F487944

General Info

Members Datasets Scaffolds Average Seq Length
1003 750 510 216

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0186950|Ga0495686_0186950_131_826
Length 231
Sequence MSSLRKRVVVFISGGGSNMLALVKAAKAADHPAKIVGVISDRPDAGGLAKAAAEGIPTFAFARKDFASKDAHEAAIFSCLDELQPDILCLAGYMRLLTGEFIRRYEGRIINIHPSLLPLFPGLHTHQRAIDAGMRIAGCTVHFVTEGMDEGPVIGQASVPVLSDDTAETLAARVLGIEHQLYPLVLRLMADGKVKMEDGRTVTAVDTGTTLVPPALRQLVLQLVEGQTSQG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
31 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
32 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
33 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
42 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681786 Brucella suis 92/29 Isolate Unclassified
45 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
56 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
57 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
58 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
59 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
60 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
61 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
62 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
63 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
64 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
65 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
66 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
67 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
68 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
69 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
70 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
71 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
72 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
73 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
74 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
75 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
76 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
77 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
78 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
79 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
80 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
81 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
82 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
83 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
84 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
85 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
86 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
87 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
88 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
89 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
90 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
91 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
92 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
93 2643221557 Ensifer sp. Root558 Isolate Unclassified
94 2643221558 Rhizobium sp. Root149 Isolate Unclassified
95 2643221599 Rhizobium sp. Root708 Isolate Unclassified
96 2643221607 Rhizobium sp. Root73 Isolate Unclassified
97 2643221610 Ensifer sp. Root74 Isolate Unclassified
98 2643221618 Ensifer sp. Root231 Isolate Unclassified
99 2643221626 Ensifer sp. Root31 Isolate Unclassified
100 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
101 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
102 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
103 2643221638 Duganella sp. Root336D2 Isolate Unclassified
104 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221659 Ensifer sp. Root127 Isolate Unclassified
107 2643221664 Massilia sp. Root418 Isolate Unclassified
108 2643221668 Ensifer sp. Root423 Isolate Unclassified
109 2643221675 Ensifer sp. Root1298 Isolate Unclassified
110 2643221680 Ensifer sp. Root1312 Isolate Unclassified
111 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
112 2643221688 Rhizobium sp. Root482 Isolate Unclassified
113 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
114 2643221698 Ensifer sp. Root142 Isolate Unclassified
115 2643221712 Ensifer sp. Root258 Isolate Unclassified
116 2643221718 Rhizobium sp. Root268 Isolate Unclassified
117 2643221723 Ensifer sp. Root278 Isolate Unclassified
118 2643221726 Ensifer sp. Root954 Isolate Unclassified
119 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
120 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
121 2718217882 Rhizobium sp. N741 Isolate Nodule
122 2718217927 Rhizobium sp. N324 Isolate Nodule
123 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
124 2718218009 Rhizobium sp. N561 Isolate Nodule
125 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
126 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
127 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2718218423 Rhizobium sp. N941 Isolate Nodule
132 2721755514 Rhizobium sp. N6212 Isolate Nodule
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755809 Rhizobium sp. N541 Isolate Nodule
136 2721755810 Rhizobium sp. N871 Isolate Nodule
137 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
138 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
139 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
140 2728369365 Rhizobium sp. N1341 Isolate Nodule
141 2728369397 Rhizobium sp. N1314 Isolate Nodule
142 2738541280 Massilia sp. GV090 Isolate Unclassified
143 2738541293 Rhizobium sp. GV031 Isolate Unclassified
144 2738541300 Massilia sp. GV016 Isolate Unclassified
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2738543018 Massilia sp. GV045 Isolate Unclassified
147 2738543030 Massilia sp. GV097 Isolate Unclassified
148 2751185800 Brucella pituitosa AA2 Isolate Unclassified
149 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
150 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
151 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
152 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
153 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
154 2791355256 Rhizobium sp. M10 Isolate Nodule
155 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
156 2791355260 Rhizobium sp. L9 Isolate Nodule
157 2791355261 Rhizobium sp. J15 Isolate Nodule
158 2791355262 Rhizobium sp. M1 Isolate Nodule
159 2791355263 Rhizobium chutanense C5 Isolate Nodule
160 2791355264 Rhizobium sp. S9 Isolate Nodule
161 2791355265 Rhizobium sp. H4 Isolate Nodule
162 2791355266 Rhizobium sp. L43 Isolate Nodule
163 2791355267 Rhizobium sp. L18 Isolate Nodule
164 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
165 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
166 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
167 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
168 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
169 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
170 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
171 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
172 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
173 2802429633 Rhizobium anhuiense J3 Isolate Nodule
174 2802429634 Rhizobium anhuiense S10 Isolate Nodule
175 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
176 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
177 2802429637 Rhizobium anhuiense C15 Isolate Nodule
178 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
179 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
180 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
181 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
182 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
183 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
184 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
185 2838048938 Rhizobium pisi 27/80 Isolate Nodule
186 2838061910 Rhizobium phaseoli L15 Isolate Nodule
187 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
188 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
189 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
190 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
191 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
192 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
193 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
194 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
195 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
196 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
197 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
198 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
199 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
200 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
203 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
204 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
205 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
206 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
207 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
208 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
209 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
210 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
211 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
212 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
213 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
214 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
215 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
216 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
217 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
218 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
219 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
220 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
221 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
222 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
223 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
224 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
225 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
226 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
227 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
228 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
229 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
230 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
231 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
232 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
233 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
234 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
235 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
236 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
237 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
238 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
239 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
240 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
241 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
242 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
243 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
244 2844163670 Ensifer sp. 1H6 Isolate Unclassified
245 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
246 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
247 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
248 2854911287 Brucella lupini LUP21 Isolate Unclassified
249 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
250 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
251 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
252 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
253 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
254 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
255 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
256 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
257 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
258 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
259 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
260 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
261 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
262 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
263 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
264 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
265 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
266 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
267 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
268 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
269 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
270 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
271 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
272 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
273 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
274 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
275 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
276 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
277 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
278 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
279 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
280 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
281 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
282 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
283 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
284 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
285 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
286 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
287 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
288 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
289 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
290 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
291 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
292 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
293 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
294 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
295 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
296 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
297 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
298 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
299 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
300 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
301 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
302 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
303 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
304 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
305 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
306 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
307 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
308 2936381700 Rhizobium chutanense C16 Isolate Unclassified
309 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
310 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
