F487930

General Info

Members Datasets Scaffolds Average Seq Length
1003 310 2006 207

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10496695|Ga0105243_104966952
Length 205
Sequence VDRREENRAKALKDLQQLGVLMLDGHFDYGNGYHGAAYLNPHQLFLHPSTIWRFAQDLLDLLPTEILQNTDVVAGPATGGALLAHTLAGLLDRRRSLTHPPSSFAPLHSDPVGLSLRPFYAREIKGKRVLIADDIRNTGQTLARCASLVKDAGGTVIATMQIYDRMEAVADIGVPNFALAEYKAPENYKASGCPLCAAKTPITRF

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
283 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 3.69
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 17.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10496695 3300009148 Unclassified 1155
2 ARSoilOldRDRAFT_c011613 3300000044 Unclassified 739
3 JGI24749J21850_1014012 3300002076 Bacteria 1125
4 JGI25406J46586_10004384 3300003203 Bacteria 6579
5 Ga0065715_10095859 3300005293 Bacteria 3993
6 Ga0065715_10111447 3300005293 Bacteria 2538
7 Ga0065707_10132525 3300005295 Bacteria 1896
8 Ga0065707_10165573 3300005295 Unclassified 1525
9 Ga0065707_10393890 3300005295 Unclassified 861
10 Ga0070658_10762480 3300005327 Unclassified 840
11 Ga0070676_10003456 3300005328 Bacteria 8235
12 Ga0070676_10035152 3300005328 Bacteria 2881
13 Ga0070676_10059889 3300005328 Bacteria 2259
14 Ga0070676_10194541 3300005328 Bacteria 1326
15 Ga0070690_100012530 3300005330 Bacteria 4990
16 Ga0070690_100015824 3300005330 Bacteria 4506
17 Ga0070690_100023454 3300005330 Bacteria 3784
18 Ga0070690_100280232 3300005330 Bacteria 1189
19 Ga0070670_100007523 3300005331 Bacteria 9247
20 Ga0070670_100038125 3300005331 Bacteria 4132
21 Ga0070670_100319078 3300005331 Unclassified 1361
22 Ga0070670_100319150 3300005331 Bacteria 1361
23 Ga0070677_10015150 3300005333 Bacteria 2728
24 Ga0070677_10041065 3300005333 Bacteria 1824
25 Ga0068869_100027715 3300005334 Bacteria 3952
26 Ga0068869_100147512 3300005334 Bacteria 1822
27 Ga0068869_100371161 3300005334 Unclassified 1171
28 Ga0068869_100532332 3300005334 Bacteria 985
29 Ga0070666_10057079 3300005335 Unclassified 2637
30 Ga0070666_10071281 3300005335 Bacteria 2365
31 Ga0070680_100141891 3300005336 Bacteria 2015
32 Ga0070680_100657655 3300005336 Unclassified 901
33 Ga0068868_100101125 3300005338 Bacteria 2333
34 Ga0068868_100103775 3300005338 Bacteria 2303
35 Ga0068868_100121211 3300005338 Unclassified 2133
36 Ga0070689_100011320 3300005340 Bacteria 6385
37 Ga0070689_100164161 3300005340 Bacteria 1797
38 Ga0070689_100619713 3300005340 Bacteria 939
39 Ga0070691_10150863 3300005341 Bacteria 1191
40 Ga0070687_100015058 3300005343 Bacteria 3487
41 Ga0070687_100023041 3300005343 Bacteria 2954
42 Ga0070687_100137391 3300005343 Bacteria 1419
43 Ga0070687_100196570 3300005343 Bacteria 1219
44 Ga0070661_100174269 3300005344 Unclassified 1635
45 Ga0070661_100299801 3300005344 Bacteria 1251
46 Ga0070661_100439859 3300005344 Bacteria 1036
47 Ga0070692_10645500 3300005345 Bacteria 706
48 Ga0070668_100082872 3300005347 Bacteria 2516
49 Ga0070668_100094455 3300005347 Bacteria 2361
50 Ga0070668_100327918 3300005347 Bacteria 1290
51 Ga0070668_100727744 3300005347 Bacteria 877
52 Ga0070669_100006919 3300005353 Bacteria 8151
53 Ga0070669_100007608 3300005353 Bacteria 7744
54 Ga0070669_100014142 3300005353 Bacteria 5678
55 Ga0070669_100039788 3300005353 Bacteria 3417
56 Ga0070669_100081299 3300005353 Unclassified 2413
57 Ga0070669_100102780 3300005353 Bacteria 2158
58 Ga0070669_100748875 3300005353 Unclassified 828
59 Ga0070675_100004749 3300005354 Bacteria 10371
60 Ga0070675_100022248 3300005354 Bacteria 5064
61 Ga0070675_100025840 3300005354 Bacteria 4709
62 Ga0070675_100064504 3300005354 Bacteria 3028
63 Ga0070675_100143337 3300005354 Bacteria 2044
64 Ga0070675_100191297 3300005354 Bacteria 1773
65 Ga0070675_100299501 3300005354 Unclassified 1416
66 Ga0070675_100358774 3300005354 Bacteria 1294
67 Ga0070675_101042314 3300005354 Unclassified 751
68 Ga0070671_100004673 3300005355 Bacteria 10865
69 Ga0070671_100097220 3300005355 Bacteria 2469
70 Ga0070671_100120451 3300005355 Bacteria 2208
71 Ga0070671_100558790 3300005355 Bacteria 987
72 Ga0070674_100003008 3300005356 Bacteria 9374
73 Ga0070674_100007639 3300005356 Bacteria 6386
74 Ga0070674_100014968 3300005356 Bacteria 4832
75 Ga0070674_100056026 3300005356 Bacteria 2733
76 Ga0070674_100094656 3300005356 Bacteria 2164
77 Ga0070674_100785939 3300005356 Unclassified 821
78 Ga0070673_100029829 3300005364 Bacteria 4073
79 Ga0070673_100039117 3300005364 Bacteria 3627
80 Ga0070673_100053840 3300005364 Bacteria 3163
81 Ga0070673_100066071 3300005364 Unclassified 2888
82 Ga0070673_100148846 3300005364 Bacteria 1981
83 Ga0070673_100222246 3300005364 Bacteria 1635
84 Ga0070673_100222711 3300005364 Archaea 1633
85 Ga0070688_100011077 3300005365 Bacteria 5004
86 Ga0070688_100012397 3300005365 Bacteria 4776
87 Ga0070688_100078683 3300005365 Bacteria 2128
88 Ga0070688_100089728 3300005365 Bacteria 2007
89 Ga0070688_100184043 3300005365 Bacteria 1451
90 Ga0070688_100225902 3300005365 Bacteria 1322
91 Ga0070659_100250382 3300005366 Bacteria 1468
92 Ga0070659_100271540 3300005366 Bacteria 1409
93 Ga0070659_100401929 3300005366 Bacteria 1156
94 Ga0070667_100014960 3300005367 Bacteria 6410
95 Ga0070667_100105698 3300005367 Bacteria 2436
96 Ga0070667_100161538 3300005367 Bacteria 1973
97 Ga0070667_101247020 3300005367 Unclassified 696
98 Ga0070709_10407025 3300005434 Bacteria 1017
99 Ga0070713_100020681 3300005436 Bacteria 5050
100 Ga0070701_10091233 3300005438 Bacteria 1670
101 Ga0070701_10129195 3300005438 Unclassified 1434
102 Ga0070701_10144663 3300005438 Bacteria 1363
103 Ga0070701_10570971 3300005438 Bacteria 745
104 Ga0070705_100015088 3300005440 Bacteria 3987
105 Ga0070700_100003298 3300005441 Bacteria 8322
106 Ga0070700_100003654 3300005441 Bacteria 7951
107 Ga0070700_100245871 3300005441 Bacteria 1281
108 Ga0070694_100000569 3300005444 Bacteria 20444
109 Ga0070694_100052766 3300005444 Bacteria 2750
110 Ga0070694_100074412 3300005444 Bacteria 2348
111 Ga0070694_100082883 3300005444 Bacteria 2234
112 Ga0070694_100162749 3300005444 Bacteria 1639
113 Ga0070694_100190084 3300005444 Bacteria 1524
114 Ga0070694_100261875 3300005444 Bacteria 1312
115 Ga0070694_100426327 3300005444 Bacteria 1043
116 Ga0070708_100634488 3300005445 Bacteria 1007
117 Ga0070663_100128439 3300005455 Unclassified 1922
118 Ga0070678_100022377 3300005456 Bacteria 4187
119 Ga0070678_100048007 3300005456 Bacteria 3071
120 Ga0070662_100038957 3300005457 Bacteria 3379
121 Ga0070662_100112052 3300005457 Bacteria 2080
122 Ga0070662_100184523 3300005457 Bacteria 1646
123 Ga0070662_100414133 3300005457 Bacteria 1114
124 Ga0070662_100797122 3300005457 Bacteria 803
125 Ga0070662_101090312 3300005457 Bacteria 685
126 Ga0070681_10182649 3300005458 Unclassified 2019
127 Ga0070681_10223528 3300005458 Bacteria 1798
128 Ga0070681_10717096 3300005458 Bacteria 916
129 Ga0068867_100024065 3300005459 Bacteria 4364
130 Ga0068867_100043000 3300005459 Bacteria 3306
131 Ga0068867_100066688 3300005459 Bacteria 2681
132 Ga0068867_100139749 3300005459 Unclassified 1892
133 Ga0070685_10007783 3300005466 Bacteria 5484
134 Ga0070685_10050926 3300005466 Unclassified 2394
135 Ga0070685_10148626 3300005466 Bacteria 1483
136 Ga0070685_10234893 3300005466 Bacteria 1208
137 Ga0070685_10329156 3300005466 Unclassified 1038
138 Ga0070706_101010689 3300005467 Unclassified 767
139 Ga0070707_100026069 3300005468 Bacteria 5548
140 Ga0070707_100042034 3300005468 Bacteria 4376
141 Ga0070707_100042519 3300005468 Bacteria 4351
142 Ga0070707_100793022 3300005468 Bacteria 911
143 Ga0070698_100009315 3300005471 Bacteria 10532
144 Ga0070698_100019156 3300005471 Bacteria 7194
145 Ga0070698_100049616 3300005471 Bacteria 4282
146 Ga0070698_100213917 3300005471 Bacteria 1862
147 Ga0070699_100001533 3300005518 Bacteria 21114
148 Ga0070699_100002754 3300005518 Bacteria 15671
149 Ga0070699_100005303 3300005518 Bacteria 11306
150 Ga0070699_100214657 3300005518 Bacteria 1714
151 Ga0070699_100348455 3300005518 Bacteria 1334
152 Ga0070699_100980496 3300005518 Bacteria 775
153 Ga0070699_101064269 3300005518 Bacteria 742
154 Ga0070679_100423924 3300005530 Unclassified 1276
155 Ga0070684_100034091 3300005535 Bacteria 4351
156 Ga0070697_100015498 3300005536 Bacteria 5983
157 Ga0070697_100072268 3300005536 Bacteria 2830
158 Ga0070697_100209021 3300005536 Bacteria 1661
159 Ga0070697_100457073 3300005536 Unclassified 1113
160 Ga0070697_100587727 3300005536 Unclassified 978
161 Ga0070697_101033016 3300005536 Bacteria 731
162 Ga0068853_100163620 3300005539 Bacteria 2009
163 Ga0068853_100228620 3300005539 Bacteria 1701
164 Ga0068853_100929037 3300005539 Bacteria 836
165 Ga0070672_100005521 3300005543 Bacteria 8391
166 Ga0070672_100010601 3300005543 Bacteria 6397
167 Ga0070672_100071118 3300005543 Bacteria 2766
168 Ga0070686_100002220 3300005544 Bacteria 10721
169 Ga0070686_100011277 3300005544 Bacteria 5065
170 Ga0070686_100026131 3300005544 Bacteria 3520
171 Ga0070686_100069343 3300005544 Bacteria 2303
172 Ga0070695_100000124 3300005545 Bacteria 34655
173 Ga0070695_100004253 3300005545 Bacteria 8374
174 Ga0070695_100008618 3300005545 Bacteria 6057
175 Ga0070695_100268641 3300005545 Unclassified 1248
176 Ga0070695_100455751 3300005545 Bacteria 981
177 Ga0070696_100002752 3300005546 Bacteria 11668
178 Ga0070696_100005583 3300005546 Bacteria 8398
179 Ga0070696_100006089 3300005546 Bacteria 8057
180 Ga0070696_100126355 3300005546 Bacteria 1856
181 Ga0070693_100541285 3300005547 Bacteria 832
182 Ga0070665_100054908 3300005548 Bacteria 3995
