070697_100099551 3300005536 Bacteria 2413
224 Ga0070697_100183615 3300005536 Unclassified 1773
225 Ga0068853_100002585 3300005539 Bacteria 13605
226 Ga0068853_100012206 3300005539 Bacteria 6986
227 Ga0068853_100058645 3300005539 Bacteria 3323
228 Ga0068853_100062302 3300005539 Bacteria 3227
229 Ga0068853_100075322 3300005539 Bacteria 2945
230 Ga0068853_100512826 3300005539 Bacteria 1133
231 Ga0068853_100537719 3300005539 Bacteria 1106
232 Ga0068853_100613430 3300005539 Bacteria 1034
233 Ga0068853_101224935 3300005539 Bacteria 725
234 Ga0068853_101351199 3300005539 Bacteria 689
235 Ga0070672_100003794 3300005543 Bacteria 9836
236 Ga0070672_100013405 3300005543 Bacteria 5790
237 Ga0070672_100044382 3300005543 Bacteria 3433
238 Ga0070672_100115468 3300005543 Bacteria 2192
239 Ga0070672_100510816 3300005543 Bacteria 1040
240 Ga0070672_100583006 3300005543 Bacteria 973
241 Ga0070686_100059074 3300005544 Bacteria 2469
242 Ga0070686_100140055 3300005544 Bacteria 1683
243 Ga0070686_100173722 3300005544 Bacteria 1526
244 Ga0070686_101668352 3300005544 Unclassified 540
245 Ga0070695_100131378 3300005545 Bacteria 1726
246 Ga0070695_100949317 3300005545 Bacteria 697
247 Ga0070696_100006026 3300005546 Bacteria 8087
248 Ga0070696_100096816 3300005546 Bacteria 2109
249 Ga0070696_100203389 3300005546 Unclassified 1479
250 Ga0070696_101561868 3300005546 Bacteria 566
251 Ga0070693_100001226 3300005547 Bacteria 11574
252 Ga0070693_100105056 3300005547 Unclassified 1727
253 Ga0070693_100259685 3300005547 Bacteria 1155
254 Ga0070693_100760087 3300005547 Bacteria 715
255 Ga0070665_100011617 3300005548 Bacteria 8903
256 Ga0070665_100028574 3300005548 Bacteria 5616
257 Ga0070704_100034124 3300005549 Bacteria 3447
258 Ga0070704_100234547 3300005549 Bacteria 1499
259 Ga0068855_100009298 3300005563 Bacteria 11868
260 Ga0068855_100050825 3300005563 Bacteria 4883
261 Ga0068855_100065716 3300005563 Bacteria 4229
262 Ga0070664_100003369 3300005564 Bacteria 12916
263 Ga0070664_100019399 3300005564 Bacteria 5595
264 Ga0070664_100028219 3300005564 Bacteria 4668
265 Ga0070664_100032678 3300005564 Bacteria 4353
266 Ga0070664_100180412 3300005564 Bacteria 1876
267 Ga0070664_100190729 3300005564 Bacteria 1826
268 Ga0070664_100237111 3300005564 Bacteria 1637
269 Ga0070664_100251308 3300005564 Bacteria 1589
270 Ga0070664_100425248 3300005564 Bacteria 1217
271 Ga0068857_100030912 3300005577 Bacteria 4731
272 Ga0068857_100105739 3300005577 Bacteria 2527
273 Ga0068857_100246737 3300005577 Bacteria 1636
274 Ga0068857_100318810 3300005577 Bacteria 1435
275 Ga0068857_100467539 3300005577 Bacteria 1181
276 Ga0068857_101008628 3300005577 Bacteria 801
277 Ga0068854_100015960 3300005578 Bacteria 4993
278 Ga0068854_100017224 3300005578 Bacteria 4831
279 Ga0068854_100037793 3300005578 Bacteria 3390
280 Ga0068854_100070474 3300005578 Bacteria 2555
281 Ga0068854_100163506 3300005578 Bacteria 1726
282 Ga0068854_101223485 3300005578 Bacteria 674
283 Ga0068854_101947411 3300005578 Unclassified 541
284 Ga0068856_100000501 3300005614 Bacteria 43455
285 Ga0068856_100008151 3300005614 Bacteria 10218
286 Ga0068856_100028277 3300005614 Bacteria 5474
287 Ga0068856_100113650 3300005614 Bacteria 2706
288 Ga0068856_100168874 3300005614 Bacteria 2199
289 Ga0068856_100524922 3300005614 Bacteria 1205
290 Ga0070702_100008018 3300005615 Bacteria 5094
291 Ga0070702_100016351 3300005615 Bacteria 3805
292 Ga0070702_100021250 3300005615 Bacteria 3412
293 Ga0070702_100276767 3300005615 Bacteria 1150
294 Ga0070702_100871264 3300005615 Bacteria 702
295 Ga0068852_100000954 3300005616 Bacteria 19044
296 Ga0068852_100023289 3300005616 Bacteria 4982
297 Ga0068852_100078411 3300005616 Bacteria 2922
298 Ga0068852_100172028 3300005616 Bacteria 2031
299 Ga0068852_100561423 3300005616 Bacteria 1143
300 Ga0068859_100001898 3300005617 Bacteria 21302
301 Ga0068859_100071862 3300005617 Bacteria 3495
302 Ga0068859_100255186 3300005617 Bacteria 1844
303 Ga0068859_100435709 3300005617 Bacteria 1407
304 Ga0068859_100547405 3300005617 Bacteria 1252
305 Ga0068859_100664340 3300005617 Unclassified 1134
306 Ga0068859_100941424 3300005617 Bacteria 947
307 Ga0068859_100951329 3300005617 Bacteria 942
308 Ga0068864_100003963 3300005618 Bacteria 12193
309 Ga0068864_100004967 3300005618 Bacteria 10906
310 Ga0068864_100031157 3300005618 Bacteria 4524
311 Ga0068864_100393291 3300005618 Unclassified 1316
312 Ga0068864_100499529 3300005618 Bacteria 1170
313 Ga0068864_101502942 3300005618 Bacteria 676
314 Ga0068866_10009861 3300005718 Bacteria 4073
315 Ga0068866_10010565 3300005718 Bacteria 3963
316 Ga0068866_10058626 3300005718 Bacteria 1989
317 Ga0068866_10210111 3300005718 Bacteria 1168
318 Ga0068866_10282777 3300005718 Bacteria 1028
319 Ga0068861_100004851 3300005719 Bacteria 9047
320 Ga0068861_100065539 3300005719 Bacteria 2798
321 Ga0068861_100168869 3300005719 Bacteria 1811
322 Ga0068861_100364238 3300005719 Bacteria 1272
323 Ga0068851_10000476 3300005834 Bacteria 17664
324 Ga0068851_10002196 3300005834 Bacteria 8586
325 Ga0068851_10016592 3300005834 Bacteria 3526
326 Ga0068851_10046645 3300005834 Bacteria 2192
327 Ga0068851_10373459 3300005834 Bacteria 834
328 Ga0068870_10025442 3300005840 Bacteria 2938
329 Ga0068870_10029323 3300005840 Bacteria 2771
330 Ga0068870_10073330 3300005840 Bacteria 1872
331 Ga0068870_10144585 3300005840 Bacteria 1394
332 Ga0068870_10216121 3300005840 Unclassified 1171
333 Ga0068870_10716408 3300005840 Bacteria 692
334 Ga0068863_100006358 3300005841 Bacteria 11585
335 Ga0068863_100007460 3300005841 Bacteria 10706
336 Ga0068863_100027360 3300005841 Bacteria 5438
337 Ga0068863_100145228 3300005841 Bacteria 2269
338 Ga0068863_100582931 3300005841 Bacteria 1106
339 Ga0068863_101285037 3300005841 Bacteria 738
340 Ga0068858_100007447 3300005842 Bacteria 10581
341 Ga0068858_100013260 3300005842 Bacteria 7768
342 Ga0068858_100032341 3300005842 Bacteria 4858
343 Ga0068858_100158717 3300005842 Bacteria 2129
344 Ga0068858_100246349 3300005842 Bacteria 1697
345 Ga0068860_100008063 3300005843 Bacteria 10495
346 Ga0068860_100016372 3300005843 Bacteria 7230
347 Ga0068860_100016610 3300005843 Bacteria 7178
348 Ga0068860_100236463 3300005843 Bacteria 1776
349 Ga0068860_100360550 3300005843 Bacteria 1432
350 Ga0068860_100524993 3300005843 Bacteria 1184
351 Ga0068860_100900990 3300005843 Bacteria 900
352 Ga0068862_100017677 3300005844 Bacteria 5936
353 Ga0068862_100019065 3300005844 Bacteria 5719
354 Ga0068862_100146751 3300005844 Bacteria 2097
355 Ga0070715_10019657 3300006163 Bacteria 2594
356 Ga0070715_10103692 3300006163 Bacteria 1331
357 Ga0070712_100057838 3300006175 Bacteria 2726
358 Ga0070712_100232800 3300006175 Bacteria 1464
359 Ga0070712_100248429 3300006175 Bacteria 1420
360 Ga0075366_10347765 3300006195 Bacteria 910
361 Ga0075366_10437270 3300006195 Bacteria 807
362 Ga0097621_100002112 3300006237 Bacteria 13606
363 Ga0097621_100005718 3300006237 Bacteria 8780
364 Ga0097621_100012568 3300006237 Bacteria 6281
365 Ga0097621_100030975 3300006237 Bacteria 4240
366 Ga0097621_100071335 3300006237 Bacteria 2870
367 Ga0097621_100348134 3300006237 Bacteria 1317
368 Ga0097621_100538973 3300006237 Bacteria 1061
369 Ga0075370_10001359 3300006353 Bacteria 10529
370 Ga0068871_100021233 3300006358 Bacteria 4987
371 Ga0068871_100054968 3300006358 Bacteria 3231
372 Ga0068871_100128656 3300006358 Bacteria 2145
373 Ga0068871_100168354 3300006358 Bacteria 1877
374 Ga0075428_100092192 3300006844 Bacteria 3303
375 Ga0075430_100327965 3300006846 Bacteria 1265
376 Ga0075430_100981951 3300006846 Bacteria 696
377 Ga0075431_100365946 3300006847 Bacteria 1448
378 Ga0075431_101761874 3300006847 Unclassified 576
379 Ga0075434_100088599 3300006871 Bacteria 3096
380 Ga0075434_100572095 3300006871 Bacteria 1149
381 Ga0075429_100438924 3300006880 Bacteria 1144
382 Ga0068865_100042727 3300006881 Bacteria 3092
383 Ga0068865_100078323 3300006881 Bacteria 2364
384 Ga0068865_100194874 3300006881 Bacteria 1569
