F487774

General Info

Members Datasets Scaffolds Average Seq Length
996 344 994 159

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10292356|Ga0163163_102923563
Length 176
Sequence MRLHILAVGFGRGTLESPLSEEFLGRAAQLGKRMGFPEVVCEEIAVSKERDVRKRMADEAERLAKRVPAGAHIILLDAKGKGMTSEDFADMLGALRDAGTKDLAFVIGGPDGLAPLPGKRAGRSLAFGPQTWPHLLVRAMLSEQIYRALTILAGHPYHRGWRRRYAQSWGYSGIGD

Samples

Sample ID Description Type Environment
1 2818991467 Bosea vestrisii 3192 Isolate Unclassified
2 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
108 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
332 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
333 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
339 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
340 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
341 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.3
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 0.8
Rhizosphere 93.07
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1037014 3300001978 Bacteria 571
2 JGI25165J46597_1000047 3300003214 Bacteria 254601
3 JGI25165J46597_1000066 3300003214 Bacteria 199459
4 JGI25153J46596_10003510 3300003215 Bacteria 8751
5 rootH2_10048452 3300003320 Bacteria 17007
6 rootH1_10213236 3300003323 Bacteria 2899
7 Ga0006562J51391_1008604 3300003578 Bacteria 1760
8 Ga0070658_10004407 3300005327 Bacteria 11473
9 Ga0070658_10036793 3300005327 Bacteria 3945
10 Ga0070658_10087273 3300005327 Bacteria 2568
11 Ga0070658_10206018 3300005327 Unclassified 1661
12 Ga0070658_10298341 3300005327 Bacteria 1374
13 Ga0070658_10730507 3300005327 Bacteria 860
14 Ga0070658_10833509 3300005327 Bacteria 801
15 Ga0070683_100073837 3300005329 Bacteria 3184
16 Ga0070683_100158491 3300005329 Bacteria 2147
17 Ga0070670_100200910 3300005331 Bacteria 1732
18 Ga0070666_10000186 3300005335 Bacteria 42661
19 Ga0070666_10016173 3300005335 Bacteria 4769
20 Ga0070680_100338169 3300005336 Unclassified 1279
21 Ga0070680_100612609 3300005336 Unclassified 935
22 Ga0070682_101339295 3300005337 Unclassified 610
23 Ga0068868_100146063 3300005338 Bacteria 1945
24 Ga0068868_100149671 3300005338 Bacteria 1922
25 Ga0070660_100010072 3300005339 Bacteria 6668
26 Ga0070660_100039636 3300005339 Bacteria 3581
27 Ga0070660_100650468 3300005339 Bacteria 883
28 Ga0070689_100140372 3300005340 Bacteria 1943
29 Ga0070689_100410635 3300005340 Bacteria 1146
30 Ga0070691_10000233 3300005341 Bacteria 18941
31 Ga0070691_10000745 3300005341 Bacteria 12815
32 Ga0070691_10455750 3300005341 Bacteria 731
33 Ga0070661_100000165 3300005344 Bacteria 54127
34 Ga0070692_10319679 3300005345 Bacteria 954
35 Ga0070669_100503195 3300005353 Bacteria 1005
36 Ga0070675_100144883 3300005354 Bacteria 2033
37 Ga0070671_100025930 3300005355 Bacteria 4814
38 Ga0070671_100383808 3300005355 Bacteria 1201
39 Ga0070673_100021993 3300005364 Bacteria 4635
40 Ga0070673_101014556 3300005364 Bacteria 773
41 Ga0070659_100032854 3300005366 Bacteria 4029
42 Ga0070659_100683006 3300005366 Unclassified 887
43 Ga0070667_100035730 3300005367 Bacteria 4164
44 Ga0070667_100126325 3300005367 Bacteria 2229
45 Ga0070667_100127747 3300005367 Bacteria 2217
46 Ga0070709_10092958 3300005434 Bacteria 1993
47 Ga0070714_100077745 3300005435 Bacteria 2883
48 Ga0070714_100416058 3300005435 Bacteria 1273
49 Ga0070713_100000002 3300005436 Bacteria 245989
50 Ga0070713_100125509 3300005436 Bacteria 2257
51 Ga0070713_100354936 3300005436 Unclassified 1361
52 Ga0070713_100371466 3300005436 Bacteria 1331
53 Ga0070713_100701889 3300005436 Unclassified 966
54 Ga0070711_100162649 3300005439 Bacteria 1693
55 Ga0070711_100420447 3300005439 Bacteria 1089
56 Ga0070711_100430453 3300005439 Bacteria 1077
57 Ga0070711_101318116 3300005439 Bacteria 627
58 Ga0070700_100138904 3300005441 Bacteria 1649
59 Ga0070700_100170110 3300005441 Bacteria 1508
60 Ga0070694_100963828 3300005444 Bacteria 707
61 Ga0070663_100010410 3300005455 Bacteria 5797
62 Ga0070663_100145180 3300005455 Bacteria 1815
63 Ga0070663_100275941 3300005455 Bacteria 1338
64 Ga0070678_100008084 3300005456 Bacteria 6279
65 Ga0070678_100028781 3300005456 Bacteria 3795
66 Ga0070678_100044373 3300005456 Bacteria 3174
67 Ga0070662_100097136 3300005457 Bacteria 2223
68 Ga0070681_10000014 3300005458 Bacteria 132528
69 Ga0070681_10119942 3300005458 Bacteria 2566
70 Ga0070681_10138798 3300005458 Bacteria 2361
71 Ga0070681_10140087 3300005458 Bacteria 2349
72 Ga0070681_10464866 3300005458 Bacteria 1178
73 Ga0070681_10668315 3300005458 Unclassified 954
74 Ga0070681_10812933 3300005458 Bacteria 852
75 Ga0068867_100157813 3300005459 Bacteria 1787
76 Ga0068867_100322589 3300005459 Bacteria 1280
77 Ga0070685_10246756 3300005466 Bacteria 1181
78 Ga0070699_100478448 3300005518 Bacteria 1130
79 Ga0070699_101567409 3300005518 Bacteria 604
80 Ga0070679_100003975 3300005530 Bacteria 13615
81 Ga0070679_100036559 3300005530 Bacteria 4873
82 Ga0070679_100046782 3300005530 Bacteria 4313
83 Ga0070679_100350510 3300005530 Unclassified 1424
84 Ga0070679_100383967 3300005530 Bacteria 1351
85 Ga0070679_101858376 3300005530 Unclassified 551
86 Ga0070684_100142656 3300005535 Bacteria 2167
87 Ga0068853_100003994 3300005539 Bacteria 11341