183 Ga0070665_100106088 3300005548 Bacteria 2812
184 Ga0070665_100119989 3300005548 Bacteria 2631
185 Ga0070665_100655464 3300005548 Unclassified 1063
186 Ga0070704_100002921 3300005549 Bacteria 9709
187 Ga0070704_100015187 3300005549 Bacteria 4831
188 Ga0070704_100224216 3300005549 Archaea 1530
189 Ga0070704_100287152 3300005549 Unclassified 1366
190 Ga0070704_100404078 3300005549 Unclassified 1166
191 Ga0070704_100480248 3300005549 Bacteria 1075
192 Ga0068855_100029695 3300005563 Bacteria 6536
193 Ga0068855_100214551 3300005563 Bacteria 2161
194 Ga0070664_100016061 3300005564 Bacteria 6134
195 Ga0070664_100042798 3300005564 Bacteria 3822
196 Ga0070664_100048888 3300005564 Bacteria 3575
197 Ga0070664_100052986 3300005564 Bacteria 3438
198 Ga0068857_100010357 3300005577 Bacteria 8101
199 Ga0068857_100084011 3300005577 Bacteria 2845
200 Ga0068857_100382866 3300005577 Bacteria 1307
201 Ga0068857_100426672 3300005577 Bacteria 1237
202 Ga0068857_100558708 3300005577 Bacteria 1079
203 Ga0068854_100001221 3300005578 Bacteria 15413
204 Ga0068856_100023149 3300005614 Bacteria 6042
205 Ga0068856_100284924 3300005614 Bacteria 1669
206 Ga0070702_100019533 3300005615 Bacteria 3537
207 Ga0070702_100037578 3300005615 Unclassified 2690
208 Ga0070702_100059174 3300005615 Bacteria 2222
209 Ga0070702_100248131 3300005615 Bacteria 1205
210 Ga0068852_100036790 3300005616 Bacteria 4100
211 Ga0068852_101172813 3300005616 Bacteria 789
212 Ga0068859_100049771 3300005617 Bacteria 4209
213 Ga0068859_100052219 3300005617 Bacteria 4109
214 Ga0068859_100087172 3300005617 Unclassified 3169
215 Ga0068859_100087846 3300005617 Unclassified 3158
216 Ga0068859_100190420 3300005617 Bacteria 2136
217 Ga0068859_100251747 3300005617 Bacteria 1857
218 Ga0068859_100414039 3300005617 Unclassified 1444
219 Ga0068859_100612190 3300005617 Unclassified 1182
220 Ga0068859_100947900 3300005617 Unclassified 944
221 Ga0068859_101467367 3300005617 Bacteria 753
222 Ga0068864_100002418 3300005618 Bacteria 15421
223 Ga0068864_100225774 3300005618 Bacteria 1730
224 Ga0068864_100384805 3300005618 Bacteria 1330
225 Ga0068866_10229913 3300005718 Bacteria 1124
226 Ga0068866_10321987 3300005718 Unclassified 973
227 Ga0068861_100004854 3300005719 Bacteria 9044
228 Ga0068861_100006617 3300005719 Bacteria 7910
229 Ga0068861_100038658 3300005719 Bacteria 3557
230 Ga0068861_100100611 3300005719 Bacteria 2298
231 Ga0068861_100117610 3300005719 Unclassified 2139
232 Ga0068861_100218387 3300005719 Bacteria 1610
233 Ga0068861_100419122 3300005719 Unclassified 1192
234 Ga0068861_100641944 3300005719 Bacteria 980
235 Ga0068861_100681539 3300005719 Unclassified 953
236 Ga0068870_10003815 3300005840 Bacteria 6417
237 Ga0068870_10013120 3300005840 Bacteria 3886
238 Ga0068870_10013632 3300005840 Bacteria 3825
239 Ga0068863_100004157 3300005841 Bacteria 14293
240 Ga0068863_100006788 3300005841 Bacteria 11220
241 Ga0068863_100082287 3300005841 Bacteria 3050
242 Ga0068863_100112993 3300005841 Unclassified 2587
243 Ga0068863_100341852 3300005841 Bacteria 1456
244 Ga0068863_100374047 3300005841 Bacteria 1390
245 Ga0068858_100004887 3300005842 Bacteria 13149
246 Ga0068858_100009751 3300005842 Bacteria 9148
247 Ga0068858_100017517 3300005842 Bacteria 6719
248 Ga0068858_100039247 3300005842 Bacteria 4391
249 Ga0068858_100042722 3300005842 Bacteria 4203
250 Ga0068858_100083089 3300005842 Bacteria 2978
251 Ga0068858_100443127 3300005842 Unclassified 1251
252 Ga0068858_100936088 3300005842 Bacteria 848
253 Ga0068860_100003758 3300005843 Bacteria 15606
254 Ga0068860_100055797 3300005843 Bacteria 3756
255 Ga0068860_100081514 3300005843 Unclassified 3077
256 Ga0068860_100139427 3300005843 Unclassified 2330
257 Ga0068860_100310701 3300005843 Bacteria 1546
258 Ga0068860_100341357 3300005843 Bacteria 1473
259 Ga0068860_100412951 3300005843 Unclassified 1337
260 Ga0068860_100729428 3300005843 Bacteria 1002
261 Ga0068862_100021406 3300005844 Bacteria 5402
262 Ga0068862_100035244 3300005844 Bacteria 4236
263 Ga0068862_100056294 3300005844 Bacteria 3369
264 Ga0068862_101503313 3300005844 Bacteria 679
265 Ga0081455_10019733 3300005937 Bacteria 6367
266 Ga0081538_10027347 3300005981 Bacteria 3957
267 Ga0081539_10000024 3300005985 Bacteria 354702
268 Ga0081539_10006511 3300005985 Bacteria 11161
269 Ga0075432_10007359 3300006058 Bacteria 3748
270 Ga0070716_100120815 3300006173 Bacteria 1640
271 Ga0097621_100115009 3300006237 Bacteria 2277
272 Ga0097621_100126120 3300006237 Bacteria 2174
273 Ga0097621_100132863 3300006237 Bacteria 2120
274 Ga0097621_100142093 3300006237 Bacteria 2052
275 Ga0097621_100176629 3300006237 Unclassified 1843
276 Ga0097621_100387123 3300006237 Unclassified 1250
277 Ga0068871_100005171 3300006358 Bacteria 9124
278 Ga0068871_100067472 3300006358 Bacteria 2935
279 Ga0068871_100076790 3300006358 Bacteria 2759
280 Ga0068871_100174440 3300006358 Unclassified 1845
281 Ga0068871_100208534 3300006358 Bacteria 1689
282 Ga0068871_100386496 3300006358 Bacteria 1244
283 Ga0075428_100002059 3300006844 Bacteria 21682
284 Ga0075428_100007575 3300006844 Bacteria 12030
285 Ga0075428_100047818 3300006844 Bacteria 4697
286 Ga0075428_100065340 3300006844 Bacteria 3984
287 Ga0075428_100179956 3300006844 Bacteria 2289
288 Ga0075428_100196758 3300006844 Bacteria 2180
289 Ga0075428_100303824 3300006844 Bacteria 1715
290 Ga0075428_100313810 3300006844 Bacteria 1685
291 Ga0075430_100002081 3300006846 Bacteria 16524
292 Ga0075430_100002965 3300006846 Bacteria 14212
293 Ga0075430_100010598 3300006846 Bacteria 7808
294 Ga0075430_100239441 3300006846 Bacteria 1504
295 Ga0075430_100260933 3300006846 Bacteria 1435
296 Ga0075430_100506617 3300006846 Unclassified 996
297 Ga0075431_100037374 3300006847 Bacteria 5003
298 Ga0075431_100098362 3300006847 Bacteria 3021
299 Ga0075431_100386774 3300006847 Bacteria 1402
300 Ga0075433_10002979 3300006852 Bacteria 13009
301 Ga0075433_10012328 3300006852 Bacteria 6899
302 Ga0075433_10020979 3300006852 Bacteria 5472
303 Ga0075433_10033064 3300006852 Bacteria 4433
304 Ga0075433_10045182 3300006852 Bacteria 3828
305 Ga0075434_100001885 3300006871 Bacteria 18146
306 Ga0075434_100015367 3300006871 Bacteria 7335
307 Ga0075434_100053436 3300006871 Bacteria 4014
308 Ga0075434_100105900 3300006871 Bacteria 2822
309 Ga0075434_100161311 3300006871 Bacteria 2262
310 Ga0075434_100190725 3300006871 Bacteria 2070
311 Ga0075434_100257744 3300006871 Unclassified 1763
312 Ga0075434_100398585 3300006871 Unclassified 1397
313 Ga0075434_100722111 3300006871 Bacteria 1013
314 Ga0075434_100729634 3300006871 Bacteria 1008
315 Ga0075429_100025040 3300006880 Bacteria 5180
316 Ga0075429_100033174 3300006880 Bacteria 4486
317 Ga0075429_100038910 3300006880 Bacteria 4140
318 Ga0075429_100135462 3300006880 Bacteria 2155
319 Ga0075429_100216855 3300006880 Unclassified 1676
320 Ga0075429_100266450 3300006880 Unclassified 1500
321 Ga0075429_100306333 3300006880 Bacteria 1391
322 Ga0075429_100313267 3300006880 Bacteria 1374
323 Ga0075429_100363019 3300006880 Bacteria 1268
324 Ga0068865_100027783 3300006881 Bacteria 3740
325 Ga0068865_100174092 3300006881 Unclassified 1652
326 Ga0068865_100269669 3300006881 Bacteria 1351
327 Ga0068865_100295515 3300006881 Unclassified 1294
328 Ga0068865_100522645 3300006881 Unclassified 993
329 Ga0068865_100645825 3300006881 Bacteria 899
330 Ga0075436_100001894 3300006914 Bacteria 14378
331 Ga0075436_100017181 3300006914 Bacteria 4951
332 Ga0075436_100097399 3300006914 Bacteria 2046
333 Ga0075436_100176514 3300006914 Bacteria 1509
334 Ga0097620_100049772 3300006931 Bacteria 4209
335 Ga0097620_100052218 3300006931 Bacteria 4109
336 Ga0097620_100087167 3300006931 Unclassified 3169
337 Ga0097620_100087839 3300006931 Unclassified 3158
338 Ga0097620_100190408 3300006931 Bacteria 2136
339 Ga0097620_100251744 3300006931 Bacteria 1857
340 Ga0097620_100414051 3300006931 Unclassified 1444
341 Ga0097620_100612261 3300006931 Unclassified 1182
342 Ga0097620_100947836 3300006931 Unclassified 944
343 Ga0097620_101467325 3300006931 Bacteria 753
344 Ga0075435_100000059 3300007076 Bacteria 56189
345 Ga0075435_100003706 3300007076 Bacteria 10404
346 Ga0075435_100006273 3300007076 Bacteria 8393
347 Ga0075435_100008498 3300007076 Bacteria 7371
348 Ga0075435_100009328 3300007076 Bacteria 7097
349 Ga0075435_100021620 3300007076 Bacteria 4951
350 Ga0075435_100033289 3300007076 Bacteria 4074
351 Ga0075435_100046888 3300007076 Bacteria 3468
352 Ga0075435_100137921 3300007076 Bacteria 2045
353 Ga0075435_100154935 3300007076 Bacteria 1928
354 Ga0075435_100175624 3300007076 Unclassified 1809
355 Ga0075435_100468558 3300007076 Bacteria 1087
356 Ga0105240_10183434 3300009093 Bacteria 2468
357 Ga0105240_10269705 3300009093 Bacteria 1960
358 Ga0105240_10307762 3300009093 Bacteria 1811
359 Ga0105240_10387890 3300009093 Bacteria 1576
360 Ga0105240_10528461 3300009093 Bacteria 1308
361 Ga0111539_10000326 3300009094 Bacteria 58218
362 Ga0111539_10002569 3300009094 Bacteria 24030
363 Ga0111539_10003793 3300009094 Bacteria 19890
364 Ga0111539_10015587 3300009094 Bacteria 9450
365 Ga0111539_10041812 3300009094 Bacteria 5508
366 Ga0111539_10069299 3300009094 Bacteria 4164
367 Ga0111539_10121417 3300009094 Bacteria 3061
368 Ga0111539_10201596 3300009094 Bacteria 2320
369 Ga0111539_10208519 3300009094 Bacteria 2277
370 Ga0111539_10235167 3300009094 Bacteria 2133
371 Ga0111539_10343836 3300009094 Bacteria 1736
372 Ga0111539_10370869 3300009094 Bacteria 1666
373 Ga0111539_10409928 3300009094 Bacteria 1578