385 Ga0068865_100447582 3300006881 Bacteria 1067
386 Ga0068865_100449474 3300006881 Unclassified 1065
387 Ga0097620_100001898 3300006931 Bacteria 21302
388 Ga0097620_100071860 3300006931 Bacteria 3495
389 Ga0097620_100255176 3300006931 Bacteria 1844
390 Ga0097620_100435733 3300006931 Bacteria 1407
391 Ga0097620_100547321 3300006931 Bacteria 1252
392 Ga0097620_100664361 3300006931 Unclassified 1134
393 Ga0097620_100941426 3300006931 Bacteria 947
394 Ga0097620_100951386 3300006931 Bacteria 942
395 Ga0079104_1070403 3300006946 Bacteria 736
396 Ga0075435_100040819 3300007076 Bacteria 3707
397 Ga0105240_10391589 3300009093 Bacteria 1567
398 Ga0111539_10385315 3300009094 Bacteria 1632
399 Ga0111539_11335416 3300009094 Unclassified 832
400 Ga0105245_10005274 3300009098 Bacteria 11352
401 Ga0105245_10538975 3300009098 Bacteria 1188
402 Ga0105247_10001753 3300009101 Bacteria 15274
403 Ga0105247_10039210 3300009101 Bacteria 2894
404 Ga0105247_10354478 3300009101 Bacteria 1033
405 Ga0114129_10598554 3300009147 Bacteria 1429
406 Ga0105243_10217223 3300009148 Bacteria 1687
407 Ga0105241_10030883 3300009174 Bacteria 4007
408 Ga0105241_10242395 3300009174 Bacteria 1525
409 Ga0105241_10977948 3300009174 Bacteria 790
410 Ga0105242_10008835 3300009176 Bacteria 7733
411 Ga0105248_10002321 3300009177 Bacteria 21090
412 Ga0105248_10035498 3300009177 Bacteria 5577
413 Ga0105248_10065720 3300009177 Bacteria 4072
414 Ga0105248_10144086 3300009177 Bacteria 2688
415 Ga0105248_10469001 3300009177 Bacteria 1419
416 Ga0105248_11217929 3300009177 Bacteria 851
417 Ga0105248_11882112 3300009177 Bacteria 679
418 Ga0105237_10026378 3300009545 Bacteria 5938
419 Ga0105237_10907489 3300009545 Bacteria 888
420 Ga0105237_10972273 3300009545 Bacteria 856
421 Ga0105237_11876566 3300009545 Bacteria 607
422 Ga0105238_10050699 3300009551 Bacteria 4177
423 Ga0105238_10275630 3300009551 Bacteria 1663
424 Ga0105238_10794792 3300009551 Bacteria 961
425 Ga0105238_11570564 3300009551 Bacteria 688
426 Ga0105239_10293039 3300010375 Bacteria 1832
427 Ga0105239_12009964 3300010375 Bacteria 671
428 Ga0105239_12181677 3300010375 Bacteria 644
429 Ga0105246_10012522 3300011119 Bacteria 5297
430 Ga0105246_10014207 3300011119 Bacteria 5005
431 Ga0105246_10940231 3300011119 Bacteria 778
432 Ga0105246_11830858 3300011119 Unclassified 581
433 Ga0157327_1002598 3300012512 Bacteria 1261
434 Ga0157373_10133082 3300013100 Bacteria 1748
435 Ga0157373_10189200 3300013100 Bacteria 1451
436 Ga0157373_10500290 3300013100 Bacteria 878
437 Ga0157371_10329952 3300013102 Bacteria 1108
438 Ga0157371_10537680 3300013102 Bacteria 865
439 Ga0157370_10053447 3300013104 Bacteria 3851
440 Ga0157370_10526817 3300013104 Bacteria 1084
441 Ga0157370_10744506 3300013104 Bacteria 893
442 Ga0157370_10752238 3300013104 Bacteria 888
443 Ga0157369_10182088 3300013105 Bacteria 2210
444 Ga0157374_10004115 3300013296 Bacteria 12209
445 Ga0157374_10181315 3300013296 Bacteria 2057
446 Ga0157374_10521797 3300013296 Bacteria 1194
447 Ga0157374_11810130 3300013296 Bacteria 636
448 Ga0157378_10018467 3300013297 Bacteria 6126
449 Ga0157378_10338904 3300013297 Bacteria 1465
450 Ga0157378_10671874 3300013297 Bacteria 1053
451 Ga0157378_10856583 3300013297 Bacteria 937
452 Ga0157378_10909515 3300013297 Bacteria 911
453 Ga0163162_10005903 3300013306 Bacteria 11845
454 Ga0163162_11141097 3300013306 Unclassified 884
455 Ga0163162_11606189 3300013306 Bacteria 742
456 Ga0163162_11889976 3300013306 Bacteria 683
457 Ga0163162_13177786 3300013306 Unclassified 527
458 Ga0157372_10002202 3300013307 Bacteria 21182
459 Ga0157372_10234795 3300013307 Bacteria 2127
460 Ga0157372_10236499 3300013307 Bacteria 2119
461 Ga0157372_10639152 3300013307 Bacteria 1239
462 Ga0157372_10766247 3300013307 Bacteria 1122
463 Ga0157372_10787616 3300013307 Bacteria 1105
464 Ga0157372_11276940 3300013307 Bacteria 847
465 Ga0157375_10002393 3300013308 Bacteria 16235
466 Ga0157375_10006884 3300013308 Bacteria 9917
467 Ga0157375_10014727 3300013308 Bacteria 6988
468 Ga0157375_10100382 3300013308 Unclassified 2975
469 Ga0157375_10210782 3300013308 Bacteria 2100
470 Ga0157375_10465745 3300013308 Bacteria 1429
471 Ga0157375_11223962 3300013308 Bacteria 881
472 Ga0157375_12568344 3300013308 Bacteria 608
473 Ga0157375_13036659 3300013308 Bacteria 560
474 Ga0163163_10010324 3300014325 Bacteria 8394
475 Ga0163163_10014488 3300014325 Bacteria 7249
476 Ga0163163_10094812 3300014325 Bacteria 3003
477 Ga0163163_10177214 3300014325 Bacteria 2179
478 Ga0163163_12436755 3300014325 Unclassified 581
479 Ga0157380_10124024 3300014326 Unclassified 2193
480 Ga0157380_10640721 3300014326 Bacteria 1058
481 Ga0157377_10001110 3300014745 Bacteria 11387
482 Ga0157377_10031297 3300014745 Bacteria 2890
483 Ga0157377_10985736 3300014745 Bacteria 637
484 Ga0157379_10000468 3300014968 Bacteria 32782
485 Ga0157379_10080560 3300014968 Bacteria 2917
486 Ga0157379_10676028 3300014968 Bacteria 968
487 Ga0157379_11059213 3300014968 Bacteria 775
488 Ga0157379_11432943 3300014968 Bacteria 670
489 Ga0157379_11605809 3300014968 Unclassified 635
490 Ga0157376_10004741 3300014969 Bacteria 9464
491 Ga0157376_10008432 3300014969 Bacteria 7437
492 Ga0157376_10050155 3300014969 Bacteria 3461
493 Ga0157376_10177816 3300014969 Bacteria 1943
494 Ga0157376_10875144 3300014969 Bacteria 915
495 Ga0157376_11018700 3300014969 Bacteria 851
496 Ga0163161_10024939 3300017792 Bacteria 4228
497 Ga0163161_10081611 3300017792 Bacteria 2381
498 Ga0163161_10146123 3300017792 Bacteria 1794
499 Ga0163161_10261832 3300017792 Bacteria 1351
500 Ga0163161_10361953 3300017792 Bacteria 1155
501 Ga0207666_1003713 3300025271 Bacteria 1885
502 Ga0207697_10002020 3300025315 Bacteria 10735
503 Ga0207697_10055192 3300025315 Bacteria 1647
504 Ga0207697_10167281 3300025315 Bacteria 961
505 Ga0207656_10001542 3300025321 Bacteria 7636
506 Ga0207656_10020111 3300025321 Bacteria 2649
507 Ga0207656_10041909 3300025321 Bacteria 1946
508 Ga0207682_10000122 3300025893 Bacteria 35790
509 Ga0207682_10002288 3300025893 Bacteria 8627
510 Ga0207682_10192018 3300025893 Bacteria 936
511 Ga0207682_10291377 3300025893 Bacteria 764
512 Ga0207692_10010396 3300025898 Bacteria 3920
513 Ga0207692_10619939 3300025898 Bacteria 697
514 Ga0207642_10004552 3300025899 Bacteria 4477
515 Ga0207642_10021941 3300025899 Bacteria 2523
516 Ga0207642_10082113 3300025899 Bacteria 1568
517 Ga0207642_10206192 3300025899 Bacteria 1089
518 Ga0207642_10704087 3300025899 Bacteria 637
519 Ga0207710_10010926 3300025900 Bacteria 3824
520 Ga0207710_10033638 3300025900 Bacteria 2249
521 Ga0207710_10459216 3300025900 Bacteria 658
522 Ga0207680_10006781 3300025903 Bacteria 5557
523 Ga0207680_10011252 3300025903 Bacteria 4514
524 Ga0207680_10029102 3300025903 Bacteria 3099
525 Ga0207680_10088597 3300025903 Bacteria 1963
526 Ga0207680_10474274 3300025903 Unclassified 889
527 Ga0207680_10641229 3300025903 Bacteria 760
528 Ga0207685_10045645 3300025905 Bacteria 1663
529 Ga0207699_10013896 3300025906 Bacteria 4134
530 Ga0207699_10069488 3300025906 Bacteria 2148
531 Ga0207699_10106966 3300025906 Bacteria 1786
532 Ga0207699_10442568 3300025906 Bacteria 931
533 Ga0207645_10000063 3300025907 Bacteria 76658
534 Ga0207645_10002170 3300025907 Bacteria 15668
535 Ga0207645_10062528 3300025907 Bacteria 2379
536 Ga0207645_10214664 3300025907 Bacteria 1268
537 Ga0207645_10573755 3300025907 Unclassified 766
538 Ga0207645_10618971 3300025907 Bacteria 735
539 Ga0207643_10000768 3300025908 Bacteria 19617
540 Ga0207643_10007365 3300025908 Bacteria 5903
541 Ga0207643_10028629 3300025908 Bacteria 3095
542 Ga0207643_10197017 3300025908 Bacteria 1225
543 Ga0207643_10239385 3300025908 Unclassified 1115
544 Ga0207705_10385196 3300025909 Bacteria 1083
545 Ga0207705_10809948 3300025909 Bacteria 727
546 Ga0207684_10060790 3300025910 Bacteria 3209
547 Ga0207654_10020526 3300025911 Bacteria 3504
548 Ga0207654_10025901 3300025911 Bacteria 3170
549 Ga0207654_10149011 3300025911 Bacteria 1500