311 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
312 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
313 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
314 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
315 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
316 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
317 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
318 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
319 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
320 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
321 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
322 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
323 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
324 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
325 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
326 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
327 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
328 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
329 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
330 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
331 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
332 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
333 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
334 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
335 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
336 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
337 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
338 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
339 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
340 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
341 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
342 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
343 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
344 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
345 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
346 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
347 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
348 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
349 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
350 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
351 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
352 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
353 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
354 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
355 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
356 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
357 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
358 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
359 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
360 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
361 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
362 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
363 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
364 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
365 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
366 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
367 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
368 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
369 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
370 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
371 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
372 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
373 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
374 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
375 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
376 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
377 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
378 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
379 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
380 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
381 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
382 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
383 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
384 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
385 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
386 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
387 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
388 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
389 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
390 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
391 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
392 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
393 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
394 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
395 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
396 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
397 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
398 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
399 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
400 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
401 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
402 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
403 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
404 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
405 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
406 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
407 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
408 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
409 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
410 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
411 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
412 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
413 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
414 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
415 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
416 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
417 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
418 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
419 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
420 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
421 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
422 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
423 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
424 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
425 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
426 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
427 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
428 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
429 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
430 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
431 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
432 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
433 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
434 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
435 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
436 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
437 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
438 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
439 2996887358 Rhizobium sp. R711 Isolate Nodule
440 2996893221 Rhizobium sp. R635 Isolate Nodule
441 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
442 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
443 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
444 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
445 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
446 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
447 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
448 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
449 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
450 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
451 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
452 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
453 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
454 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
455 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
456 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
457 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
458 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
459 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
460 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
461 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
462 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
463 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
464 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
465 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
466 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
467 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
468 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
469 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
470 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
471 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
472 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
473 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
474 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
475 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
476 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
477 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
478 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
479 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
480 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
481 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
482 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
483 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
484 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
485 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
486 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
487 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
488 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
489 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
490 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
491 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
492 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
493 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
494 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
495 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
496 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
497 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
498 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
499 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
500 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
501 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
502 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
503 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
504 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
505 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
506 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
507 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
508 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
509 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
510 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
511 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
512 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
513 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
514 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
516 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
517 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
518 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
519 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
520 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
521 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
522 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
523 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
524 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
525 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
526 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
527 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
528 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
529 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
530 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
531 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
532 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
543 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
546 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
547 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
550 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
551 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
552 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
553 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
554 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
555 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
556 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
557 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
558 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
559 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
560 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
561 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
562 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
563 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
564 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
565 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
566 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
567 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
568 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
569 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
570 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
571 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
572 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
573 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
574 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
575 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
576 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
577 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
578 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
579 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
580 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
581 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
582 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