374 Ga0111539_10587288 3300009094 Bacteria 1297
375 Ga0111539_10797873 3300009094 Unclassified 1099
376 Ga0111539_10968187 3300009094 Bacteria 989
377 Ga0111539_11200010 3300009094 Unclassified 881
378 Ga0105245_10029287 3300009098 Bacteria 4863
379 Ga0105245_10063579 3300009098 Bacteria 3333
380 Ga0105245_10559907 3300009098 Bacteria 1166
381 Ga0114129_10000690 3300009147 Bacteria 42700
382 Ga0114129_10001192 3300009147 Bacteria 34525
383 Ga0114129_10001315 3300009147 Bacteria 33235
384 Ga0114129_10003812 3300009147 Bacteria 21254
385 Ga0114129_10005798 3300009147 Bacteria 17483
386 Ga0114129_10010157 3300009147 Bacteria 13423
387 Ga0114129_10017382 3300009147 Bacteria 10242
388 Ga0114129_10040277 3300009147 Bacteria 6586
389 Ga0114129_10069380 3300009147 Bacteria 4913
390 Ga0114129_10087948 3300009147 Bacteria 4308
391 Ga0114129_10145232 3300009147 Bacteria 3250
392 Ga0114129_10148674 3300009147 Bacteria 3207
393 Ga0114129_10183235 3300009147 Bacteria 2848
394 Ga0114129_10278744 3300009147 Bacteria 2234
395 Ga0114129_10314693 3300009147 Bacteria 2083
396 Ga0114129_10358589 3300009147 Bacteria 1930
397 Ga0114129_10595762 3300009147 Bacteria 1433
398 Ga0114129_11023675 3300009147 Unclassified 1039
399 Ga0105243_10094033 3300009148 Bacteria 2475
400 Ga0105243_10124010 3300009148 Unclassified 2182
401 Ga0105243_10127601 3300009148 Unclassified 2154
402 Ga0105243_10236405 3300009148 Bacteria 1624
403 Ga0105243_10355165 3300009148 Bacteria 1347
404 Ga0105243_10442763 3300009148 Bacteria 1217
405 Ga0105241_10176859 3300009174 Bacteria 1767
406 Ga0105242_10002104 3300009176 Bacteria 15686
407 Ga0105242_10082246 3300009176 Bacteria 2695
408 Ga0105242_10104808 3300009176 Unclassified 2401
409 Ga0105242_10697834 3300009176 Bacteria 993
410 Ga0105248_10024718 3300009177 Bacteria 6681
411 Ga0105248_10028665 3300009177 Bacteria 6204
412 Ga0105248_10033372 3300009177 Bacteria 5750
413 Ga0105248_10058912 3300009177 Bacteria 4313
414 Ga0105248_10105896 3300009177 Bacteria 3171
415 Ga0105248_10200680 3300009177 Bacteria 2247
416 Ga0105248_10215175 3300009177 Bacteria 2164
417 Ga0105248_10381763 3300009177 Bacteria 1586
418 Ga0105248_10524495 3300009177 Unclassified 1336
419 Ga0105248_10691504 3300009177 Bacteria 1151
420 Ga0105238_10850920 3300009551 Bacteria 929
421 Ga0105249_10035578 3300009553 Bacteria 4516
422 Ga0105249_10054172 3300009553 Unclassified 3667
423 Ga0105249_10178102 3300009553 Bacteria 2066
424 Ga0105249_10323483 3300009553 Unclassified 1554
425 Ga0105249_10579034 3300009553 Bacteria 1176
426 Ga0105249_10988758 3300009553 Bacteria 910
427 Ga0105249_11137563 3300009553 Bacteria 851
428 Ga0105246_10857000 3300011119 Unclassified 811
429 Ga0157328_1001049 3300012478 Bacteria 1124
430 Ga0157369_10209103 3300013105 Unclassified 2046
431 Ga0157374_10040011 3300013296 Bacteria 4316
432 Ga0157374_10071398 3300013296 Bacteria 3273
433 Ga0157374_11055213 3300013296 Unclassified 832
434 Ga0157378_10106459 3300013297 Bacteria 2565
435 Ga0157378_10844884 3300013297 Unclassified 944
436 Ga0157378_10948834 3300013297 Unclassified 893
437 Ga0163162_10288852 3300013306 Unclassified 1772
438 Ga0157372_10422103 3300013307 Bacteria 1554
439 Ga0157372_11071409 3300013307 Unclassified 933
440 Ga0157375_10035690 3300013308 Bacteria 4749
441 Ga0157375_10036438 3300013308 Bacteria 4706
442 Ga0157375_10065572 3300013308 Bacteria 3620
443 Ga0157375_10156288 3300013308 Bacteria 2419
444 Ga0157375_10171380 3300013308 Bacteria 2318
445 Ga0157375_10241743 3300013308 Bacteria 1965
446 Ga0157375_10357024 3300013308 Unclassified 1627
447 Ga0157375_10359792 3300013308 Unclassified 1621
448 Ga0157375_10970469 3300013308 Bacteria 991
449 Ga0163163_10017080 3300014325 Bacteria 6760
450 Ga0163163_10068279 3300014325 Bacteria 3537
451 Ga0163163_10107046 3300014325 Bacteria 2822
452 Ga0163163_10116686 3300014325 Bacteria 2701
453 Ga0163163_10329552 3300014325 Unclassified 1581
454 Ga0163163_10478598 3300014325 Bacteria 1306
455 Ga0157380_10001648 3300014326 Bacteria 14702
456 Ga0157380_10001840 3300014326 Bacteria 14026
457 Ga0157380_10021220 3300014326 Bacteria 4868
458 Ga0157380_10052912 3300014326 Bacteria 3217
459 Ga0157380_10787978 3300014326 Unclassified 966
460 Ga0157380_10823141 3300014326 Unclassified 948
461 Ga0157380_11575128 3300014326 Bacteria 712
462 Ga0157377_10085625 3300014745 Bacteria 1851
463 Ga0157377_10100461 3300014745 Bacteria 1723
464 Ga0157377_10111535 3300014745 Bacteria 1645
465 Ga0157377_10299800 3300014745 Unclassified 1060
466 Ga0157379_10015605 3300014968 Bacteria 6670
467 Ga0157379_10020277 3300014968 Bacteria 5878
468 Ga0157379_10052086 3300014968 Bacteria 3655
469 Ga0157379_10293392 3300014968 Unclassified 1481
470 Ga0157379_10697735 3300014968 Unclassified 952
471 Ga0157376_10004135 3300014969 Bacteria 10058
472 Ga0157376_10024862 3300014969 Bacteria 4710
473 Ga0157376_10125669 3300014969 Bacteria 2281
474 Ga0157376_10597175 3300014969 Bacteria 1098
475 Ga0163161_10092846 3300017792 Bacteria 2235
476 Ga0206356_10331988 3300020070 Bacteria 875
477 Ga0207697_10000950 3300025315 Bacteria 16340
478 Ga0207697_10029465 3300025315 Bacteria 2246
479 Ga0207682_10002213 3300025893 Bacteria 8772
480 Ga0207682_10005844 3300025893 Bacteria 4987
481 Ga0207682_10074025 3300025893 Bacteria 1448
482 Ga0207642_10175920 3300025899 Unclassified 1162
483 Ga0207688_10014880 3300025901 Bacteria 4222
484 Ga0207688_10306581 3300025901 Bacteria 972
485 Ga0207680_10021511 3300025903 Bacteria 3491
486 Ga0207680_10554670 3300025903 Bacteria 820
487 Ga0207647_10336042 3300025904 Bacteria 857
488 Ga0207685_10009396 3300025905 Bacteria 2839
489 Ga0207645_10001137 3300025907 Bacteria 22015
490 Ga0207645_10004630 3300025907 Bacteria 10129
491 Ga0207645_10011453 3300025907 Bacteria 6054
492 Ga0207645_10069832 3300025907 Bacteria 2247
493 Ga0207643_10000596 3300025908 Bacteria 22885
494 Ga0207643_10003169 3300025908 Bacteria 8856
495 Ga0207643_10047862 3300025908 Bacteria 2421
496 Ga0207643_10109177 3300025908 Bacteria 1628
497 Ga0207705_10260925 3300025909 Bacteria 1323
498 Ga0207684_10396282 3300025910 Bacteria 1187
499 Ga0207654_10102304 3300025911 Bacteria 1767
500 Ga0207707_10093895 3300025912 Bacteria 2621
501 Ga0207707_10236348 3300025912 Bacteria 1590
502 Ga0207707_10582430 3300025912 Unclassified 948
503 Ga0207707_10631355 3300025912 Bacteria 904
504 Ga0207695_10129290 3300025913 Bacteria 2484
505 Ga0207695_10361921 3300025913 Unclassified 1337
506 Ga0207695_10449414 3300025913 Bacteria 1172
507 Ga0207693_10359858 3300025915 Bacteria 1138
508 Ga0207660_10069907 3300025917 Bacteria 2551
509 Ga0207662_10003174 3300025918 Bacteria 8405
510 Ga0207662_10005833 3300025918 Bacteria 6600
511 Ga0207662_10013321 3300025918 Bacteria 4598
512 Ga0207662_10087348 3300025918 Bacteria 1913
513 Ga0207662_10110008 3300025918 Bacteria 1717
514 Ga0207649_10187342 3300025920 Bacteria 1453
515 Ga0207652_10209373 3300025921 Bacteria 1755
516 Ga0207652_10519247 3300025921 Bacteria 1072
517 Ga0207646_10069585 3300025922 Bacteria 3143
518 Ga0207646_10080478 3300025922 Bacteria 2913
519 Ga0207646_10144059 3300025922 Bacteria 2147
520 Ga0207646_10153248 3300025922 Bacteria 2078
521 Ga0207646_10302378 3300025922 Bacteria 1445
522 Ga0207681_10006546 3300025923 Bacteria 7147
523 Ga0207681_10019875 3300025923 Bacteria 4252
524 Ga0207681_10174841 3300025923 Unclassified 1630
525 Ga0207681_10196335 3300025923 Bacteria 1547
526 Ga0207681_10345075 3300025923 Bacteria 1190
527 Ga0207681_10487542 3300025923 Bacteria 1008
528 Ga0207650_10015570 3300025925 Bacteria 5298
529 Ga0207650_10276239 3300025925 Unclassified 1367
530 Ga0207650_10279177 3300025925 Unclassified 1360
531 Ga0207659_10003809 3300025926 Bacteria 9096
532 Ga0207659_10005813 3300025926 Bacteria 7517
533 Ga0207659_10017805 3300025926 Bacteria 4647
534 Ga0207659_10022077 3300025926 Bacteria 4234
535 Ga0207659_10048899 3300025926 Bacteria 2997
536 Ga0207659_10110190 3300025926 Bacteria 2091
537 Ga0207659_10112867 3300025926 Bacteria 2069
538 Ga0207659_10209829 3300025926 Bacteria 1560
539 Ga0207687_10048100 3300025927 Bacteria 2959
540 Ga0207687_10119764 3300025927 Bacteria 1967
541 Ga0207687_10348028 3300025927 Bacteria 1207
542 Ga0207687_10359453 3300025927 Bacteria 1188
543 Ga0207700_10184029 3300025928 Bacteria 1751
544 Ga0207644_10018710 3300025931 Bacteria 4689
545 Ga0207644_10278543 3300025931 Bacteria 1342
546 Ga0207644_10496703 3300025931 Bacteria 1006
547 Ga0207690_10063645 3300025932 Bacteria 2516
548 Ga0207706_10001590 3300025933 Bacteria 22552
549 Ga0207706_10044786 3300025933 Bacteria 3921
550 Ga0207706_10118323 3300025933 Bacteria 2330
551 Ga0207706_10162469 3300025933 Bacteria 1963
552 Ga0207706_10164240 3300025933 Bacteria 1951
553 Ga0207686_10031703 3300025934 Bacteria 3140
554 Ga0207686_10058711 3300025934 Bacteria 2427
555 Ga0207686_10118882 3300025934 Unclassified 1795
556 Ga0207686_10500755 3300025934 Bacteria 942
557 Ga0207686_10944532 3300025934 Unclassified 697
558 Ga0207709_10039603 3300025935 Bacteria 2816
559 Ga0207709_10183833 3300025935 Bacteria 1478
560 Ga0207670_10060063 3300025936 Bacteria 2588
561 Ga0207670_10089289 3300025936 Bacteria 2175
562 Ga0207670_10163310 3300025936 Bacteria 1664
563 Ga0207670_10622019 3300025936 Bacteria 888
564 Ga0207670_10813055 3300025936 Unclassified 779
565 Ga0207669_10000468 3300025937 Bacteria 17644
566 Ga0207669_10018812 3300025937 Bacteria 3581
567 Ga0207669_10036352 3300025937 Bacteria 2813
568 Ga0207669_10140118 3300025937 Bacteria 1677