550 Ga0207707_10090349 3300025912 Bacteria 2676
551 Ga0207707_10121232 3300025912 Bacteria 2286
552 Ga0207707_10142375 3300025912 Bacteria 2096
553 Ga0207707_10324372 3300025912 Bacteria 1329
554 Ga0207707_11038522 3300025912 Bacteria 671
555 Ga0207695_10065764 3300025913 Bacteria 3727
556 Ga0207671_10069344 3300025914 Bacteria 2628
557 Ga0207693_10000325 3300025915 Bacteria 44161
558 Ga0207693_10008159 3300025915 Bacteria 8582
559 Ga0207693_10220591 3300025915 Bacteria 1490
560 Ga0207693_10227572 3300025915 Bacteria 1464
561 Ga0207663_10007700 3300025916 Bacteria 5603
562 Ga0207663_10026584 3300025916 Bacteria 3361
563 Ga0207663_10044183 3300025916 Bacteria 2734
564 Ga0207660_10584377 3300025917 Bacteria 909
565 Ga0207660_10609047 3300025917 Bacteria 890
566 Ga0207660_10997148 3300025917 Bacteria 683
567 Ga0207660_11604473 3300025917 Bacteria 524
568 Ga0207662_10008935 3300025918 Bacteria 5498
569 Ga0207662_10019968 3300025918 Bacteria 3818
570 Ga0207662_10620559 3300025918 Unclassified 753
571 Ga0207657_10000466 3300025919 Bacteria 42880
572 Ga0207657_10001368 3300025919 Bacteria 26012
573 Ga0207657_10381966 3300025919 Bacteria 1109
574 Ga0207657_10506264 3300025919 Bacteria 946
575 Ga0207649_10015860 3300025920 Bacteria 4236
576 Ga0207649_10293383 3300025920 Bacteria 1186
577 Ga0207649_10322080 3300025920 Bacteria 1136
578 Ga0207649_10488651 3300025920 Bacteria 935
579 Ga0207652_10039193 3300025921 Bacteria 4020
580 Ga0207652_10040299 3300025921 Bacteria 3966
581 Ga0207652_10094814 3300025921 Bacteria 2628
582 Ga0207652_10708094 3300025921 Bacteria 898
583 Ga0207681_10064460 3300025923 Bacteria 2530
584 Ga0207681_10202033 3300025923 Bacteria 1526
585 Ga0207681_11608533 3300025923 Unclassified 544
586 Ga0207694_10004305 3300025924 Bacteria 11133
587 Ga0207694_10230574 3300025924 Bacteria 1512
588 Ga0207694_10464660 3300025924 Bacteria 1057
589 Ga0207694_11725165 3300025924 Bacteria 527
590 Ga0207650_10031069 3300025925 Bacteria 3854
591 Ga0207650_10184832 3300025925 Bacteria 1663
592 Ga0207650_10688039 3300025925 Bacteria 863
593 Ga0207650_10949601 3300025925 Bacteria 731
594 Ga0207659_10008693 3300025926 Bacteria 6318
595 Ga0207659_10014819 3300025926 Bacteria 5039
596 Ga0207659_10017211 3300025926 Bacteria 4717
597 Ga0207659_10057720 3300025926 Bacteria 2785
598 Ga0207659_10106730 3300025926 Bacteria 2121
599 Ga0207687_10002822 3300025927 Bacteria 11780
600 Ga0207687_10008180 3300025927 Bacteria 6844
601 Ga0207700_10000305 3300025928 Bacteria 29115
602 Ga0207700_10003146 3300025928 Bacteria 9525
603 Ga0207664_10027714 3300025929 Bacteria 4299
604 Ga0207644_10003026 3300025931 Bacteria 10818
605 Ga0207644_10011724 3300025931 Bacteria 5802
606 Ga0207644_10014386 3300025931 Bacteria 5293
607 Ga0207644_10025999 3300025931 Bacteria 4029
608 Ga0207644_10032590 3300025931 Bacteria 3636
609 Ga0207644_10056805 3300025931 Bacteria 2825
610 Ga0207644_10405076 3300025931 Bacteria 1115
611 Ga0207644_10505510 3300025931 Unclassified 997
612 Ga0207690_10001719 3300025932 Bacteria 13452
613 Ga0207690_10167264 3300025932 Bacteria 1644
614 Ga0207690_10445460 3300025932 Bacteria 1040
615 Ga0207690_10558471 3300025932 Bacteria 931
616 Ga0207706_10000348 3300025933 Bacteria 49952
617 Ga0207706_10007643 3300025933 Bacteria 9992
618 Ga0207706_10010951 3300025933 Bacteria 8271
619 Ga0207706_10066043 3300025933 Bacteria 3184
620 Ga0207706_10112405 3300025933 Bacteria 2396
621 Ga0207706_10140782 3300025933 Bacteria 2122
622 Ga0207706_10189082 3300025933 Bacteria 1808
623 Ga0207686_10001142 3300025934 Bacteria 15331
624 Ga0207686_10107255 3300025934 Bacteria 1877
625 Ga0207686_10226058 3300025934 Bacteria 1354
626 Ga0207709_10094382 3300025935 Bacteria 1964
627 Ga0207709_10313755 3300025935 Bacteria 1171
628 Ga0207670_10049455 3300025936 Bacteria 2813
629 Ga0207670_10092033 3300025936 Bacteria 2146
630 Ga0207670_10133814 3300025936 Bacteria 1820
631 Ga0207669_10004061 3300025937 Bacteria 6408
632 Ga0207669_10012655 3300025937 Bacteria 4158
633 Ga0207669_10024908 3300025937 Bacteria 3224
634 Ga0207669_10030970 3300025937 Bacteria 2981
635 Ga0207669_10224481 3300025937 Bacteria 1381
636 Ga0207669_10264761 3300025937 Bacteria 1288
637 Ga0207669_10453636 3300025937 Bacteria 1016
638 Ga0207669_11438369 3300025937 Bacteria 587
639 Ga0207704_10059942 3300025938 Bacteria 2352
640 Ga0207704_10166083 3300025938 Bacteria 1577
641 Ga0207704_10172595 3300025938 Bacteria 1553
642 Ga0207704_10875914 3300025938 Bacteria 754
643 Ga0207665_10020143 3300025939 Bacteria 4381
644 Ga0207665_10041946 3300025939 Bacteria 3057
645 Ga0207691_10000050 3300025940 Bacteria 94763
646 Ga0207691_10003897 3300025940 Bacteria 14494
647 Ga0207691_10008366 3300025940 Bacteria 9941
648 Ga0207691_10036482 3300025940 Bacteria 4555
649 Ga0207691_10105500 3300025940 Bacteria 2510
650 Ga0207691_10501993 3300025940 Bacteria 1030
651 Ga0207691_10543397 3300025940 Bacteria 985
652 Ga0207711_10000206 3300025941 Bacteria 62928
653 Ga0207711_10050487 3300025941 Bacteria 3561
654 Ga0207711_10062709 3300025941 Bacteria 3207
655 Ga0207711_10110292 3300025941 Bacteria 2447
656 Ga0207711_10142912 3300025941 Bacteria 2154
657 Ga0207711_10196091 3300025941 Bacteria 1842
658 Ga0207711_10351948 3300025941 Bacteria 1364
659 Ga0207711_11401286 3300025941 Bacteria 641
660 Ga0207689_10015081 3300025942 Bacteria 6552
661 Ga0207689_10019801 3300025942 Bacteria 5668
662 Ga0207689_10058566 3300025942 Bacteria 3169
663 Ga0207689_10163842 3300025942 Bacteria 1832
664 Ga0207689_10667223 3300025942 Bacteria 876
665 Ga0207661_10050119 3300025944 Bacteria 3325
666 Ga0207661_10108798 3300025944 Bacteria 2341
667 Ga0207661_10135088 3300025944 Bacteria 2117
668 Ga0207661_10400415 3300025944 Bacteria 1245
669 Ga0207679_10006145 3300025945 Bacteria 7583
670 Ga0207679_10026312 3300025945 Bacteria 4010
671 Ga0207679_10152227 3300025945 Bacteria 1884
672 Ga0207679_10263584 3300025945 Bacteria 1471
673 Ga0207679_10269844 3300025945 Bacteria 1455
674 Ga0207679_10334945 3300025945 Bacteria 1314
675 Ga0207679_10398445 3300025945 Bacteria 1210
676 Ga0207679_10464617 3300025945 Bacteria 1124
677 Ga0207679_10737282 3300025945 Bacteria 896
678 Ga0207679_11291436 3300025945 Bacteria 670
679 Ga0207667_10003947 3300025949 Bacteria 18249
680 Ga0207667_10006898 3300025949 Bacteria 13719
681 Ga0207667_10081648 3300025949 Bacteria 3349
682 Ga0207667_10114624 3300025949 Bacteria 2778
683 Ga0207667_10140622 3300025949 Bacteria 2485
684 Ga0207667_10455527 3300025949 Bacteria 1300
685 Ga0207651_10008148 3300025960 Bacteria 5638
686 Ga0207651_10009389 3300025960 Bacteria 5353
687 Ga0207651_10014666 3300025960 Bacteria 4532
688 Ga0207651_10014902 3300025960 Bacteria 4502
689 Ga0207651_10022142 3300025960 Bacteria 3879
690 Ga0207651_10023068 3300025960 Bacteria 3820
691 Ga0207651_10187329 3300025960 Bacteria 1647
692 Ga0207651_10274228 3300025960 Bacteria 1391
693 Ga0207651_11092951 3300025960 Bacteria 714
694 Ga0207651_11879939 3300025960 Unclassified 538
695 Ga0207712_10241980 3300025961 Bacteria 1454
696 Ga0207712_12128647 3300025961 Unclassified 502
697 Ga0207668_10018632 3300025972 Bacteria 4373
698 Ga0207668_10047309 3300025972 Unclassified 2944
699 Ga0207668_10177060 3300025972 Unclassified 1679
700 Ga0207668_10252117 3300025972 Bacteria 1434
701 Ga0207668_10433416 3300025972 Bacteria 1118
702 Ga0207668_10695160 3300025972 Bacteria 893
703 Ga0207640_10052457 3300025981 Bacteria 2656
704 Ga0207640_10340942 3300025981 Bacteria 1200
705 Ga0207640_11362150 3300025981 Bacteria 635
706 Ga0207640_11726821 3300025981 Bacteria 565
707 Ga0207658_10012203 3300025986 Bacteria 5864
708 Ga0207658_10014058 3300025986 Bacteria 5479
709 Ga0207658_10015510 3300025986 Bacteria 5228
710 Ga0207658_10024215 3300025986 Bacteria 4245
711 Ga0207658_10050347 3300025986 Bacteria 3065
712 Ga0207658_10058129 3300025986 Bacteria 2876
713 Ga0207658_10124215 3300025986 Bacteria 2063
714 Ga0207658_10152411 3300025986 Bacteria 1885