88 Ga0068853_100211317 3300005539 Bacteria 1768
89 Ga0068853_100291717 3300005539 Bacteria 1506
90 Ga0068853_100378984 3300005539 Bacteria 1321
91 Ga0068853_101617218 3300005539 Bacteria 628
92 Ga0070672_100315352 3300005543 Bacteria 1328
93 Ga0070686_101715881 3300005544 Bacteria 533
94 Ga0070695_100002111 3300005545 Bacteria 11372
95 Ga0070695_100330101 3300005545 Bacteria 1137
96 Ga0070696_101105250 3300005546 Bacteria 666
97 Ga0070693_100220095 3300005547 Bacteria 1243
98 Ga0070665_100001530 3300005548 Bacteria 26749
99 Ga0070665_100051864 3300005548 Bacteria 4114
100 Ga0070665_100077890 3300005548 Bacteria 3321
101 Ga0070665_100111159 3300005548 Bacteria 2743
102 Ga0070665_100121214 3300005548 Bacteria 2617
103 Ga0070665_100122251 3300005548 Bacteria 2605
104 Ga0070665_100151100 3300005548 Bacteria 2325
105 Ga0070665_100633014 3300005548 Bacteria 1083
106 Ga0070665_101366927 3300005548 Unclassified 717
107 Ga0068855_100002193 3300005563 Bacteria 24145
108 Ga0068855_100048766 3300005563 Bacteria 4997
109 Ga0068855_100080088 3300005563 Bacteria 3787
110 Ga0068855_100111048 3300005563 Bacteria 3147
111 Ga0068855_100119698 3300005563 Bacteria 3014
112 Ga0068855_100169874 3300005563 Bacteria 2470
113 Ga0068855_100470750 3300005563 Bacteria 1369
114 Ga0068857_100000488 3300005577 Bacteria 28351
115 Ga0068857_100071060 3300005577 Bacteria 3101
116 Ga0068854_100110573 3300005578 Bacteria 2072
117 Ga0068854_100211766 3300005578 Bacteria 1529
118 Ga0068854_100740836 3300005578 Bacteria 852
119 Ga0068856_100000312 3300005614 Bacteria 53339
120 Ga0068856_100015005 3300005614 Bacteria 7484
121 Ga0068856_100290201 3300005614 Bacteria 1653
122 Ga0068856_100390075 3300005614 Bacteria 1412
123 Ga0070702_100978006 3300005615 Bacteria 668
124 Ga0068852_100020713 3300005616 Bacteria 5232
125 Ga0068852_100024329 3300005616 Bacteria 4893
126 Ga0068852_100399302 3300005616 Bacteria 1352
127 Ga0068852_100475000 3300005616 Bacteria 1241
128 Ga0068864_100041460 3300005618 Bacteria 3937
129 Ga0068864_100173795 3300005618 Bacteria 1966
130 Ga0068864_100700039 3300005618 Bacteria 990
131 Ga0068870_10050663 3300005840 Bacteria 2195
132 Ga0068870_10192425 3300005840 Bacteria 1232
133 Ga0068863_101378720 3300005841 Bacteria 712
134 Ga0068858_100002481 3300005842 Bacteria 18623
135 Ga0068858_100020836 3300005842 Bacteria 6127
136 Ga0068858_100034722 3300005842 Bacteria 4678
137 Ga0068858_100039125 3300005842 Bacteria 4399
138 Ga0068858_100686734 3300005842 Bacteria 996
139 Ga0068860_100045955 3300005843 Bacteria 4164
140 Ga0068862_100086116 3300005844 Bacteria 2731
141 Ga0068862_101047302 3300005844 Bacteria 809
142 Ga0068862_101159582 3300005844 Bacteria 770
143 Ga0081455_10025361 3300005937 Bacteria 5473
144 Ga0070717_10047683 3300006028 Bacteria 3511
145 Ga0070716_100432140 3300006173 Bacteria 955
146 Ga0070712_100000045 3300006175 Bacteria 66187
147 Ga0070712_100000272 3300006175 Bacteria 29104
148 Ga0070712_100099290 3300006175 Bacteria 2148
149 Ga0070712_100332087 3300006175 Bacteria 1239
150 Ga0070712_101809077 3300006175 Unclassified 535
151 Ga0075366_10589639 3300006195 Bacteria 689
152 Ga0097621_100008952 3300006237 Bacteria 7240
153 Ga0097621_100025748 3300006237 Bacteria 4606
154 Ga0097621_100083442 3300006237 Bacteria 2663
155 Ga0097621_100132495 3300006237 Bacteria 2123
156 Ga0097621_100320017 3300006237 Bacteria 1374
157 Ga0068871_100021718 3300006358 Bacteria 4939
158 Ga0068871_100054046 3300006358 Bacteria 3257
159 Ga0068871_100085337 3300006358 Bacteria 2622
160 Ga0068871_100287114 3300006358 Bacteria 1441
161 Ga0075428_101607414 3300006844 Bacteria 679
162 Ga0075434_100049585 3300006871 Bacteria 4170
163 Ga0075434_100111155 3300006871 Bacteria 2751
164 Ga0068865_100076460 3300006881 Bacteria 2390
165 Ga0068865_100406511 3300006881 Bacteria 1116
166 Ga0068865_100767937 3300006881 Bacteria 829
167 Ga0068865_101383753 3300006881 Bacteria 628
168 Ga0075436_100000098 3300006914 Bacteria 51153
169 Ga0075436_100033900 3300006914 Bacteria 3519
170 Ga0075436_101048453 3300006914 Unclassified 613
171 Ga0075435_100223570 3300007076 Bacteria 1599
172 Ga0075435_100369560 3300007076 Bacteria 1231
173 Ga0099795_10057315 3300007788 Bacteria 1436
174 Ga0105240_10003190 3300009093 Bacteria 25760
175 Ga0105240_10008350 3300009093 Bacteria 14823
176 Ga0105240_10041567 3300009093 Bacteria 5867
177 Ga0105240_10055978 3300009093 Bacteria 4936
178 Ga0105240_10097765 3300009093 Bacteria 3577
179 Ga0105240_10131371 3300009093 Bacteria 3003
180 Ga0105240_10142623 3300009093 Bacteria 2863
181 Ga0105240_10179371 3300009093 Bacteria 2501
182 Ga0105240_10206041 3300009093 Bacteria 2302
183 Ga0105240_10453700 3300009093 Bacteria 1434
184 Ga0105240_10465984 3300009093 Bacteria 1411
185 Ga0105240_10722596 3300009093 Bacteria 1085
186 Ga0105240_10811292 3300009093 Bacteria 1013
187 Ga0105240_10902905 3300009093 Unclassified 950
188 Ga0105240_11255268 3300009093 Bacteria 783
189 Ga0105240_11289482 3300009093 Unclassified 771
190 Ga0111539_10017891 3300009094 Bacteria 8778
191 Ga0105245_10003180 3300009098 Bacteria 14678
192 Ga0105245_10150733 3300009098 Bacteria 2199
193 Ga0105245_10502347 3300009098 Bacteria 1229