583 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
584 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
585 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
586 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
587 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
588 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
589 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
590 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
591 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
592 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
593 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
594 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
595 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
596 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
597 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
598 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
599 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
600 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
601 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
602 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
603 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
604 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
605 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
606 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
607 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
608 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
609 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
610 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
611 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
612 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
613 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
614 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
615 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
616 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
617 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
618 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
619 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
620 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
621 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
622 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
623 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
624 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
625 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
626 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
627 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
628 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
629 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
630 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
631 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
632 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
633 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
634 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
635 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
636 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
637 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
638 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
639 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
640 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
641 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
642 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
643 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
644 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
645 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
646 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
647 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
648 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
649 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
650 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
651 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
652 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
653 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
654 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
655 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
656 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
657 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
658 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
659 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
660 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
661 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
662 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
664 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
665 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
671 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
672 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
673 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
674 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
676 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
677 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
678 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
679 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
680 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
681 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
682 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
683 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
684 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
685 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
686 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
687 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
688 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
689 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
690 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
691 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
692 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
693 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
694 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
695 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
696 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
697 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
698 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
699 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
700 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
701 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
702 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
703 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
704 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
705 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
706 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
707 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
708 8005258706 Rhizobium sp. R693 Isolate Nodule
709 8005275841 Rhizobium sp. N4311 Isolate Nodule
710 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
711 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
712 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
713 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
714 8005321885 Rhizobium sp. R72 Isolate Nodule
715 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
716 8005382845 Rhizobium sp. R634 Isolate Nodule
717 8005395548 Rhizobium sp. R339 Isolate Nodule
718 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
719 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
720 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
721 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
722 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
723 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
724 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
725 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
726 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
727 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
728 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
729 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
730 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
731 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
732 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
733 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
734 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
735 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
736 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
737 8018176218 Rhizobium sp. N122 Isolate Nodule
738 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
739 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
740 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
741 8024501048 Rhizobium sp. H4 Isolate Nodule
742 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
743 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
744 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
745 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
746 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
747 8056382006 Rhizobium croatiense 13T Isolate Nodule
748 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
749 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
750 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.45
Metatranscriptomes 0.4
Isolates 49.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 18.44
Nodule 38.48
Rhizoplane 1.6
Rhizosphere 22.33
Stem 0
Stem Tuber 0
Unclassified 19.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000129 3300002705 Bacteria 54812
2 JGI25162J39368_1000663 3300002737 Bacteria 24312
3 JGI25162J39368_1000771 3300002737 Bacteria 21641
4 JGI25154J39366_1000393 3300002738 Bacteria 23858
5 JGI25154J39366_1010856 3300002738 Bacteria 1064
6 JGI25157J39369_1000061 3300002741 Bacteria 105511
7 JGI25163J39215_1005407 3300002771 Bacteria 815
8 JGI25152J39213_1000780 3300002773 Bacteria 16053
9 JGI25152J39213_1003870 3300002773 Bacteria 4923
10 JGI25152J39213_1005651 3300002773 Bacteria 3586
11 JGI25150J39212_1000033 3300002774 Bacteria 96269
12 JGI25159J45721_1000136 3300002987 Bacteria 34768
13 JGI25159J45721_1000539 3300002987 Bacteria 17199
14 JGI25151J46595_10000108 3300003187 Bacteria 112874
15 JGI25151J46595_10001664 3300003187 Bacteria 14579
16 JGI25151J46595_10004059 3300003187 Bacteria 7850
17 JGI25151J46595_10029420 3300003187 Bacteria 2175
18 JGI25165J46597_1000887 3300003214 Bacteria 21063
19 JGI25165J46597_1001344 3300003214 Bacteria 13749
20 JGI25165J46597_1003152 3300003214 Bacteria 4380
21 JGI25153J46596_10000780 3300003215 Bacteria 19521
22 JGI25153J46596_10005162 3300003215 Bacteria 6878
23 JGI25153J46596_10008442 3300003215 Bacteria 4922
24 JGI25153J46596_10026362 3300003215 Bacteria 2057
25 rootH1_10029408 3300003316 Bacteria 1135
26 rootL2_10224148 3300003322 Bacteria 1214
27 rootH1_10199986 3300003323 Bacteria 1878
28 rootH1_10199992 3300003323 Bacteria 4130
29 JGI25160J50197_1000008 3300003354 Bacteria 289163
30 JGI25160J50197_1000015 3300003354 Bacteria 250902
31 JGI25160J50197_1000191 3300003354 Bacteria 51959
32 JGI25160J50197_1013276 3300003354 Bacteria 2817
33 JGI25161J50226_1000005 3300003374 Bacteria 292548
34 JGI25161J50226_1000051 3300003374 Bacteria 110051
35 JGI25161J50226_1000645 3300003374 Bacteria 14023
36 Ga0055526_1004586 3300003771 Bacteria 8241
37 Ga0055526_1006805 3300003771 Bacteria 6103
38 Ga0055526_1011614 3300003771 Bacteria 3946
39 Ga0055526_1025227 3300003771 Bacteria 1913
40 Ga0055526_1050721 3300003771 Bacteria 949
41 Ga0055524_1001028 3300003775 Bacteria 17224
42 Ga0055524_1001385 3300003775 Bacteria 13993
43 Ga0055524_1002986 3300003775 Bacteria 8403
44 Ga0055524_1008559 3300003775 Bacteria 4242
45 Ga0055524_1043002 3300003775 Bacteria 1116
46 Ga0055536_1005530 3300003781 Bacteria 6146
47 Ga0055528_1000201 3300003790 Bacteria 50283
48 Ga0055528_1001755 3300003790 Bacteria 12505
49 Ga0055528_1003372 3300003790 Bacteria 8058
50 Ga0055528_1005168 3300003790 Bacteria 6135
51 Ga0055528_1016328 3300003790 Bacteria 2631
52 Ga0055530_10021277 3300003791 Bacteria 1915
53 Ga0055540_1000220 3300003792 Bacteria 53660
54 Ga0055540_1003015 3300003792 Bacteria 8420
55 Ga0055540_1022079 3300003792 Bacteria 1635
56 Ga0055531_10002199 3300003794 Bacteria 13276
57 Ga0055531_10011531 3300003794 Bacteria 4248
58 Ga0055531_10021064 3300003794 Bacteria 2546
59 Ga0055543_1000012 3300004625 Bacteria 186581
60 Ga0055543_1000040 3300004625 Bacteria 122485
61 Ga0055543_1000258 3300004625 Bacteria 39859
62 Ga0055543_1001853 3300004625 Bacteria 7713
63 Ga0065165_1000015 3300005262 Bacteria 289201
64 Ga0065165_1000125 3300005262 Bacteria 130283
65 Ga0065165_1007971 3300005262 Bacteria 5070
66 Ga0065165_1008405 3300005262 Bacteria 4836
67 Ga0065165_1024782 3300005262 Bacteria 2008
68 Ga0065165_1095829 3300005262 Bacteria 749
69 Ga0065704_10123258 3300005289 Bacteria 1736
70 Ga0070658_10655175 3300005327 Bacteria 911
71 Ga0070709_10347892 3300005434 Bacteria 1094
72 Ga0070713_100183244 3300005436 Bacteria 1883
73 Ga0070665_100020587 3300005548 Bacteria 6628
74 Ga0068855_100134254 3300005563 Bacteria 2824
75 Ga0068856_100317635 3300005614 Bacteria 1575
76 Ga0068863_100251041 3300005841 Bacteria 1709
77 Ga0068862_100689433 3300005844 Bacteria 989
78 Ga0075365_10000858 3300006038 Bacteria 12642
79 Ga0075365_10001303 3300006038 Bacteria 11124
80 Ga0075365_10002765 3300006038 Bacteria 8765
81 Ga0075364_10287326 3300006051 Bacteria 1119
82 Ga0070716_100002842 3300006173 Bacteria 8063
83 Ga0075362_10001499 3300006177 Bacteria 7503
84 Ga0075367_10002234 3300006178 Bacteria 8746
85 Ga0075367_10072548 3300006178 Bacteria 2073
86 Ga0075367_10130236 3300006178 Bacteria 1555
87 Ga0075369_10000760 3300006186 Bacteria 10508
88 Ga0075369_10012547 3300006186 Bacteria 3348
89 Ga0075369_10117755 3300006186 Bacteria 1201
90 Ga0075366_10005574 3300006195 Bacteria 6825
91 Ga0075370_10060792 3300006353 Bacteria 2152
92 Ga0075370_10256504 3300006353 Bacteria 1037
93 Ga0079104_1001622 3300006946 Bacteria 14656
94 Ga0079104_1007055 3300006946 Bacteria 4135
95 Ga0105240_10000032 3300009093 Bacteria 283907
96 Ga0105243_10225965 3300009148 Bacteria 1658
97 Ga0105248_10518140 3300009177 Bacteria 1344
98 Ga0105237_10002365 3300009545 Bacteria 23399
99 Ga0105238_10491988 3300009551 Bacteria 1227
100 Ga0105249_10051807 3300009553 Bacteria 3746
101 Ga0123342_1018873 3300009766 Bacteria 5383
102 Ga0123342_1031383 3300009766 Bacteria 2576
103 Ga0105239_10012679 3300010375 Bacteria 9377
104 Ga0157373_10034649 3300013100 Bacteria 3626
105 Ga0157373_10092973 3300013100 Bacteria 2124
106 Ga0157373_10421988 3300013100 Bacteria 958
107 Ga0157370_10006055 3300013104 Bacteria 13428
108 Ga0157369_10065345 3300013105 Bacteria 3915
109 Ga0157369_10072048 3300013105 Bacteria 3708
110 Ga0171463_1001 3300013249 Bacteria 1406070
111 Ga0157378_10067397 3300013297 Bacteria 3207
112 Ga0182008_10008143 3300014497 Bacteria 5737