715 Ga0207658_10239669 3300025986 Bacteria 1536
716 Ga0207658_10981786 3300025986 Bacteria 770
717 Ga0207677_10003987 3300026023 Bacteria 7876
718 Ga0207677_10004591 3300026023 Bacteria 7428
719 Ga0207677_10016492 3300026023 Bacteria 4379
720 Ga0207677_10452334 3300026023 Bacteria 1101
721 Ga0207677_10626954 3300026023 Unclassified 946
722 Ga0207677_10939956 3300026023 Unclassified 781
723 Ga0207703_10011006 3300026035 Bacteria 7049
724 Ga0207703_10015129 3300026035 Bacteria 6022
725 Ga0207703_10106953 3300026035 Bacteria 2380
726 Ga0207703_10119837 3300026035 Bacteria 2257
727 Ga0207703_10131869 3300026035 Bacteria 2159
728 Ga0207703_10363966 3300026035 Bacteria 1334
729 Ga0207639_10004024 3300026041 Bacteria 9920
730 Ga0207639_10033229 3300026041 Bacteria 3803
731 Ga0207639_10110691 3300026041 Bacteria 2237
732 Ga0207639_10159221 3300026041 Bacteria 1901
733 Ga0207639_10477823 3300026041 Bacteria 1135
734 Ga0207639_11209686 3300026041 Bacteria 709
735 Ga0207639_11656784 3300026041 Bacteria 600
736 Ga0207678_10001239 3300026067 Bacteria 23525
737 Ga0207678_10003313 3300026067 Bacteria 14522
738 Ga0207678_10004708 3300026067 Bacteria 12246
739 Ga0207678_10004837 3300026067 Bacteria 12095
740 Ga0207678_10320185 3300026067 Bacteria 1334
741 Ga0207678_11305163 3300026067 Bacteria 642
742 Ga0207708_10000508 3300026075 Bacteria 29987
743 Ga0207708_10021379 3300026075 Bacteria 4879
744 Ga0207708_10340880 3300026075 Bacteria 1227
745 Ga0207708_10450359 3300026075 Bacteria 1072
746 Ga0207702_10003414 3300026078 Bacteria 14530
747 Ga0207702_10067318 3300026078 Bacteria 3073
748 Ga0207702_10402513 3300026078 Bacteria 1320
749 Ga0207702_10429520 3300026078 Bacteria 1279
750 Ga0207702_11026191 3300026078 Bacteria 818
751 Ga0207702_11115817 3300026078 Bacteria 783
752 Ga0207702_11403300 3300026078 Bacteria 692
753 Ga0207641_10015244 3300026088 Bacteria 6298
754 Ga0207641_10026696 3300026088 Bacteria 4768
755 Ga0207641_10082257 3300026088 Bacteria 2797
756 Ga0207641_10094728 3300026088 Bacteria 2619
757 Ga0207641_10178962 3300026088 Bacteria 1941
758 Ga0207648_10007719 3300026089 Bacteria 10516
759 Ga0207648_10010430 3300026089 Bacteria 8803
760 Ga0207648_10014516 3300026089 Bacteria 7274
761 Ga0207648_10040739 3300026089 Unclassified 4080
762 Ga0207648_10044885 3300026089 Bacteria 3878
763 Ga0207648_10511326 3300026089 Bacteria 1100
764 Ga0207648_11249946 3300026089 Bacteria 698
765 Ga0207676_10007884 3300026095 Bacteria 7574
766 Ga0207676_10010014 3300026095 Bacteria 6746
767 Ga0207676_10073814 3300026095 Bacteria 2746
768 Ga0207676_10151937 3300026095 Bacteria 1995
769 Ga0207676_10261446 3300026095 Bacteria 1563
770 Ga0207676_10602703 3300026095 Bacteria 1055
771 Ga0207676_11113900 3300026095 Bacteria 781
772 Ga0207676_11552315 3300026095 Unclassified 659
773 Ga0207674_10001129 3300026116 Bacteria 34633
774 Ga0207674_10035874 3300026116 Bacteria 5172
775 Ga0207674_10089333 3300026116 Bacteria 3074
776 Ga0207674_10103165 3300026116 Bacteria 2831
777 Ga0207674_10660870 3300026116 Bacteria 1009
778 Ga0207675_100008267 3300026118 Bacteria 9801
779 Ga0207675_100031990 3300026118 Bacteria 4901
780 Ga0207675_100230712 3300026118 Bacteria 1786
781 Ga0207675_100286330 3300026118 Bacteria 1602
782 Ga0207683_10000521 3300026121 Bacteria 35599
783 Ga0207683_10000671 3300026121 Bacteria 31464
784 Ga0207683_10010301 3300026121 Bacteria 7971
785 Ga0207683_10051411 3300026121 Bacteria 3610
786 Ga0207683_10133298 3300026121 Bacteria 2235
787 Ga0207683_10163928 3300026121 Bacteria 2011
788 Ga0207683_10370018 3300026121 Bacteria 1317
789 Ga0207683_11005534 3300026121 Bacteria 774
790 Ga0207683_11141034 3300026121 Bacteria 723
791 Ga0207698_10011451 3300026142 Bacteria 5753
792 Ga0207698_10016330 3300026142 Bacteria 5002
793 Ga0207698_10082443 3300026142 Bacteria 2600
794 Ga0207698_10177064 3300026142 Bacteria 1885
795 Ga0207698_10296062 3300026142 Bacteria 1504
796 Ga0207698_10720914 3300026142 Bacteria 994
797 Ga0209281_1052066 3300027111 Bacteria 650
798 Ga0209970_1015234 3300027614 Unclassified 1279
799 Ga0210002_1006057 3300027617 Bacteria 1819
800 Ga0209983_1016899 3300027665 Bacteria 1508
801 Ga0209971_1081172 3300027682 Unclassified 790
802 Ga0209974_10007864 3300027876 Bacteria 3658
803 Ga0209974_10073925 3300027876 Unclassified 1165
804 Ga0207428_10099454 3300027907 Bacteria 2249
805 Ga0207428_11031129 3300027907 Bacteria 577
806 Ga0268266_10026424 3300028379 Bacteria 4939
807 Ga0268266_10159486 3300028379 Bacteria 2040
808 Ga0268266_10299583 3300028379 Bacteria 1499
809 Ga0268266_10673991 3300028379 Bacteria 996
810 Ga0268265_10015909 3300028380 Bacteria 5160
811 Ga0268265_10016365 3300028380 Bacteria 5092
812 Ga0268265_10042080 3300028380 Bacteria 3387
813 Ga0268264_10010254 3300028381 Bacteria 7757
814 Ga0268264_10085622 3300028381 Bacteria 2705
815 Ga0268264_10159738 3300028381 Bacteria 2029
816 Ga0268264_10233326 3300028381 Bacteria 1700
817 Ga0268264_10516959 3300028381 Bacteria 1166
818 Ga0268264_10965139 3300028381 Bacteria 858
819 Ga0268264_11362423 3300028381 Bacteria 720
820 Ga0268264_12038089 3300028381 Bacteria 583
821 Ga0265320_10266974 3300031240 Bacteria 758
822 Ga0307408_100242722 3300031548 Bacteria 1481
823 Ga0307408_100309508 3300031548 Bacteria 1326
824 Ga0307405_10014241 3300031731 Bacteria 4270
825 Ga0307405_10090759 3300031731 Bacteria 2022
826 Ga0307413_10006008 3300031824 Bacteria 5495
827 Ga0307413_10028975 3300031824 Bacteria 3091
828 Ga0307410_10018600 3300031852 Bacteria 4202
829 Ga0307410_10486113 3300031852 Bacteria 1013
830 Ga0307406_10004935 3300031901 Bacteria 7269
831 Ga0307406_10013415 3300031901 Bacteria 4693
832 Ga0307407_10584691 3300031903 Bacteria 829
833 Ga0307412_10001731 3300031911 Bacteria 12072
834 Ga0307412_10007973 3300031911 Bacteria 6037
835 Ga0307409_100003355 3300031995 Bacteria 8677
836 Ga0307409_100032231 3300031995 Bacteria 3796
837 Ga0307409_102424494 3300031995 Bacteria 554
838 Ga0307416_100010465 3300032002 Bacteria 6127
839 Ga0307414_10003937 3300032004 Bacteria 8005
840 Ga0307414_10019397 3300032004 Bacteria 4214
841 Ga0307411_10028879 3300032005 Bacteria 3378
842 Ga0307415_100058674 3300032126 Bacteria 2650
843 Ga0373930_0105734 3300034816 Bacteria 673
844 Ga0373959_0085312 3300034820 Bacteria 733
845 Ga0373926_0120784 3300035083 Bacteria 988
846 Ga0373936_0045452 3300035113 Bacteria 1769
847 Ga0373945_0024041 3300035116 Bacteria 2108
848 Ga0373945_0037392 3300035116 Bacteria 1742
849 Ga0373953_0001566 3300035117 Bacteria 6680
850 Ga0373954_0026148 3300035118 Bacteria 2673
851 Ga0373954_0242711 3300035118 Bacteria 886
852 Ga0373954_0286019 3300035118 Bacteria 813
853 Ga0373954_0376946 3300035118 Bacteria 701
854 Ga0373956_0004080 3300035119 Bacteria 5858
855 Ga0373956_0388202 3300035119 Unclassified 666
856 Ga0373957_0001063 3300035120 Bacteria 7250
857 Ga0373960_0298082 3300035121 Bacteria 599
858 Ga0373943_0169424 3300035170 Bacteria 1194
859 Ga0373946_0024078 3300035171 Unclassified 2383
860 Ga0373946_0032255 3300035171 Bacteria 2103
861 Ga0373955_0114059 3300035172 Bacteria 1565
862 Ga0373955_0249447 3300035172 Bacteria 1064
863 Ga0373955_0273105 3300035172 Bacteria 1016
864 Ga0373924_0065634 3300035410 Bacteria 1524
865 Ga0373931_0202282 3300035691 Bacteria 1187
866 Ga0373935_0046876 3300035692 Unclassified 2731
867 Ga0373935_0069964 3300035692 Bacteria 2261
868 Ga0373935_0082703 3300035692 Bacteria 2089
869 Ga0373935_0145746 3300035692 Unclassified 1603
870 Ga0373935_1110921 3300035692 Bacteria 588
871 Ga0373927_0008806 3300035695 Bacteria 6782
872 Ga0373927_0641167 3300035695 Bacteria 702
873 Ga0373933_0231033 3300035724 Bacteria 1188
874 Ga0373933_1039707 3300035724 Unclassified 539
875 Ga0373947_0014657 3300035725 Bacteria 4496
876 Ga0373947_0151165 3300035725 Unclassified 1495
877 Ga0373947_0194312 3300035725 Unclassified 1325
878 Ga0373947_0393262 3300035725 Bacteria 934
879 Ga0373937_0031824 3300036401 Bacteria 4782