194 Ga0105245_11368090 3300009098 Bacteria 758
195 Ga0105245_11401351 3300009098 Unclassified 749
196 Ga0105243_10001197 3300009148 Bacteria 23346
197 Ga0105243_10197578 3300009148 Bacteria 1762
198 Ga0105241_10021411 3300009174 Bacteria 4778
199 Ga0105241_10023341 3300009174 Bacteria 4586
200 Ga0105241_10032104 3300009174 Bacteria 3934
201 Ga0105241_10037543 3300009174 Bacteria 3650
202 Ga0105241_10083024 3300009174 Bacteria 2513
203 Ga0105241_10092007 3300009174 Bacteria 2394
204 Ga0105241_10897980 3300009174 Bacteria 823
205 Ga0105241_11032134 3300009174 Unclassified 771
206 Ga0105242_10100872 3300009176 Bacteria 2446
207 Ga0105242_10209808 3300009176 Bacteria 1735
208 Ga0105242_10237858 3300009176 Bacteria 1636
209 Ga0105242_10332987 3300009176 Bacteria 1396
210 Ga0105242_10458515 3300009176 Bacteria 1203
211 Ga0105242_10487470 3300009176 Bacteria 1170
212 Ga0105248_10000001 3300009177 Bacteria 1881304
213 Ga0105248_10046527 3300009177 Bacteria 4863
214 Ga0105248_10167437 3300009177 Bacteria 2477
215 Ga0105237_10001328 3300009545 Bacteria 32811
216 Ga0105237_10017408 3300009545 Bacteria 7450
217 Ga0105237_10119270 3300009545 Bacteria 2632
218 Ga0105237_10124628 3300009545 Bacteria 2571
219 Ga0105237_10152508 3300009545 Bacteria 2307
220 Ga0105237_10456066 3300009545 Bacteria 1284
221 Ga0105237_10479450 3300009545 Bacteria 1250
222 Ga0105237_10958028 3300009545 Bacteria 863
223 Ga0105238_10001442 3300009551 Bacteria 23898
224 Ga0105238_10007214 3300009551 Bacteria 11124
225 Ga0105238_10029405 3300009551 Bacteria 5597
226 Ga0105238_10041074 3300009551 Bacteria 4686
227 Ga0105238_10084835 3300009551 Bacteria 3156
228 Ga0105238_10108063 3300009551 Bacteria 2763
229 Ga0105238_10109825 3300009551 Bacteria 2739
230 Ga0105238_10159880 3300009551 Bacteria 2228
231 Ga0105238_10194969 3300009551 Bacteria 2001
232 Ga0105238_10220135 3300009551 Unclassified 1874
233 Ga0105238_10346649 3300009551 Bacteria 1474
234 Ga0105238_10364576 3300009551 Bacteria 1435
235 Ga0105238_10449216 3300009551 Bacteria 1286
236 Ga0105238_10697084 3300009551 Bacteria 1027
237 Ga0105238_10918751 3300009551 Bacteria 894
238 Ga0105238_11159832 3300009551 Unclassified 796
239 Ga0105238_11537992 3300009551 Bacteria 694
240 Ga0105249_10447220 3300009553 Bacteria 1330
241 Ga0105249_10591650 3300009553 Bacteria 1163
242 Ga0105239_10000733 3300010375 Bacteria 46597
243 Ga0105239_10013335 3300010375 Bacteria 9132
244 Ga0105239_10155260 3300010375 Bacteria 2556
245 Ga0105239_10196315 3300010375 Bacteria 2260
246 Ga0105239_10234079 3300010375 Bacteria 2061
247 Ga0105239_10240178 3300010375 Bacteria 2033
248 Ga0105239_10249633 3300010375 Bacteria 1993
249 Ga0105239_10380124 3300010375 Bacteria 1596
250 Ga0105239_10435526 3300010375 Bacteria 1486
251 Ga0105239_10652841 3300010375 Bacteria 1202
252 Ga0105239_11448524 3300010375 Bacteria 793
253 Ga0105239_11741428 3300010375 Bacteria 722
254 Ga0105239_12822588 3300010375 Unclassified 567
255 Ga0105246_10038893 3300011119 Bacteria 3201
256 Ga0105246_10240577 3300011119 Bacteria 1430
257 Ga0105246_10870075 3300011119 Bacteria 806
258 Ga0157373_10022768 3300013100 Bacteria 4544
259 Ga0157373_10077361 3300013100 Bacteria 2347
260 Ga0157373_10176511 3300013100 Bacteria 1504
261 Ga0157370_10007427 3300013104 Bacteria 11928
262 Ga0157370_10015393 3300013104 Bacteria 7774
263 Ga0157370_10103482 3300013104 Bacteria 2665
264 Ga0157370_10140928 3300013104 Bacteria 2246
265 Ga0157370_10504837 3300013104 Bacteria 1110
266 Ga0157369_10046281 3300013105 Bacteria 4728
267 Ga0157369_10078713 3300013105 Bacteria 3531
268 Ga0157369_10145336 3300013105 Bacteria 2508
269 Ga0157369_10269239 3300013105 Bacteria 1776
270 Ga0157369_10479685 3300013105 Bacteria 1287
271 Ga0157369_10682016 3300013105 Bacteria 1059
272 Ga0157369_11415477 3300013105 Unclassified 708
273 Ga0157374_10186664 3300013296 Bacteria 2027
274 Ga0157374_10257347 3300013296 Bacteria 1719
275 Ga0157374_11136986 3300013296 Bacteria 802
276 Ga0157378_10027790 3300013297 Bacteria 4990
277 Ga0157378_10153330 3300013297 Bacteria 2148
278 Ga0157378_12083891 3300013297 Unclassified 618
279 Ga0163162_10070776 3300013306 Bacteria 3539
280 Ga0163162_10075656 3300013306 Bacteria 3427
281 Ga0163162_10102916 3300013306 Bacteria 2949
282 Ga0163162_10177304 3300013306 Bacteria 2257
283 Ga0157372_10010958 3300013307 Bacteria 9649
284 Ga0157372_10016824 3300013307 Bacteria 7850
285 Ga0157372_10020242 3300013307 Bacteria 7176
286 Ga0157372_10368401 3300013307 Bacteria 1674
287 Ga0157375_10058531 3300013308 Bacteria 3813
288 Ga0157375_10119739 3300013308 Bacteria 2740
289 Ga0163163_10006118 3300014325 Bacteria 10480
290 Ga0163163_10097247 3300014325 Bacteria 2964
291 Ga0163163_10103553 3300014325 Bacteria 2871
292 Ga0163163_10292356 3300014325 Bacteria 1681
293 Ga0163163_10510237 3300014325 Bacteria 1264
294 Ga0157380_10608657 3300014326 Bacteria 1082
295 Ga0182008_10155742 3300014497 Bacteria 1147
296 Ga0182008_10458552 3300014497 Bacteria 694
297 Ga0157377_10268231 3300014745 Bacteria 1114
298 Ga0157379_10005723 3300014968 Bacteria 10691
299 Ga0157379_10010207 3300014968 Bacteria 8182
300 Ga0157379_10013038 3300014968 Bacteria 7278