113 Ga0182007_10000460 3300015262 Bacteria 24598
114 Ga0182005_1001195 3300015265 Bacteria 10741
115 Ga0183363_1174 3300015690 Bacteria 14284
116 Ga0214544_1000017 3300021320 Bacteria 193638
117 Ga0214542_1000006 3300021321 Bacteria 345164
118 Ga0214543_1000003 3300021327 Bacteria 692327
119 Ga0214543_1000014 3300021327 Bacteria 324986
120 Ga0228711_1000001 3300022739 Bacteria 357377
121 Ga0228710_1000001 3300022740 Bacteria 314328
122 Ga0209435_100042 3300025206 Bacteria 105563
123 Ga0209760_103229 3300025207 Bacteria 1459
124 Ga0209436_100971 3300025208 Bacteria 11156
125 Ga0209436_102619 3300025208 Bacteria 5272
126 Ga0209672_103729 3300025228 Bacteria 3039
127 Ga0209437_100033 3300025233 Bacteria 512520
128 Ga0209437_100075 3300025233 Bacteria 297202
129 Ga0207425_1000031 3300025245 Bacteria 261181
130 Ga0207425_1005673 3300025245 Bacteria 3523
131 Ga0207425_1010232 3300025245 Bacteria 2293
132 Ga0207425_1010928 3300025245 Bacteria 2190
133 Ga0209646_1000145 3300025246 Bacteria 105563
134 Ga0209026_1000160 3300025250 Bacteria 105563
135 Ga0209677_101318 3300025253 Bacteria 10964
136 Ga0209759_1000177 3300025256 Bacteria 105563
137 Ga0209129_1000053 3300025258 Bacteria 262823
138 Ga0209129_1000137 3300025258 Bacteria 123213
139 Ga0209129_1001658 3300025258 Bacteria 12046
140 Ga0209129_1004647 3300025258 Bacteria 5254
141 Ga0209233_1000056 3300025261 Bacteria 438104
142 Ga0209233_1000064 3300025261 Bacteria 392156
143 Ga0209233_1000209 3300025261 Bacteria 115124
144 Ga0209673_1000041 3300025273 Bacteria 307397
145 Ga0209673_1000319 3300025273 Bacteria 88129
146 Ga0209673_1000603 3300025273 Bacteria 55646
147 Ga0209673_1001904 3300025273 Bacteria 16728
148 Ga0209673_1002052 3300025273 Bacteria 15245
149 Ga0209673_1005246 3300025273 Bacteria 6593
150 Ga0209673_1006607 3300025273 Bacteria 5552
151 Ga0209130_1000006 3300025284 Bacteria 596528
152 Ga0209130_1000007 3300025284 Bacteria 591584
153 Ga0209130_1000018 3300025284 Bacteria 388301
154 Ga0209130_1026324 3300025284 Bacteria 1249
155 Ga0209130_1041110 3300025284 Bacteria 891
156 Ga0209676_1000694 3300025292 Bacteria 47316
157 Ga0209676_1003604 3300025292 Bacteria 9324
158 Ga0209676_1008047 3300025292 Bacteria 4794
159 Ga0209025_1000087 3300025294 Bacteria 261181
160 Ga0209025_1000199 3300025294 Bacteria 146058
161 Ga0209025_1000580 3300025294 Bacteria 66332
162 Ga0209025_1001502 3300025294 Bacteria 30072
163 Ga0209025_1001754 3300025294 Bacteria 26007
164 Ga0209025_1007635 3300025294 Bacteria 8001
165 Ga0209025_1009735 3300025294 Bacteria 6641
166 Ga0209025_1014633 3300025294 Bacteria 4803
167 Ga0209025_1027130 3300025294 Bacteria 2851
168 Ga0209025_1066977 3300025294 Bacteria 1300
169 Ga0209564_1000330 3300025295 Bacteria 92033
170 Ga0209564_1000425 3300025295 Bacteria 74279
171 Ga0209564_1000431 3300025295 Bacteria 72866
172 Ga0209564_1001106 3300025295 Bacteria 31905
173 Ga0209564_1004048 3300025295 Bacteria 9246
174 Ga0209564_1042266 3300025295 Bacteria 1212
175 Ga0209758_1000081 3300025297 Bacteria 261181
176 Ga0209758_1000333 3300025297 Bacteria 88318
177 Ga0209758_1000890 3300025297 Bacteria 40935
178 Ga0209758_1002000 3300025297 Bacteria 21958
179 Ga0209758_1002059 3300025297 Bacteria 21481
180 Ga0209758_1002927 3300025297 Bacteria 16450
181 Ga0209758_1005916 3300025297 Bacteria 9096
182 Ga0209758_1031983 3300025297 Bacteria 2146
183 Ga0209050_1007450 3300025298 Bacteria 6130
184 Ga0209050_1013684 3300025298 Bacteria 3577
185 Ga0209256_1000877 3300025299 Bacteria 37183
186 Ga0209256_1001695 3300025299 Bacteria 21274
187 Ga0209256_1001781 3300025299 Bacteria 20391
188 Ga0209256_1002866 3300025299 Bacteria 13104
189 Ga0209256_1003093 3300025299 Bacteria 12194
190 Ga0209256_1005385 3300025299 Bacteria 7409
191 Ga0209256_1008203 3300025299 Bacteria 4905
192 Ga0209256_1043748 3300025299 Bacteria 1122
193 Ga0207426_1000044 3300025302 Bacteria 428043
194 Ga0207426_1000064 3300025302 Bacteria 358276
195 Ga0207426_1000106 3300025302 Bacteria 244368
196 Ga0207426_1000119 3300025302 Bacteria 221800
197 Ga0209051_1000198 3300025303 Bacteria 106688
198 Ga0209051_1001443 3300025303 Bacteria 20239
199 Ga0209051_1001611 3300025303 Bacteria 18403
200 Ga0209051_1002094 3300025303 Bacteria 15026
201 Ga0209051_1002200 3300025303 Bacteria 14404
202 Ga0209051_1065244 3300025303 Bacteria 1124
203 Ga0209257_1001713 3300025304 Bacteria 24577
204 Ga0209257_1002246 3300025304 Bacteria 19809
205 Ga0209257_1004254 3300025304 Bacteria 11304
206 Ga0209257_1040331 3300025304 Bacteria 1394
207 Ga0209257_1043170 3300025304 Bacteria 1324
208 Ga0207697_10105119 3300025315 Bacteria 1206
209 Ga0207695_10000024 3300025913 Bacteria 632311
210 Ga0207671_10000718 3300025914 Bacteria 42274
211 Ga0207650_10008527 3300025925 Bacteria 6998
212 Ga0207700_10073190 3300025928 Bacteria 2645
213 Ga0207665_10000133 3300025939 Bacteria 49199
214 Ga0207667_10107346 3300025949 Bacteria 2880
215 Ga0207712_10084772 3300025961 Bacteria 2316
216 Ga0207641_10229578 3300026088 Bacteria 1724
217 Ga0207676_10546880 3300026095 Bacteria 1106
218 Ga0207698_10284304 3300026142 Bacteria 1532
219 Ga0209281_1000053 3300027111 Bacteria 309587
220 Ga0209281_1000236 3300027111 Bacteria 113362
221 Ga0209281_1000266 3300027111 Bacteria 100574
222 Ga0209282_1000007 3300027666 Bacteria 254917
223 Ga0268266_10034684 3300028379 Bacteria 4292
224 Ga0268266_10154536 3300028379 Bacteria 2071
225 Ga0268264_10633587 3300028381 Unclassified 1057
226 Ga0307515_10000070 3300028794 Bacteria 239322
227 Ga0307515_10009357 3300028794 Bacteria 18953
228 Ga0307515_10009393 3300028794 Bacteria 18922
229 Ga0307515_10010607 3300028794 Bacteria 17629
230 Ga0307515_10266528 3300028794 Bacteria 1441
231 Ga0307515_10361103 3300028794 Bacteria 1093
232 Ga0307513_10017679 3300031456 Bacteria 8541
233 Ga0307513_10064384 3300031456 Bacteria 3864
234 Ga0307408_100084949 3300031548 Bacteria 2375
235 Ga0307405_10001075 3300031731 Bacteria 11115
236 Ga0307406_10010681 3300031901 Bacteria 5185
237 Ga0307412_10003169 3300031911 Bacteria 9142
238 Ga0307412_10457103 3300031911 Bacteria 1053
239 Ga0315914_1000006 3300031967 Bacteria 239817
240 Ga0307409_100072804 3300031995 Bacteria 2738
241 Ga0307414_10126819 3300032004 Bacteria 1973
242 Ga0307510_10352406 3300033180 Bacteria 922
243 Ga0315913_1000002 3300033430 Bacteria 241452
244 Ga0315915_1000001 3300033464 Bacteria 481518
245 Ga0395900_0111279 3300037418 Bacteria 2813
246 Ga0395905_0016934 3300037471 Bacteria 6922
247 Ga0395905_0047077 3300037471 Bacteria 4043
248 Ga0395901_0000508 3300038443 Bacteria 45081
249 Ga0436365_0215315 3300039437 Bacteria 1041
250 Ga0436365_0573424 3300039437 Bacteria 751
251 Ga0439436_0018152 3300041404 Bacteria 2103
252 Ga0439438_023347 3300041405 Bacteria 1706
253 Ga0439465_0026630 3300041413 Bacteria 1829
254 Ga0439465_0093300 3300041413 Bacteria 1032
255 Ga0451793_1931244 3300041452 Bacteria 1214
256 Ga0451837_0331042 3300041494 Bacteria 1341
257 Ga0451839_0799242 3300041496 Bacteria 1251
258 Ga0451841_0302975 3300041498 Bacteria 1489
259 Ga0451841_0659426 3300041498 Bacteria 5282
260 Ga0451845_0068571 3300041501 Bacteria 1944
261 Ga0451846_49560 3300041502 Bacteria 1403
262 Ga0451847_0047250 3300041503 Bacteria 5077
263 Ga0451847_0824177 3300041503 Bacteria 749
264 Ga0451849_0746664 3300041505 Bacteria 1077
265 Ga0451849_1275464 3300041505 Bacteria 1036
266 Ga0451849_1509101 3300041505 Bacteria 1572
267 Ga0451851_0316867 3300041507 Bacteria 5269
268 Ga0451851_0644451 3300041507 Bacteria 1358
269 Ga0451855_1139024 3300041511 Bacteria 3291
270 Ga0451853_0907327 3300041512 Bacteria 2165
271 Ga0439445_0035464 3300042004 Bacteria 1310
272 Ga0439449_0010290 3300042007 Bacteria 3532
273 Ga0439449_0102273 3300042007 Bacteria 1059
274 Ga0439462_0009016 3300042015 Bacteria 2524
275 Ga0450906_008763 3300042145 Bacteria 1946
276 Ga0439434_0051995 3300042435 Bacteria 1271
277 Ga0466965_0064857 3300044683 Bacteria 1829
278 Ga0466966_0528769 3300044684 Bacteria 709
279 Ga0466963_0402478 3300044694 Bacteria 965
280 Ga0466968_0017525 3300044735 Bacteria 2864
281 Ga0466970_0012880 3300044765 Bacteria 4282
282 Ga0466970_0032477 3300044765 Bacteria 2758
283 Ga0466957_0081763 3300044842 Bacteria 2012
284 Ga0466960_0151262 3300044901 Bacteria 1240
285 Ga0466958_0150466 3300045836 Bacteria 1468
286 Ga0495617_037385 3300046452 Bacteria 1626
287 Ga0495592_0097073 3300046454 Bacteria 2105
288 Ga0495603_0157881 3300046455 Bacteria 1316
289 Ga0495590_0108203 3300046457 Bacteria 991
290 Ga0495638_0003817 3300046460 Bacteria 11698
291 Ga0495638_0037074 3300046460 Bacteria 3103
292 Ga0495651_0251438 3300046462 Bacteria 1207
293 Ga0495605_0011138 3300046474 Bacteria 5025
294 Ga0495605_0181496 3300046474 Bacteria 925
295 Ga0495662_0010800 3300046476 Bacteria 4465
296 Ga0495664_0066671 3300046477 Bacteria 2147
297 Ga0495585_0011550 3300046492 Bacteria 5226
298 Ga0495585_0038977 3300046492 Bacteria 2673
299 Ga0495585_0061354 3300046492 Bacteria 2068
300 Ga0495585_0123347 3300046492 Bacteria 1369
301 Ga0495596_0108794 3300046500 Bacteria 1076
302 Ga0495607_0068939 3300046501 Bacteria 1982
303 Ga0495607_0210805 3300046501 Bacteria 956
304 Ga0495583_0004596 3300046506 Bacteria 9785
305 Ga0495583_0013729 3300046506 Bacteria 4498
306 Ga0495606_0007105 3300046507 Bacteria 10123
307 Ga0495606_0035483 3300046507 Bacteria 3407
308 Ga0495606_0036357 3300046507 Bacteria 3355
309 Ga0495606_0049390 3300046507 Bacteria 2760
310 Ga0495610_0006488 3300046512 Bacteria 8037
311 Ga0495610_0033071 3300046512 Bacteria 2677
312 Ga0495616_0016301 3300046513 Bacteria 4116
313 Ga0495616_0049112 3300046513 Bacteria 2117
314 Ga0495620_0008876 3300046515 Bacteria 5374
315 Ga0495620_0035575 3300046515 Bacteria 2237
316 Ga0495628_0108952 3300046516 Bacteria 2132
317 Ga0495631_0003953 3300046518 Bacteria 8006
318 Ga0495632_0021429 3300046519 Bacteria 3482
319 Ga0495632_0029637 3300046519 Bacteria 2847
320 Ga0495632_0084482 3300046519 Bacteria 1510
321 Ga0495643_0023538 3300046522 Bacteria 3501
322 Ga0495643_0024536 3300046522 Bacteria 3419
323 Ga0495643_0123974 3300046522 Bacteria 1303
324 Ga0495648_0016629 3300046524 Bacteria 5295
325 Ga0495648_0222101 3300046524 Bacteria 931
326 Ga0495652_0176860 3300046529 Bacteria 1642
327 Ga0495654_0000092 3300046530 Bacteria 101504
328 Ga0495654_0072443 3300046530 Bacteria 1631
329 Ga0495640_0199047 3300046533 Bacteria 1270
330 Ga0495587_0067533 3300046536 Bacteria 2084
331 Ga0495609_0034871 3300046538 Bacteria 2279
332 Ga0495609_0121838 3300046538 Bacteria 1121
333 Ga0495621_0139715 3300046539 Bacteria 947
334 Ga0495622_0008227 3300046557 Bacteria 4832
335 Ga0495633_0112623 3300046558 Bacteria 1261
336 Ga0495633_0116324 3300046558 Bacteria 1239
337 Ga0495668_0004226 3300046616 Bacteria 10340
338 Ga0495611_0005820 3300046648 Bacteria 5263
339 Ga0495625_0000883 3300046660 Bacteria 40600
340 Ga0495625_0011676 3300046660 Bacteria 7145
341 Ga0495625_0021680 3300046660 Bacteria 4941
342 Ga0495625_0244679 3300046660 Bacteria 1166
343 Ga0495625_0378203 3300046660 Bacteria 889
344 Ga0495659_0000169 3300046664 Bacteria 29041
345 Ga0495661_0099044 3300046665 Bacteria 1644
346 Ga0495588_0017354 3300046674 Bacteria 3493
347 Ga0495588_0034968 3300046674 Bacteria 2544
348 Ga0495657_0034711 3300046675 Bacteria 3501
349 Ga0495646_0217716 3300046680 Bacteria 1034
350 Ga0495658_0078054 3300046683 Bacteria 1937
351 Ga0495670_0089722 3300046691 Bacteria 1572
352 Ga0495670_0362318 3300046691 Bacteria 781
353 Ga0495671_0005586 3300046692 Bacteria 7340
354 Ga0495671_0111024 3300046692 Bacteria 1339
355 Ga0495649_0015455 3300046694 Bacteria 4345
356 Ga0495600_0014412 3300046809 Bacteria 4982
357 Ga0495660_0027278 3300046810 Bacteria 3232
358 Ga0495660_0029535 3300046810 Bacteria 3092
359 Ga0495660_0181624 3300046810 Bacteria 1017
360 Ga0495604_0041180 3300047317 Bacteria 3623
361 Ga0495636_0035876 3300047318 Bacteria 2043
362 Ga0495636_0094526 3300047318 Bacteria 1301
363 Ga0495672_0000045 3300047320 Bacteria 255145
364 Ga0495672_0009853 3300047320 Bacteria 6874
365 Ga0495687_016382 3300047443 Bacteria 3729
366 Ga0495681_0103466 3300047470 Bacteria 1242
367 Ga0495686_0001036 3300047472 Bacteria 33364
368 Ga0495686_0008424 3300047472 Bacteria 7565
369 Ga0495686_0018580 3300047472 Bacteria 4661
370 Ga0495686_0030342 3300047472 Bacteria 3512
371 Ga0495686_0186950 3300047472 Bacteria 1196
372 Ga0495626_0081029 3300048091 Bacteria 1442
373 Ga0495626_0099234 3300048091 Bacteria 1271
374 Ga0496100_0037143 3300048903 Bacteria 3077
375 Ga0496100_0521848 3300048903 Bacteria 917
376 Ga0496101_0288769 3300048904 Bacteria 1283
377 Ga0496102_0066355 3300048905 Bacteria 3307
378 Ga0496103_0008468 3300048906 Bacteria 6109
379 Ga0496106_0015849 3300048909 Bacteria 5574
380 Ga0496106_0365858 3300048909 Bacteria 1159
381 Ga0496111_0002706 3300048914 Bacteria 10766
382 Ga0496112_0079195 3300048915 Bacteria 3250
383 Ga0496113_0228648 3300048916 Bacteria 1483
384 Ga0496116_0000026 3300048919 Bacteria 450803
385 Ga0496116_0005741 3300048919 Bacteria 11414
386 Ga0496116_0009536 3300048919 Bacteria 8267
387 Ga0496116_0010291 3300048919 Bacteria 7856
388 Ga0496116_0039068 3300048919 Bacteria 3285
389 Ga0496116_0056409 3300048919 Bacteria 2574
390 Ga0496116_0096303 3300048919 Bacteria 1783
391 Ga0496116_0289728 3300048919 Bacteria 787
392 Ga0496117_0001867 3300048920 Bacteria 28420
393 Ga0496117_0023329 3300048920 Bacteria 4934
394 Ga0496117_0029504 3300048920 Bacteria 4227
395 Ga0496117_0030478 3300048920 Bacteria 4139
396 Ga0496117_0097743 3300048920 Bacteria 1869
397 Ga0496117_0105548 3300048920 Bacteria 1770
398 Ga0496118_0012870 3300048921 Bacteria 7974
399 Ga0496118_0022747 3300048921 Bacteria 5466
400 Ga0496118_0024577 3300048921 Bacteria 5195
401 Ga0496118_0034308 3300048921 Bacteria 4143
402 Ga0496118_0074792 3300048921 Bacteria 2419
403 Ga0496118_0213674 3300048921 Bacteria 1130
404 Ga0496119_0004467 3300048922 Bacteria 13916
405 Ga0496119_0027539 3300048922 Bacteria 3903
406 Ga0496119_0059809 3300048922 Bacteria 2285
407 Ga0496119_0237284 3300048922 Bacteria 925
408 Ga0496120_0036918 3300048923 Bacteria 2903
409 Ga0496121_0008112 3300048924 Bacteria 12489
410 Ga0496121_0012320 3300048924 Bacteria 9350
411 Ga0496121_0012537 3300048924 Bacteria 9225
412 Ga0496121_0035352 3300048924 Bacteria 4480
413 Ga0496121_0037316 3300048924 Bacteria 4317
414 Ga0496121_0132588 3300048924 Bacteria 1862
415 Ga0496121_0198199 3300048924 Bacteria 1433
416 Ga0496121_0212161 3300048924 Bacteria 1371
417 Ga0496122_0000160 3300048925 Bacteria 159236
418 Ga0496122_0000604 3300048925 Bacteria 73844
419 Ga0496122_0005715 3300048925 Bacteria 14660
420 Ga0496122_0011685 3300048925 Bacteria 8849
421 Ga0496122_0012377 3300048925 Bacteria 8508
422 Ga0496122_0031039 3300048925 Bacteria 4458
423 Ga0496122_0037563 3300048925 Bacteria 3895
424 Ga0496122_0043473 3300048925 Bacteria 3519
425 Ga0496122_0188671 3300048925 Bacteria 1219
426 Ga0496122_0248322 3300048925 Bacteria 997