569 Ga0207669_10173699 3300025937 Bacteria 1537
570 Ga0207704_10035209 3300025938 Bacteria 2867
571 Ga0207704_10164374 3300025938 Bacteria 1583
572 Ga0207704_10188731 3300025938 Bacteria 1497
573 Ga0207704_10212457 3300025938 Unclassified 1425
574 Ga0207704_10574666 3300025938 Bacteria 919
575 Ga0207665_10159106 3300025939 Bacteria 1623
576 Ga0207691_10000690 3300025940 Bacteria 33386
577 Ga0207691_10002023 3300025940 Bacteria 19849
578 Ga0207691_10005794 3300025940 Bacteria 11949
579 Ga0207691_10006933 3300025940 Bacteria 10926
580 Ga0207691_10080397 3300025940 Bacteria 2932
581 Ga0207691_10234169 3300025940 Bacteria 1589
582 Ga0207711_10027718 3300025941 Bacteria 4760
583 Ga0207711_10115220 3300025941 Unclassified 2395
584 Ga0207711_10185217 3300025941 Bacteria 1895
585 Ga0207711_10216061 3300025941 Bacteria 1752
586 Ga0207711_10292038 3300025941 Unclassified 1503
587 Ga0207711_10391281 3300025941 Unclassified 1291
588 Ga0207711_11022726 3300025941 Bacteria 766
589 Ga0207689_10001533 3300025942 Bacteria 21987
590 Ga0207689_10169045 3300025942 Bacteria 1802
591 Ga0207689_10233093 3300025942 Unclassified 1521
592 Ga0207689_10247201 3300025942 Unclassified 1475
593 Ga0207679_10004854 3300025945 Bacteria 8386
594 Ga0207679_10019831 3300025945 Bacteria 4527
595 Ga0207679_10048780 3300025945 Unclassified 3085
596 Ga0207679_10050101 3300025945 Bacteria 3050
597 Ga0207679_10122837 3300025945 Bacteria 2070
598 Ga0207679_10198948 3300025945 Bacteria 1672
599 Ga0207667_10226159 3300025949 Bacteria 1917
600 Ga0207667_10584377 3300025949 Unclassified 1127
601 Ga0207651_10043868 3300025960 Bacteria 2988
602 Ga0207651_10082834 3300025960 Bacteria 2317
603 Ga0207651_10189928 3300025960 Unclassified 1637
604 Ga0207651_10303907 3300025960 Bacteria 1328
605 Ga0207712_10110175 3300025961 Unclassified 2064
606 Ga0207712_10111503 3300025961 Bacteria 2053
607 Ga0207712_10225693 3300025961 Unclassified 1500
608 Ga0207712_10488166 3300025961 Bacteria 1051
609 Ga0207668_10049279 3300025972 Bacteria 2895
610 Ga0207668_10776572 3300025972 Bacteria 847
611 Ga0207640_10003631 3300025981 Bacteria 8328
612 Ga0207640_10327061 3300025981 Bacteria 1223
613 Ga0207658_10039419 3300025986 Bacteria 3408
614 Ga0207658_10081972 3300025986 Bacteria 2476
615 Ga0207658_10175470 3300025986 Unclassified 1769
616 Ga0207658_10325921 3300025986 Bacteria 1331
617 Ga0207677_10012834 3300026023 Bacteria 4835
618 Ga0207677_10024246 3300026023 Bacteria 3765
619 Ga0207677_10114401 3300026023 Bacteria 2016
620 Ga0207677_10142339 3300026023 Bacteria 1838
621 Ga0207677_10299905 3300026023 Bacteria 1327
622 Ga0207703_10008230 3300026035 Bacteria 8238
623 Ga0207703_10028892 3300026035 Bacteria 4376
624 Ga0207639_10358983 3300026041 Bacteria 1303
625 Ga0207678_10053380 3300026067 Bacteria 3483
626 Ga0207708_10000978 3300026075 Bacteria 21433
627 Ga0207708_10029265 3300026075 Bacteria 4174
628 Ga0207708_10030671 3300026075 Bacteria 4077
629 Ga0207708_10058973 3300026075 Unclassified 2929
630 Ga0207708_10075362 3300026075 Bacteria 2587
631 Ga0207708_10122812 3300026075 Bacteria 2024
632 Ga0207708_10409391 3300026075 Bacteria 1123
633 Ga0207708_10714523 3300026075 Unclassified 857
634 Ga0207702_10109656 3300026078 Bacteria 2451
635 Ga0207702_10396806 3300026078 Bacteria 1329
636 Ga0207641_10002783 3300026088 Bacteria 15931
637 Ga0207641_10175304 3300026088 Bacteria 1960
638 Ga0207641_10183531 3300026088 Bacteria 1918
639 Ga0207641_10332390 3300026088 Bacteria 1444
640 Ga0207641_10401264 3300026088 Bacteria 1316
641 Ga0207648_10000805 3300026089 Bacteria 35418
642 Ga0207648_10014999 3300026089 Bacteria 7137
643 Ga0207648_10027201 3300026089 Bacteria 5080
644 Ga0207648_10044014 3300026089 Bacteria 3918
645 Ga0207648_10049877 3300026089 Bacteria 3661
646 Ga0207648_10268863 3300026089 Unclassified 1523
647 Ga0207648_10353996 3300026089 Bacteria 1324
648 Ga0207648_10386271 3300026089 Bacteria 1266
649 Ga0207676_10029846 3300026095 Bacteria 4086
650 Ga0207676_10188741 3300026095 Bacteria 1812
651 Ga0207676_10264934 3300026095 Bacteria 1553
652 Ga0207676_10811015 3300026095 Bacteria 913
653 Ga0207674_10009352 3300026116 Bacteria 11215
654 Ga0207674_10233292 3300026116 Bacteria 1788
655 Ga0207675_100008939 3300026118 Bacteria 9400
656 Ga0207675_100027357 3300026118 Bacteria 5312
657 Ga0207675_100029695 3300026118 Bacteria 5091
658 Ga0207675_100030928 3300026118 Bacteria 4986
659 Ga0207675_100039585 3300026118 Unclassified 4400
660 Ga0207675_100077599 3300026118 Bacteria 3112
661 Ga0207675_100181489 3300026118 Bacteria 2015
662 Ga0207675_100196249 3300026118 Bacteria 1937
663 Ga0207675_100197629 3300026118 Bacteria 1931
664 Ga0207675_100241170 3300026118 Bacteria 1747
665 Ga0207683_10015181 3300026121 Bacteria 6554
666 Ga0207683_10036793 3300026121 Bacteria 4262
667 Ga0207683_10043452 3300026121 Unclassified 3927
668 Ga0207683_10132968 3300026121 Bacteria 2238
669 Ga0207683_10412224 3300026121 Bacteria 1244
670 Ga0207683_10807588 3300026121 Bacteria 871
671 Ga0209966_1037061 3300027695 Bacteria 1005
672 Ga0207428_10000089 3300027907 Bacteria 127333
673 Ga0207428_10005248 3300027907 Bacteria 12106
674 Ga0207428_10006276 3300027907 Bacteria 10989
675 Ga0207428_10006605 3300027907 Bacteria 10675
676 Ga0207428_10011850 3300027907 Bacteria 7683
677 Ga0207428_10017912 3300027907 Bacteria 6069
678 Ga0207428_10049237 3300027907 Bacteria 3377
679 Ga0207428_10112914 3300027907 Bacteria 2089
680 Ga0268266_10053548 3300028379 Bacteria 3467
681 Ga0268266_10111300 3300028379 Unclassified 2426
682 Ga0268266_10679558 3300028379 Unclassified 992
683 Ga0268265_10011586 3300028380 Bacteria 5962
684 Ga0268265_10014767 3300028380 Bacteria 5329
685 Ga0268265_10022100 3300028380 Bacteria 4466
686 Ga0268265_10128550 3300028380 Bacteria 2101
687 Ga0268265_10288911 3300028380 Unclassified 1471
688 Ga0268265_10577709 3300028380 Bacteria 1071
689 Ga0268265_10720920 3300028380 Unclassified 965
690 Ga0268265_10991641 3300028380 Bacteria 829
691 Ga0268265_11069978 3300028380 Bacteria 799
692 Ga0268264_10053947 3300028381 Bacteria 3355
693 Ga0268264_10069962 3300028381 Unclassified 2970
694 Ga0268264_10095497 3300028381 Bacteria 2573
695 Ga0268264_10097812 3300028381 Bacteria 2544
696 Ga0268264_10178004 3300028381 Bacteria 1929
697 Ga0268264_10356581 3300028381 Bacteria 1394
698 Ga0268264_10721106 3300028381 Unclassified 991
699 Ga0265332_10015263 3300031238 Bacteria 3390
700 Ga0265331_10267381 3300031250 Bacteria 767
701 Ga0307408_100010928 3300031548 Bacteria 5992
702 Ga0307408_100191432 3300031548 Bacteria 1648
703 Ga0307408_100509269 3300031548 Bacteria 1055
704 Ga0307408_101000922 3300031548 Unclassified 770
705 Ga0307405_10017521 3300031731 Bacteria 3932
706 Ga0307405_10076292 3300031731 Bacteria 2174
707 Ga0307410_10042247 3300031852 Bacteria 3012
708 Ga0307406_10152392 3300031901 Bacteria 1651
709 Ga0307407_10006934 3300031903 Bacteria 5091
710 Ga0307412_10781508 3300031911 Bacteria 827
711 Ga0307409_100024378 3300031995 Bacteria 4218
712 Ga0307409_100035869 3300031995 Bacteria 3638
713 Ga0307409_100242218 3300031995 Bacteria 1643
714 Ga0307409_100865873 3300031995 Bacteria 915
715 Ga0307416_100085945 3300032002 Bacteria 2679
716 Ga0307416_100131998 3300032002 Bacteria 2250
717 Ga0307416_100623841 3300032002 Bacteria 1160
718 Ga0307416_100636564 3300032002 Bacteria 1150
719 Ga0307416_101100645 3300032002 Bacteria 899
720 Ga0307411_10003293 3300032005 Bacteria 7462
721 Ga0307411_10037004 3300032005 Bacteria 3064
722 Ga0307411_10208472 3300032005 Bacteria 1507
723 Ga0307411_10537060 3300032005 Bacteria 995
724 Ga0307415_100408823 3300032126 Bacteria 1161
725 Ga0373930_0000283 3300034816 Bacteria 6468
726 Ga0373950_0015049 3300034818 Bacteria 1308
727 Ga0373958_0009694 3300034819 Bacteria 1590
728 Ga0373929_0011638 3300035085 Bacteria 1660
729 Ga0373940_0144275 3300035088 Bacteria 754
730 Ga0373940_0168659 3300035088 Unclassified 706
731 Ga0373944_0014961 3300035089 Bacteria 2172
732 Ga0373951_0022058 3300035091 Bacteria 1464
733 Ga0373932_0007036 3300035112 Bacteria 2673
734 Ga0373932_0136002 3300035112 Unclassified 832
735 Ga0373936_0133773 3300035113 Unclassified 1067
736 Ga0373939_0000434 3300035114 Bacteria 10521
737 Ga0373939_0047967 3300035114 Bacteria 1314
738 Ga0373939_0071219 3300035114 Bacteria 1132
739 Ga0373941_0229236 3300035115 Unclassified 717
740 Ga0373954_0168984 3300035118 Unclassified 1071
741 Ga0373956_0068926 3300035119 Bacteria 1612
742 Ga0373956_0189356 3300035119 Bacteria 974
743 Ga0373960_0090510 3300035121 Bacteria 977
744 Ga0373943_0299599 3300035170 Unclassified 913
745 Ga0373946_0098286 3300035171 Bacteria 1308
746 Ga0373961_0001638 3300035241 Bacteria 6292
747 Ga0373962_0000201 3300035242 Bacteria 12625
748 Ga0373931_0096016 3300035691 Bacteria 1660
749 Ga0373931_0335619 3300035691 Bacteria 942
750 Ga0373927_0325313 3300035695 Bacteria 1013
751 Ga0373933_0070860 3300035724 Bacteria 2121
752 Ga0373937_0003967 3300036401 Bacteria 12516
753 Ga0373925_0205475 3300037068 Unclassified 1568
754 Ga0373925_0433419 3300037068 Unclassified 1075
755 Ga0373925_0476225 3300037068 Bacteria 1024
756 Ga0242420_030619 3300038996 Unclassified 997
757 Ga0436365_0739792 3300039437 Bacteria 3091
758 Ga0451853_1099285 3300041512 Unclassified 832
759 Ga0439431_0127809 3300041997 Unclassified 712
760 Ga0451577_0052666 3300042876 Bacteria 3634
761 Ga0451577_0084809 3300042876 Bacteria 2827
762 Ga0466963_0031177 3300044694 Bacteria 3445
763 Ga0453684_0563969 3300044712 Bacteria 1252