301 Ga0157379_10023301 3300014968 Bacteria 5492
302 Ga0157379_10056367 3300014968 Bacteria 3512
303 Ga0157379_10063538 3300014968 Bacteria 3300
304 Ga0157379_10288473 3300014968 Bacteria 1494
305 Ga0157379_11036755 3300014968 Bacteria 783
306 Ga0157376_10282182 3300014969 Bacteria 1565
307 Ga0157376_10663790 3300014969 Bacteria 1044
308 Ga0157376_12630317 3300014969 Bacteria 543
309 Ga0182007_10032517 3300015262 Bacteria 1771
310 Ga0182005_1006445 3300015265 Bacteria 3587
311 Ga0163161_10084162 3300017792 Bacteria 2345
312 Ga0213873_10069974 3300021358 Unclassified 965
313 Ga0213876_10000388 3300021384 Bacteria 36939
314 Ga0213876_10000483 3300021384 Bacteria 31487
315 Ga0213876_10061775 3300021384 Unclassified 1977
316 Ga0213875_10339657 3300021388 Unclassified 713
317 Ga0213871_10006451 3300021441 Bacteria 2481
318 Ga0224572_1005619 3300024225 Bacteria 2242
319 Ga0228598_1032500 3300024227 Bacteria 1028
320 Ga0228598_1048399 3300024227 Bacteria 842
321 Ga0209233_1000045 3300025261 Bacteria 473379
322 Ga0209233_1004631 3300025261 Bacteria 4649
323 Ga0209758_1000008 3300025297 Bacteria 1215263
324 Ga0207426_1037572 3300025302 Bacteria 1530
325 Ga0207642_10508668 3300025899 Bacteria 738
326 Ga0207688_10116409 3300025901 Bacteria 1556
327 Ga0207680_10002065 3300025903 Bacteria 9407
328 Ga0207647_10083618 3300025904 Bacteria 1911
329 Ga0207647_10253713 3300025904 Bacteria 1008
330 Ga0207699_10000133 3300025906 Bacteria 50958
331 Ga0207699_10083145 3300025906 Bacteria 1991
332 Ga0207643_10045800 3300025908 Bacteria 2471
333 Ga0207705_10000058 3300025909 Bacteria 155967
334 Ga0207705_10009572 3300025909 Bacteria 7049
335 Ga0207705_10063229 3300025909 Bacteria 2674
336 Ga0207705_10198421 3300025909 Bacteria 1520
337 Ga0207654_10026187 3300025911 Bacteria 3155
338 Ga0207654_10030302 3300025911 Bacteria 2969
339 Ga0207654_10279994 3300025911 Bacteria 1128
340 Ga0207654_10392884 3300025911 Bacteria 963
341 Ga0207654_10625563 3300025911 Unclassified 769
342 Ga0207707_10000001 3300025912 Bacteria 1212482
343 Ga0207707_10001851 3300025912 Bacteria 19343
344 Ga0207707_10052643 3300025912 Bacteria 3544
345 Ga0207707_10076001 3300025912 Bacteria 2931
346 Ga0207707_10089456 3300025912 Bacteria 2691
347 Ga0207707_10201843 3300025912 Bacteria 1734
348 Ga0207695_10000004 3300025913 Bacteria 1288665
349 Ga0207695_10009649 3300025913 Bacteria 11901
350 Ga0207695_10025972 3300025913 Bacteria 6545
351 Ga0207695_10185467 3300025913 Bacteria 2000
352 Ga0207695_10265172 3300025913 Bacteria 1614
353 Ga0207695_10300514 3300025913 Bacteria 1496
354 Ga0207695_10318130 3300025913 Bacteria 1446
355 Ga0207695_10510702 3300025913 Bacteria 1084
356 Ga0207695_11373346 3300025913 Bacteria 587
357 Ga0207671_10008524 3300025914 Bacteria 8680
358 Ga0207671_10039659 3300025914 Bacteria 3487
359 Ga0207671_10124152 3300025914 Bacteria 1976
360 Ga0207671_10266508 3300025914 Bacteria 1349
361 Ga0207693_10000035 3300025915 Bacteria 110713
362 Ga0207693_10000145 3300025915 Bacteria 65383
363 Ga0207693_10345818 3300025915 Unclassified 1164
364 Ga0207693_10664415 3300025915 Bacteria 809
365 Ga0207693_11044357 3300025915 Unclassified 622
366 Ga0207663_10132565 3300025916 Bacteria 1724
367 Ga0207663_10409148 3300025916 Bacteria 1039
368 Ga0207663_10444347 3300025916 Bacteria 999
369 Ga0207663_10529375 3300025916 Bacteria 919
370 Ga0207660_10000343 3300025917 Bacteria 30105
371 Ga0207660_10005636 3300025917 Bacteria 8130
372 Ga0207660_10260396 3300025917 Unclassified 1371
373 Ga0207657_10001163 3300025919 Bacteria 27950
374 Ga0207657_10031643 3300025919 Bacteria 4788
375 Ga0207657_10255897 3300025919 Bacteria 1394
376 Ga0207657_10339033 3300025919 Bacteria 1187
377 Ga0207649_10000713 3300025920 Bacteria 21869
378 Ga0207649_10045683 3300025920 Bacteria 2686
379 Ga0207652_10001515 3300025921 Bacteria 20513
380 Ga0207652_10001611 3300025921 Bacteria 19837
381 Ga0207652_10037141 3300025921 Bacteria 4122
382 Ga0207652_10226186 3300025921 Bacteria 1686
383 Ga0207681_10326529 3300025923 Bacteria 1222
384 Ga0207694_10000010 3300025924 Bacteria 439722
385 Ga0207694_10019979 3300025924 Bacteria 5067
386 Ga0207694_10031229 3300025924 Bacteria 4067
387 Ga0207694_10125538 3300025924 Bacteria 2052
388 Ga0207694_10164227 3300025924 Bacteria 1795
389 Ga0207694_10174989 3300025924 Bacteria 1739
390 Ga0207694_10307457 3300025924 Bacteria 1306
391 Ga0207694_10479462 3300025924 Bacteria 1040
392 Ga0207694_10578392 3300025924 Bacteria 944
393 Ga0207694_10824958 3300025924 Bacteria 783
394 Ga0207694_10893792 3300025924 Bacteria 751
395 Ga0207650_10078032 3300025925 Bacteria 2505
396 Ga0207650_10106481 3300025925 Bacteria 2166
397 Ga0207659_10114725 3300025926 Bacteria 2054
398 Ga0207687_10006441 3300025927 Bacteria 7754
399 Ga0207687_10041918 3300025927 Bacteria 3146
400 Ga0207700_10000887 3300025928 Bacteria 17225
401 Ga0207700_10073149 3300025928 Bacteria 2646
402 Ga0207700_10270732 3300025928 Bacteria 1458
403 Ga0207664_10034382 3300025929 Bacteria 3904
404 Ga0207664_10974179 3300025929 Bacteria 760
405 Ga0207644_10110370 3300025931 Bacteria 2079
406 Ga0207644_10148518 3300025931 Bacteria 1812
407 Ga0207690_10176985 3300025932 Bacteria 1603