427 Ga0496122_0318563 3300048925 Bacteria 828
428 Ga0496123_0000034 3300048926 Bacteria 274836
429 Ga0496123_0000103 3300048926 Bacteria 168232
430 Ga0496123_0003820 3300048926 Bacteria 16441
431 Ga0496123_0008044 3300048926 Bacteria 9762
432 Ga0496123_0009653 3300048926 Bacteria 8658
433 Ga0496123_0045222 3300048926 Bacteria 3002
434 Ga0496123_0057206 3300048926 Bacteria 2540
435 Ga0496123_0149581 3300048926 Bacteria 1262
436 Ga0496124_0001469 3300048927 Bacteria 34707
437 Ga0496124_0005176 3300048927 Bacteria 14827
438 Ga0496124_0008098 3300048927 Bacteria 11045
439 Ga0496124_0012183 3300048927 Bacteria 8511
440 Ga0496124_0054620 3300048927 Bacteria 3380
441 Ga0496124_0076704 3300048927 Bacteria 2758
442 Ga0496124_0107636 3300048927 Bacteria 2249
443 Ga0496124_0109488 3300048927 Bacteria 2226
444 Ga0496124_0192816 3300048927 Bacteria 1557
445 Ga0496124_0246281 3300048927 Bacteria 1325
446 Ga0496124_0268234 3300048927 Bacteria 1252
447 Ga0496124_0569779 3300048927 Bacteria 743
448 Ga0496125_0004365 3300048928 Bacteria 16385
449 Ga0496125_0009397 3300048928 Bacteria 10056
450 Ga0496125_0017778 3300048928 Bacteria 6767
451 Ga0496125_0049367 3300048928 Bacteria 3497
452 Ga0496125_0051911 3300048928 Bacteria 3377
453 Ga0496125_0127217 3300048928 Bacteria 1802
454 Ga0496125_0355894 3300048928 Bacteria 872
455 Ga0496126_0000069 3300048929 Bacteria 246935
456 Ga0496126_0001336 3300048929 Bacteria 39105
457 Ga0496126_0006321 3300048929 Bacteria 13225
458 Ga0496126_0041488 3300048929 Bacteria 4258
459 Ga0496126_0068735 3300048929 Bacteria 3162
460 Ga0496126_0103341 3300048929 Bacteria 2490
461 Ga0496126_0214523 3300048929 Bacteria 1619
462 Ga0501308_024281 3300049128 Bacteria 779
463 Ga0495678_037486 3300049459 Bacteria 1969
464 Ga0495682_0199677 3300049460 Bacteria 709
465 Ga0501313_021698 3300049529 Bacteria 797
466 Ga0501315_011186 3300049531 Bacteria 1091
467 Ga0501034_0167911 3300049571 Bacteria 2162
468 Ga0501034_0213083 3300049571 Bacteria 1886
469 Ga0501036_0149380 3300049572 Bacteria 1971
470 Ga0501043_0121628 3300049579 Bacteria 2047
471 Ga0501048_0435449 3300049582 Bacteria 938
472 Ga0501073_0376747 3300049589 Bacteria 980
473 Ga0501080_0313249 3300049742 Bacteria 1422
474 Ga0501280_003075 3300049776 Bacteria 2627
475 Ga0501280_006911 3300049776 Bacteria 1593
476 Ga0501035_0704233 3300049822 Bacteria 814
477 Ga0501045_0502139 3300049824 Bacteria 901
478 nmdc:mga03683_87540_c1 3300050489 Bacteria 1354
479 nmdc:mga03n38_33570_c1 3300050490 Bacteria 2184
480 nmdc:mga00v17_359109_c1 3300050491 Bacteria 947
481 nmdc:mga0yw44_3000_c1 3300050492 Bacteria 7370
482 nmdc:mga0k408_232359_c1 3300050493 Bacteria 1101
483 nmdc:mga06z11_472136_c1 3300050494 Bacteria 759
484 nmdc:mga07m45_140263_c1 3300050496 Bacteria 1400
485 nmdc:mga0sz30_167045_c1 3300050516 Bacteria 975
486 nmdc:mga0sz30_8860_c1 3300050516 Bacteria 3813
487 Ga0495601_0078710 3300053077 Bacteria 2113
488 Ga0500610_0112906 3300053079 Bacteria 1395
489 Ga0495619_0022478 3300053085 Bacteria 4037
490 Ga0500578_0064509 3300053086 Bacteria 2335
491 Ga0500578_0073300 3300053086 Bacteria 2181
492 Ga0500643_141821 3300053087 Bacteria 645
493 Ga0500654_055175 3300053099 Bacteria 2096
494 Ga0500569_007786 3300053109 Bacteria 2421
495 Ga0500569_008089 3300053109 Bacteria 2392
496 Ga0500594_0032146 3300053118 Bacteria 1388
497 Ga0500614_009709 3300053123 Bacteria 2056
498 Ga0500658_0006339 3300053134 Bacteria 4388
499 Ga0500658_0084466 3300053134 Bacteria 1363
500 Ga0500568_0002529 3300053139 Bacteria 10682
501 Ga0500577_0039181 3300053142 Bacteria 1716
502 Ga0500590_001191 3300053148 Bacteria 10331
503 Ga0500604_0062650 3300053151 Bacteria 1171
504 Ga0500616_0001190 3300053153 Bacteria 26447
505 Ga0500616_0001711 3300053153 Bacteria 20169
506 Ga0500616_0006652 3300053153 Bacteria 7517
507 Ga0500622_0008805 3300053156 Bacteria 5618
508 Ga0500627_0099460 3300053158 Bacteria 1305
509 Ga0501082_0104676 3300060353 Bacteria 2448
510 Ga0466962_0050301 3300061719 Bacteria 1992

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10105119 Ga0207697_101051192 176
2 3300046501 Ga0495607_0210805 Ga0495607_0210805_386_946 186
3 3300049529 Ga0501313_021698 Ga0501313_021698_207_773 187
4 3300049531 Ga0501315_011186 Ga0501315_011186_500_1066 187
5 3300049128 Ga0501308_024281 Ga0501308_024281_26_604 189
6 3300006946 Ga0079104_1001622 Ga0079104_100162216 193
7 3300022739 Ga0228711_1000001 Ga0228711_100000113 193
8 3300022740 Ga0228710_1000001 Ga0228710_1000001312 193
9 3300025284 Ga0209130_1026324 Ga0209130_10263242 193
10 3300025928 Ga0207700_10073190 Ga0207700_100731902 193
11 3300027111 Ga0209281_1000266 Ga0209281_100026686 193
12 3300027666 Ga0209282_1000007 Ga0209282_1000007240 193
13 3300031967 Ga0315914_1000006 Ga0315914_10000063 193
14 3300033430 Ga0315913_1000002 Ga0315913_1000002239 193
15 3300033464 Ga0315915_1000001 Ga0315915_1000001247 193
16 3300025295 Ga0209564_1042266 Ga0209564_10422662 194
17 3300006946 Ga0079104_1007055 Ga0079104_10070553 195
18 3300027111 Ga0209281_1000236 Ga0209281_100023642 195
19 3300005262 Ga0065165_1095829 Ga0065165_10958291 196
20 3300006173 Ga0070716_100002842 Ga0070716_1000028424 196
21 3300025939 Ga0207665_10000133 Ga0207665_1000013321 196
22 iso_pu_bacteria 2738541280 2738738765 197
23 iso_pu_bacteria 2738541300 2738844646 197
24 iso_pu_bacteria 2738543018 2739276170 197
25 iso_pu_bacteria 2738543030 2739345306 197
26 3300025304 Ga0209257_1040331 Ga0209257_10403312 199
27 3300028381 Ga0268264_10633587 Ga0268264_106335872 199
28 iso_pu_bacteria 2643221664 2644356613 199
29 3300002773 JGI25152J39213_1000780 JGI25152J39213_10007801 200
30 3300002774 JGI25150J39212_1000033 JGI25150J39212_100003374 200
31 3300003187 JGI25151J46595_10000108 JGI25151J46595_1000010848 200
32 3300003215 JGI25153J46596_10000780 JGI25153J46596_100007807 200
33 3300003792 Ga0055540_1000220 Ga0055540_100022044 200
34 3300003794 Ga0055531_10021064 Ga0055531_100210644 200
35 3300005841 Ga0068863_100251041 Ga0068863_1002510412 200
36 3300006178 Ga0075367_10130236 Ga0075367_101302362 200
37 3300006353 Ga0075370_10256504 Ga0075370_102565042 200
38 3300009553 Ga0105249_10051807 Ga0105249_100518072 200
39 3300013297 Ga0157378_10067397 Ga0157378_100673973 200
40 3300025245 Ga0207425_1000031 Ga0207425_100003168 200
41 3300025258 Ga0209129_1000053 Ga0209129_100005369 200
42 3300025273 Ga0209673_1002052 Ga0209673_10020524 200
43 3300025273 Ga0209673_1005246 Ga0209673_10052465 200
44 3300025294 Ga0209025_1000087 Ga0209025_100008768 200
45 3300025297 Ga0209758_1000081 Ga0209758_100008168 200
46 3300025298 Ga0209050_1013684 Ga0209050_10136841 200
47 3300025299 Ga0209256_1043748 Ga0209256_10437481 200
48 3300025303 Ga0209051_1000198 Ga0209051_100019896 200
49 3300025304 Ga0209257_1002246 Ga0209257_100224613 200
50 3300025961 Ga0207712_10084772 Ga0207712_100847723 200
51 3300026088 Ga0207641_10229578 Ga0207641_102295782 200
52 3300026095 Ga0207676_10546880 Ga0207676_105468802 200
53 3300031731 Ga0307405_10001075 Ga0307405_100010756 200
54 3300038443 Ga0395901_0000508 Ga0395901_0000508_40138_40749 200
55 3300044683 Ga0466965_0064857 Ga0466965_0064857_220_831 200
56 3300044901 Ga0466960_0151262 Ga0466960_0151262_298_909 200
57 3300046506 Ga0495583_0004596 Ga0495583_0004596_5041_5715 200
58 3300046507 Ga0495606_0035483 Ga0495606_0035483_683_1294 200
59 3300046507 Ga0495606_0049390 Ga0495606_0049390_1402_2013 200
60 3300046660 Ga0495625_0011676 Ga0495625_0011676_5171_5782 200
61 3300046664 Ga0495659_0000169 Ga0495659_0000169_10638_11249 200
62 3300046692 Ga0495671_0005586 Ga0495671_0005586_1286_1897 200
63 3300046810 Ga0495660_0027278 Ga0495660_0027278_95_706 200
64 3300046810 Ga0495660_0181624 Ga0495660_0181624_95_706 200
65 3300047320 Ga0495672_0000045 Ga0495672_0000045_217608_218219 200
66 3300047472 Ga0495686_0008424 Ga0495686_0008424_806_1417 200
67 3300048904 Ga0496101_0288769 Ga0496101_0288769_281_940 200
68 3300048916 Ga0496113_0228648 Ga0496113_0228648_85_744 200
69 3300048919 Ga0496116_0005741 Ga0496116_0005741_9471_10130 200
70 3300048919 Ga0496116_0009536 Ga0496116_0009536_1010_1669 200
71 3300048919 Ga0496116_0056409 Ga0496116_0056409_1085_1744 200
72 3300048920 Ga0496117_0030478 Ga0496117_0030478_49_708 200
73 3300048921 Ga0496118_0074792 Ga0496118_0074792_933_1592 200
74 3300048924 Ga0496121_0008112 Ga0496121_0008112_3040_3699 200
75 3300048925 Ga0496122_0000160 Ga0496122_0000160_70792_71463 200
76 3300048925 Ga0496122_0005715 Ga0496122_0005715_11443_12102 200
77 3300048925 Ga0496122_0043473 Ga0496122_0043473_654_1313 200
78 3300048926 Ga0496123_0000034 Ga0496123_0000034_100470_101141 200
79 3300048926 Ga0496123_0003820 Ga0496123_0003820_8956_9615 200
80 3300048927 Ga0496124_0005176 Ga0496124_0005176_8722_9381 200
81 3300048927 Ga0496124_0054620 Ga0496124_0054620_1939_2598 200
82 3300048927 Ga0496124_0076704 Ga0496124_0076704_1814_2485 200
83 3300048928 Ga0496125_0004365 Ga0496125_0004365_12271_12930 200
84 3300048928 Ga0496125_0355894 Ga0496125_0355894_129_788 200
85 3300048929 Ga0496126_0041488 Ga0496126_0041488_3432_4091 200
86 3300049572 Ga0501036_0149380 Ga0501036_0149380_531_1196 200
87 3300049582 Ga0501048_0435449 Ga0501048_0435449_87_752 200
88 3300049589 Ga0501073_0376747 Ga0501073_0376747_31_696 200
89 3300049742 Ga0501080_0313249 Ga0501080_0313249_713_1378 200
90 3300050494 nmdc:mga06z11_472136_c1 nmdc:mga06z11_472136_c1_31_702 200
91 iso_pu_bacteria 2534681786 2535484456 200
92 iso_pu_bacteria 2643221554 2643788362 200
93 iso_pu_bacteria 2643221638 2644213710 200
94 iso_pu_bacteria 2751185800 2753359022 200
95 iso_pu_bacteria 2758568016 2758641259 200
96 iso_pu_bacteria 2854911287 2854914543 200
97 iso_pu_bacteria 2915650412 2915651528 200
98 3300041413 Ga0439465_0093300 Ga0439465_0093300_18_680 201
99 3300042004 Ga0439445_0035464 Ga0439445_0035464_129_791 201
100 3300042007 Ga0439449_0102273 Ga0439449_0102273_170_832 201
101 3300002773 JGI25152J39213_1005651 JGI25152J39213_10056513 202
102 3300003187 JGI25151J46595_10004059 JGI25151J46595_100040595 202
103 3300025258 Ga0209129_1000137 Ga0209129_100013722 202
104 3300025294 Ga0209025_1001754 Ga0209025_10017548 202
105 3300053087 Ga0500643_141821 Ga0500643_141821_19_630 202
106 iso_pu_bacteria 2519899620 2520377445 202
107 3300003771 Ga0055526_1011614 Ga0055526_10116143 203
108 3300003771 Ga0055526_1025227 Ga0055526_10252274 203
109 3300003775 Ga0055524_1008559 Ga0055524_10085594 203
110 3300003790 Ga0055528_1000201 Ga0055528_100020132 203
111 3300003790 Ga0055528_1003372 Ga0055528_10033726 203
112 3300006038 Ga0075365_10001303 Ga0075365_100013039 203
113 3300006178 Ga0075367_10002234 Ga0075367_100022347 203
114 3300006186 Ga0075369_10000760 Ga0075369_100007609 203
115 3300013100 Ga0157373_10421988 Ga0157373_104219881 203
116 3300021327 Ga0214543_1000003 Ga0214543_1000003531 203
117 3300025273 Ga0209673_1000041 Ga0209673_1000041113 203
118 3300025273 Ga0209673_1000319 Ga0209673_100031949 203
119 3300025292 Ga0209676_1008047 Ga0209676_10080474 203
120 3300025295 Ga0209564_1000431 Ga0209564_100043140 203
121 3300025295 Ga0209564_1004048 Ga0209564_10040483 203
122 3300025299 Ga0209256_1002866 Ga0209256_10028667 203
123 3300025299 Ga0209256_1005385 Ga0209256_10053854 203
124 3300039437 Ga0436365_0215315 Ga0436365_0215315_400_1014 203
125 3300039437 Ga0436365_0573424 Ga0436365_0573424_23_637 203
126 3300053134 Ga0500658_0084466 Ga0500658_0084466_51_662 203
127 iso_pu_bacteria 2643221558 2643809960 203
128 iso_pu_bacteria 2643221637 2644206147 203
129 iso_pu_bacteria 2643221718 2644649794 203
130 3300006038 Ga0075365_10000858 Ga0075365_100008585 204
131 3300028794 Ga0307515_10266528 Ga0307515_102665282 204
132 3300028794 Ga0307515_10361103 Ga0307515_103611032 204
133 3300033180 Ga0307510_10352406 Ga0307510_103524062 204
134 3300037471 Ga0395905_0016934 Ga0395905_0016934_1459_2073 204
135 3300046454 Ga0495592_0097073 Ga0495592_0097073_59_754 204
136 3300046476 Ga0495662_0010800 Ga0495662_0010800_1610_2305 204
137 3300046477 Ga0495664_0066671 Ga0495664_0066671_1321_2016 204
138 3300046516 Ga0495628_0108952 Ga0495628_0108952_1353_2048 204
139 3300046529 Ga0495652_0176860 Ga0495652_0176860_802_1497 204
140 3300046533 Ga0495640_0199047 Ga0495640_0199047_429_1124 204
141 3300046536 Ga0495587_0067533 Ga0495587_0067533_953_1648 204
142 3300046557 Ga0495622_0008227 Ga0495622_0008227_1290_1985 204
143 3300046674 Ga0495588_0017354 Ga0495588_0017354_2141_2836 204
144 3300046675 Ga0495657_0034711 Ga0495657_0034711_2503_3198 204
145 3300046680 Ga0495646_0217716 Ga0495646_0217716_209_904 204
146 3300046683 Ga0495658_0078054 Ga0495658_0078054_811_1506 204
147 3300046809 Ga0495600_0014412 Ga0495600_0014412_3151_3846 204
148 3300047317 Ga0495604_0041180 Ga0495604_0041180_2744_3439 204
149 3300048922 Ga0496119_0004467 Ga0496119_0004467_9605_10222 204
150 3300048924 Ga0496121_0212161 Ga0496121_0212161_519_1148 204
151 3300048925 Ga0496122_0188671 Ga0496122_0188671_424_1041 204
152 3300048926 Ga0496123_0057206 Ga0496123_0057206_598_1215 204
153 3300048928 Ga0496125_0049367 Ga0496125_0049367_2789_3406 204
154 3300048928 Ga0496125_0127217 Ga0496125_0127217_179_796 204
155 3300048929 Ga0496126_0068735 Ga0496126_0068735_1201_1818 204
156 3300050492 nmdc:mga0yw44_3000_c1 nmdc:mga0yw44_3000_c1_376_1002 204
157 3300053077 Ga0495601_0078710 Ga0495601_0078710_83_778 204
158 3300053085 Ga0495619_0022478 Ga0495619_0022478_2624_3319 204
159 3300053123 Ga0500614_009709 Ga0500614_009709_1244_1939 204
160 3300053148 Ga0500590_001191 Ga0500590_001191_4762_5457 204
161 3300053151 Ga0500604_0062650 Ga0500604_0062650_544_1161 204
162 3300025303 Ga0209051_1002200 Ga0209051_10022005 205
163 3300031548 Ga0307408_100084949 Ga0307408_1000849492 205
164 3300031911 Ga0307412_10003169 Ga0307412_100031694 205
165 3300037418 Ga0395900_0111279 Ga0395900_0111279_685_1302 205
166 3300037471 Ga0395905_0047077 Ga0395905_0047077_2840_3457 205
167 3300041404 Ga0439436_0018152 Ga0439436_0018152_174_806 205
168 3300041413 Ga0439465_0026630 Ga0439465_0026630_1165_1782 205
169 3300041503 Ga0451847_0824177 Ga0451847_0824177_46_663 205
170 3300042007 Ga0439449_0010290 Ga0439449_0010290_677_1309 205
171 3300042015 Ga0439462_0009016 Ga0439462_0009016_508_1140 205
172 3300042145 Ga0450906_008763 Ga0450906_008763_1089_1721 205
173 3300046462 Ga0495651_0251438 Ga0495651_0251438_547_1182 205
174 3300046512 Ga0495610_0006488 Ga0495610_0006488_2729_3403 205
175 3300046519 Ga0495632_0021429 Ga0495632_0021429_92_766 205
176 3300046519 Ga0495632_0029637 Ga0495632_0029637_2184_2801 205
177 3300046660 Ga0495625_0244679 Ga0495625_0244679_519_1151 205
178 3300047472 Ga0495686_0030342 Ga0495686_0030342_782_1456 205
179 3300048920 Ga0496117_0105548 Ga0496117_0105548_572_1246 205
180 3300048924 Ga0496121_0012320 Ga0496121_0012320_640_1314 205
181 3300048924 Ga0496121_0132588 Ga0496121_0132588_1095_1715 205
182 3300048925 Ga0496122_0031039 Ga0496122_0031039_1059_1733 205