764 Ga0451576_0006121 3300045051 Bacteria 14828
765 Ga0451576_0015570 3300045051 Bacteria 8418
766 Ga0451576_0069690 3300045051 Bacteria 3660
767 Ga0451576_0095346 3300045051 Bacteria 3094
768 Ga0451576_0102641 3300045051 Bacteria 2975
769 Ga0451576_0242994 3300045051 Unclassified 1881
770 Ga0495603_0020517 3300046455 Bacteria 4004
771 Ga0495603_0134743 3300046455 Unclassified 1438
772 Ga0495629_0206020 3300046459 Unclassified 1359
773 Ga0495629_0315293 3300046459 Bacteria 1069
774 Ga0495653_0011116 3300046463 Bacteria 7361
775 Ga0495582_0144771 3300046473 Unclassified 1348
776 Ga0495582_0195440 3300046473 Bacteria 1155
777 Ga0495594_0010988 3300046499 Bacteria 4701
778 Ga0495618_0250283 3300046514 Bacteria 1112
779 Ga0495643_0008993 3300046522 Bacteria 6273
780 Ga0495642_0226806 3300046528 Unclassified 816
781 Ga0495586_0348242 3300046535 Bacteria 851
782 Ga0495586_0428446 3300046535 Bacteria 762
783 Ga0495598_0000883 3300046537 Bacteria 5790
784 Ga0495598_0041740 3300046537 Unclassified 1344
785 Ga0495609_0048775 3300046538 Unclassified 1891
786 Ga0495621_0012374 3300046539 Unclassified 2660
787 Ga0495621_0224951 3300046539 Unclassified 760
788 Ga0495645_0098729 3300046543 Bacteria 2078
789 Ga0495633_0212475 3300046558 Bacteria 886
790 Ga0495667_0428064 3300046559 Bacteria 833
791 Ga0495659_0012119 3300046664 Bacteria 2787
792 Ga0495659_0082202 3300046664 Bacteria 1224
793 Ga0495588_0011909 3300046674 Bacteria 4096
794 Ga0495623_0088628 3300046679 Bacteria 1904
795 Ga0495647_0044237 3300046681 Unclassified 1707
796 Ga0495658_0011838 3300046683 Bacteria 4400
797 Ga0495658_0267089 3300046683 Bacteria 1078
798 Ga0495658_0285096 3300046683 Bacteria 1043
799 Ga0495669_0008144 3300046684 Bacteria 4398
800 Ga0495669_0162577 3300046684 Bacteria 1060
801 Ga0495669_0366985 3300046684 Unclassified 696
802 Ga0495613_0011640 3300046689 Bacteria 6540
803 Ga0495670_0014484 3300046691 Bacteria 3877
804 Ga0495670_0021878 3300046691 Bacteria 3156
805 Ga0495670_0250721 3300046691 Bacteria 944
806 Ga0495636_0080930 3300047318 Bacteria 1398
807 Ga0495680_0535177 3300047322 Bacteria 791
808 Ga0495680_0548918 3300047322 Bacteria 779
809 Ga0495684_0236751 3300047471 Bacteria 1333
810 Ga0495684_0367643 3300047471 Bacteria 1017
811 Ga0496100_0011855 3300048903 Bacteria 4976
812 Ga0496100_0124060 3300048903 Bacteria 1811
813 Ga0496101_0001528 3300048904 Bacteria 13862
814 Ga0496101_0296538 3300048904 Unclassified 1266
815 Ga0496102_0050902 3300048905 Bacteria 3773
816 Ga0496102_0083999 3300048905 Bacteria 2938
817 Ga0496104_0005154 3300048907 Bacteria 11417
818 Ga0496104_0121931 3300048907 Bacteria 2503
819 Ga0496104_0185702 3300048907 Bacteria 1990
820 Ga0496104_0386206 3300048907 Unclassified 1312
821 Ga0496105_0083390 3300048908 Bacteria 2640
822 Ga0496105_0406557 3300048908 Bacteria 1080
823 Ga0496105_0414152 3300048908 Unclassified 1068
824 Ga0496105_0472841 3300048908 Bacteria 987
825 Ga0496106_0099859 3300048909 Bacteria 2250
826 Ga0496106_0228736 3300048909 Bacteria 1484
827 Ga0496106_0426244 3300048909 Unclassified 1066
828 Ga0496107_0173714 3300048910 Bacteria 1599
829 Ga0496107_0193143 3300048910 Bacteria 1513
830 Ga0496107_0597739 3300048910 Bacteria 816
831 Ga0496108_0091879 3300048911 Bacteria 2580
832 Ga0496108_0098365 3300048911 Bacteria 2494
833 Ga0496108_0187972 3300048911 Bacteria 1790
834 Ga0496109_0065627 3300048912 Bacteria 3323
835 Ga0496109_0128102 3300048912 Bacteria 2368
836 Ga0496110_0508917 3300048913 Bacteria 1096
837 Ga0496111_0227324 3300048914 Bacteria 1386
838 Ga0496112_0098199 3300048915 Bacteria 2898
839 Ga0496113_0027706 3300048916 Bacteria 4065
840 Ga0496113_0113376 3300048916 Unclassified 2113
841 Ga0496113_0138197 3300048916 Bacteria 1916
842 Ga0496114_0000958 3300048917 Bacteria 21594
843 Ga0496114_0037085 3300048917 Bacteria 4032
844 Ga0496114_0113300 3300048917 Unclassified 2325
845 Ga0496114_0161326 3300048917 Unclassified 1950
846 Ga0496114_0488984 3300048917 Bacteria 1089
847 Ga0496115_0407910 3300048918 Unclassified 1102
848 Ga0501298_008031 3300049521 Unclassified 1764
849 Ga0501033_0003006 3300049570 Bacteria 14080
850 Ga0501034_0106141 3300049571 Bacteria 2801
851 Ga0501036_0015274 3300049572 Bacteria 6411
852 Ga0501037_0021978 3300049573 Bacteria 4722
853 Ga0501037_0149995 3300049573 Bacteria 1666
854 Ga0501038_0017908 3300049574 Bacteria 6400
855 Ga0501039_0463637 3300049575 Bacteria 995
856 Ga0501041_0164470 3300049577 Bacteria 1387
857 Ga0501042_0053182 3300049578 Bacteria 2889
858 Ga0501042_0054092 3300049578 Bacteria 2863
859 Ga0501042_0122829 3300049578 Bacteria 1870
860 Ga0501046_0039273 3300049580 Bacteria 3791
861 Ga0501046_0134152 3300049580 Bacteria 1876
862 Ga0501047_0019837 3300049581 Bacteria 6453
863 Ga0501048_0007365 3300049582 Bacteria 8338
864 Ga0501048_0181392 3300049582 Unclassified 1492
865 Ga0501048_0187935 3300049582 Bacteria 1464
866 Ga0501067_0014178 3300049583 Bacteria 4415
867 Ga0501069_0015746 3300049585 Bacteria 4053
868 Ga0501070_0044237 3300049586 Bacteria 3705
869 Ga0501071_0018661 3300049587 Bacteria 4807
870 Ga0501071_0453718 3300049587 Bacteria 981
871 Ga0501071_0560297 3300049587 Bacteria 878
872 Ga0501072_0082267 3300049588 Bacteria 2552
873 Ga0501072_0104081 3300049588 Bacteria 2257
874 Ga0501072_0225504 3300049588 Unclassified 1493
875 Ga0501073_0031152 3300049589 Bacteria 3806
876 Ga0501074_0073307 3300049590 Bacteria 2459
877 Ga0501075_0052356 3300049591 Bacteria 3070
878 Ga0501075_0275229 3300049591 Bacteria 1283
879 Ga0501076_0034227 3300049592 Bacteria 3970
880 Ga0501076_0165628 3300049592 Bacteria 1801
881 Ga0501076_0344641 3300049592 Bacteria 1223
882 Ga0501076_1002497 3300049592 Bacteria 688
883 Ga0501077_0043205 3300049593 Bacteria 2865
884 Ga0501077_0294633 3300049593 Unclassified 1033
885 Ga0501209_107415 3300049656 Bacteria 822
886 Ga0501230_045712 3300049667 Unclassified 859
887 Ga0501079_0005417 3300049741 Bacteria 9505
888 Ga0501080_0123302 3300049742 Bacteria 2400
889 Ga0501081_0045006 3300049743 Bacteria 3031
890 Ga0501081_0145019 3300049743 Unclassified 1703
891 Ga0501083_0039072 3300049744 Bacteria 3224
892 Ga0501083_0045681 3300049744 Bacteria 2962
893 Ga0501283_004835 3300049779 Unclassified 1833
894 Ga0501035_0010650 3300049822 Bacteria 8515
895 Ga0501035_0371986 3300049822 Unclassified 1193
896 Ga0501044_0014198 3300049823 Bacteria 8602
897 nmdc:mga05p37_108391_c1 3300050507 Bacteria 3417
898 nmdc:mga05p37_108497_c1 3300050507 Unclassified 3415
899 nmdc:mga05p37_126790_c1 3300050507 Bacteria 3134
900 nmdc:mga05p37_12719_c1 3300050507 Bacteria 10060
901 nmdc:mga05p37_206143_c1 3300050507 Bacteria 2378
902 nmdc:mga05p37_255885_c1 3300050507 Bacteria 2098
903 nmdc:mga05p37_25614_c1 3300050507 Bacteria 7175
904 nmdc:mga05p37_258_c1 3300050507 Bacteria 54798
905 nmdc:mga05p37_355106_c1 3300050507 Bacteria 1725
906 nmdc:mga05p37_36123_c1 3300050507 Bacteria 5178
907 nmdc:mga05p37_362870_c1 3300050507 Bacteria 1702
908 nmdc:mga05p37_38447_c1 3300050507 Bacteria 5869
909 nmdc:mga05p37_395308_c1 3300050507 Bacteria 1616
910 nmdc:mga05p37_49095_c1 3300050507 Bacteria 5191
911 nmdc:mga05p37_491180_c1 3300050507 Unclassified 1411
912 nmdc:mga05p37_4987_c1 3300050507 Bacteria 15557
913 nmdc:mga05p37_55249_c1 3300050507 Bacteria 4885
914 nmdc:mga05p37_61464_c1 3300050507 Bacteria 4624
915 nmdc:mga09592_166143_c1 3300050508 Bacteria 1907
916 nmdc:mga09592_267041_c1 3300050508 Unclassified 1484
917 nmdc:mga09592_311162_c1 3300050508 Bacteria 1365
918 nmdc:mga09592_3354_c1 3300050508 Bacteria 12948
919 nmdc:mga09592_462671_c1 3300050508 Bacteria 1094
920 nmdc:mga09592_7887_c1 3300050508 Bacteria 8653
921 nmdc:mga09592_822_c1 3300050508 Bacteria 24008
922 nmdc:mga0qj67_23233_c1 3300050509 Bacteria 4768
923 nmdc:mga0qj67_286351_c1 3300050509 Unclassified 1335
924 nmdc:mga0qj67_524622_c1 3300050509 Unclassified 951
925 nmdc:mga0qj67_6035_c1 3300050509 Bacteria 8874
926 nmdc:mga0qj67_90229_c1 3300050509 Bacteria 2462
927 nmdc:mga06r32_149144_c1 3300050510 Bacteria 2317
928 nmdc:mga06r32_377359_c1 3300050510 Bacteria 1401
929 nmdc:mga06r32_45974_c1 3300050510 Bacteria 4164
930 nmdc:mga06r32_66982_c1 3300050510 Bacteria 3466
931 nmdc:mga06r32_88652_c1 3300050510 Bacteria 3020
932 nmdc:mga08y16_102757_c1 3300050511 Bacteria 2976
933 nmdc:mga08y16_1037917_c1 3300050511 Unclassified 798
934 nmdc:mga08y16_1191448_c1 3300050511 Unclassified 733
935 nmdc:mga08y16_126712_c1 3300050511 Bacteria 2656
936 nmdc:mga08y16_144436_c1 3300050511 Bacteria 2473
937 nmdc:mga08y16_157785_c1 3300050511 Bacteria 2358
938 nmdc:mga08y16_193743_c1 3300050511 Bacteria 2107
939 nmdc:mga08y16_209337_c1 3300050511 Bacteria 2020
940 nmdc:mga08y16_267711_c1 3300050511 Bacteria 1764
941 nmdc:mga08y16_4443_c1 3300050511 Bacteria 14660
942 nmdc:mga08y16_4580_c1 3300050511 Bacteria 14413
943 nmdc:mga0n895_104249_c1 3300050512 Bacteria 2848
944 nmdc:mga0n895_14185_c1 3300050512 Bacteria 7227
945 nmdc:mga0n895_172201_c1 3300050512 Bacteria 2197
946 nmdc:mga0n895_264060_c1 3300050512 Unclassified 1747
947 nmdc:mga0n895_361084_c1 3300050512 Bacteria 1471
948 nmdc:mga0n895_36192_c1 3300050512 Bacteria 4766
949 nmdc:mga0n895_4524_c1 3300050512 Bacteria 11440
950 nmdc:mga0n895_454075_c1 3300050512 Bacteria 1294
951 nmdc:mga0n895_46918_c1 3300050512 Bacteria 4223
952 nmdc:mga0n895_48217_c1 3300050512 Bacteria 4168
953 nmdc:mga0n895_48258_c1 3300050512 Bacteria 4167
954 nmdc:mga0n895_683896_c1 3300050512 Bacteria 1023
955 nmdc:mga0n895_903176_c1 3300050512 Bacteria 869