408 Ga0207690_10650126 3300025932 Bacteria 864
409 Ga0207686_10069968 3300025934 Bacteria 2253
410 Ga0207686_10072192 3300025934 Bacteria 2223
411 Ga0207686_10228583 3300025934 Bacteria 1347
412 Ga0207686_10297675 3300025934 Bacteria 1197
413 Ga0207709_10069009 3300025935 Bacteria 2236
414 Ga0207709_10145616 3300025935 Bacteria 1634
415 Ga0207670_10884461 3300025936 Bacteria 747
416 Ga0207665_10399728 3300025939 Bacteria 1046
417 Ga0207691_10255183 3300025940 Bacteria 1513
418 Ga0207691_10322190 3300025940 Bacteria 1325
419 Ga0207711_10000001 3300025941 Bacteria 1325674
420 Ga0207711_10103045 3300025941 Bacteria 2527
421 Ga0207711_10157015 3300025941 Bacteria 2056
422 Ga0207711_11854189 3300025941 Bacteria 546
423 Ga0207661_10245798 3300025944 Bacteria 1589
424 Ga0207661_10743783 3300025944 Unclassified 902
425 Ga0207661_11126067 3300025944 Bacteria 723
426 Ga0207679_10693291 3300025945 Bacteria 924
427 Ga0207667_10000116 3300025949 Bacteria 128218
428 Ga0207667_10010486 3300025949 Bacteria 10832
429 Ga0207667_10051617 3300025949 Bacteria 4334
430 Ga0207667_10054170 3300025949 Bacteria 4219
431 Ga0207667_10280258 3300025949 Bacteria 1703
432 Ga0207667_10415966 3300025949 Bacteria 1368
433 Ga0207651_10060661 3300025960 Bacteria 2627
434 Ga0207712_10175517 3300025961 Bacteria 1679
435 Ga0207712_11345309 3300025961 Unclassified 639
436 Ga0207640_10181371 3300025981 Bacteria 1579
437 Ga0207640_11099119 3300025981 Unclassified 703
438 Ga0207658_10072101 3300025986 Bacteria 2617
439 Ga0207658_10153914 3300025986 Bacteria 1877
440 Ga0207658_10838691 3300025986 Bacteria 835
441 Ga0207677_10362415 3300026023 Unclassified 1218
442 Ga0207677_10402358 3300026023 Bacteria 1161
443 Ga0207703_10007826 3300026035 Bacteria 8451
444 Ga0207703_10024046 3300026035 Bacteria 4794
445 Ga0207703_10028607 3300026035 Bacteria 4395
446 Ga0207703_10033739 3300026035 Bacteria 4060
447 Ga0207639_10070415 3300026041 Bacteria 2732
448 Ga0207639_10094996 3300026041 Bacteria 2395
449 Ga0207639_10354036 3300026041 Bacteria 1312
450 Ga0207639_10598537 3300026041 Bacteria 1016
451 Ga0207639_10761296 3300026041 Bacteria 901
452 Ga0207639_10993129 3300026041 Bacteria 786
453 Ga0207678_10024654 3300026067 Bacteria 5254
454 Ga0207678_10425809 3300026067 Bacteria 1151
455 Ga0207702_10000007 3300026078 Bacteria 332551
456 Ga0207702_10000012 3300026078 Bacteria 269770
457 Ga0207702_10019910 3300026078 Bacteria 5558
458 Ga0207702_10045111 3300026078 Bacteria 3709
459 Ga0207702_10062926 3300026078 Bacteria 3171
460 Ga0207702_10516094 3300026078 Viruses 1166
461 Ga0207702_10857662 3300026078 Unclassified 899
462 Ga0207648_10022114 3300026089 Bacteria 5713
463 Ga0207648_10808173 3300026089 Bacteria 873
464 Ga0207648_11565818 3300026089 Bacteria 619
465 Ga0207676_10032252 3300026095 Bacteria 3946
466 Ga0207676_10803188 3300026095 Bacteria 918
467 Ga0207674_10000107 3300026116 Bacteria 95635
468 Ga0207674_10094261 3300026116 Bacteria 2980
469 Ga0207674_10136288 3300026116 Bacteria 2417
470 Ga0207674_10405724 3300026116 Bacteria 1317
471 Ga0207674_10660046 3300026116 Bacteria 1010
472 Ga0207675_100115394 3300026118 Bacteria 2537
473 Ga0207675_100955280 3300026118 Unclassified 875
474 Ga0207683_10015302 3300026121 Bacteria 6531
475 Ga0207683_10062021 3300026121 Bacteria 3292
476 Ga0207683_10145708 3300026121 Bacteria 2135
477 Ga0207698_10002022 3300026142 Bacteria 11968
478 Ga0207698_10050270 3300026142 Bacteria 3179
479 Ga0207698_10206682 3300026142 Bacteria 1763
480 Ga0207698_10240572 3300026142 Bacteria 1649
481 Ga0207428_10200811 3300027907 Bacteria 1500
482 Ga0268266_10000357 3300028379 Bacteria 70858
483 Ga0268266_10015674 3300028379 Bacteria 6493
484 Ga0268266_10017377 3300028379 Bacteria 6137
485 Ga0268266_10033283 3300028379 Bacteria 4382
486 Ga0268266_10282334 3300028379 Bacteria 1544
487 Ga0268266_10311014 3300028379 Bacteria 1472
488 Ga0268266_10495887 3300028379 Bacteria 1165
489 Ga0268266_10507701 3300028379 Bacteria 1152
490 Ga0268266_10617939 3300028379 Bacteria 1041
491 Ga0268264_10094282 3300028381 Bacteria 2587
492 Ga0268264_10146423 3300028381 Bacteria 2112
493 Ga0268264_10621808 3300028381 Bacteria 1066
494 Ga0265318_10000082 3300028577 Bacteria 85943
495 Ga0307517_10137249 3300028786 Bacteria 1734
496 Ga0265338_10000006 3300028800 Bacteria 570804
497 Ga0265338_10001374 3300028800 Bacteria 39593
498 Ga0265338_10032945 3300028800 Bacteria 5042
499 Ga0265338_10039132 3300028800 Bacteria 4480
500 Ga0265338_10067710 3300028800 Bacteria 3082
501 Ga0265338_10160012 3300028800 Bacteria 1740
502 Ga0265338_10172698 3300028800 Bacteria 1656
503 Ga0265338_10258806 3300028800 Bacteria 1280
504 Ga0265338_10538297 3300028800 Bacteria 819
505 Ga0265762_1022919 3300030760 Bacteria 1156
506 Ga0265760_10065112 3300031090 Bacteria 1112
507 Ga0265330_10017766 3300031235 Bacteria 3273
508 Ga0265330_10020152 3300031235 Bacteria 3049
509 Ga0265330_10117172 3300031235 Bacteria 1136
510 Ga0265330_10126415 3300031235 Bacteria 1088
511 Ga0265330_10264748 3300031235 Bacteria 724
512 Ga0265332_10011438 3300031238 Bacteria 3947
513 Ga0265332_10045629 3300031238 Bacteria 1888
514 Ga0265332_10229408 3300031238 Bacteria 769