183 3300053099 Ga0500654_055175 Ga0500654_055175_1443_2075 205
184 iso_pu_bacteria 2513237159 2514001931 205
185 iso_pu_bacteria 2582581865 2585387113 205
186 iso_pu_bacteria 2582581866 2585392767 205
187 iso_pu_bacteria 2643221607 2644046509 205
188 iso_pu_bacteria 2643221636 2644200862 205
189 iso_pu_bacteria 2643221686 2644479299 205
190 iso_pu_bacteria 2842521101 2842526296 205
191 3300009766 Ga0123342_1031383 Ga0123342_10313832 206
192 3300013105 Ga0157369_10065345 Ga0157369_100653452 206
193 3300028794 Ga0307515_10009357 Ga0307515_1000935717 206
194 3300031911 Ga0307412_10457103 Ga0307412_104571032 206
195 3300031995 Ga0307409_100072804 Ga0307409_1000728043 206
196 3300046455 Ga0495603_0157881 Ga0495603_0157881_16_690 206
197 3300046492 Ga0495585_0061354 Ga0495585_0061354_595_1269 206
198 3300046558 Ga0495633_0116324 Ga0495633_0116324_344_1018 206
199 3300046660 Ga0495625_0378203 Ga0495625_0378203_85_705 206
200 3300046674 Ga0495588_0034968 Ga0495588_0034968_1708_2382 206
201 3300047470 Ga0495681_0103466 Ga0495681_0103466_238_912 206
202 3300048903 Ga0496100_0521848 Ga0496100_0521848_62_736 206
203 iso_pu_bacteria 2582581306 2585266112 206
204 iso_pu_bacteria 2600254933 2600375315 206
205 3300032004 Ga0307414_10126819 Ga0307414_101268192 207
206 iso_pu_bacteria 2643221688 2644493349 207
207 3300005436 Ga0070713_100183244 Ga0070713_1001832442 208
208 3300046492 Ga0495585_0038977 Ga0495585_0038977_1852_2526 208
209 iso_pu_bacteria 2510461069 2510839644 208
210 iso_pu_bacteria 2558860983 2561466096 208
211 iso_pu_bacteria 2643221689 2644502346 208
212 iso_pu_bacteria 2818991272 2819242493 208
213 iso_pu_bacteria 2989776772 2989778234 208
214 iso_pu_bacteria 8005246636 8005251267 208
215 iso_pu_bacteria 8005658619 8005659930 208
216 iso_pu_bacteria 8018150411 8018152505 208
217 iso_pu_bacteria 8055431914 8055434237 208
218 3300013105 Ga0157369_10072048 Ga0157369_100720482 210
219 3300025294 Ga0209025_1066977 Ga0209025_10669772 210
220 3300041405 Ga0439438_023347 Ga0439438_023347_717_1379 210
221 3300042435 Ga0439434_0051995 Ga0439434_0051995_266_928 210
222 3300048915 Ga0496112_0079195 Ga0496112_0079195_1007_1672 210
223 3300002987 JGI25159J45721_1000136 JGI25159J45721_100013614 211
224 3300003354 JGI25160J50197_1000015 JGI25160J50197_100001549 211
225 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005192 211
226 3300004625 Ga0055543_1000012 Ga0055543_100001250 211
227 3300005262 Ga0065165_1000125 Ga0065165_100012591 211
228 3300025284 Ga0209130_1000018 Ga0209130_1000018221 211
229 3300025294 Ga0209025_1014633 Ga0209025_10146332 211
230 3300025297 Ga0209758_1031983 Ga0209758_10319832 211
231 3300025302 Ga0207426_1000044 Ga0207426_1000044168 211
232 3300028794 Ga0307515_10000070 Ga0307515_10000070129 211
233 3300031456 Ga0307513_10017679 Ga0307513_100176792 211
234 iso_pu_bacteria 2896384573 2896386694 211
235 3300005289 Ga0065704_10123258 Ga0065704_101232582 212
236 3300028794 Ga0307515_10010607 Ga0307515_100106075 212
237 3300049776 Ga0501280_003075 Ga0501280_003075_828_1484 212
238 3300049776 Ga0501280_006911 Ga0501280_006911_107_763 212
239 iso_pu_bacteria 2551306090 2551721354 212
240 iso_pu_bacteria 2582581283 2585165614 212
241 iso_pu_bacteria 2582581304 2585256566 213
242 iso_pu_bacteria 2738541293 2738802209 213
243 3300005434 Ga0070709_10347892 Ga0070709_103478921 214
244 3300048919 Ga0496116_0000026 Ga0496116_0000026_234760_235419 214
245 3300048920 Ga0496117_0097743 Ga0496117_0097743_612_1271 214
246 3300048925 Ga0496122_0318563 Ga0496122_0318563_63_722 214
247 3300048927 Ga0496124_0192816 Ga0496124_0192816_165_824 214
248 3300048929 Ga0496126_0000069 Ga0496126_0000069_57954_58613 214
249 iso_pu_bacteria 2585427594 2585847167 214
250 iso_pu_bacteria 2599185236 2599722060 214
251 iso_pu_bacteria 2775507049 2776912872 214
252 iso_pu_bacteria 2919166419 2919168432 214
253 iso_pu_bacteria 2939669807 2939670219 214
254 iso_pu_bacteria 2978969890 2978971101 214
255 iso_pu_bacteria 2984587000 2984588263 214
256 iso_pu_bacteria 8054460903 8054461947 214
257 3300013100 Ga0157373_10092973 Ga0157373_100929732 215
258 iso_pu_bacteria 2511231052 2511501070 215
259 iso_pu_bacteria 2512875026 2512972185 215
260 iso_pu_bacteria 2513237086 2513582845 215
261 iso_pu_bacteria 2513237089 2513603264 215
262 iso_pu_bacteria 2513237091 2513616234 215
263 iso_pu_bacteria 2513237140 2513881043 215
264 iso_pu_bacteria 2513237143 2513902279 215
265 iso_pu_bacteria 2513237144 2513908885 215
266 iso_pu_bacteria 2513237146 2513925746 215
267 iso_pu_bacteria 2513237156 2513983870 215
268 iso_pu_bacteria 2513237160 2514004719 215
269 iso_pu_bacteria 2516653046 2516892351 215
270 iso_pu_bacteria 2517487022 2517569149 215
271 iso_pu_bacteria 2524023207 2524451081 215
272 iso_pu_bacteria 2551306084 2551680465 215
273 iso_pu_bacteria 2551306085 2551683852 215
274 iso_pu_bacteria 2551306086 2551695754 215
275 iso_pu_bacteria 2551306087 2551698137 215
276 iso_pu_bacteria 2551306089 2551713132 215
277 iso_pu_bacteria 2551306091 2551727278 215
278 iso_pu_bacteria 2551306092 2551739170 215
279 iso_pu_bacteria 2551306093 2551745195 215
280 iso_pu_bacteria 2599185170 2599418550 215
281 iso_pu_bacteria 2657244999 2657683213 215
282 iso_pu_bacteria 2802428858 2802717793 215
283 iso_pu_bacteria 2802428859 2802723278 215
284 iso_pu_bacteria 2802428860 2802733141 215
285 iso_pu_bacteria 2802428861 2802736277 215
286 iso_pu_bacteria 2802428862 2802743513 215
287 iso_pu_bacteria 2802428863 2802750774 215
288 iso_pu_bacteria 2802429268 2804751399 215
289 iso_pu_bacteria 2838035591 2838037754 215
290 iso_pu_bacteria 2838074704 2838076494 215
291 iso_pu_bacteria 2838661181 2838662767 215
292 iso_pu_bacteria 2855825444 2855831423 215
293 iso_pu_bacteria 2855839649 2855840547 215
294 iso_pu_bacteria 2858800743 2858801075 215
295 iso_pu_bacteria 2915980308 2915986273 215
296 iso_pu_bacteria 2915986958 2915988308 215
297 iso_pu_bacteria 2915993759 2915996160 215
298 iso_pu_bacteria 2916000859 2916001175 215
299 iso_pu_bacteria 2916007675 2916014006 215
300 iso_pu_bacteria 2916014648 2916020243 215
301 iso_pu_bacteria 2916021584 2916025152 215
302 iso_pu_bacteria 2916028427 2916032637 215
303 iso_pu_bacteria 2916035215 2916040277 215
304 iso_pu_bacteria 2916041962 2916042695 215
305 iso_pu_bacteria 2916048683 2916049615 215
306 iso_pu_bacteria 2916055098 2916055259 215
307 iso_pu_bacteria 2916061851 2916062701 215
308 iso_pu_bacteria 2916076590 2916076777 215
309 iso_pu_bacteria 2920760137 2920762822 215
310 iso_pu_bacteria 2921201388 2921204366 215
311 iso_pu_bacteria 2921208531 2921210050 215
312 iso_pu_bacteria 2921237296 2921240045 215
313 iso_pu_bacteria 2921244191 2921246195 215
314 iso_pu_bacteria 2921250672 2921251054 215
315 iso_pu_bacteria 2921257292 2921257885 215
316 iso_pu_bacteria 2921263974 2921264136 215
317 iso_pu_bacteria 2921282425 2921286248 215
318 iso_pu_bacteria 2921289301 2921294831 215
319 iso_pu_bacteria 2921296804 2921299626 215
320 iso_pu_bacteria 2924144063 2924146586 215
321 iso_pu_bacteria 2924150972 2924151197 215
322 iso_pu_bacteria 2924158325 2924160674 215
323 iso_pu_bacteria 2924165586 2924171712 215
324 iso_pu_bacteria 2924172951 2924177525 215
325 iso_pu_bacteria 2924179722 2924185891 215
326 iso_pu_bacteria 2924186466 2924188719 215
327 iso_pu_bacteria 2924193448 2924198163 215
328 iso_pu_bacteria 2924200457 2924203021 215
329 iso_pu_bacteria 2924207177 2924212633 215
330 iso_pu_bacteria 2924214083 2924218051 215
331 iso_pu_bacteria 2924221636 2924226761 215
332 iso_pu_bacteria 2924228884 2924230290 215
333 iso_pu_bacteria 2933016740 2933019564 215
334 iso_pu_bacteria 2937002841 2937004316 215
335 iso_pu_bacteria 2937009748 2937011069 215
336 iso_pu_bacteria 2937016420 2937019401 215
337 iso_pu_bacteria 2937023124 2937028501 215
338 iso_pu_bacteria 2937029754 2937029766 215
339 iso_pu_bacteria 2937036028 2937036792 215
340 iso_pu_bacteria 2937042894 2937048318 215
341 iso_pu_bacteria 2937049772 2937056089 215
342 iso_pu_bacteria 2937056579 2937059172 215
343 iso_pu_bacteria 2937063883 2937067840 215
344 iso_pu_bacteria 2937071275 2937073943 215
345 iso_pu_bacteria 2937078374 2937082872 215
346 iso_pu_bacteria 2937084907 2937090524 215
347 iso_pu_bacteria 2937091812 2937095690 215
348 iso_pu_bacteria 2937098957 2937104117 215
349 iso_pu_bacteria 2937106411 2937110734 215
350 iso_pu_bacteria 2937113482 2937113967 215
351 iso_pu_bacteria 2937119839 2937125464 215
352 iso_pu_bacteria 2937126314 2937129032 215
353 iso_pu_bacteria 2957375807 2957379925 215
354 iso_pu_bacteria 2957382221 2957385828 215
355 iso_pu_bacteria 2957388812 2957389031 215
356 iso_pu_bacteria 2957395598 2957398335 215
357 iso_pu_bacteria 2957402308 2957407534 215
358 iso_pu_bacteria 2957408893 2957411614 215
359 iso_pu_bacteria 2957415311 2957418883 215
360 iso_pu_bacteria 2957422303 2957429866 215
361 iso_pu_bacteria 2957430029 2957432539 215
362 iso_pu_bacteria 2957437181 2957438993 215
363 iso_pu_bacteria 2957443900 2957446521 215
364 iso_pu_bacteria 2957450854 2957456587 215
365 iso_pu_bacteria 2957457609 2957463339 215
366 iso_pu_bacteria 2957464669 2957466631 215
367 iso_pu_bacteria 2957471148 2957473173 215
368 iso_pu_bacteria 2957478035 2957479919 215
369 iso_pu_bacteria 2957484790 2957485722 215
370 iso_pu_bacteria 2957491536 2957496255 215
371 iso_pu_bacteria 2957498199 2957503554 215
372 iso_pu_bacteria 2957505466 2957509254 215
373 iso_pu_bacteria 2960584000 2960588733 215
374 iso_pu_bacteria 2960591022 2960595673 215
375 iso_pu_bacteria 2960597568 2960601606 215
376 iso_pu_bacteria 2960603979 2960608562 215
377 iso_pu_bacteria 2960610863 2960611909 215
378 iso_pu_bacteria 2960617483 2960617802 215
379 iso_pu_bacteria 2960624210 2960630670 215
380 iso_pu_bacteria 2960631154 2960633125 215
381 iso_pu_bacteria 2960637947 2960643190 215
382 iso_pu_bacteria 2960645483 2960645792 215
383 iso_pu_bacteria 2960652885 2960658010 215
384 iso_pu_bacteria 2960660292 2960666505 215
385 iso_pu_bacteria 2960667422 2960668692 215
386 iso_pu_bacteria 2960674078 2960675885 215
387 iso_pu_bacteria 2960680706 2960684262 215
388 iso_pu_bacteria 2960687367 2960689069 215
389 iso_pu_bacteria 2960693952 2960696790 215
390 iso_pu_bacteria 2964607997 2964609486 215
391 iso_pu_bacteria 2964615318 2964616027 215
392 iso_pu_bacteria 2964621998 2964625079 215
393 iso_pu_bacteria 2964628898 2964635383 215
394 iso_pu_bacteria 2964636051 2964642539 215
395 iso_pu_bacteria 2964643177 2964646925 215
396 iso_pu_bacteria 2964649959 2964656336 215
397 iso_pu_bacteria 2964656573 2964659728 215
398 iso_pu_bacteria 2964663802 2964665576 215
399 iso_pu_bacteria 2964670856 2964672022 215
400 iso_pu_bacteria 2964678106 2964679411 215
401 iso_pu_bacteria 2964685014 2964688255 215
402 iso_pu_bacteria 2964691889 2964692139 215
403 iso_pu_bacteria 2964698721 2964703518 215
404 iso_pu_bacteria 2964705432 2964708590 215
405 iso_pu_bacteria 2964712639 2964718656 215
406 iso_pu_bacteria 2964719344 2964722300 215
407 iso_pu_bacteria 2967664464 2967668679 215
408 iso_pu_bacteria 2967671571 2967677139 215
409 iso_pu_bacteria 2967678726 2967681628 215
410 iso_pu_bacteria 2967686174 2967687134 215
411 iso_pu_bacteria 2967693043 2967693346 215
412 iso_pu_bacteria 2967706974 2967707818 215
413 iso_pu_bacteria 2967714385 2967716428 215
414 iso_pu_bacteria 2967721400 2967723328 215
415 iso_pu_bacteria 2967728569 2967734634 215
416 iso_pu_bacteria 2967735183 2967735544 215
417 iso_pu_bacteria 2967742019 2967745106 215
418 iso_pu_bacteria 2967748971 2967754505 215
419 iso_pu_bacteria 2967755722 2967756995 215
420 iso_pu_bacteria 2967762386 2967763897 215
421 iso_pu_bacteria 2967769361 2967771679 215
422 iso_pu_bacteria 2967775926 2967776701 215
423 iso_pu_bacteria 2970019648 2970020539 215
424 iso_pu_bacteria 2970026789 2970032655 215
425 iso_pu_bacteria 2970033650 2970035732 215
426 iso_pu_bacteria 2970040964 2970045421 215
427 iso_pu_bacteria 2970047711 2970050481 215
428 iso_pu_bacteria 2970054988 2970057920 215
429 iso_pu_bacteria 2970061556 2970067786 215
430 iso_pu_bacteria 2970068827 2970072000 215
431 iso_pu_bacteria 2970076120 2970081395 215
432 iso_pu_bacteria 2970082768 2970088304 215
433 iso_pu_bacteria 2970088815 2970091613 215
434 iso_pu_bacteria 2970095765 2970100955 215
435 iso_pu_bacteria 2970102677 2970105075 215
436 iso_pu_bacteria 2970109326 2970114587 215
437 iso_pu_bacteria 2970116247 2970117820 215
438 iso_pu_bacteria 2970122695 2970124358 215
439 iso_pu_bacteria 2970129317 2970129618 215
440 iso_pu_bacteria 2970136068 2970136506 215
441 iso_pu_bacteria 2970143518 2970144473 215
442 iso_pu_bacteria 2970149975 2970155827 215
443 iso_pu_bacteria 2970156795 2970162894 215
444 iso_pu_bacteria 2970164137 2970166849 215
445 iso_pu_bacteria 2970170962 2970176026 215
446 iso_pu_bacteria 2970177841 2970178480 215
447 iso_pu_bacteria 2970184632 2970187386 215
448 iso_pu_bacteria 2970191845 2970194280 215
449 iso_pu_bacteria 2977516862 2977517875 215
450 iso_pu_bacteria 2977523885 2977529804 215
451 iso_pu_bacteria 2977530762 2977536953 215
452 iso_pu_bacteria 2977537788 2977538088 215
453 iso_pu_bacteria 2977544691 2977545993 215
454 iso_pu_bacteria 2977551784 2977552088 215
455 iso_pu_bacteria 2977558990 2977562810 215
456 iso_pu_bacteria 2977565890 2977566313 215
457 iso_pu_bacteria 2977572785 2977576533 215
458 iso_pu_bacteria 2977579622 2977581193 215
459 iso_pu_bacteria 3005409236 3005412489 215
460 iso_pu_bacteria 648276728 648736465 215
461 iso_pu_bacteria 8003992118 8003993047 215
462 iso_pu_bacteria 8003999396 8004000283 215
463 3300048927 Ga0496124_0001469 Ga0496124_0001469_732_1400 216
464 iso_pu_bacteria 2508501122 2509108569 216
465 iso_pu_bacteria 2838736955 2838741176 216
466 iso_pu_bacteria 2841840854 2841844927 216
467 iso_pu_bacteria 2842140634 2842144649 216
468 iso_pu_bacteria 2891373044 2891376454 216
469 iso_pu_bacteria 2913295892 2913297394 216
470 3300003187 JGI25151J46595_10029420 JGI25151J46595_100294202 217
471 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008177 217
472 3300003354 JGI25160J50197_1013276 JGI25160J50197_10132761 217
473 3300003374 JGI25161J50226_1000645 JGI25161J50226_10006457 217
474 3300003771 Ga0055526_1050721 Ga0055526_10507212 217
475 3300003775 Ga0055524_1001028 Ga0055524_10010286 217
476 3300003781 Ga0055536_1005530 Ga0055536_10055304 217
477 3300003791 Ga0055530_10021277 Ga0055530_100212772 217
478 3300003794 Ga0055531_10002199 Ga0055531_100021993 217
479 3300004625 Ga0055543_1000040 Ga0055543_100004037 217
480 3300005262 Ga0065165_1000015 Ga0065165_1000015178 217
481 3300005262 Ga0065165_1008405 Ga0065165_10084053 217
482 3300013249 Ga0171463_1001 Ga0171463_1001167 217
483 3300015690 Ga0183363_1174 Ga0183363_11749 217
484 3300021320 Ga0214544_1000017 Ga0214544_1000017138 217
485 3300021321 Ga0214542_1000006 Ga0214542_100000692 217
486 3300021327 Ga0214543_1000014 Ga0214543_1000014231 217
487 3300025208 Ga0209436_102619 Ga0209436_1026192 217