956 nmdc:mga0n895_92723_c1 3300050512 Bacteria 3024
957 nmdc:mga0n895_934334_c1 3300050512 Bacteria 851
958 nmdc:mga0rr50_1294_c1 3300050513 Bacteria 13637
959 nmdc:mga0rr50_201335_c1 3300050513 Bacteria 1636
960 nmdc:mga0rr50_25341_c1 3300050513 Bacteria 4122
961 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
962 nmdc:mga0rr50_348800_c1 3300050513 Bacteria 1245
963 nmdc:mga0rr50_40637_c1 3300050513 Bacteria 3383
964 nmdc:mga0rr50_433469_c1 3300050513 Bacteria 1113
965 nmdc:mga0rr50_487323_c1 3300050513 Bacteria 1047
966 nmdc:mga0rr50_56620_c1 3300050513 Bacteria 2930
967 nmdc:mga0rr50_75399_c1 3300050513 Unclassified 2585
968 nmdc:mga0rr50_80107_c1 3300050513 Bacteria 2517
969 nmdc:mga0rr50_86553_c1 3300050513 Bacteria 2431
970 nmdc:mga0rr50_942110_c1 3300050513 Unclassified 736
971 nmdc:mga08x19_18942_c1 3300050514 Bacteria 4220
972 nmdc:mga08x19_201308_c1 3300050514 Unclassified 1365
973 nmdc:mga08x19_27999_c1 3300050514 Bacteria 3527
974 nmdc:mga08x19_28672_c1 3300050514 Bacteria 3489
975 nmdc:mga08x19_350378_c1 3300050514 Bacteria 1031
976 nmdc:mga08x19_874_c1 3300050514 Bacteria 19134
977 nmdc:mga0a205_104720_c1 3300050515 Bacteria 2728
978 nmdc:mga0a205_137012_c1 3300050515 Bacteria 2349
979 nmdc:mga0a205_159814_c1 3300050515 Bacteria 2150
980 nmdc:mga0a205_26965_c1 3300050515 Bacteria 5486
981 nmdc:mga0a205_3419_c1 3300050515 Bacteria 14154
982 nmdc:mga0a205_41152_c1 3300050515 Bacteria 4450
983 nmdc:mga0a205_505480_c1 3300050515 Bacteria 1065
984 nmdc:mga0a205_517307_c1 3300050515 Bacteria 1050
985 nmdc:mga0a205_53562_c1 3300050515 Bacteria 3894
986 nmdc:mga0a205_9989_c1 3300050515 Bacteria 8710
987 Ga0495655_0013821 3300053083 Bacteria 1679
988 Ga0495619_0640311 3300053085 Bacteria 726
989 Ga0500658_0073013 3300053134 Unclassified 1452
990 Ga0500611_000717 3300053727 Bacteria 3400
991 Ga0501084_0011669 3300054114 Bacteria 7275
992 Ga0501084_0034365 3300054114 Bacteria 4240
993 Ga0590071_000032 3300059421 Bacteria 36750
994 Ga0590071_000125 3300059421 Bacteria 21355
995 Ga0590074_000020 3300059423 Bacteria 19078
996 Ga0590075_001343 3300059424 Bacteria 6186
997 Ga0590075_004073 3300059424 Bacteria 3457
998 Ga0590077_001180 3300059426 Bacteria 6355
999 Ga0590077_001941 3300059426 Bacteria 4561
1000 Ga0501082_0012722 3300060353 Bacteria 7232
1001 Ga0501082_0221317 3300060353 Bacteria 1647
1002 Ga0530510_0155068 3300061734 Bacteria 1692
1003 Ga0530510_0550840 3300061734 Bacteria 876
1004 Ga0105243_10496695
1005 ARSoilOldRDRAFT_c011613
1006 JGI24749J21850_1014012
1007 JGI25406J46586_10004384
1008 Ga0065715_10095859
1009 Ga0065715_10111447
1010 Ga0065707_10132525
1011 Ga0065707_10165573
1012 Ga0065707_10393890
1013 Ga0070658_10762480
1014 Ga0070676_10003456
1015 Ga0070676_10035152
1016 Ga0070676_10059889
1017 Ga0070676_10194541
1018 Ga0070690_100012530
1019 Ga0070690_100015824
1020 Ga0070690_100023454
1021 Ga0070690_100280232
1022 Ga0070670_100007523
1023 Ga0070670_100038125
1024 Ga0070670_100319078
1025 Ga0070670_100319150
1026 Ga0070677_10015150
1027 Ga0070677_10041065
1028 Ga0068869_100027715
1029 Ga0068869_100147512
1030 Ga0068869_100371161
1031 Ga0068869_100532332
1032 Ga0070666_10057079
1033 Ga0070666_10071281
1034 Ga0070680_100141891
1035 Ga0070680_100657655
1036 Ga0068868_100101125
1037 Ga0068868_100103775
1038 Ga0068868_100121211
1039 Ga0070689_100011320
1040 Ga0070689_100164161
1041 Ga0070689_100619713
1042 Ga0070691_10150863
1043 Ga0070687_100015058
1044 Ga0070687_100023041
1045 Ga0070687_100137391
1046 Ga0070687_100196570
1047 Ga0070661_100174269
1048 Ga0070661_100299801
1049 Ga0070661_100439859
1050 Ga0070692_10645500
1051 Ga0070668_100082872
1052 Ga0070668_100094455
1053 Ga0070668_100327918
1054 Ga0070668_100727744
1055 Ga0070669_100006919
1056 Ga0070669_100007608
1057 Ga0070669_100014142
1058 Ga0070669_100039788
1059 Ga0070669_100081299
1060 Ga0070669_100102780
1061 Ga0070669_100748875
1062 Ga0070675_100004749
1063 Ga0070675_100022248
1064 Ga0070675_100025840
1065 Ga0070675_100064504
1066 Ga0070675_100143337
1067 Ga0070675_100191297
1068 Ga0070675_100299501
1069 Ga0070675_100358774
1070 Ga0070675_101042314
1071 Ga0070671_100004673
1072 Ga0070671_100097220
1073 Ga0070671_100120451
1074 Ga0070671_100558790
1075 Ga0070674_100003008
1076 Ga0070674_100007639
1077 Ga0070674_100014968
1078 Ga0070674_100056026
1079 Ga0070674_100094656
1080 Ga0070674_100785939
1081 Ga0070673_100029829
1082 Ga0070673_100039117
1083 Ga0070673_100053840
1084 Ga0070673_100066071
1085 Ga0070673_100148846
1086 Ga0070673_100222246
1087 Ga0070673_100222711
1088 Ga0070688_100011077
1089 Ga0070688_100012397
1090 Ga0070688_100078683
1091 Ga0070688_100089728
1092 Ga0070688_100184043
1093 Ga0070688_100225902
1094 Ga0070659_100250382
1095 Ga0070659_100271540
1096 Ga0070659_100401929
1097 Ga0070667_100014960
1098 Ga0070667_100105698
1099 Ga0070667_100161538
1100 Ga0070667_101247020
1101 Ga0070709_10407025
1102 Ga0070713_100020681
1103 Ga0070701_10091233
1104 Ga0070701_10129195
1105 Ga0070701_10144663
1106 Ga0070701_10570971
1107 Ga0070705_100015088
1108 Ga0070700_100003298
1109 Ga0070700_100003654
1110 Ga0070700_100245871
1111 Ga0070694_100000569
1112 Ga0070694_100052766
1113 Ga0070694_100074412
1114 Ga0070694_100082883
1115 Ga0070694_100162749
1116 Ga0070694_100190084
1117 Ga0070694_100261875
1118 Ga0070694_100426327
1119 Ga0070708_100634488
1120 Ga0070663_100128439
1121 Ga0070678_100022377
1122 Ga0070678_100048007
1123 Ga0070662_100038957
1124 Ga0070662_100112052
1125 Ga0070662_100184523
1126 Ga0070662_100414133
1127 Ga0070662_100797122
1128 Ga0070662_101090312
1129 Ga0070681_10182649
1130 Ga0070681_10223528
1131 Ga0070681_10717096
1132 Ga0068867_100024065
1133 Ga0068867_100043000
1134 Ga0068867_100066688
1135 Ga0068867_100139749
1136 Ga0070685_10007783
1137 Ga0070685_10050926
1138 Ga0070685_10148626
1139 Ga0070685_10234893
1140 Ga0070685_10329156
1141 Ga0070706_101010689
1142 Ga0070707_100026069
1143 Ga0070707_100042034
1144 Ga0070707_100042519
1145 Ga0070707_100793022
1146 Ga0070698_100009315
1147 Ga0070698_100019156
1148 Ga0070698_100049616
1149 Ga0070698_100213917
1150 Ga0070699_100001533
1151 Ga0070699_100002754
1152 Ga0070699_100005303
1153 Ga0070699_100214657
1154 Ga0070699_100348455
1155 Ga0070699_100980496
1156 Ga0070699_101064269
1157 Ga0070679_100423924
1158 Ga0070684_100034091
1159 Ga0070697_100015498
1160 Ga0070697_100072268
1161 Ga0070697_100209021
1162 Ga0070697_100457073
1163 Ga0070697_100587727
1164 Ga0070697_101033016
1165 Ga0068853_100163620
1166 Ga0068853_100228620
1167 Ga0068853_100929037
1168 Ga0070672_100005521
1169 Ga0070672_100010601
1170 Ga0070672_100071118
1171 Ga0070686_100002220
1172 Ga0070686_100011277
1173 Ga0070686_100026131
1174 Ga0070686_100069343
1175 Ga0070695_100000124
1176 Ga0070695_100004253
1177 Ga0070695_100008618
1178 Ga0070695_100268641
1179 Ga0070695_100455751
1180 Ga0070696_100002752
1181 Ga0070696_100005583
1182 Ga0070696_100006089
1183 Ga0070696_100126355
1184 Ga0070693_100541285
1185 Ga0070665_100054908
1186 Ga0070665_100106088
1187 Ga0070665_100119989
1188 Ga0070665_100655464
1189 Ga0070704_100002921
1190 Ga0070704_100015187
1191 Ga0070704_100224216
1192 Ga0070704_100287152
1193 Ga0070704_100404078
1194 Ga0070704_100480248
1195 Ga0068855_100029695
1196 Ga0068855_100214551
1197 Ga0070664_100016061
1198 Ga0070664_100042798
1199 Ga0070664_100048888
1200 Ga0070664_100052986
1201 Ga0068857_100010357
1202 Ga0068857_100084011
1203 Ga0068857_100382866
1204 Ga0068857_100426672
1205 Ga0068857_100558708
1206 Ga0068854_100001221
1207 Ga0068856_100023149
1208 Ga0068856_100284924
1209 Ga0070702_100019533
1210 Ga0070702_100037578
1211 Ga0070702_100059174
1212 Ga0070702_100248131
1213 Ga0068852_100036790
1214 Ga0068852_101172813
1215 Ga0068859_100049771
1216 Ga0068859_100052219
1217 Ga0068859_100087172
1218 Ga0068859_100087846
1219 Ga0068859_100190420
1220 Ga0068859_100251747
1221 Ga0068859_100414039
1222 Ga0068859_100612190
1223 Ga0068859_100947900
1224 Ga0068859_101467367
1225 Ga0068864_100002418
1226 Ga0068864_100225774
1227 Ga0068864_100384805
1228 Ga0068866_10229913
1229 Ga0068866_10321987
1230 Ga0068861_100004854
1231 Ga0068861_100006617
1232 Ga0068861_100038658
1233 Ga0068861_100100611
1234 Ga0068861_100117610
1235 Ga0068861_100218387
1236 Ga0068861_100419122
1237 Ga0068861_100641944
1238 Ga0068861_100681539
1239 Ga0068870_10003815
1240 Ga0068870_10013120
1241 Ga0068870_10013632
1242 Ga0068863_100004157
1243 Ga0068863_100006788
1244 Ga0068863_100082287
1245 Ga0068863_100112993
1246 Ga0068863_100341852
1247 Ga0068863_100374047
1248 Ga0068858_100004887
1249 Ga0068858_100009751
1250 Ga0068858_100017517
1251 Ga0068858_100039247
1252 Ga0068858_100042722
1253 Ga0068858_100083089
1254 Ga0068858_100443127
1255 Ga0068858_100936088
1256 Ga0068860_100003758
1257 Ga0068860_100055797
1258 Ga0068860_100081514
1259 Ga0068860_100139427
1260 Ga0068860_100310701
1261 Ga0068860_100341357
1262 Ga0068860_100412951
1263 Ga0068860_100729428
1264 Ga0068862_100021406
1265 Ga0068862_100035244
1266 Ga0068862_100056294
1267 Ga0068862_101503313
1268 Ga0081455_10019733
1269 Ga0081538_10027347
1270 Ga0081539_10000024
1271 Ga0081539_10006511
1272 Ga0075432_10007359
1273 Ga0070716_100120815
1274 Ga0097621_100115009
1275 Ga0097621_100126120
1276 Ga0097621_100132863
1277 Ga0097621_100142093
1278 Ga0097621_100176629
1279 Ga0097621_100387123
1280 Ga0068871_100005171
1281 Ga0068871_100067472
1282 Ga0068871_100076790
1283 Ga0068871_100174440
1284 Ga0068871_100208534
1285 Ga0068871_100386496
1286 Ga0075428_100002059