515 Ga0265328_10000123 3300031239 Bacteria 37155
516 Ga0265328_10077249 3300031239 Bacteria 1226
517 Ga0265320_10000039 3300031240 Bacteria 134478
518 Ga0265320_10087964 3300031240 Bacteria 1442
519 Ga0265320_10133739 3300031240 Bacteria 1126
520 Ga0265320_10218157 3300031240 Unclassified 850
521 Ga0265325_10000007 3300031241 Bacteria 208874
522 Ga0265325_10000079 3300031241 Bacteria 67833
523 Ga0265325_10000719 3300031241 Bacteria 23911
524 Ga0265325_10000967 3300031241 Bacteria 20649
525 Ga0265325_10001558 3300031241 Bacteria 15979
526 Ga0265325_10011992 3300031241 Bacteria 4966
527 Ga0265325_10039095 3300031241 Bacteria 2500
528 Ga0265325_10076961 3300031241 Bacteria 1664
529 Ga0265340_10000096 3300031247 Bacteria 41553
530 Ga0265340_10012732 3300031247 Bacteria 4441
531 Ga0265340_10040690 3300031247 Bacteria 2288
532 Ga0265340_10120477 3300031247 Bacteria 1207
533 Ga0265340_10230810 3300031247 Unclassified 827
534 Ga0265340_10287215 3300031247 Bacteria 730
535 Ga0265339_10001422 3300031249 Bacteria 17761
536 Ga0265339_10009647 3300031249 Bacteria 6044
537 Ga0265339_10010793 3300031249 Bacteria 5654
538 Ga0265339_10024789 3300031249 Bacteria 3451
539 Ga0265339_10033205 3300031249 Bacteria 2907
540 Ga0265339_10044716 3300031249 Bacteria 2441
541 Ga0265339_10133225 3300031249 Bacteria 1269
542 Ga0265339_10168870 3300031249 Unclassified 1096
543 Ga0265331_10000009 3300031250 Bacteria 314950
544 Ga0265331_10000026 3300031250 Bacteria 223760
545 Ga0265331_10000212 3300031250 Bacteria 70202
546 Ga0265331_10004939 3300031250 Bacteria 8190
547 Ga0265331_10007849 3300031250 Bacteria 6119
548 Ga0265331_10033930 3300031250 Bacteria 2520
549 Ga0265331_10035419 3300031250 Bacteria 2456
550 Ga0265331_10059058 3300031250 Bacteria 1814
551 Ga0265331_10095890 3300031250 Bacteria 1368
552 Ga0265327_10000007 3300031251 Bacteria 678515
553 Ga0265327_10270709 3300031251 Bacteria 752
554 Ga0265316_10000936 3300031344 Bacteria 31773
555 Ga0265316_10008650 3300031344 Bacteria 9424
556 Ga0265316_10022243 3300031344 Bacteria 5353
557 Ga0265316_10030437 3300031344 Bacteria 4424
558 Ga0265316_10142806 3300031344 Bacteria 1797
559 Ga0265316_10170606 3300031344 Bacteria 1623
560 Ga0265316_10173197 3300031344 Bacteria 1609
561 Ga0265316_10223662 3300031344 Bacteria 1388
562 Ga0265316_10223981 3300031344 Bacteria 1387
563 Ga0265316_10296269 3300031344 Bacteria 1179
564 Ga0265316_10395879 3300031344 Bacteria 995
565 Ga0265316_10546327 3300031344 Bacteria 825
566 Ga0265316_10598323 3300031344 Unclassified 782
567 Ga0265316_10835927 3300031344 Bacteria 645
568 Ga0307513_10285806 3300031456 Bacteria 1424
569 Ga0265313_10001902 3300031595 Bacteria 18946
570 Ga0265313_10003138 3300031595 Bacteria 13641
571 Ga0265313_10005466 3300031595 Bacteria 9337
572 Ga0265313_10022563 3300031595 Bacteria 3411
573 Ga0265313_10072246 3300031595 Bacteria 1586
574 Ga0265313_10133665 3300031595 Bacteria 1072
575 Ga0265313_10143935 3300031595 Bacteria 1023
576 Ga0265313_10280843 3300031595 Unclassified 673
577 Ga0265314_10003096 3300031711 Bacteria 16371
578 Ga0265314_10007438 3300031711 Bacteria 9501
579 Ga0265314_10010041 3300031711 Bacteria 7935
580 Ga0265314_10021019 3300031711 Bacteria 5030
581 Ga0265314_10049633 3300031711 Bacteria 2936
582 Ga0265314_10067096 3300031711 Bacteria 2418
583 Ga0265314_10075023 3300031711 Bacteria 2251
584 Ga0265314_10090308 3300031711 Bacteria 1996
585 Ga0265314_10126574 3300031711 Bacteria 1599
586 Ga0265314_10132386 3300031711 Bacteria 1553
587 Ga0265314_10145242 3300031711 Bacteria 1462
588 Ga0265314_10150855 3300031711 Bacteria 1425
589 Ga0265314_10297721 3300031711 Bacteria 906
590 Ga0265314_10359740 3300031711 Bacteria 798
591 Ga0265342_10015572 3300031712 Bacteria 4998
592 Ga0265342_10022757 3300031712 Bacteria 3979
593 Ga0265342_10030960 3300031712 Bacteria 3312
594 Ga0265342_10044100 3300031712 Bacteria 2690
595 Ga0265342_10060617 3300031712 Bacteria 2231
596 Ga0265342_10099607 3300031712 Bacteria 1657
597 Ga0307516_10007154 3300031730 Bacteria 12884
598 Ga0307516_10007941 3300031730 Bacteria 12080
599 Ga0307406_10098051 3300031901 Bacteria 1989
600 Ga0373926_0061795 3300035083 Bacteria 1367
601 Ga0373929_0229211 3300035085 Unclassified 531
602 Ga0373944_0017334 3300035089 Bacteria 2043
603 Ga0373944_0194262 3300035089 Unclassified 733
604 Ga0373952_0031461 3300035092 Bacteria 1180
605 Ga0373923_0012135 3300035111 Bacteria 3177
606 Ga0373923_0054576 3300035111 Bacteria 1682
607 Ga0373923_0126678 3300035111 Bacteria 1145
608 Ga0373945_0067629 3300035116 Bacteria 1345
609 Ga0373945_0144424 3300035116 Bacteria 961
610 Ga0373953_0050352 3300035117 Bacteria 1682
611 Ga0373953_0241486 3300035117 Bacteria 784
612 Ga0373954_0065479 3300035118 Bacteria 1720
613 Ga0373954_0066270 3300035118 Bacteria 1710
614 Ga0373954_0136386 3300035118 Bacteria 1196
615 Ga0373956_0023081 3300035119 Bacteria 2667
616 Ga0373956_0065371 3300035119 Bacteria 1652
617 Ga0373956_0180208 3300035119 Bacteria 999
618 Ga0373957_0043071 3300035120 Bacteria 1705
619 Ga0373943_0021651 3300035170 Bacteria 2970
620 Ga0373943_0390685 3300035170 Bacteria 802
621 Ga0373955_0032059 3300035172 Bacteria 2755
622 Ga0373955_0043618 3300035172 Bacteria 2413