488 3300025245 Ga0207425_1010232 Ga0207425_10102322 217
489 3300025284 Ga0209130_1000007 Ga0209130_1000007125 217
490 3300025292 Ga0209676_1000694 Ga0209676_100069444 217
491 3300025294 Ga0209025_1000580 Ga0209025_100058034 217
492 3300025294 Ga0209025_1027130 Ga0209025_10271301 217
493 3300025295 Ga0209564_1000330 Ga0209564_10003307 217
494 3300025298 Ga0209050_1007450 Ga0209050_10074502 217
495 3300025299 Ga0209256_1000877 Ga0209256_10008776 217
496 3300025299 Ga0209256_1001781 Ga0209256_100178122 217
497 3300025302 Ga0207426_1000064 Ga0207426_1000064125 217
498 3300025303 Ga0209051_1001611 Ga0209051_10016115 217
499 3300025304 Ga0209257_1001713 Ga0209257_100171314 217
500 3300031901 Ga0307406_10010681 Ga0307406_100106815 217
501 3300044735 Ga0466968_0017525 Ga0466968_0017525_1514_2185 217
502 3300044765 Ga0466970_0032477 Ga0466970_0032477_461_1132 217
503 3300048914 Ga0496111_0002706 Ga0496111_0002706_6057_6713 217
504 3300048919 Ga0496116_0010291 Ga0496116_0010291_3360_4016 217
505 3300048920 Ga0496117_0023329 Ga0496117_0023329_260_916 217
506 3300048921 Ga0496118_0024577 Ga0496118_0024577_135_791 217
507 3300048927 Ga0496124_0008098 Ga0496124_0008098_9312_9968 217
508 3300048927 Ga0496124_0107636 Ga0496124_0107636_856_1512 217
509 iso_pu_bacteria 2509276019 2509374404 217
510 iso_pu_bacteria 2510917030 2511197152 217
511 iso_pu_bacteria 2558860100 2558863431 217
512 iso_pu_bacteria 2582581298 2585221038 217
513 iso_pu_bacteria 2585427529 2585549240 217
514 iso_pu_bacteria 2599185352 2600191988 217
515 iso_pu_bacteria 2643221557 2643807146 217
516 iso_pu_bacteria 2643221610 2644069588 217
517 iso_pu_bacteria 2643221668 2644380528 217
518 iso_pu_bacteria 2643221675 2644420742 217
519 iso_pu_bacteria 2643221680 2644454267 217
520 iso_pu_bacteria 2643221723 2644675594 217
521 iso_pu_bacteria 2643221726 2644689604 217
522 iso_pu_bacteria 2850079185 2850080530 217
523 iso_pu_bacteria 2919100787 2919103872 217
524 iso_pu_bacteria 2920822456 2920823898 217
525 iso_pu_bacteria 3005445848 3005446799 217
526 3300025284 Ga0209130_1041110 Ga0209130_10411101 218
527 3300025294 Ga0209025_1001502 Ga0209025_100150216 218
528 3300046530 Ga0495654_0000092 Ga0495654_0000092_30947_31606 218
529 3300048909 Ga0496106_0365858 Ga0496106_0365858_197_856 218
530 3300048921 Ga0496118_0022747 Ga0496118_0022747_1020_1694 218
531 3300048924 Ga0496121_0037316 Ga0496121_0037316_2298_2957 218
532 3300048924 Ga0496121_0198199 Ga0496121_0198199_724_1383 218
533 3300048925 Ga0496122_0012377 Ga0496122_0012377_2630_3289 218
534 3300048926 Ga0496123_0008044 Ga0496123_0008044_6570_7229 218
535 3300048926 Ga0496123_0149581 Ga0496123_0149581_206_865 218
536 3300048929 Ga0496126_0103341 Ga0496126_0103341_655_1314 218
537 iso_pu_bacteria 2791355082 2792584214 218
538 iso_pu_bacteria 2844163670 2844168460 218
539 iso_pu_bacteria 3003930520 3003932725 218
540 iso_pu_bacteria 8049293176 8049293972 218
541 3300003322 rootL2_10224148 rootL2_102241483 219
542 3300003792 Ga0055540_1003015 Ga0055540_10030155 219
543 3300003794 Ga0055531_10011531 Ga0055531_100115314 219
544 3300025292 Ga0209676_1003604 Ga0209676_10036048 219
545 3300025294 Ga0209025_1009735 Ga0209025_10097357 219
546 3300025297 Ga0209758_1000890 Ga0209758_100089026 219
547 3300025303 Ga0209051_1001443 Ga0209051_10014435 219
548 3300025304 Ga0209257_1004254 Ga0209257_10042546 219
549 3300048920 Ga0496117_0029504 Ga0496117_0029504_3211_3876 219
550 3300048922 Ga0496119_0237284 Ga0496119_0237284_172_837 219
551 3300048925 Ga0496122_0000604 Ga0496122_0000604_14876_15541 219
552 3300048925 Ga0496122_0248322 Ga0496122_0248322_55_717 219
553 3300048926 Ga0496123_0000103 Ga0496123_0000103_164091_164756 219
554 3300048927 Ga0496124_0109488 Ga0496124_0109488_1375_2037 219
555 3300048927 Ga0496124_0569779 Ga0496124_0569779_59_724 219
556 3300048928 Ga0496125_0009397 Ga0496125_0009397_6082_6747 219
557 3300048929 Ga0496126_0214523 Ga0496126_0214523_159_821 219
558 iso_pu_bacteria 2509276033 2509443030 219
559 iso_pu_bacteria 2510065019 2510132342 219
560 iso_pu_bacteria 2510461076 2510898679 219
561 iso_pu_bacteria 2510917022 2511137075 219
562 iso_pu_bacteria 2510917028 2511186407 219
563 iso_pu_bacteria 2513237084 2513569181 219
564 iso_pu_bacteria 2513237085 2513578854 219
565 iso_pu_bacteria 2513237088 2513596293 219
566 iso_pu_bacteria 2513237093 2513632714 219
567 iso_pu_bacteria 2513237103 2513709166 219
568 iso_pu_bacteria 2513237138 2513871250 219
569 iso_pu_bacteria 2515075009 2515111326 219
570 iso_pu_bacteria 2515154113 2515638475 219
571 iso_pu_bacteria 2515154114 2515644361 219
572 iso_pu_bacteria 2515154116 2515659149 219
573 iso_pu_bacteria 2515154134 2515740513 219
574 iso_pu_bacteria 2516653077 2517039967 219
575 iso_pu_bacteria 2516653085 2517075519 219
576 iso_pu_bacteria 2517093000 2517094100 219
577 iso_pu_bacteria 2517287029 2517405919 219
578 iso_pu_bacteria 2524023209 2524460601 219
579 iso_pu_bacteria 2529292951 2530643844 219
580 iso_pu_bacteria 2534681796 2535515763 219
581 iso_pu_bacteria 2582581294 2585203126 219
582 iso_pu_bacteria 2582581299 2585231447 219
583 iso_pu_bacteria 2582581307 2585273215 219
584 iso_pu_bacteria 2582581308 2585278952 219
585 iso_pu_bacteria 2582581315 2585325433 219
586 iso_pu_bacteria 2582581316 2585329595 219
587 iso_pu_bacteria 2582581867 2585400077 219
588 iso_pu_bacteria 2585427526 2585528016 219
589 iso_pu_bacteria 2585427527 2585530748 219
590 iso_pu_bacteria 2585427528 2585541382 219
591 iso_pu_bacteria 2585427530 2585554929 219
592 iso_pu_bacteria 2585427531 2585559485 219
593 iso_pu_bacteria 2585427590 2585822636 219
594 iso_pu_bacteria 2585427593 2585839486 219
595 iso_pu_bacteria 2585427608 2585902156 219
596 iso_pu_bacteria 2585427609 2585905139 219
597 iso_pu_bacteria 2585428125 2587979746 219
598 iso_pu_bacteria 2615840624 2616296171 219
599 iso_pu_bacteria 2615840626 2616305775 219
600 iso_pu_bacteria 2615840698 2616553985 219
601 iso_pu_bacteria 2617270742 2617384175 219
602 iso_pu_bacteria 2643221599 2644007970 219
603 iso_pu_bacteria 2643221618 2644108937 219
604 iso_pu_bacteria 2643221626 2644151459 219
605 iso_pu_bacteria 2643221634 2644196559 219
606 iso_pu_bacteria 2643221643 2644239056 219
607 iso_pu_bacteria 2643221655 2644311593 219
608 iso_pu_bacteria 2643221659 2644329851 219
609 iso_pu_bacteria 2643221698 2644546525 219
610 iso_pu_bacteria 2643221712 2644617392 219
611 iso_pu_bacteria 2667528174 2671115261 219
612 iso_pu_bacteria 2718217882 2719180334 219
613 iso_pu_bacteria 2718217927 2719384911 219
614 iso_pu_bacteria 2718217997 2719664656 219
615 iso_pu_bacteria 2718218009 2719731083 219
616 iso_pu_bacteria 2718218199 2720491076 219
617 iso_pu_bacteria 2718218232 2720612445 219
618 iso_pu_bacteria 2718218233 2720619284 219
619 iso_pu_bacteria 2718218363 2721146428 219
620 iso_pu_bacteria 2718218365 2721157949 219
621 iso_pu_bacteria 2718218366 2721163307 219
622 iso_pu_bacteria 2718218423 2721398631 219
623 iso_pu_bacteria 2721755514 2722839477 219
624 iso_pu_bacteria 2721755556 2723026105 219
625 iso_pu_bacteria 2721755684 2723559649 219
626 iso_pu_bacteria 2721755809 2724037444 219
627 iso_pu_bacteria 2721755810 2724043839 219
628 iso_pu_bacteria 2721755823 2724109369 219
629 iso_pu_bacteria 2724679232 2725946774 219
630 iso_pu_bacteria 2728369352 2730107041 219
631 iso_pu_bacteria 2728369365 2730163571 219
632 iso_pu_bacteria 2728369397 2730297581 219
633 iso_pu_bacteria 2738541333 2739035946 219
634 iso_pu_bacteria 2765235942 2766067561 219
635 iso_pu_bacteria 2775507266 2778177531 219
636 iso_pu_bacteria 2791355256 2793296241 219
637 iso_pu_bacteria 2791355259 2793317567 219
638 iso_pu_bacteria 2791355260 2793321057 219
639 iso_pu_bacteria 2791355261 2793327089 219
640 iso_pu_bacteria 2791355262 2793333658 219
641 iso_pu_bacteria 2791355263 2793339748 219
642 iso_pu_bacteria 2791355264 2793347975 219
643 iso_pu_bacteria 2791355265 2793357410 219
644 iso_pu_bacteria 2791355266 2793358961 219
645 iso_pu_bacteria 2791355267 2793367891 219
646 iso_pu_bacteria 2802429605 2805926538 219
647 iso_pu_bacteria 2802429606 2805933337 219
648 iso_pu_bacteria 2802429633 2806046875 219
649 iso_pu_bacteria 2802429634 2806052458 219
650 iso_pu_bacteria 2802429635 2806058771 219
651 iso_pu_bacteria 2802429636 2806067461 219
652 iso_pu_bacteria 2802429637 2806074034 219
653 iso_pu_bacteria 2818991448 2819611551 219
654 iso_pu_bacteria 2818991453 2819639204 219
655 iso_pu_bacteria 2838016132 2838017328 219
656 iso_pu_bacteria 2838022645 2838023103 219
657 iso_pu_bacteria 2838042994 2838048868 219
658 iso_pu_bacteria 2838048938 2838049190 219
659 iso_pu_bacteria 2838061910 2838063364 219
660 iso_pu_bacteria 2838668709 2838670887 219
661 iso_pu_bacteria 2838680041 2838681383 219
662 iso_pu_bacteria 2838686498 2838688566 219
663 iso_pu_bacteria 2838694306 2838694582 219
664 iso_pu_bacteria 2838701080 2838703258 219
665 iso_pu_bacteria 2838707686 2838707960 219
666 iso_pu_bacteria 2838729681 2838730861 219
667 iso_pu_bacteria 2838742623 2838744245 219
668 iso_pu_bacteria 2841851746 2841856926 219
669 iso_pu_bacteria 2842077413 2842080809 219
670 iso_pu_bacteria 2842110456 2842115018 219
671 iso_pu_bacteria 2842118031 2842121428 219
672 iso_pu_bacteria 2842146304 2842147518 219
673 iso_pu_bacteria 2842156927 2842160096 219
674 iso_pu_bacteria 2842163707 2842168339 219
675 iso_pu_bacteria 2842180545 2842183287 219
676 iso_pu_bacteria 2842192696 2842197989 219
677 iso_pu_bacteria 2842198810 2842199531 219
678 iso_pu_bacteria 2842205361 2842207657 219
679 iso_pu_bacteria 2842217011 2842221243 219
680 iso_pu_bacteria 2842229732 2842235112 219
681 iso_pu_bacteria 2842237096 2842237371 219
682 iso_pu_bacteria 2842243621 2842245709 219
683 iso_pu_bacteria 2842250916 2842252584 219
684 iso_pu_bacteria 2842257432 2842259641 219
685 iso_pu_bacteria 2842264693 2842266882 219
686 iso_pu_bacteria 2842271015 2842274480 219
687 iso_pu_bacteria 2842278818 2842281548 219
688 iso_pu_bacteria 2842291075 2842294465 219
689 iso_pu_bacteria 2842298080 2842302405 219
690 iso_pu_bacteria 2842304105 2842306723 219
691 iso_pu_bacteria 2842317721 2842318612 219
692 iso_pu_bacteria 2842357229 2842360862 219
693 iso_pu_bacteria 2842363717 2842365291 219
694 iso_pu_bacteria 2842370503 2842371846 219
695 iso_pu_bacteria 2842377471 2842380863 219
696 iso_pu_bacteria 2842384541 2842387934 219
697 iso_pu_bacteria 2842395702 2842398215 219
698 iso_pu_bacteria 2842402390 2842404346 219
699 iso_pu_bacteria 2842409023 2842410969 219
700 iso_pu_bacteria 2842415677 2842417575 219
701 iso_pu_bacteria 2842428310 2842431013 219
702 iso_pu_bacteria 2842434925 2842436989 219
703 iso_pu_bacteria 2842441272 2842443067 219
704 iso_pu_bacteria 2842447887 2842453289 219
705 iso_pu_bacteria 2842462802 2842465078 219
706 iso_pu_bacteria 2842469257 2842471696 219
707 iso_pu_bacteria 2842482326 2842482894 219
708 iso_pu_bacteria 2842489311 2842493797 219
709 iso_pu_bacteria 2842495871 2842497247 219
710 iso_pu_bacteria 2842509118 2842509770 219
711 iso_pu_bacteria 2844454524 2844455082 219
712 iso_pu_bacteria 2852387548 2852389124 219
713 iso_pu_bacteria 2857516855 2857520250 219
714 iso_pu_bacteria 2919408235 2919409356 219
715 iso_pu_bacteria 2923556063 2923557524 219
716 iso_pu_bacteria 2933570622 2933573163 219
717 iso_pu_bacteria 2933586486 2933591417 219
718 iso_pu_bacteria 2935894831 2935895104 219
719 iso_pu_bacteria 2935901341 2935904088 219
720 iso_pu_bacteria 2936367885 2936368080 219
721 iso_pu_bacteria 2936375103 2936381526 219
722 iso_pu_bacteria 2936381700 2936384903 219
723 iso_pu_bacteria 2941499720 2941500160 219
724 iso_pu_bacteria 2996887358 2996888730 219
725 iso_pu_bacteria 2996893221 2996895127 219
726 iso_pu_bacteria 3005416602 3005417185 219
727 iso_pu_bacteria 3005452660 3005453494 219
728 iso_pu_bacteria 639633055 639647472 219
729 iso_pu_bacteria 8005258706 8005260002 219
730 iso_pu_bacteria 8005275841 8005279631 219
731 iso_pu_bacteria 8005289223 8005292832 219
732 iso_pu_bacteria 8005301065 8005304638 219
733 iso_pu_bacteria 8005307578 8005311136 219
734 iso_pu_bacteria 8005314921 8005315246 219
735 iso_pu_bacteria 8005321885 8005323257 219
736 iso_pu_bacteria 8005376324 8005376567 219
737 iso_pu_bacteria 8005382845 8005385956 219
738 iso_pu_bacteria 8005395548 8005400261 219
739 iso_pu_bacteria 8005430974 8005437121 219
740 iso_pu_bacteria 8005460587 8005461970 219
741 iso_pu_bacteria 8005484373 8005485583 219
742 iso_pu_bacteria 8005497431 8005499378 219
743 iso_pu_bacteria 8005542996 8005544397 219
744 iso_pu_bacteria 8005556819 8005558887 219
745 iso_pu_bacteria 8005563573 8005570476 219
746 iso_pu_bacteria 8005570704 8005572733 219
747 iso_pu_bacteria 8005619151 8005620568 219
748 iso_pu_bacteria 8005626139 8005627469 219
749 iso_pu_bacteria 8005645114 8005649893 219
750 iso_pu_bacteria 8005668836 8005670794 219
751 iso_pu_bacteria 8005682033 8005684522 219
752 iso_pu_bacteria 8005688590 8005691063 219
753 iso_pu_bacteria 8005695170 8005698738 219
754 iso_pu_bacteria 8018127388 8018131374 219
755 iso_pu_bacteria 8018163183 8018169469 219
756 iso_pu_bacteria 8018176218 8018182550 219
757 iso_pu_bacteria 8023680758 8023686907 219
758 iso_pu_bacteria 8024479707 8024481146 219
759 iso_pu_bacteria 8024501048 8024503212 219
760 iso_pu_bacteria 8046767195 8046767722 219
761 iso_pu_bacteria 8056375014 8056380771 219
762 iso_pu_bacteria 8056382006 8056384706 219
763 iso_pu_bacteria 8057575449 8057582152 219
764 iso_pu_bacteria 8057874678 8057879915 219
765 3300027111 Ga0209281_1000053 Ga0209281_1000053240 220
766 3300028379 Ga0268266_10034684 Ga0268266_100346845 220
767 3300046507 Ga0495606_0036357 Ga0495606_0036357_1940_2605 220
768 3300048927 Ga0496124_0012183 Ga0496124_0012183_4464_5132 220
769 3300048929 Ga0496126_0001336 Ga0496126_0001336_35405_36073 220
770 3300049571 Ga0501034_0167911 Ga0501034_0167911_1325_1990 220
771 3300049571 Ga0501034_0213083 Ga0501034_0213083_945_1610 220
772 3300049579 Ga0501043_0121628 Ga0501043_0121628_158_823 220
773 3300049822 Ga0501035_0704233 Ga0501035_0704233_104_769 220
774 3300049824 Ga0501045_0502139 Ga0501045_0502139_169_834 220
775 3300053153 Ga0500616_0001190 Ga0500616_0001190_21053_21736 220
776 iso_pu_bacteria 2510917026 2511171876 220
777 iso_pu_bacteria 2585427633 2585995164 220
778 iso_pu_bacteria 2585427634 2585999711 220
779 iso_pu_bacteria 2919171160 2919171371 220
780 iso_pu_bacteria 8056875544 8056876538 220
781 3300002773 JGI25152J39213_1003870 JGI25152J39213_10038704 221
782 3300002987 JGI25159J45721_1000539 JGI25159J45721_10005398 221
783 3300003215 JGI25153J46596_10008442 JGI25153J46596_100084424 221
784 3300003374 JGI25161J50226_1000051 JGI25161J50226_100005120 221
785 3300003771 Ga0055526_1006805 Ga0055526_10068052 221
786 3300003775 Ga0055524_1002986 Ga0055524_10029862 221
787 3300003790 Ga0055528_1005168 Ga0055528_10051682 221
788 3300003792 Ga0055540_1022079 Ga0055540_10220792 221