1287 Ga0075428_100007575
1288 Ga0075428_100047818
1289 Ga0075428_100065340
1290 Ga0075428_100179956
1291 Ga0075428_100196758
1292 Ga0075428_100303824
1293 Ga0075428_100313810
1294 Ga0075430_100002081
1295 Ga0075430_100002965
1296 Ga0075430_100010598
1297 Ga0075430_100239441
1298 Ga0075430_100260933
1299 Ga0075430_100506617
1300 Ga0075431_100037374
1301 Ga0075431_100098362
1302 Ga0075431_100386774
1303 Ga0075433_10002979
1304 Ga0075433_10012328
1305 Ga0075433_10020979
1306 Ga0075433_10033064
1307 Ga0075433_10045182
1308 Ga0075434_100001885
1309 Ga0075434_100015367
1310 Ga0075434_100053436
1311 Ga0075434_100105900
1312 Ga0075434_100161311
1313 Ga0075434_100190725
1314 Ga0075434_100257744
1315 Ga0075434_100398585
1316 Ga0075434_100722111
1317 Ga0075434_100729634
1318 Ga0075429_100025040
1319 Ga0075429_100033174
1320 Ga0075429_100038910
1321 Ga0075429_100135462
1322 Ga0075429_100216855
1323 Ga0075429_100266450
1324 Ga0075429_100306333
1325 Ga0075429_100313267
1326 Ga0075429_100363019
1327 Ga0068865_100027783
1328 Ga0068865_100174092
1329 Ga0068865_100269669
1330 Ga0068865_100295515
1331 Ga0068865_100522645
1332 Ga0068865_100645825
1333 Ga0075436_100001894
1334 Ga0075436_100017181
1335 Ga0075436_100097399
1336 Ga0075436_100176514
1337 Ga0097620_100049772
1338 Ga0097620_100052218
1339 Ga0097620_100087167
1340 Ga0097620_100087839
1341 Ga0097620_100190408
1342 Ga0097620_100251744
1343 Ga0097620_100414051
1344 Ga0097620_100612261
1345 Ga0097620_100947836
1346 Ga0097620_101467325
1347 Ga0075435_100000059
1348 Ga0075435_100003706
1349 Ga0075435_100006273
1350 Ga0075435_100008498
1351 Ga0075435_100009328
1352 Ga0075435_100021620
1353 Ga0075435_100033289
1354 Ga0075435_100046888
1355 Ga0075435_100137921
1356 Ga0075435_100154935
1357 Ga0075435_100175624
1358 Ga0075435_100468558
1359 Ga0105240_10183434
1360 Ga0105240_10269705
1361 Ga0105240_10307762
1362 Ga0105240_10387890
1363 Ga0105240_10528461
1364 Ga0111539_10000326
1365 Ga0111539_10002569
1366 Ga0111539_10003793
1367 Ga0111539_10015587
1368 Ga0111539_10041812
1369 Ga0111539_10069299
1370 Ga0111539_10121417
1371 Ga0111539_10201596
1372 Ga0111539_10208519
1373 Ga0111539_10235167
1374 Ga0111539_10343836
1375 Ga0111539_10370869
1376 Ga0111539_10409928
1377 Ga0111539_10587288
1378 Ga0111539_10797873
1379 Ga0111539_10968187
1380 Ga0111539_11200010
1381 Ga0105245_10029287
1382 Ga0105245_10063579
1383 Ga0105245_10559907
1384 Ga0114129_10000690
1385 Ga0114129_10001192
1386 Ga0114129_10001315
1387 Ga0114129_10003812
1388 Ga0114129_10005798
1389 Ga0114129_10010157
1390 Ga0114129_10017382
1391 Ga0114129_10040277
1392 Ga0114129_10069380
1393 Ga0114129_10087948
1394 Ga0114129_10145232
1395 Ga0114129_10148674
1396 Ga0114129_10183235
1397 Ga0114129_10278744
1398 Ga0114129_10314693
1399 Ga0114129_10358589
1400 Ga0114129_10595762
1401 Ga0114129_11023675
1402 Ga0105243_10094033
1403 Ga0105243_10124010
1404 Ga0105243_10127601
1405 Ga0105243_10236405
1406 Ga0105243_10355165
1407 Ga0105243_10442763
1408 Ga0105241_10176859
1409 Ga0105242_10002104
1410 Ga0105242_10082246
1411 Ga0105242_10104808
1412 Ga0105242_10697834
1413 Ga0105248_10024718
1414 Ga0105248_10028665
1415 Ga0105248_10033372
1416 Ga0105248_10058912
1417 Ga0105248_10105896
1418 Ga0105248_10200680
1419 Ga0105248_10215175
1420 Ga0105248_10381763
1421 Ga0105248_10524495
1422 Ga0105248_10691504
1423 Ga0105238_10850920
1424 Ga0105249_10035578
1425 Ga0105249_10054172
1426 Ga0105249_10178102
1427 Ga0105249_10323483
1428 Ga0105249_10579034
1429 Ga0105249_10988758
1430 Ga0105249_11137563
1431 Ga0105246_10857000
1432 Ga0157328_1001049
1433 Ga0157369_10209103
1434 Ga0157374_10040011
1435 Ga0157374_10071398
1436 Ga0157374_11055213
1437 Ga0157378_10106459
1438 Ga0157378_10844884
1439 Ga0157378_10948834
1440 Ga0163162_10288852
1441 Ga0157372_10422103
1442 Ga0157372_11071409
1443 Ga0157375_10035690
1444 Ga0157375_10036438
1445 Ga0157375_10065572
1446 Ga0157375_10156288
1447 Ga0157375_10171380
1448 Ga0157375_10241743
1449 Ga0157375_10357024
1450 Ga0157375_10359792
1451 Ga0157375_10970469
1452 Ga0163163_10017080
1453 Ga0163163_10068279
1454 Ga0163163_10107046
1455 Ga0163163_10116686
1456 Ga0163163_10329552
1457 Ga0163163_10478598
1458 Ga0157380_10001648
1459 Ga0157380_10001840
1460 Ga0157380_10021220
1461 Ga0157380_10052912
1462 Ga0157380_10787978
1463 Ga0157380_10823141
1464 Ga0157380_11575128
1465 Ga0157377_10085625
1466 Ga0157377_10100461
1467 Ga0157377_10111535
1468 Ga0157377_10299800
1469 Ga0157379_10015605
1470 Ga0157379_10020277
1471 Ga0157379_10052086
1472 Ga0157379_10293392
1473 Ga0157379_10697735
1474 Ga0157376_10004135
1475 Ga0157376_10024862
1476 Ga0157376_10125669
1477 Ga0157376_10597175
1478 Ga0163161_10092846
1479 Ga0206356_10331988
1480 Ga0207697_10000950
1481 Ga0207697_10029465
1482 Ga0207682_10002213
1483 Ga0207682_10005844
1484 Ga0207682_10074025
1485 Ga0207642_10175920
1486 Ga0207688_10014880
1487 Ga0207688_10306581
1488 Ga0207680_10021511
1489 Ga0207680_10554670
1490 Ga0207647_10336042
1491 Ga0207685_10009396
1492 Ga0207645_10001137
1493 Ga0207645_10004630
1494 Ga0207645_10011453
1495 Ga0207645_10069832
1496 Ga0207643_10000596
1497 Ga0207643_10003169
1498 Ga0207643_10047862
1499 Ga0207643_10109177
1500 Ga0207705_10260925
1501 Ga0207684_10396282
1502 Ga0207654_10102304
1503 Ga0207707_10093895
1504 Ga0207707_10236348
1505 Ga0207707_10582430
1506 Ga0207707_10631355
1507 Ga0207695_10129290
1508 Ga0207695_10361921
1509 Ga0207695_10449414
1510 Ga0207693_10359858
1511 Ga0207660_10069907
1512 Ga0207662_10003174
1513 Ga0207662_10005833
1514 Ga0207662_10013321
1515 Ga0207662_10087348
1516 Ga0207662_10110008
1517 Ga0207649_10187342
1518 Ga0207652_10209373
1519 Ga0207652_10519247
1520 Ga0207646_10069585
1521 Ga0207646_10080478
1522 Ga0207646_10144059
1523 Ga0207646_10153248
1524 Ga0207646_10302378
1525 Ga0207681_10006546
1526 Ga0207681_10019875
1527 Ga0207681_10174841
1528 Ga0207681_10196335
1529 Ga0207681_10345075
1530 Ga0207681_10487542
1531 Ga0207650_10015570
1532 Ga0207650_10276239
1533 Ga0207650_10279177
1534 Ga0207659_10003809
1535 Ga0207659_10005813
1536 Ga0207659_10017805
1537 Ga0207659_10022077
1538 Ga0207659_10048899
1539 Ga0207659_10110190
1540 Ga0207659_10112867
1541 Ga0207659_10209829
1542 Ga0207687_10048100
1543 Ga0207687_10119764
1544 Ga0207687_10348028
1545 Ga0207687_10359453
1546 Ga0207700_10184029
1547 Ga0207644_10018710
1548 Ga0207644_10278543
1549 Ga0207644_10496703
1550 Ga0207690_10063645
1551 Ga0207706_10001590
1552 Ga0207706_10044786
1553 Ga0207706_10118323
1554 Ga0207706_10162469
1555 Ga0207706_10164240
1556 Ga0207686_10031703
1557 Ga0207686_10058711
1558 Ga0207686_10118882
1559 Ga0207686_10500755
1560 Ga0207686_10944532
1561 Ga0207709_10039603
1562 Ga0207709_10183833
1563 Ga0207670_10060063
1564 Ga0207670_10089289
1565 Ga0207670_10163310
1566 Ga0207670_10622019
1567 Ga0207670_10813055
1568 Ga0207669_10000468
1569 Ga0207669_10018812
1570 Ga0207669_10036352
1571 Ga0207669_10140118
1572 Ga0207669_10173699
1573 Ga0207704_10035209
1574 Ga0207704_10164374
1575 Ga0207704_10188731
1576 Ga0207704_10212457
1577 Ga0207704_10574666
1578 Ga0207665_10159106
1579 Ga0207691_10000690
1580 Ga0207691_10002023
1581 Ga0207691_10005794
1582 Ga0207691_10006933
1583 Ga0207691_10080397
1584 Ga0207691_10234169
1585 Ga0207711_10027718
1586 Ga0207711_10115220
1587 Ga0207711_10185217
1588 Ga0207711_10216061
1589 Ga0207711_10292038
1590 Ga0207711_10391281
1591 Ga0207711_11022726
1592 Ga0207689_10001533
1593 Ga0207689_10169045
1594 Ga0207689_10233093
1595 Ga0207689_10247201
1596 Ga0207679_10004854
1597 Ga0207679_10019831
1598 Ga0207679_10048780
1599 Ga0207679_10050101
1600 Ga0207679_10122837
1601 Ga0207679_10198948
1602 Ga0207667_10226159
1603 Ga0207667_10584377
1604 Ga0207651_10043868
1605 Ga0207651_10082834
1606 Ga0207651_10189928
1607 Ga0207651_10303907
1608 Ga0207712_10110175
1609 Ga0207712_10111503
1610 Ga0207712_10225693
1611 Ga0207712_10488166
1612 Ga0207668_10049279
1613 Ga0207668_10776572
1614 Ga0207640_10003631
1615 Ga0207640_10327061
1616 Ga0207658_10039419
1617 Ga0207658_10081972
1618 Ga0207658_10175470
1619 Ga0207658_10325921
1620 Ga0207677_10012834
1621 Ga0207677_10024246
1622 Ga0207677_10114401
1623 Ga0207677_10142339
1624 Ga0207677_10299905
1625 Ga0207703_10008230
1626 Ga0207703_10028892
1627 Ga0207639_10358983
1628 Ga0207678_10053380
1629 Ga0207708_10000978
1630 Ga0207708_10029265
1631 Ga0207708_10030671
1632 Ga0207708_10058973
1633 Ga0207708_10075362
1634 Ga0207708_10122812
1635 Ga0207708_10409391
1636 Ga0207708_10714523
1637 Ga0207702_10109656
1638 Ga0207702_10396806
1639 Ga0207641_10002783
1640 Ga0207641_10175304
1641 Ga0207641_10183531
1642 Ga0207641_10332390
1643 Ga0207641_10401264
1644 Ga0207648_10000805
1645 Ga0207648_10014999
1646 Ga0207648_10027201
1647 Ga0207648_10044014
1648 Ga0207648_10049877
1649 Ga0207648_10268863
1650 Ga0207648_10353996
1651 Ga0207648_10386271
1652 Ga0207676_10029846
1653 Ga0207676_10188741
1654 Ga0207676_10264934
1655 Ga0207676_10811015
1656 Ga0207674_10009352
1657 Ga0207674_10233292
1658 Ga0207675_100008939
1659 Ga0207675_100027357
1660 Ga0207675_100029695
1661 Ga0207675_100030928
1662 Ga0207675_100039585
1663 Ga0207675_100077599
1664 Ga0207675_100181489
1665 Ga0207675_100196249
1666 Ga0207675_100197629
1667 Ga0207675_100241170
1668 Ga0207683_10015181
1669 Ga0207683_10036793
1670 Ga0207683_10043452
1671 Ga0207683_10132968
1672 Ga0207683_10412224
1673 Ga0207683_10807588
1674 Ga0209966_1037061
1675 Ga0207428_10000089
1676 Ga0207428_10005248
1677 Ga0207428_10006276
1678 Ga0207428_10006605