623 Ga0373955_0051751 3300035172 Bacteria 2238
624 Ga0373924_0179037 3300035410 Bacteria 933
625 Ga0373931_0029941 3300035691 Bacteria 2799
626 Ga0373931_0633688 3300035691 Bacteria 701
627 Ga0373935_0447515 3300035692 Bacteria 933
628 Ga0373927_0528139 3300035695 Unclassified 780
629 Ga0373933_0025178 3300035724 Bacteria 3411
630 Ga0373933_0034446 3300035724 Bacteria 2951
631 Ga0373933_0075443 3300035724 Bacteria 2058
632 Ga0373933_0233500 3300035724 Bacteria 1182
633 Ga0373933_0821321 3300035724 Unclassified 612
634 Ga0373947_0011553 3300035725 Bacteria 5064
635 Ga0373937_0009750 3300036401 Bacteria 8372
636 Ga0373937_0010384 3300036401 Bacteria 8132
637 Ga0373937_0060950 3300036401 Bacteria 3468
638 Ga0373937_0071295 3300036401 Bacteria 3204
639 Ga0373937_0789074 3300036401 Bacteria 897
640 Ga0373937_0825298 3300036401 Bacteria 875
641 Ga0373937_1340931 3300036401 Bacteria 663
642 Ga0373937_2067487 3300036401 Unclassified 516
643 Ga0373925_0031160 3300037068 Bacteria 3917
644 Ga0373925_0044126 3300037068 Bacteria 3310
645 Ga0373925_0054428 3300037068 Bacteria 2993
646 Ga0373925_0213161 3300037068 Bacteria 1539
647 Ga0373925_0236591 3300037068 Bacteria 1462
648 Ga0373925_0473851 3300037068 Bacteria 1026
649 Ga0373925_0740031 3300037068 Unclassified 811
650 Ga0373925_1459805 3300037068 Unclassified 560
651 Ga0395899_0060219 3300037312 Bacteria 2797
652 Ga0395900_0053179 3300037418 Bacteria 4168
653 Ga0395900_0656383 3300037418 Bacteria 985
654 Ga0395898_0008535 3300037466 Bacteria 10824
655 Ga0395898_0818680 3300037466 Bacteria 871
656 Ga0395905_0953991 3300037471 Bacteria 761
657 Ga0436364_0045683 3300037853 Bacteria 650
658 Ga0436364_0630355 3300037853 Bacteria 2053
659 Ga0436364_1385246 3300037853 Unclassified 1149
660 Ga0395901_0062777 3300038443 Bacteria 3866
661 Ga0395901_0448753 3300038443 Bacteria 1319
662 Ga0436365_0151405 3300039437 Bacteria 11975
663 Ga0436365_0412683 3300039437 Bacteria 137628
664 Ga0436365_0550500 3300039437 Bacteria 3716
665 Ga0436365_0678770 3300039437 Bacteria 2534
666 Ga0436365_0991473 3300039437 Bacteria 77252
667 Ga0436365_1551085 3300039437 Unclassified 758
668 Ga0436360_0160041 3300039438 Bacteria 6302
669 Ga0436360_0900296 3300039438 Bacteria 1275
670 Ga0436363_0377217 3300039450 Bacteria 921
671 Ga0436363_0857110 3300039450 Bacteria 743
672 Ga0436363_1394367 3300039450 Unclassified 660
673 Ga0436363_1716475 3300039450 Bacteria 12115
674 Ga0436362_0193065 3300039453 Unclassified 1597
675 Ga0436362_0413829 3300039453 Bacteria 1007
676 Ga0436362_0497344 3300039453 Unclassified 504
677 Ga0436362_0609469 3300039453 Bacteria 1351
678 Ga0451791_0308433 3300041451 Unclassified 584
679 Ga0451793_1177649 3300041452 Bacteria 1072
680 Ga0451849_1436860 3300041505 Bacteria 626
681 Ga0466957_0489198 3300044842 Bacteria 852
682 Ga0451576_0238219 3300045051 Bacteria 1901
683 Ga0495617_080398 3300046452 Bacteria 1068
684 Ga0495592_0002029 3300046454 Bacteria 14254
685 Ga0495603_0014799 3300046455 Bacteria 4718
686 Ga0495651_0088138 3300046462 Bacteria 2332
687 Ga0495651_0325111 3300046462 Bacteria 1024
688 Ga0495580_0118273 3300046472 Bacteria 1840
689 Ga0495580_0168382 3300046472 Bacteria 1515
690 Ga0495582_0055510 3300046473 Bacteria 2183
691 Ga0495605_0137072 3300046474 Bacteria 1100
692 Ga0495662_0073329 3300046476 Bacteria 1660
693 Ga0495664_0039971 3300046477 Bacteria 2772
694 Ga0495664_0212652 3300046477 Bacteria 1171
695 Ga0495584_0187340 3300046491 Bacteria 1051
696 Ga0495585_0009380 3300046492 Bacteria 5870
697 Ga0495585_0169679 3300046492 Bacteria 1128
698 Ga0495596_0076830 3300046500 Bacteria 1297
699 Ga0495606_0161475 3300046507 Bacteria 1307
700 Ga0495608_0173215 3300046511 Bacteria 1368
701 Ga0495616_0057027 3300046513 Bacteria 1927
702 Ga0495628_0010755 3300046516 Bacteria 7750
703 Ga0495628_0696989 3300046516 Unclassified 718
704 Ga0495663_0058607 3300046525 Bacteria 1207
705 Ga0495666_0084114 3300046526 Bacteria 1503
706 Ga0495652_0035285 3300046529 Bacteria 4354
707 Ga0495652_0051267 3300046529 Bacteria 3525
708 Ga0495652_0080670 3300046529 Bacteria 2687
709 Ga0495665_0136860 3300046531 Bacteria 1281
710 Ga0495665_0332784 3300046531 Bacteria 775
711 Ga0495587_0145848 3300046536 Bacteria 1350
712 Ga0495598_0034670 3300046537 Bacteria 1440
713 Ga0495621_0168074 3300046539 Bacteria 870
714 Ga0495621_0515117 3300046539 Unclassified 517
715 Ga0495645_0004240 3300046543 Bacteria 9791
716 Ga0495645_0031707 3300046543 Bacteria 3851
717 Ga0495645_0406883 3300046543 Bacteria 866
718 Ga0495622_0002481 3300046557 Bacteria 8925
719 Ga0495656_0007146 3300046615 Bacteria 3940
720 Ga0495668_0254767 3300046616 Bacteria 961
721 Ga0495611_0114925 3300046648 Bacteria 1254
722 Ga0495625_0127072 3300046660 Bacteria 1730
723 Ga0495635_0050975 3300046663 Bacteria 2853
724 Ga0495659_0038061 3300046664 Bacteria 1707
725 Ga0495661_0097010 3300046665 Bacteria 1666
726 Ga0495661_0208571 3300046665 Bacteria 1019
727 Ga0495588_0009480 3300046674 Bacteria 4500
728 Ga0495657_0057811 3300046675 Bacteria 2578
729 Ga0495657_0082257 3300046675 Bacteria 2081
730 Ga0495599_0002546 3300046678 Bacteria 10623
731 Ga0495599_0069790 3300046678 Bacteria 2193