880 Ga0373937_0058715 3300036401 Bacteria 3534
881 Ga0373937_0063706 3300036401 Bacteria 3391
882 Ga0373937_0083164 3300036401 Bacteria 2961
883 Ga0373937_0250788 3300036401 Bacteria 1669
884 Ga0373937_0399204 3300036401 Bacteria 1304
885 Ga0373937_0718065 3300036401 Bacteria 946
886 Ga0373937_0730367 3300036401 Bacteria 937
887 Ga0373937_0750483 3300036401 Bacteria 923
888 Ga0373937_1480386 3300036401 Bacteria 626
889 Ga0373925_0028408 3300037068 Unclassified 4098
890 Ga0373925_0115812 3300037068 Bacteria 2075
891 Ga0373925_0196340 3300037068 Bacteria 1603
892 Ga0373925_0235522 3300037068 Bacteria 1465
893 Ga0395900_0091133 3300037418 Bacteria 3133
894 Ga0395898_0675386 3300037466 Bacteria 975
895 Ga0395905_0928408 3300037471 Bacteria 773
896 Ga0395901_1310468 3300038443 Unclassified 686
897 Ga0439439_0248430 3300041406 Bacteria 527
898 Ga0439465_0001002 3300041413 Bacteria 8992
899 Ga0451807_0338218 3300041486 Unclassified 1476
900 Ga0451807_1577585 3300041486 Unclassified 996
901 Ga0451853_2791291 3300041512 Unclassified 1405
902 Ga0451853_2848785 3300041512 Bacteria 529
903 Ga0439445_0041824 3300042004 Bacteria 1219
904 Ga0439432_048440 3300042006 Bacteria 1331
905 Ga0439449_0004982 3300042007 Bacteria 5109
906 Ga0439449_0077187 3300042007 Bacteria 1228
907 Ga0439449_0193389 3300042007 Bacteria 761
908 Ga0451577_1574076 3300042876 Bacteria 580
909 Ga0453684_1039907 3300044712 Bacteria 869
910 Ga0453684_1049021 3300044712 Bacteria 864
911 Ga0453684_1995305 3300044712 Bacteria 585
912 Ga0495638_0023914 3300046460 Bacteria 3991
913 Ga0495651_0418439 3300046462 Bacteria 872
914 Ga0495653_0142931 3300046463 Bacteria 1681
915 Ga0495580_0033056 3300046472 Bacteria 3728
916 Ga0495580_0130092 3300046472 Bacteria 1746
917 Ga0495580_0766676 3300046472 Bacteria 627
918 Ga0495582_0137845 3300046473 Bacteria 1381
919 Ga0495662_0013157 3300046476 Bacteria 4030
920 Ga0495607_0036428 3300046501 Bacteria 2964
921 Ga0495628_1026907 3300046516 Bacteria 566
922 Ga0495630_0880557 3300046517 Bacteria 682
923 Ga0495665_0041125 3300046531 Bacteria 2460
924 Ga0495640_0251632 3300046533 Bacteria 1106
925 Ga0495586_0571092 3300046535 Bacteria 653
926 Ga0495621_0010073 3300046539 Bacteria 2884
927 Ga0495621_0040597 3300046539 Bacteria 1631
928 Ga0495597_0072129 3300046542 Bacteria 1486
929 Ga0495668_0374043 3300046616 Bacteria 782
930 Ga0495634_0114034 3300046642 Bacteria 1736
931 Ga0495625_0038919 3300046660 Bacteria 3476
932 Ga0495635_0079108 3300046663 Unclassified 2250
933 Ga0495635_0358461 3300046663 Bacteria 972
934 Ga0495635_0848445 3300046663 Unclassified 587
935 Ga0495659_0098062 3300046664 Unclassified 1132
936 Ga0495657_0245943 3300046675 Bacteria 1078
937 Ga0495657_0560202 3300046675 Bacteria 663
938 Ga0495623_0257641 3300046679 Bacteria 978
939 Ga0495646_0236501 3300046680 Bacteria 983
940 Ga0495647_0017141 3300046681 Bacteria 2559
941 Ga0495647_0357351 3300046681 Bacteria 666
942 Ga0495658_0015330 3300046683 Bacteria 3930
943 Ga0495658_0399847 3300046683 Bacteria 876
944 Ga0495613_0030163 3300046689 Bacteria 4028
945 Ga0495600_0021476 3300046809 Bacteria 4134
946 Ga0495604_0967476 3300047317 Bacteria 528
947 Ga0495674_0789274 3300047319 Bacteria 739
948 Ga0495680_0094411 3300047322 Bacteria 2238
949 Ga0495684_0068494 3300047471 Bacteria 2698
950 Ga0495684_0694585 3300047471 Bacteria 675
951 Ga0496100_0167128 3300048903 Bacteria 1581
952 Ga0496100_1431463 3300048903 Bacteria 546
953 Ga0496101_0023009 3300048904 Bacteria 4299
954 Ga0496101_0092246 3300048904 Bacteria 2255
955 Ga0496102_0001775 3300048905 Bacteria 18730
956 Ga0496102_0307081 3300048905 Bacteria 1495
957 Ga0496103_0112706 3300048906 Bacteria 1728
958 Ga0496103_0158399 3300048906 Bacteria 1452
959 Ga0496104_0019440 3300048907 Bacteria 6215
960 Ga0496105_0003181 3300048908 Bacteria 12103
961 Ga0496105_0012571 3300048908 Bacteria 6707
962 Ga0496106_0002695 3300048909 Bacteria 13172
963 Ga0496106_0210988 3300048909 Bacteria 1547
964 Ga0496106_0435883 3300048909 Bacteria 1053
965 Ga0496106_1328055 3300048909 Bacteria 557
966 Ga0496106_1411027 3300048909 Bacteria 538
967 Ga0496107_0028829 3300048910 Bacteria 3947
968 Ga0496107_0033839 3300048910 Bacteria 3658
969 Ga0496107_0077343 3300048910 Bacteria 2424
970 Ga0496107_0205019 3300048910 Bacteria 1466
971 Ga0496108_0101812 3300048911 Bacteria 2450
972 Ga0496109_0002530 3300048912 Bacteria 15325
973 Ga0496109_0029171 3300048912 Bacteria 4940
974 Ga0496109_0221426 3300048912 Bacteria 1780
975 Ga0496110_0116931 3300048913 Bacteria 2401
976 Ga0496110_0149768 3300048913 Bacteria 2112
977 Ga0496110_0334654 3300048913 Bacteria 1379
978 Ga0496112_0004784 3300048915 Bacteria 11548
979 Ga0496113_0115810 3300048916 Bacteria 2091
980 Ga0496113_1245566 3300048916 Unclassified 580
981 Ga0496115_0215673 3300048918 Bacteria 1584
982 Ga0501043_0511171 3300049579 Bacteria 896
983 Ga0501069_0440466 3300049585 Bacteria 774
984 Ga0501225_0004647 3300049705 Bacteria 4078
985 nmdc:mga0k408_582087_c1 3300050493 Bacteria 661
986 nmdc:mga0k408_97907_c1 3300050493 Bacteria 1728
987 nmdc:mga07m45_331_c2 3300050496 Bacteria 10624
988 nmdc:mga05p37_314471_c1 3300050507 Bacteria 1006
989 nmdc:mga09592_1737371_c1 3300050508 Bacteria 502
990 nmdc:mga06r32_437021_c1 3300050510 Bacteria 1289
991 nmdc:mga08y16_62265_c1 3300050511 Bacteria 3896
992 nmdc:mga08y16_838340_c1 3300050511 Bacteria 909
993 nmdc:mga0n895_120099_c1 3300050512 Bacteria 2649
994 nmdc:mga0n895_500405_c1 3300050512 Bacteria 1224
995 nmdc:mga0rr50_929824_c1 3300050513 Bacteria 741
996 nmdc:mga08x19_118521_c1 3300050514 Bacteria 1772
997 Ga0495612_0015968 3300053078 Bacteria 3009
998 Ga0495595_0207490 3300053084 Bacteria 976
999 Ga0495619_0025853 3300053085 Bacteria 3773
1000 Ga0495619_0665551 3300053085 Bacteria 709
1001 Ga0500643_035473 3300053087 Bacteria 1495
1002 Ga0500562_217577 3300053108 Bacteria 516
1003 Ga0500559_0036317 3300053136 Bacteria 2130
1004 Ga0500622_0001561 3300053156 Bacteria 18103
1005 8002872413 8002869464 Bacteria 3588529
1006 Ga0451576_0302606
1007 JGI24739J22299_10212328
1008 JGI24738J21930_10048653
1009 JGI24035J26624_1024959
1010 JGI24034J26672_10050173
1011 JGI24751J29686_10042893
1012 Ga0065712_10125273
1013 Ga0065712_10449412
1014 Ga0065715_10621509
1015 Ga0065715_10684967
1016 Ga0070658_10015416
1017 Ga0070658_10037824
1018 Ga0070658_10700029
1019 Ga0070676_10011751
1020 Ga0070676_10025732
1021 Ga0070676_10053860
1022 Ga0070676_10176203
1023 Ga0070676_10200655
1024 Ga0070683_100008661
1025 Ga0070683_100066700
1026 Ga0070683_100168839
1027 Ga0070683_100513673
1028 Ga0070690_100004706
1029 Ga0070670_100031661
1030 Ga0070670_100063299
1031 Ga0070670_100187766
1032 Ga0070670_100301745
1033 Ga0070670_100508328
1034 Ga0070677_10000368
1035 Ga0070677_10008003
1036 Ga0070677_10348836
1037 Ga0068869_100009589
1038 Ga0068869_100038232
1039 Ga0068869_100078886
1040 Ga0068869_100102508
1041 Ga0068869_100579095
1042 Ga0068869_101192905
1043 Ga0070666_10002822
1044 Ga0070666_10011842
1045 Ga0070666_10020013
1046 Ga0070666_10056906
1047 Ga0070666_10155472
1048 Ga0070680_100074872
1049 Ga0070680_100079171
1050 Ga0070680_101042730
1051 Ga0070682_100144367
1052 Ga0070682_100260121
1053 Ga0070682_100314907
1054 Ga0068868_100000824
1055 Ga0068868_100003562
1056 Ga0068868_100004933
1057 Ga0068868_100036501
1058 Ga0068868_100874375
1059 Ga0068868_101345264
1060 Ga0070660_100002758
1061 Ga0070660_100006654
1062 Ga0070660_100126945
1063 Ga0070660_100358709
1064 Ga0070660_100485537
1065 Ga0070660_100742854
1066 Ga0070660_100745214
1067 Ga0070689_100011605
1068 Ga0070689_100059889
1069 Ga0070689_100159993
1070 Ga0070689_100559673
1071 Ga0070687_100058286
1072 Ga0070661_100006417
1073 Ga0070661_100006954
1074 Ga0070661_100010090
1075 Ga0070661_100020787
1076 Ga0070661_100078734
1077 Ga0070661_100642110
1078 Ga0070692_10006399
1079 Ga0070692_10242401
1080 Ga0070692_10513006
1081 Ga0070668_100001817
1082 Ga0070668_100001893
1083 Ga0070668_100003653
1084 Ga0070668_100006022