789 3300004625 Ga0055543_1000258 Ga0055543_10002585 221
790 3300005262 Ga0065165_1007971 Ga0065165_10079715 221
791 3300005844 Ga0068862_100689433 Ga0068862_1006894332 221
792 3300006186 Ga0075369_10117755 Ga0075369_101177552 221
793 3300025208 Ga0209436_100971 Ga0209436_1009713 221
794 3300025245 Ga0207425_1010928 Ga0207425_10109282 221
795 3300025258 Ga0209129_1004647 Ga0209129_10046474 221
796 3300025273 Ga0209673_1000603 Ga0209673_100060343 221
797 3300025284 Ga0209130_1000006 Ga0209130_1000006494 221
798 3300025294 Ga0209025_1007635 Ga0209025_10076356 221
799 3300025295 Ga0209564_1000425 Ga0209564_100042513 221
800 3300025297 Ga0209758_1002000 Ga0209758_100200024 221
801 3300025297 Ga0209758_1002927 Ga0209758_10029277 221
802 3300025297 Ga0209758_1005916 Ga0209758_10059168 221
803 3300025299 Ga0209256_1001695 Ga0209256_10016957 221
804 3300025302 Ga0207426_1000106 Ga0207426_100010670 221
805 3300025303 Ga0209051_1002094 Ga0209051_10020943 221
806 3300025304 Ga0209257_1043170 Ga0209257_10431702 221
807 3300046457 Ga0495590_0108203 Ga0495590_0108203_93_758 221
808 3300046522 Ga0495643_0024536 Ga0495643_0024536_2402_3067 221
809 3300046694 Ga0495649_0015455 Ga0495649_0015455_295_960 221
810 3300048909 Ga0496106_0015849 Ga0496106_0015849_3498_4163 221
811 3300048919 Ga0496116_0096303 Ga0496116_0096303_777_1442 221
812 3300048921 Ga0496118_0213674 Ga0496118_0213674_162_827 221
813 3300048924 Ga0496121_0035352 Ga0496121_0035352_3398_4063 221
814 3300048925 Ga0496122_0037563 Ga0496122_0037563_1046_1711 221
815 3300048926 Ga0496123_0009653 Ga0496123_0009653_3740_4405 221
816 3300048928 Ga0496125_0017778 Ga0496125_0017778_3742_4407 221
817 3300050516 nmdc:mga0sz30_167045_c1 nmdc:mga0sz30_167045_c1_146_811 221
818 3300053156 Ga0500622_0008805 Ga0500622_0008805_4634_5299 221
819 3300060353 Ga0501082_0104676 Ga0501082_0104676_1090_1755 221
820 iso_pu_bacteria 8024486573 8024489714 221
821 3300047472 Ga0495686_0001036 Ga0495686_0001036_11874_12560 222
822 3300002705 JGI25156J39149_1000129 JGI25156J39149_100012914 223
823 3300002737 JGI25162J39368_1000663 JGI25162J39368_100066310 223
824 3300002737 JGI25162J39368_1000771 JGI25162J39368_10007719 223
825 3300002738 JGI25154J39366_1000393 JGI25154J39366_100039314 223
826 3300002738 JGI25154J39366_1010856 JGI25154J39366_10108562 223
827 3300002741 JGI25157J39369_1000061 JGI25157J39369_100006114 223
828 3300002771 JGI25163J39215_1005407 JGI25163J39215_10054071 223
829 3300003187 JGI25151J46595_10001664 JGI25151J46595_100016647 223
830 3300003214 JGI25165J46597_1000887 JGI25165J46597_100088710 223
831 3300003214 JGI25165J46597_1001344 JGI25165J46597_10013449 223
832 3300003214 JGI25165J46597_1003152 JGI25165J46597_10031524 223
833 3300003215 JGI25153J46596_10005162 JGI25153J46596_100051622 223
834 3300003215 JGI25153J46596_10026362 JGI25153J46596_100263621 223
835 3300003316 rootH1_10029408 rootH1_100294081 223
836 3300003323 rootH1_10199986 rootH1_101999862 223
837 3300003323 rootH1_10199992 rootH1_101999922 223
838 3300003354 JGI25160J50197_1000191 JGI25160J50197_100019114 223
839 3300003771 Ga0055526_1004586 Ga0055526_10045866 223
840 3300003775 Ga0055524_1001385 Ga0055524_100138511 223
841 3300003775 Ga0055524_1043002 Ga0055524_10430021 223
842 3300003790 Ga0055528_1001755 Ga0055528_10017554 223
843 3300003790 Ga0055528_1016328 Ga0055528_10163282 223
844 3300004625 Ga0055543_1001853 Ga0055543_10018532 223
845 3300005262 Ga0065165_1024782 Ga0065165_10247822 223
846 3300005327 Ga0070658_10655175 Ga0070658_106551752 223
847 3300005548 Ga0070665_100020587 Ga0070665_1000205874 223
848 3300005563 Ga0068855_100134254 Ga0068855_1001342543 223
849 3300005614 Ga0068856_100317635 Ga0068856_1003176352 223
850 3300006038 Ga0075365_10002765 Ga0075365_100027656 223
851 3300006051 Ga0075364_10287326 Ga0075364_102873262 223
852 3300006177 Ga0075362_10001499 Ga0075362_100014995 223
853 3300006178 Ga0075367_10072548 Ga0075367_100725482 223
854 3300006186 Ga0075369_10012547 Ga0075369_100125474 223
855 3300006195 Ga0075366_10005574 Ga0075366_100055747 223
856 3300006353 Ga0075370_10060792 Ga0075370_100607922 223
857 3300009093 Ga0105240_10000032 Ga0105240_10000032170 223
858 3300009148 Ga0105243_10225965 Ga0105243_102259652 223
859 3300009177 Ga0105248_10518140 Ga0105248_105181402 223
860 3300009545 Ga0105237_10002365 Ga0105237_1000236521 223
861 3300009551 Ga0105238_10491988 Ga0105238_104919881 223
862 3300009766 Ga0123342_1018873 Ga0123342_10188733 223
863 3300010375 Ga0105239_10012679 Ga0105239_100126797 223
864 3300013100 Ga0157373_10034649 Ga0157373_100346492 223
865 3300013104 Ga0157370_10006055 Ga0157370_100060554 223
866 3300014497 Ga0182008_10008143 Ga0182008_100081434 223
867 3300015262 Ga0182007_10000460 Ga0182007_100004607 223
868 3300015265 Ga0182005_1001195 Ga0182005_10011954 223
869 3300025206 Ga0209435_100042 Ga0209435_10004215 223
870 3300025207 Ga0209760_103229 Ga0209760_1032291 223
871 3300025228 Ga0209672_103729 Ga0209672_1037292 223
872 3300025233 Ga0209437_100033 Ga0209437_100033321 223
873 3300025233 Ga0209437_100075 Ga0209437_100075183 223
874 3300025245 Ga0207425_1005673 Ga0207425_10056732 223
875 3300025246 Ga0209646_1000145 Ga0209646_100014515 223
876 3300025250 Ga0209026_1000160 Ga0209026_100016015 223
877 3300025253 Ga0209677_101318 Ga0209677_1013184 223
878 3300025256 Ga0209759_1000177 Ga0209759_100017715 223
879 3300025258 Ga0209129_1001658 Ga0209129_10016584 223
880 3300025261 Ga0209233_1000056 Ga0209233_10000569 223
881 3300025261 Ga0209233_1000064 Ga0209233_1000064101 223
882 3300025261 Ga0209233_1000209 Ga0209233_1000209109 223
883 3300025273 Ga0209673_1001904 Ga0209673_10019045 223
884 3300025273 Ga0209673_1006607 Ga0209673_10066072 223
885 3300025294 Ga0209025_1000199 Ga0209025_100019953 223
886 3300025295 Ga0209564_1001106 Ga0209564_100110629 223
887 3300025297 Ga0209758_1000333 Ga0209758_100033375 223
888 3300025297 Ga0209758_1002059 Ga0209758_10020599 223
889 3300025299 Ga0209256_1003093 Ga0209256_10030932 223
890 3300025299 Ga0209256_1008203 Ga0209256_10082035 223
891 3300025302 Ga0207426_1000119 Ga0207426_1000119167 223
892 3300025303 Ga0209051_1065244 Ga0209051_10652441 223
893 3300025913 Ga0207695_10000024 Ga0207695_10000024171 223
894 3300025914 Ga0207671_10000718 Ga0207671_100007186 223
895 3300025925 Ga0207650_10008527 Ga0207650_100085275 223
896 3300025949 Ga0207667_10107346 Ga0207667_101073462 223
897 3300026142 Ga0207698_10284304 Ga0207698_102843042 223
898 3300028379 Ga0268266_10154536 Ga0268266_101545362 223
899 3300028794 Ga0307515_10009393 Ga0307515_100093935 223
900 3300031456 Ga0307513_10064384 Ga0307513_100643843 223
901 3300041452 Ga0451793_1931244 Ga0451793_1931244_374_1063 223
902 3300041494 Ga0451837_0331042 Ga0451837_0331042_70_741 223
903 3300041496 Ga0451839_0799242 Ga0451839_0799242_528_1199 223
904 3300041498 Ga0451841_0302975 Ga0451841_0302975_519_1190 223
905 3300041498 Ga0451841_0659426 Ga0451841_0659426_3455_4126 223
906 3300041501 Ga0451845_0068571 Ga0451845_0068571_819_1490 223
907 3300041502 Ga0451846_49560 Ga0451846_49560_71_742 223
908 3300041503 Ga0451847_0047250 Ga0451847_0047250_4381_5052 223
909 3300041505 Ga0451849_0746664 Ga0451849_0746664_74_745 223
910 3300041505 Ga0451849_1275464 Ga0451849_1275464_12_683 223
911 3300041505 Ga0451849_1509101 Ga0451849_1509101_784_1455 223
912 3300041507 Ga0451851_0316867 Ga0451851_0316867_331_1002 223
913 3300041507 Ga0451851_0644451 Ga0451851_0644451_601_1272 223
914 3300041511 Ga0451855_1139024 Ga0451855_1139024_1721_2392 223
915 3300041512 Ga0451853_0907327 Ga0451853_0907327_1439_2110 223
916 3300044684 Ga0466966_0528769 Ga0466966_0528769_28_699 223
917 3300044694 Ga0466963_0402478 Ga0466963_0402478_69_740 223
918 3300044765 Ga0466970_0012880 Ga0466970_0012880_3286_3957 223
919 3300044842 Ga0466957_0081763 Ga0466957_0081763_468_1139 223
920 3300045836 Ga0466958_0150466 Ga0466958_0150466_311_982 223
921 3300046452 Ga0495617_037385 Ga0495617_037385_117_791 223
922 3300046460 Ga0495638_0003817 Ga0495638_0003817_5768_6442 223
923 3300046460 Ga0495638_0037074 Ga0495638_0037074_141_812 223
924 3300046474 Ga0495605_0011138 Ga0495605_0011138_4267_4941 223
925 3300046474 Ga0495605_0181496 Ga0495605_0181496_67_738 223
926 3300046492 Ga0495585_0011550 Ga0495585_0011550_3844_4518 223
927 3300046492 Ga0495585_0123347 Ga0495585_0123347_563_1234 223
928 3300046500 Ga0495596_0108794 Ga0495596_0108794_191_862 223
929 3300046501 Ga0495607_0068939 Ga0495607_0068939_959_1633 223
930 3300046506 Ga0495583_0013729 Ga0495583_0013729_1534_2208 223
931 3300046507 Ga0495606_0007105 Ga0495606_0007105_5753_6424 223
932 3300046512 Ga0495610_0033071 Ga0495610_0033071_1527_2198 223
933 3300046513 Ga0495616_0016301 Ga0495616_0016301_2088_2762 223
934 3300046513 Ga0495616_0049112 Ga0495616_0049112_400_1071 223
935 3300046515 Ga0495620_0008876 Ga0495620_0008876_1630_2301 223
936 3300046515 Ga0495620_0035575 Ga0495620_0035575_132_806 223
937 3300046518 Ga0495631_0003953 Ga0495631_0003953_3934_4608 223
938 3300046519 Ga0495632_0084482 Ga0495632_0084482_635_1309 223
939 3300046522 Ga0495643_0023538 Ga0495643_0023538_1202_1873 223
940 3300046522 Ga0495643_0123974 Ga0495643_0123974_590_1264 223
941 3300046524 Ga0495648_0016629 Ga0495648_0016629_2455_3126 223
942 3300046524 Ga0495648_0222101 Ga0495648_0222101_38_709 223
943 3300046530 Ga0495654_0072443 Ga0495654_0072443_135_806 223
944 3300046538 Ga0495609_0034871 Ga0495609_0034871_1561_2235 223
945 3300046538 Ga0495609_0121838 Ga0495609_0121838_180_851 223
946 3300046539 Ga0495621_0139715 Ga0495621_0139715_257_931 223
947 3300046558 Ga0495633_0112623 Ga0495633_0112623_573_1244 223
948 3300046616 Ga0495668_0004226 Ga0495668_0004226_4114_4788 223
949 3300046648 Ga0495611_0005820 Ga0495611_0005820_1247_1921 223
950 3300046660 Ga0495625_0000883 Ga0495625_0000883_35632_36306 223
951 3300046660 Ga0495625_0021680 Ga0495625_0021680_3667_4338 223
952 3300046665 Ga0495661_0099044 Ga0495661_0099044_956_1627 223
953 3300046691 Ga0495670_0089722 Ga0495670_0089722_274_948 223
954 3300046691 Ga0495670_0362318 Ga0495670_0362318_54_725 223
955 3300046692 Ga0495671_0111024 Ga0495671_0111024_353_1027 223
956 3300046810 Ga0495660_0029535 Ga0495660_0029535_709_1380 223
957 3300047318 Ga0495636_0035876 Ga0495636_0035876_652_1326 223
958 3300047318 Ga0495636_0094526 Ga0495636_0094526_568_1239 223
959 3300047320 Ga0495672_0009853 Ga0495672_0009853_2787_3461 223
960 3300047443 Ga0495687_016382 Ga0495687_016382_2194_2865 223
961 3300047472 Ga0495686_0018580 Ga0495686_0018580_636_1307 223
962 3300047472 Ga0495686_0186950 Ga0495686_0186950_131_826 223
963 3300048091 Ga0495626_0081029 Ga0495626_0081029_126_797 223
964 3300048091 Ga0495626_0099234 Ga0495626_0099234_140_814 223
965 3300048903 Ga0496100_0037143 Ga0496100_0037143_181_852 223
966 3300048905 Ga0496102_0066355 Ga0496102_0066355_288_959 223
967 3300048906 Ga0496103_0008468 Ga0496103_0008468_2513_3184 223
968 3300048919 Ga0496116_0039068 Ga0496116_0039068_1075_1746 223
969 3300048919 Ga0496116_0289728 Ga0496116_0289728_57_728 223
970 3300048920 Ga0496117_0001867 Ga0496117_0001867_19757_20428 223
971 3300048921 Ga0496118_0012870 Ga0496118_0012870_4803_5474 223
972 3300048921 Ga0496118_0034308 Ga0496118_0034308_2452_3123 223
973 3300048922 Ga0496119_0027539 Ga0496119_0027539_2837_3508 223
974 3300048922 Ga0496119_0059809 Ga0496119_0059809_203_874 223
975 3300048923 Ga0496120_0036918 Ga0496120_0036918_2030_2701 223
976 3300048924 Ga0496121_0012537 Ga0496121_0012537_4497_5168 223
977 3300048925 Ga0496122_0011685 Ga0496122_0011685_4198_4869 223
978 3300048926 Ga0496123_0045222 Ga0496123_0045222_394_1065 223
979 3300048927 Ga0496124_0246281 Ga0496124_0246281_452_1123 223
980 3300048927 Ga0496124_0268234 Ga0496124_0268234_106_777 223
981 3300048928 Ga0496125_0051911 Ga0496125_0051911_44_715 223
982 3300048929 Ga0496126_0006321 Ga0496126_0006321_4197_4868 223
983 3300049459 Ga0495678_037486 Ga0495678_037486_453_1127 223
984 3300049460 Ga0495682_0199677 Ga0495682_0199677_18_692 223
985 3300050489 nmdc:mga03683_87540_c1 nmdc:mga03683_87540_c1_215_886 223
986 3300050490 nmdc:mga03n38_33570_c1 nmdc:mga03n38_33570_c1_24_695 223
987 3300050491 nmdc:mga00v17_359109_c1 nmdc:mga00v17_359109_c1_113_784 223
988 3300050493 nmdc:mga0k408_232359_c1 nmdc:mga0k408_232359_c1_139_810 223
989 3300050496 nmdc:mga07m45_140263_c1 nmdc:mga07m45_140263_c1_521_1192 223
990 3300050516 nmdc:mga0sz30_8860_c1 nmdc:mga0sz30_8860_c1_2975_3646 223
991 3300053079 Ga0500610_0112906 Ga0500610_0112906_563_1237 223
992 3300053086 Ga0500578_0064509 Ga0500578_0064509_346_1017 223
993 3300053086 Ga0500578_0073300 Ga0500578_0073300_580_1254 223
994 3300053109 Ga0500569_007786 Ga0500569_007786_215_889 223
995 3300053109 Ga0500569_008089 Ga0500569_008089_1508_2179 223
996 3300053118 Ga0500594_0032146 Ga0500594_0032146_373_1047 223
997 3300053134 Ga0500658_0006339 Ga0500658_0006339_3339_4010 223
998 3300053139 Ga0500568_0002529 Ga0500568_0002529_5787_6461 223
999 3300053142 Ga0500577_0039181 Ga0500577_0039181_660_1334 223
1000 3300053153 Ga0500616_0001711 Ga0500616_0001711_5840_6514 223
1001 3300053153 Ga0500616_0006652 Ga0500616_0006652_2773_3444 223
1002 3300053158 Ga0500627_0099460 Ga0500627_0099460_132_806 223
1003 3300061719 Ga0466962_0050301 Ga0466962_0050301_942_1613 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

6

186

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ds3-assembly1.cif.gz_A-2 crystal structure of phosphoribosylglycinamide formyltransferase from brucella melitensis 0.9899 5 190
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9805 7 203
3tqr-assembly1.cif.gz_A structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii 0.9734 5 203
1grc-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy 0.9725 7 203
3gar-assembly1.cif.gz_A-2 a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase 0.968 7 203
ID Description Score Start End Superfamily
4ds3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9899 5 190 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.977 5 192 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9676 7 204 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9655 6 187 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9635 7 204 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A1Q9AT05-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.992 1 197 GO:0004644
GO:0005829
GO:0006189
AF-A0A656Z2T7-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9865 24 174 GO:0004644
GO:0005829
GO:0006189
AF-A0A849EET8-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9844 4 206 GO:0004644
GO:0005829
GO:0006189
AF-A0A2A5GCI3-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9833 6 203 GO:0004644
GO:0005829
GO:0006189
AF-A0A381TCJ8-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9828 19 161 GO:0004644
GO:0005829
GO:0006189

Feature Viewer

pLDDT pTM Quality
92.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map