1679 Ga0207428_10011850
1680 Ga0207428_10017912
1681 Ga0207428_10049237
1682 Ga0207428_10112914
1683 Ga0268266_10053548
1684 Ga0268266_10111300
1685 Ga0268266_10679558
1686 Ga0268265_10011586
1687 Ga0268265_10014767
1688 Ga0268265_10022100
1689 Ga0268265_10128550
1690 Ga0268265_10288911
1691 Ga0268265_10577709
1692 Ga0268265_10720920
1693 Ga0268265_10991641
1694 Ga0268265_11069978
1695 Ga0268264_10053947
1696 Ga0268264_10069962
1697 Ga0268264_10095497
1698 Ga0268264_10097812
1699 Ga0268264_10178004
1700 Ga0268264_10356581
1701 Ga0268264_10721106
1702 Ga0265332_10015263
1703 Ga0265331_10267381
1704 Ga0307408_100010928
1705 Ga0307408_100191432
1706 Ga0307408_100509269
1707 Ga0307408_101000922
1708 Ga0307405_10017521
1709 Ga0307405_10076292
1710 Ga0307410_10042247
1711 Ga0307406_10152392
1712 Ga0307407_10006934
1713 Ga0307412_10781508
1714 Ga0307409_100024378
1715 Ga0307409_100035869
1716 Ga0307409_100242218
1717 Ga0307409_100865873
1718 Ga0307416_100085945
1719 Ga0307416_100131998
1720 Ga0307416_100623841
1721 Ga0307416_100636564
1722 Ga0307416_101100645
1723 Ga0307411_10003293
1724 Ga0307411_10037004
1725 Ga0307411_10208472
1726 Ga0307411_10537060
1727 Ga0307415_100408823
1728 Ga0373930_0000283
1729 Ga0373950_0015049
1730 Ga0373958_0009694
1731 Ga0373929_0011638
1732 Ga0373940_0144275
1733 Ga0373940_0168659
1734 Ga0373944_0014961
1735 Ga0373951_0022058
1736 Ga0373932_0007036
1737 Ga0373932_0136002
1738 Ga0373936_0133773
1739 Ga0373939_0000434
1740 Ga0373939_0047967
1741 Ga0373939_0071219
1742 Ga0373941_0229236
1743 Ga0373954_0168984
1744 Ga0373956_0068926
1745 Ga0373956_0189356
1746 Ga0373960_0090510
1747 Ga0373943_0299599
1748 Ga0373946_0098286
1749 Ga0373961_0001638
1750 Ga0373962_0000201
1751 Ga0373931_0096016
1752 Ga0373931_0335619
1753 Ga0373927_0325313
1754 Ga0373933_0070860
1755 Ga0373937_0003967
1756 Ga0373925_0205475
1757 Ga0373925_0433419
1758 Ga0373925_0476225
1759 Ga0242420_030619
1760 Ga0436365_0739792
1761 Ga0451853_1099285
1762 Ga0439431_0127809
1763 Ga0451577_0052666
1764 Ga0451577_0084809
1765 Ga0466963_0031177
1766 Ga0453684_0563969
1767 Ga0451576_0006121
1768 Ga0451576_0015570
1769 Ga0451576_0069690
1770 Ga0451576_0095346
1771 Ga0451576_0102641
1772 Ga0451576_0242994
1773 Ga0495603_0020517
1774 Ga0495603_0134743
1775 Ga0495629_0206020
1776 Ga0495629_0315293
1777 Ga0495653_0011116
1778 Ga0495582_0144771
1779 Ga0495582_0195440
1780 Ga0495594_0010988
1781 Ga0495618_0250283
1782 Ga0495643_0008993
1783 Ga0495642_0226806
1784 Ga0495586_0348242
1785 Ga0495586_0428446
1786 Ga0495598_0000883
1787 Ga0495598_0041740
1788 Ga0495609_0048775
1789 Ga0495621_0012374
1790 Ga0495621_0224951
1791 Ga0495645_0098729
1792 Ga0495633_0212475
1793 Ga0495667_0428064
1794 Ga0495659_0012119
1795 Ga0495659_0082202
1796 Ga0495588_0011909
1797 Ga0495623_0088628
1798 Ga0495647_0044237
1799 Ga0495658_0011838
1800 Ga0495658_0267089
1801 Ga0495658_0285096
1802 Ga0495669_0008144
1803 Ga0495669_0162577
1804 Ga0495669_0366985
1805 Ga0495613_0011640
1806 Ga0495670_0014484
1807 Ga0495670_0021878
1808 Ga0495670_0250721
1809 Ga0495636_0080930
1810 Ga0495680_0535177
1811 Ga0495680_0548918
1812 Ga0495684_0236751
1813 Ga0495684_0367643
1814 Ga0496100_0011855
1815 Ga0496100_0124060
1816 Ga0496101_0001528
1817 Ga0496101_0296538
1818 Ga0496102_0050902
1819 Ga0496102_0083999
1820 Ga0496104_0005154
1821 Ga0496104_0121931
1822 Ga0496104_0185702
1823 Ga0496104_0386206
1824 Ga0496105_0083390
1825 Ga0496105_0406557
1826 Ga0496105_0414152
1827 Ga0496105_0472841
1828 Ga0496106_0099859
1829 Ga0496106_0228736
1830 Ga0496106_0426244
1831 Ga0496107_0173714
1832 Ga0496107_0193143
1833 Ga0496107_0597739
1834 Ga0496108_0091879
1835 Ga0496108_0098365
1836 Ga0496108_0187972
1837 Ga0496109_0065627
1838 Ga0496109_0128102
1839 Ga0496110_0508917
1840 Ga0496111_0227324
1841 Ga0496112_0098199
1842 Ga0496113_0027706
1843 Ga0496113_0113376
1844 Ga0496113_0138197
1845 Ga0496114_0000958
1846 Ga0496114_0037085
1847 Ga0496114_0113300
1848 Ga0496114_0161326
1849 Ga0496114_0488984
1850 Ga0496115_0407910
1851 Ga0501298_008031
1852 Ga0501033_0003006
1853 Ga0501034_0106141
1854 Ga0501036_0015274
1855 Ga0501037_0021978
1856 Ga0501037_0149995
1857 Ga0501038_0017908
1858 Ga0501039_0463637
1859 Ga0501041_0164470
1860 Ga0501042_0053182
1861 Ga0501042_0054092
1862 Ga0501042_0122829
1863 Ga0501046_0039273
1864 Ga0501046_0134152
1865 Ga0501047_0019837
1866 Ga0501048_0007365
1867 Ga0501048_0181392
1868 Ga0501048_0187935
1869 Ga0501067_0014178
1870 Ga0501069_0015746
1871 Ga0501070_0044237
1872 Ga0501071_0018661
1873 Ga0501071_0453718
1874 Ga0501071_0560297
1875 Ga0501072_0082267
1876 Ga0501072_0104081
1877 Ga0501072_0225504
1878 Ga0501073_0031152
1879 Ga0501074_0073307
1880 Ga0501075_0052356
1881 Ga0501075_0275229
1882 Ga0501076_0034227
1883 Ga0501076_0165628
1884 Ga0501076_0344641
1885 Ga0501076_1002497
1886 Ga0501077_0043205
1887 Ga0501077_0294633
1888 Ga0501209_107415
1889 Ga0501230_045712
1890 Ga0501079_0005417
1891 Ga0501080_0123302
1892 Ga0501081_0045006
1893 Ga0501081_0145019
1894 Ga0501083_0039072
1895 Ga0501083_0045681
1896 Ga0501283_004835
1897 Ga0501035_0010650
1898 Ga0501035_0371986
1899 Ga0501044_0014198
1900 nmdc:mga05p37_108391_c1
1901 nmdc:mga05p37_108497_c1
1902 nmdc:mga05p37_126790_c1
1903 nmdc:mga05p37_12719_c1
1904 nmdc:mga05p37_206143_c1
1905 nmdc:mga05p37_255885_c1
1906 nmdc:mga05p37_25614_c1
1907 nmdc:mga05p37_258_c1
1908 nmdc:mga05p37_355106_c1
1909 nmdc:mga05p37_36123_c1
1910 nmdc:mga05p37_362870_c1
1911 nmdc:mga05p37_38447_c1
1912 nmdc:mga05p37_395308_c1
1913 nmdc:mga05p37_49095_c1
1914 nmdc:mga05p37_491180_c1
1915 nmdc:mga05p37_4987_c1
1916 nmdc:mga05p37_55249_c1
1917 nmdc:mga05p37_61464_c1
1918 nmdc:mga09592_166143_c1
1919 nmdc:mga09592_267041_c1
1920 nmdc:mga09592_311162_c1
1921 nmdc:mga09592_3354_c1
1922 nmdc:mga09592_462671_c1
1923 nmdc:mga09592_7887_c1
1924 nmdc:mga09592_822_c1
1925 nmdc:mga0qj67_23233_c1
1926 nmdc:mga0qj67_286351_c1
1927 nmdc:mga0qj67_524622_c1
1928 nmdc:mga0qj67_6035_c1
1929 nmdc:mga0qj67_90229_c1
1930 nmdc:mga06r32_149144_c1
1931 nmdc:mga06r32_377359_c1
1932 nmdc:mga06r32_45974_c1
1933 nmdc:mga06r32_66982_c1
1934 nmdc:mga06r32_88652_c1
1935 nmdc:mga08y16_102757_c1
1936 nmdc:mga08y16_1037917_c1
1937 nmdc:mga08y16_1191448_c1
1938 nmdc:mga08y16_126712_c1
1939 nmdc:mga08y16_144436_c1
1940 nmdc:mga08y16_157785_c1
1941 nmdc:mga08y16_193743_c1
1942 nmdc:mga08y16_209337_c1
1943 nmdc:mga08y16_267711_c1
1944 nmdc:mga08y16_4443_c1
1945 nmdc:mga08y16_4580_c1
1946 nmdc:mga0n895_104249_c1
1947 nmdc:mga0n895_14185_c1
1948 nmdc:mga0n895_172201_c1
1949 nmdc:mga0n895_264060_c1
1950 nmdc:mga0n895_361084_c1
1951 nmdc:mga0n895_36192_c1
1952 nmdc:mga0n895_4524_c1
1953 nmdc:mga0n895_454075_c1
1954 nmdc:mga0n895_46918_c1
1955 nmdc:mga0n895_48217_c1
1956 nmdc:mga0n895_48258_c1
1957 nmdc:mga0n895_683896_c1
1958 nmdc:mga0n895_903176_c1
1959 nmdc:mga0n895_92723_c1
1960 nmdc:mga0n895_934334_c1
1961 nmdc:mga0rr50_1294_c1
1962 nmdc:mga0rr50_201335_c1
1963 nmdc:mga0rr50_25341_c1
1964 nmdc:mga0rr50_28_c1
1965 nmdc:mga0rr50_348800_c1
1966 nmdc:mga0rr50_40637_c1
1967 nmdc:mga0rr50_433469_c1
1968 nmdc:mga0rr50_487323_c1
1969 nmdc:mga0rr50_56620_c1
1970 nmdc:mga0rr50_75399_c1
1971 nmdc:mga0rr50_80107_c1
1972 nmdc:mga0rr50_86553_c1
1973 nmdc:mga0rr50_942110_c1
1974 nmdc:mga08x19_18942_c1
1975 nmdc:mga08x19_201308_c1
1976 nmdc:mga08x19_27999_c1
1977 nmdc:mga08x19_28672_c1
1978 nmdc:mga08x19_350378_c1
1979 nmdc:mga08x19_874_c1
1980 nmdc:mga0a205_104720_c1
1981 nmdc:mga0a205_137012_c1
1982 nmdc:mga0a205_159814_c1
1983 nmdc:mga0a205_26965_c1
1984 nmdc:mga0a205_3419_c1
1985 nmdc:mga0a205_41152_c1
1986 nmdc:mga0a205_505480_c1
1987 nmdc:mga0a205_517307_c1
1988 nmdc:mga0a205_53562_c1
1989 nmdc:mga0a205_9989_c1
1990 Ga0495655_0013821
1991 Ga0495619_0640311
1992 Ga0500658_0073013
1993 Ga0500611_000717
1994 Ga0501084_0011669
1995 Ga0501084_0034365
1996 Ga0590071_000032
1997 Ga0590071_000125
1998 Ga0590074_000020
1999 Ga0590075_001343
2000 Ga0590075_004073
2001 Ga0590077_001180
2002 Ga0590077_001941
2003 Ga0501082_0012722
2004 Ga0501082_0221317
2005 Ga0530510_0155068
2006 Ga0530510_0550840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

50

176

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8183 7 183
4rv4-assembly2.cif.gz_C-2 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8106 2 183
5mp7-assembly1.cif.gz_A crystal structure of phosphoribosylpyrophosphate synthetase from mycobacterium smegmatis 0.8022 70 165
3dez-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus mutans 0.7905 6 183
4rv4-assembly1.cif.gz_A 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.7872 6 183
ID Description Score Start End Superfamily
af_P87171_221_328_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8891 125 165 3.40.50.2020
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8166 125 173 3.40.50.2020
af_Q75JN8_207_322_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8155 125 173 3.40.50.2020
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8115 15 205 3.40.50.2020
3lpnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8103 70 165 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1F2SG32-F1-model_v4 Uncharacterized protein 0.9734 1 206
AF-A0A2V8GXC9-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9435 50 206
AF-A0A7Y4WT29-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9376 20 206
AF-A0A1F5NQG5-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9371 4 206
AF-A0A1F5PKU9-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9326 4 206

Map