1085 Ga0070668_100298243
1086 Ga0070668_101007652
1087 Ga0070668_101064763
1088 Ga0070668_101198362
1089 Ga0070669_100002397
1090 Ga0070669_100007678
1091 Ga0070669_100178938
1092 Ga0070669_100207512
1093 Ga0070669_100368863
1094 Ga0070669_101866517
1095 Ga0070669_101999868
1096 Ga0070675_100000542
1097 Ga0070675_100009710
1098 Ga0070675_100061141
1099 Ga0070675_100103714
1100 Ga0070671_100000689
1101 Ga0070671_100001488
1102 Ga0070671_100023052
1103 Ga0070671_100027157
1104 Ga0070671_100028556
1105 Ga0070671_100083645
1106 Ga0070671_100106534
1107 Ga0070671_100617027
1108 Ga0070671_100654818
1109 Ga0070671_101270281
1110 Ga0070674_100000708
1111 Ga0070674_100003421
1112 Ga0070674_100009890
1113 Ga0070674_100027159
1114 Ga0070674_100028171
1115 Ga0070674_100083709
1116 Ga0070674_100091908
1117 Ga0070674_100285888
1118 Ga0070674_101314042
1119 Ga0070673_100000311
1120 Ga0070673_100003821
1121 Ga0070673_100006217
1122 Ga0070673_100012931
1123 Ga0070673_100165761
1124 Ga0070673_100178015
1125 Ga0070673_100778419
1126 Ga0070673_101401172
1127 Ga0070688_100000683
1128 Ga0070688_100009139
1129 Ga0070688_100043827
1130 Ga0070688_100095514
1131 Ga0070688_100237955
1132 Ga0070659_100000279
1133 Ga0070659_100024723
1134 Ga0070659_100038722
1135 Ga0070659_100112526
1136 Ga0070659_100400375
1137 Ga0070659_101399028
1138 Ga0070667_100014532
1139 Ga0070667_100021133
1140 Ga0070667_100027637
1141 Ga0070667_100033502
1142 Ga0070667_100037774
1143 Ga0070667_100391289
1144 Ga0070667_100671994
1145 Ga0070667_101018090
1146 Ga0070667_101046952
1147 Ga0070667_101805001
1148 Ga0070709_10081076
1149 Ga0070709_10128397
1150 Ga0070709_10561263
1151 Ga0070714_100005282
1152 Ga0070714_100023371
1153 Ga0070714_100045607
1154 Ga0070714_100073170
1155 Ga0070714_100365555
1156 Ga0070713_100000967
1157 Ga0070713_100034230
1158 Ga0070713_100599703
1159 Ga0070710_10003877
1160 Ga0070710_10016417
1161 Ga0070710_10017457
1162 Ga0070710_10770819
1163 Ga0070711_100004919
1164 Ga0070711_100029062
1165 Ga0070711_100075895
1166 Ga0070711_100182611
1167 Ga0070705_100184184
1168 Ga0070705_100346896
1169 Ga0070705_101349444
1170 Ga0070705_101734523
1171 Ga0070700_100378224
1172 Ga0070700_100589105
1173 Ga0070700_100973700
1174 Ga0070694_100080752
1175 Ga0070694_101613194
1176 Ga0070708_100116095
1177 Ga0070663_100003665
1178 Ga0070663_100007714
1179 Ga0070663_100033940
1180 Ga0070663_100425393
1181 Ga0070663_100608446
1182 Ga0070678_100001198
1183 Ga0070678_100002199
1184 Ga0070678_100017778
1185 Ga0070678_100050975
1186 Ga0070678_100088388
1187 Ga0070678_100098568
1188 Ga0070678_100185396
1189 Ga0070678_100237347
1190 Ga0070678_100764177
1191 Ga0070662_100004036
1192 Ga0070662_100006017
1193 Ga0070662_100055097
1194 Ga0070662_100136048
1195 Ga0070662_100178378
1196 Ga0070662_100319477
1197 Ga0070662_101176078
1198 Ga0070662_101331363
1199 Ga0070681_10005195
1200 Ga0070681_10149172
1201 Ga0070681_10728997
1202 Ga0068867_100005598
1203 Ga0068867_100118159
1204 Ga0068867_100179325
1205 Ga0068867_100538429
1206 Ga0068867_100607671
1207 Ga0068867_101191590
1208 Ga0068867_101933484
1209 Ga0070685_10021304
1210 Ga0070685_10078772
1211 Ga0070685_10380035
1212 Ga0070706_100021834
1213 Ga0070706_100237335
1214 Ga0070706_100362575
1215 Ga0070707_100201066
1216 Ga0070707_101976693
1217 Ga0070698_100805104
1218 Ga0070699_100007323
1219 Ga0070699_100295663
1220 Ga0070679_100017406
1221 Ga0070679_100053473
1222 Ga0070679_100493594
1223 Ga0070679_101630062
1224 Ga0070684_100014450
1225 Ga0070684_100157741
1226 Ga0070684_100562470
1227 Ga0070684_100932288
1228 Ga0070697_100099551
1229 Ga0070697_100183615
1230 Ga0068853_100002585
1231 Ga0068853_100012206
1232 Ga0068853_100058645
1233 Ga0068853_100062302
1234 Ga0068853_100075322
1235 Ga0068853_100512826
1236 Ga0068853_100537719
1237 Ga0068853_100613430
1238 Ga0068853_101224935
1239 Ga0068853_101351199
1240 Ga0070672_100003794
1241 Ga0070672_100013405
1242 Ga0070672_100044382
1243 Ga0070672_100115468
1244 Ga0070672_100510816
1245 Ga0070672_100583006
1246 Ga0070686_100059074
1247 Ga0070686_100140055
1248 Ga0070686_100173722
1249 Ga0070686_101668352
1250 Ga0070695_100131378
1251 Ga0070695_100949317
1252 Ga0070696_100006026
1253 Ga0070696_100096816
1254 Ga0070696_100203389
1255 Ga0070696_101561868
1256 Ga0070693_100001226
1257 Ga0070693_100105056
1258 Ga0070693_100259685
1259 Ga0070693_100760087
1260 Ga0070665_100011617
1261 Ga0070665_100028574
1262 Ga0070704_100034124
1263 Ga0070704_100234547
1264 Ga0068855_100009298
1265 Ga0068855_100050825
1266 Ga0068855_100065716
1267 Ga0070664_100003369
1268 Ga0070664_100019399
1269 Ga0070664_100028219
1270 Ga0070664_100032678
1271 Ga0070664_100180412
1272 Ga0070664_100190729
1273 Ga0070664_100237111
1274 Ga0070664_100251308
1275 Ga0070664_100425248
1276 Ga0068857_100030912
1277 Ga0068857_100105739
1278 Ga0068857_100246737
1279 Ga0068857_100318810
1280 Ga0068857_100467539
1281 Ga0068857_101008628
1282 Ga0068854_100015960
1283 Ga0068854_100017224
1284 Ga0068854_100037793
1285 Ga0068854_100070474
1286 Ga0068854_100163506
1287 Ga0068854_101223485
1288 Ga0068854_101947411
1289 Ga0068856_100000501
1290 Ga0068856_100008151
1291 Ga0068856_100028277
1292 Ga0068856_100113650
1293 Ga0068856_100168874
1294 Ga0068856_100524922
1295 Ga0070702_100008018
1296 Ga0070702_100016351
1297 Ga0070702_100021250
1298 Ga0070702_100276767
1299 Ga0070702_100871264
1300 Ga0068852_100000954
1301 Ga0068852_100023289
1302 Ga0068852_100078411
1303 Ga0068852_100172028
1304 Ga0068852_100561423
1305 Ga0068859_100001898
1306 Ga0068859_100071862
1307 Ga0068859_100255186
1308 Ga0068859_100435709
1309 Ga0068859_100547405
1310 Ga0068859_100664340
1311 Ga0068859_100941424
1312 Ga0068859_100951329
1313 Ga0068864_100003963
1314 Ga0068864_100004967
1315 Ga0068864_100031157
1316 Ga0068864_100393291
1317 Ga0068864_100499529
1318 Ga0068864_101502942
1319 Ga0068866_10009861
1320 Ga0068866_10010565
1321 Ga0068866_10058626
1322 Ga0068866_10210111
1323 Ga0068866_10282777
1324 Ga0068861_100004851
1325 Ga0068861_100065539
1326 Ga0068861_100168869
1327 Ga0068861_100364238
1328 Ga0068851_10000476
1329 Ga0068851_10002196
1330 Ga0068851_10016592
1331 Ga0068851_10046645
1332 Ga0068851_10373459
1333 Ga0068870_10025442
1334 Ga0068870_10029323
1335 Ga0068870_10073330
1336 Ga0068870_10144585
1337 Ga0068870_10216121
1338 Ga0068870_10716408
1339 Ga0068863_100006358
1340 Ga0068863_100007460
1341 Ga0068863_100027360
1342 Ga0068863_100145228
1343 Ga0068863_100582931
1344 Ga0068863_101285037
1345 Ga0068858_100007447
1346 Ga0068858_100013260
1347 Ga0068858_100032341
1348 Ga0068858_100158717
1349 Ga0068858_100246349
1350 Ga0068860_100008063
1351 Ga0068860_100016372
1352 Ga0068860_100016610
1353 Ga0068860_100236463
1354 Ga0068860_100360550
1355 Ga0068860_100524993
1356 Ga0068860_100900990
1357 Ga0068862_100017677
1358 Ga0068862_100019065
1359 Ga0068862_100146751
1360 Ga0070715_10019657
1361 Ga0070715_10103692
1362 Ga0070712_100057838
1363 Ga0070712_100232800
1364 Ga0070712_100248429
1365 Ga0075366_10347765
1366 Ga0075366_10437270
1367 Ga0097621_100002112
1368 Ga0097621_100005718
1369 Ga0097621_100012568
1370 Ga0097621_100030975
1371 Ga0097621_100071335
1372 Ga0097621_100348134
1373 Ga0097621_100538973
1374 Ga0075370_10001359
1375 Ga0068871_100021233
1376 Ga0068871_100054968
1377 Ga0068871_100128656
1378 Ga0068871_100168354
1379 Ga0075428_100092192
1380 Ga0075430_100327965
1381 Ga0075430_100981951
1382 Ga0075431_100365946
1383 Ga0075431_101761874
1384 Ga0075434_100088599
1385 Ga0075434_100572095
1386 Ga0075429_100438924
1387 Ga0068865_100042727
1388 Ga0068865_100078323
1389 Ga0068865_100194874
1390 Ga0068865_100447582
1391 Ga0068865_100449474
1392 Ga0097620_100001898
1393 Ga0097620_100071860
1394 Ga0097620_100255176
1395 Ga0097620_100435733
1396 Ga0097620_100547321
1397 Ga0097620_100664361
1398 Ga0097620_100941426
1399 Ga0097620_100951386
1400 Ga0079104_1070403
1401 Ga0075435_100040819
1402 Ga0105240_10391589
1403 Ga0111539_10385315
1404 Ga0111539_11335416
1405 Ga0105245_10005274
1406 Ga0105245_10538975
1407 Ga0105247_10001753
1408 Ga0105247_10039210
1409 Ga0105247_10354478
1410 Ga0114129_10598554
1411 Ga0105243_10217223
1412 Ga0105241_10030883
1413 Ga0105241_10242395
1414 Ga0105241_10977948
1415 Ga0105242_10008835
1416 Ga0105248_10002321
1417 Ga0105248_10035498
1418 Ga0105248_10065720
1419 Ga0105248_10144086
1420 Ga0105248_10469001
1421 Ga0105248_11217929
1422 Ga0105248_11882112
1423 Ga0105237_10026378
1424 Ga0105237_10907489
1425 Ga0105237_10972273
1426 Ga0105237_11876566
1427 Ga0105238_10050699
1428 Ga0105238_10275630
1429 Ga0105238_10794792
1430 Ga0105238_11570564
1431 Ga0105239_10293039
1432 Ga0105239_12009964
1433 Ga0105239_12181677
1434 Ga0105246_10012522
1435 Ga0105246_10014207
1436 Ga0105246_10940231
1437 Ga0105246_11830858
1438 Ga0157327_1002598
1439 Ga0157373_10133082
1440 Ga0157373_10189200
1441 Ga0157373_10500290
1442 Ga0157371_10329952
1443 Ga0157371_10537680
1444 Ga0157370_10053447
1445 Ga0157370_10526817
1446 Ga0157370_10744506
1447 Ga0157370_10752238
1448 Ga0157369_10182088
1449 Ga0157374_10004115
1450 Ga0157374_10181315
1451 Ga0157374_10521797
1452 Ga0157374_11810130
1453 Ga0157378_10018467
1454 Ga0157378_10338904
1455 Ga0157378_10671874
1456 Ga0157378_10856583
1457 Ga0157378_10909515
1458 Ga0163162_10005903
1459 Ga0163162_11141097
1460 Ga0163162_11606189
1461 Ga0163162_11889976
1462 Ga0163162_13177786
1463 Ga0157372_10002202
1464 Ga0157372_10234795
1465 Ga0157372_10236499
1466 Ga0157372_10639152
1467 Ga0157372_10766247
1468 Ga0157372_10787616
1469 Ga0157372_11276940
1470 Ga0157375_10002393
1471 Ga0157375_10006884
1472 Ga0157375_10014727
1473 Ga0157375_10100382
1474 Ga0157375_10210782
1475 Ga0157375_10465745
1476 Ga0157375_11223962
1477 Ga0157375_12568344
1478 Ga0157375_13036659
1479 Ga0163163_10010324
1480 Ga0163163_10014488
1481 Ga0163163_10094812
1482 Ga0163163_10177214
1483 Ga0163163_12436755
1484 Ga0157380_10124024
1485 Ga0157380_10640721
1486 Ga0157377_10001110
1487 Ga0157377_10031297
1488 Ga0157377_10985736
1489 Ga0157379_10000468
1490 Ga0157379_10080560
1491 Ga0157379_10676028
1492 Ga0157379_11059213
1493 Ga0157379_11432943
1494 Ga0157379_11605809
1495 Ga0157376_10004741
1496 Ga0157376_10008432
1497 Ga0157376_10050155
1498 Ga0157376_10177816
1499 Ga0157376_10875144
1500 Ga0157376_11018700
1501 Ga0163161_10024939
1502 Ga0163161_10081611
1503 Ga0163161_10146123
1504 Ga0163161_10261832
1505 Ga0163161_10361953
1506 Ga0207666_1003713
1507 Ga0207697_10002020
1508 Ga0207697_10055192
1509 Ga0207697_10167281
1510 Ga0207656_10001542
1511 Ga0207656_10020111
1512 Ga0207656_10041909
1513 Ga0207682_10000122
1514 Ga0207682_10002288
1515 Ga0207682_10192018
1516 Ga0207682_10291377
1517 Ga0207692_10010396
1518 Ga0207692_10619939
1519 Ga0207642_10004552
1520 Ga0207642_10021941
1521 Ga0207642_10082113
1522 Ga0207642_10206192
1523 Ga0207642_10704087
1524 Ga0207710_10010926
1525 Ga0207710_10033638
1526 Ga0207710_10459216
1527 Ga0207680_10006781
1528 Ga0207680_10011252
1529 Ga0207680_10029102
1530 Ga0207680_10088597
1531 Ga0207680_10474274
1532 Ga0207680_10641229
1533 Ga0207685_10045645
1534 Ga0207699_10013896
1535 Ga0207699_10069488
1536 Ga0207699_10106966
1537 Ga0207699_10442568
1538 Ga0207645_10000063
1539 Ga0207645_10002170
1540 Ga0207645_10062528
1541 Ga0207645_10214664
1542 Ga0207645_10573755
1543 Ga0207645_10618971
1544 Ga0207643_10000768
1545 Ga0207643_10007365
1546 Ga0207643_10028629
1547 Ga0207643_10197017
1548 Ga0207643_10239385
1549 Ga0207705_10385196
1550 Ga0207705_10809948
1551 Ga0207684_10060790
1552 Ga0207654_10020526
1553 Ga0207654_10025901
1554 Ga0207654_10149011
1555 Ga0207707_10090349
1556 Ga0207707_10121232
1557 Ga0207707_10142375
1558 Ga0207707_10324372
1559 Ga0207707_11038522
1560 Ga0207695_10065764
1561 Ga0207671_10069344
1562 Ga0207693_10000325
1563 Ga0207693_10008159
1564 Ga0207693_10220591
1565 Ga0207693_10227572
1566 Ga0207663_10007700
1567 Ga0207663_10026584
1568 Ga0207663_10044183
1569 Ga0207660_10584377
1570 Ga0207660_10609047
1571 Ga0207660_10997148
1572 Ga0207660_11604473
1573 Ga0207662_10008935
1574 Ga0207662_10019968
1575 Ga0207662_10620559
1576 Ga0207657_10000466
1577 Ga0207657_10001368
1578 Ga0207657_10381966
1579 Ga0207657_10506264
1580 Ga0207649_10015860
1581 Ga0207649_10293383
1582 Ga0207649_10322080
1583 Ga0207649_10488651
1584 Ga0207652_10039193
1585 Ga0207652_10040299
1586 Ga0207652_10094814
1587 Ga0207652_10708094
1588 Ga0207681_10064460
1589 Ga0207681_10202033
1590 Ga0207681_11608533
1591 Ga0207694_10004305
1592 Ga0207694_10230574
1593 Ga0207694_10464660
1594 Ga0207694_11725165
1595 Ga0207650_10031069
1596 Ga0207650_10184832
1597 Ga0207650_10688039
1598 Ga0207650_10949601
1599 Ga0207659_10008693
1600 Ga0207659_10014819
1601 Ga0207659_10017211
1602 Ga0207659_10057720
1603 Ga0207659_10106730
1604 Ga0207687_10002822
1605 Ga0207687_10008180
1606 Ga0207700_10000305
1607 Ga0207700_10003146
1608 Ga0207664_10027714
1609 Ga0207644_10003026
1610 Ga0207644_10011724
1611 Ga0207644_10014386
1612 Ga0207644_10025999
1613 Ga0207644_10032590
1614 Ga0207644_10056805
1615 Ga0207644_10405076
1616 Ga0207644_10505510
1617 Ga0207690_10001719
1618 Ga0207690_10167264
1619 Ga0207690_10445460
1620 Ga0207690_10558471
1621 Ga0207706_10000348
1622 Ga0207706_10007643
1623 Ga0207706_10010951
1624 Ga0207706_10066043
1625 Ga0207706_10112405
1626 Ga0207706_10140782
1627 Ga0207706_10189082
1628 Ga0207686_10001142
1629 Ga0207686_10107255
1630 Ga0207686_10226058
1631 Ga0207709_10094382
1632 Ga0207709_10313755
1633 Ga0207670_10049455
1634 Ga0207670_10092033
1635 Ga0207670_10133814
1636 Ga0207669_10004061
1637 Ga0207669_10012655
1638 Ga0207669_10024908
1639 Ga0207669_10030970
1640 Ga0207669_10224481
1641 Ga0207669_10264761
1642 Ga0207669_10453636
1643 Ga0207669_11438369
1644 Ga0207704_10059942
1645 Ga0207704_10166083
1646 Ga0207704_10172595
1647 Ga0207704_10875914
1648 Ga0207665_10020143
1649 Ga0207665_10041946
1650 Ga0207691_10000050
1651 Ga0207691_10003897
1652 Ga0207691_10008366
1653 Ga0207691_10036482
1654 Ga0207691_10105500
1655 Ga0207691_10501993
1656 Ga0207691_10543397
1657 Ga0207711_10000206
1658 Ga0207711_10050487
1659 Ga0207711_10062709
1660 Ga0207711_10110292
1661 Ga0207711_10142912
1662 Ga0207711_10196091
1663 Ga0207711_10351948
1664 Ga0207711_11401286
1665 Ga0207689_10015081
1666 Ga0207689_10019801
1667 Ga0207689_10058566
1668 Ga0207689_10163842
1669 Ga0207689_10667223
1670 Ga0207661_10050119
1671 Ga0207661_10108798
1672 Ga0207661_10135088
1673 Ga0207661_10400415
1674 Ga0207679_10006145
1675 Ga0207679_10026312
1676 Ga0207679_10152227
1677 Ga0207679_10263584
1678 Ga0207679_10269844
1679 Ga0207679_10334945
1680 Ga0207679_10398445
1681 Ga0207679_10464617
1682 Ga0207679_10737282
1683 Ga0207679_11291436
1684 Ga0207667_10003947
1685 Ga0207667_10006898
1686 Ga0207667_10081648
1687 Ga0207667_10114624
1688 Ga0207667_10140622
1689 Ga0207667_10455527
1690 Ga0207651_10008148
1691 Ga0207651_10009389
1692 Ga0207651_10014666
1693 Ga0207651_10014902
1694 Ga0207651_10022142
1695 Ga0207651_10023068
1696 Ga0207651_10187329
1697 Ga0207651_10274228
1698 Ga0207651_11092951
1699 Ga0207651_11879939
1700 Ga0207712_10241980
1701 Ga0207712_12128647
1702 Ga0207668_10018632
1703 Ga0207668_10047309
1704 Ga0207668_10177060
1705 Ga0207668_10252117
1706 Ga0207668_10433416
1707 Ga0207668_10695160
1708 Ga0207640_10052457
1709 Ga0207640_10340942
1710 Ga0207640_11362150
1711 Ga0207640_11726821
1712 Ga0207658_10012203
1713 Ga0207658_10014058
1714 Ga0207658_10015510
1715 Ga0207658_10024215
1716 Ga0207658_10050347
1717 Ga0207658_10058129
1718 Ga0207658_10124215
1719 Ga0207658_10152411
1720 Ga0207658_10239669
1721 Ga0207658_10981786
1722 Ga0207677_10003987
1723 Ga0207677_10004591
1724 Ga0207677_10016492
1725 Ga0207677_10452334
1726 Ga0207677_10626954
1727 Ga0207677_10939956
1728 Ga0207703_10011006
1729 Ga0207703_10015129
1730 Ga0207703_10106953
1731 Ga0207703_10119837
1732 Ga0207703_10131869
1733 Ga0207703_10363966
1734 Ga0207639_10004024
1735 Ga0207639_10033229
1736 Ga0207639_10110691
1737 Ga0207639_10159221
1738 Ga0207639_10477823
1739 Ga0207639_11209686
1740 Ga0207639_11656784
1741 Ga0207678_10001239
1742 Ga0207678_10003313
1743 Ga0207678_10004708
1744 Ga0207678_10004837
1745 Ga0207678_10320185
1746 Ga0207678_11305163
1747 Ga0207708_10000508
1748 Ga0207708_10021379
1749 Ga0207708_10340880
1750 Ga0207708_10450359
1751 Ga0207702_10003414
1752 Ga0207702_10067318
1753 Ga0207702_10402513
1754 Ga0207702_10429520
1755 Ga0207702_11026191
1756 Ga0207702_11115817
1757 Ga0207702_11403300
1758 Ga0207641_10015244
1759 Ga0207641_10026696
1760 Ga0207641_10082257
1761 Ga0207641_10094728
1762 Ga0207641_10178962
1763 Ga0207648_10007719
1764 Ga0207648_10010430
1765 Ga0207648_10014516
1766 Ga0207648_10040739
1767 Ga0207648_10044885
1768 Ga0207648_10511326
1769 Ga0207648_11249946
1770 Ga0207676_10007884
1771 Ga0207676_10010014
1772 Ga0207676_10073814
1773 Ga0207676_10151937
1774 Ga0207676_10261446
1775 Ga0207676_10602703
1776 Ga0207676_11113900
1777 Ga0207676_11552315
1778 Ga0207674_10001129
1779 Ga0207674_10035874
1780 Ga0207674_10089333
1781 Ga0207674_10103165
1782 Ga0207674_10660870
1783 Ga0207675_100008267
1784 Ga0207675_100031990
1785 Ga0207675_100230712
1786 Ga0207675_100286330
1787 Ga0207683_10000521
1788 Ga0207683_10000671
1789 Ga0207683_10010301
1790 Ga0207683_10051411
1791 Ga0207683_10133298
1792 Ga0207683_10163928
1793 Ga0207683_10370018
1794 Ga0207683_11005534
1795 Ga0207683_11141034
1796 Ga0207698_10011451
1797 Ga0207698_10016330
1798 Ga0207698_10082443
1799 Ga0207698_10177064
1800 Ga0207698_10296062
1801 Ga0207698_10720914
1802 Ga0209281_1052066
1803 Ga0209970_1015234
1804 Ga0210002_1006057
1805 Ga0209983_1016899
1806 Ga0209971_1081172
1807 Ga0209974_10007864
1808 Ga0209974_10073925
1809 Ga0207428_10099454
1810 Ga0207428_11031129
1811 Ga0268266_10026424
1812 Ga0268266_10159486
1813 Ga0268266_10299583
1814 Ga0268266_10673991
1815 Ga0268265_10015909
1816 Ga0268265_10016365
1817 Ga0268265_10042080
1818 Ga0268264_10010254
1819 Ga0268264_10085622
1820 Ga0268264_10159738
1821 Ga0268264_10233326
1822 Ga0268264_10516959
1823 Ga0268264_10965139
1824 Ga0268264_11362423
1825 Ga0268264_12038089
1826 Ga0265320_10266974
1827 Ga0307408_100242722
1828 Ga0307408_100309508
1829 Ga0307405_10014241
1830 Ga0307405_10090759
1831 Ga0307413_10006008
1832 Ga0307413_10028975
1833 Ga0307410_10018600
1834 Ga0307410_10486113
1835 Ga0307406_10004935
1836 Ga0307406_10013415
1837 Ga0307407_10584691
1838 Ga0307412_10001731
1839 Ga0307412_10007973
1840 Ga0307409_100003355
1841 Ga0307409_100032231
1842 Ga0307409_102424494
1843 Ga0307416_100010465
1844 Ga0307414_10003937
1845 Ga0307414_10019397
1846 Ga0307411_10028879
1847 Ga0307415_100058674
1848 Ga0373930_0105734
1849 Ga0373959_0085312
1850 Ga0373926_0120784
1851 Ga0373936_0045452
1852 Ga0373945_0024041
1853 Ga0373945_0037392
1854 Ga0373953_0001566
1855 Ga0373954_0026148
1856 Ga0373954_0242711
1857 Ga0373954_0286019
1858 Ga0373954_0376946
1859 Ga0373956_0004080
1860 Ga0373956_0388202
1861 Ga0373957_0001063
1862 Ga0373960_0298082
1863 Ga0373943_0169424
1864 Ga0373946_0024078
1865 Ga0373946_0032255
1866 Ga0373955_0114059
1867 Ga0373955_0249447
1868 Ga0373955_0273105
1869 Ga0373924_0065634
1870 Ga0373931_0202282
1871 Ga0373935_0046876
1872 Ga0373935_0069964
1873 Ga0373935_0082703
1874 Ga0373935_0145746
1875 Ga0373935_1110921
1876 Ga0373927_0008806
1877 Ga0373927_0641167
1878 Ga0373933_0231033
1879 Ga0373933_1039707
1880 Ga0373947_0014657
1881 Ga0373947_0151165
1882 Ga0373947_0194312
1883 Ga0373947_0393262
1884 Ga0373937_0031824
1885 Ga0373937_0058715
1886 Ga0373937_0063706
1887 Ga0373937_0083164
1888 Ga0373937_0250788
1889 Ga0373937_0399204
1890 Ga0373937_0718065
1891 Ga0373937_0730367
1892 Ga0373937_0750483
1893 Ga0373937_1480386
1894 Ga0373925_0028408
1895 Ga0373925_0115812
1896 Ga0373925_0196340
1897 Ga0373925_0235522
1898 Ga0395900_0091133
1899 Ga0395898_0675386
1900 Ga0395905_0928408
1901 Ga0395901_1310468
1902 Ga0439439_0248430
1903 Ga0439465_0001002
1904 Ga0451807_0338218
1905 Ga0451807_1577585
1906 Ga0451853_2791291
1907 Ga0451853_2848785
1908 Ga0439445_0041824
1909 Ga0439432_048440
1910 Ga0439449_0004982
1911 Ga0439449_0077187
1912 Ga0439449_0193389
1913 Ga0451577_1574076
1914 Ga0453684_1039907
1915 Ga0453684_1049021
1916 Ga0453684_1995305
1917 Ga0495638_0023914
1918 Ga0495651_0418439
1919 Ga0495653_0142931
1920 Ga0495580_0033056
1921 Ga0495580_0130092
1922 Ga0495580_0766676
1923 Ga0495582_0137845
1924 Ga0495662_0013157
1925 Ga0495607_0036428
1926 Ga0495628_1026907
1927 Ga0495630_0880557
1928 Ga0495665_0041125
1929 Ga0495640_0251632
1930 Ga0495586_0571092
1931 Ga0495621_0010073
1932 Ga0495621_0040597
1933 Ga0495597_0072129
1934 Ga0495668_0374043
1935 Ga0495634_0114034
1936 Ga0495625_0038919
1937 Ga0495635_0079108
1938 Ga0495635_0358461
1939 Ga0495635_0848445
1940 Ga0495659_0098062
1941 Ga0495657_0245943
1942 Ga0495657_0560202
1943 Ga0495623_0257641
1944 Ga0495646_0236501
1945 Ga0495647_0017141
1946 Ga0495647_0357351
1947 Ga0495658_0015330
1948 Ga0495658_0399847
1949 Ga0495613_0030163
1950 Ga0495600_0021476
1951 Ga0495604_0967476
1952 Ga0495674_0789274
1953 Ga0495680_0094411
1954 Ga0495684_0068494
1955 Ga0495684_0694585
1956 Ga0496100_0167128
1957 Ga0496100_1431463
1958 Ga0496101_0023009
1959 Ga0496101_0092246
1960 Ga0496102_0001775
1961 Ga0496102_0307081
1962 Ga0496103_0112706
1963 Ga0496103_0158399
1964 Ga0496104_0019440
1965 Ga0496105_0003181
1966 Ga0496105_0012571
1967 Ga0496106_0002695
1968 Ga0496106_0210988
1969 Ga0496106_0435883
1970 Ga0496106_1328055
1971 Ga0496106_1411027
1972 Ga0496107_0028829
1973 Ga0496107_0033839
1974 Ga0496107_0077343
1975 Ga0496107_0205019
1976 Ga0496108_0101812
1977 Ga0496109_0002530
1978 Ga0496109_0029171
1979 Ga0496109_0221426
1980 Ga0496110_0116931
1981 Ga0496110_0149768
1982 Ga0496110_0334654
1983 Ga0496112_0004784
1984 Ga0496113_0115810
1985 Ga0496113_1245566
1986 Ga0496115_0215673
1987 Ga0501043_0511171
1988 Ga0501069_0440466
1989 Ga0501225_0004647
1990 nmdc:mga0k408_582087_c1
1991 nmdc:mga0k408_97907_c1
1992 nmdc:mga07m45_331_c2
1993 nmdc:mga05p37_314471_c1
1994 nmdc:mga09592_1737371_c1
1995 nmdc:mga06r32_437021_c1
1996 nmdc:mga08y16_62265_c1
1997 nmdc:mga08y16_838340_c1
1998 nmdc:mga0n895_120099_c1
1999 nmdc:mga0n895_500405_c1
2000 nmdc:mga0rr50_929824_c1
2001 nmdc:mga08x19_118521_c1
2002 Ga0495612_0015968
2003 Ga0495595_0207490
2004 Ga0495619_0025853
2005 Ga0495619_0665551
2006 Ga0500643_035473
2007 Ga0500562_217577
2008 Ga0500559_0036317
2009 Ga0500622_0001561
2010 8002872413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

57

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8826 10 110
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8225 10 110
7jz6-assembly1.cif.gz_D the cryo-em structure of the catalase-peroxidase from escherichia coli 0.7842 58 88
7jz6-assembly1.cif.gz_A the cryo-em structure of the catalase-peroxidase from escherichia coli 0.7831 58 88
5whq-assembly1.cif.gz_A crystal structure of the catalase-peroxidase from neurospora crassa at 2.9 a 0.7819 58 88
ID Description Score Start End Superfamily
af_Q0DKE9_179_288_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9312 60 88 2.130.10.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8964 10 105 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8825 10 106 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8726 11 116 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8696 10 112 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A2N7L4W9-F1-model_v4 Aldehyde-activating protein 0.9529 6 100 GO:0016846
GO:0046872
AF-A0A536XBG2-F1-model_v4 GFA family protein 0.9405 5 86 GO:0016846
GO:0046872
AF-A0A501XMC7-F1-model_v4 GFA family protein 0.9401 7 114 GO:0016846
GO:0046872
AF-A0A2E3L0V2-F1-model_v4 Aldehyde-activating protein 0.9397 7 116 GO:0016846
GO:0046872
AF-A0A4Q7V8S0-F1-model_v4 CENP-V/GFA domain-containing protein 0.9383 5 114 GO:0016846
GO:0046872

Map