732 Ga0495623_0031161 3300046679 Bacteria 3429
733 Ga0495646_0477610 3300046680 Bacteria 642
734 Ga0495646_0637313 3300046680 Unclassified 539
735 Ga0495647_0120355 3300046681 Bacteria 1104
736 Ga0495658_0040998 3300046683 Bacteria 2576
737 Ga0495613_0372475 3300046689 Bacteria 978
738 Ga0495670_0010448 3300046691 Bacteria 4561
739 Ga0495670_0405797 3300046691 Bacteria 736
740 Ga0495589_0386033 3300046794 Unclassified 643
741 Ga0495600_0003255 3300046809 Bacteria 9512
742 Ga0495660_0095861 3300046810 Bacteria 1534
743 Ga0495581_0031931 3300047315 Bacteria 3051
744 Ga0495604_0008492 3300047317 Bacteria 8108
745 Ga0495604_0471718 3300047317 Unclassified 817
746 Ga0495636_0156828 3300047318 Bacteria 1024
747 Ga0495674_0236011 3300047319 Bacteria 1508
748 Ga0495672_0261542 3300047320 Bacteria 835
749 Ga0495676_0045481 3300047321 Bacteria 3572
750 Ga0495680_0009974 3300047322 Bacteria 8503
751 Ga0495680_0186175 3300047322 Bacteria 1496
752 Ga0495675_0079273 3300047444 Bacteria 2068
753 Ga0495675_0080417 3300047444 Bacteria 2053
754 Ga0495677_0105497 3300047445 Bacteria 1069
755 Ga0495673_0084336 3300047469 Bacteria 1310
756 Ga0495684_0139083 3300047471 Bacteria 1821
757 Ga0495684_0568062 3300047471 Bacteria 770
758 Ga0495602_0012502 3300048088 Bacteria 8718
759 Ga0495602_0345175 3300048088 Bacteria 1076
760 Ga0496101_0115020 3300048904 Bacteria 2029
761 Ga0496104_0503965 3300048907 Unclassified 1122
762 Ga0496109_0665898 3300048912 Unclassified 978
763 Ga0496112_0179882 3300048915 Bacteria 2079
764 Ga0496113_0092650 3300048916 Bacteria 2331
765 Ga0496115_0296705 3300048918 Bacteria 1325
766 Ga0496119_0036704 3300048922 Bacteria 3196
767 Ga0496120_0116437 3300048923 Bacteria 1388
768 Ga0496121_0000342 3300048924 Bacteria 97267
769 Ga0496121_0053748 3300048924 Bacteria 3372
770 Ga0496121_0137152 3300048924 Bacteria 1821
771 Ga0496126_0004475 3300048929 Bacteria 16682
772 Ga0496126_0085460 3300048929 Bacteria 2781
773 Ga0495682_0014850 3300049460 Bacteria 2951
774 Ga0501031_0007188 3300049568 Bacteria 7265
775 Ga0501031_0481747 3300049568 Unclassified 801
776 Ga0501032_0019525 3300049569 Bacteria 4740
777 Ga0501032_0118681 3300049569 Bacteria 1749
778 Ga0501032_0163452 3300049569 Bacteria 1461
779 Ga0501032_0222494 3300049569 Bacteria 1228
780 Ga0501032_0404806 3300049569 Bacteria 876
781 Ga0501033_0009915 3300049570 Bacteria 7315
782 Ga0501033_0035884 3300049570 Bacteria 3716
783 Ga0501033_0042084 3300049570 Bacteria 3406
784 Ga0501033_0090122 3300049570 Bacteria 2243
785 Ga0501033_0110926 3300049570 Bacteria 1996
786 Ga0501033_0129043 3300049570 Bacteria 1832
787 Ga0501033_0170018 3300049570 Bacteria 1566
788 Ga0501033_0189619 3300049570 Bacteria 1471
789 Ga0501033_0208981 3300049570 Bacteria 1392
790 Ga0501033_0310960 3300049570 Bacteria 1108
791 Ga0501033_0337716 3300049570 Unclassified 1056
792 Ga0501033_0362231 3300049570 Bacteria 1014
793 Ga0501033_0803200 3300049570 Bacteria 636
794 Ga0501033_0881066 3300049570 Bacteria 602
795 Ga0501034_0030482 3300049571 Bacteria 5483
796 Ga0501034_0122632 3300049571 Bacteria 2585
797 Ga0501034_0123280 3300049571 Bacteria 2577
798 Ga0501034_0187479 3300049571 Bacteria 2031
799 Ga0501034_0200527 3300049571 Bacteria 1954
800 Ga0501034_0223272 3300049571 Bacteria 1836
801 Ga0501034_0226097 3300049571 Bacteria 1822
802 Ga0501034_0478455 3300049571 Bacteria 1161
803 Ga0501036_0003979 3300049572 Bacteria 11875
804 Ga0501036_0120952 3300049572 Bacteria 2211
805 Ga0501036_0260047 3300049572 Bacteria 1454
806 Ga0501036_0289756 3300049572 Bacteria 1370
807 Ga0501036_0412702 3300049572 Bacteria 1126
808 Ga0501037_0003258 3300049573 Bacteria 11780
809 Ga0501037_0010726 3300049573 Bacteria 6734
810 Ga0501037_0011338 3300049573 Bacteria 6562
811 Ga0501037_0151712 3300049573 Bacteria 1656
812 Ga0501037_0347874 3300049573 Bacteria 1023
813 Ga0501038_0022382 3300049574 Bacteria 5665
814 Ga0501038_0060653 3300049574 Bacteria 3237
815 Ga0501038_0066451 3300049574 Bacteria 3071
816 Ga0501038_0094116 3300049574 Bacteria 2505
817 Ga0501038_0098103 3300049574 Bacteria 2443
818 Ga0501038_0108913 3300049574 Bacteria 2296
819 Ga0501038_0123152 3300049574 Bacteria 2136
820 Ga0501038_0294125 3300049574 Unclassified 1275
821 Ga0501038_0430508 3300049574 Bacteria 1017
822 Ga0501038_0954687 3300049574 Bacteria 631
823 Ga0501038_0964427 3300049574 Bacteria 627
824 Ga0501039_0000722 3300049575 Bacteria 23835
825 Ga0501039_0200760 3300049575 Bacteria 1568
826 Ga0501039_1137685 3300049575 Bacteria 604
827 Ga0501040_0271842 3300049576 Bacteria 1210
828 Ga0501040_0705447 3300049576 Bacteria 730
829 Ga0501041_0510738 3300049577 Bacteria 765
830 Ga0501042_0029241 3300049578 Bacteria 3886
831 Ga0501043_0002787 3300049579 Bacteria 14605
832 Ga0501043_0072392 3300049579 Bacteria 2707
833 Ga0501043_0076031 3300049579 Bacteria 2638
834 Ga0501043_0099636 3300049579 Bacteria 2284
835 Ga0501043_0110245 3300049579 Bacteria 2161
836 Ga0501043_0152686 3300049579 Bacteria 1807
837 Ga0501043_0340253 3300049579 Bacteria 1141
838 Ga0501046_0008706 3300049580 Bacteria 8820
839 Ga0501046_0011955 3300049580 Bacteria 7405
840 Ga0501046_0051438 3300049580 Bacteria 3250
841 Ga0501046_0107284 3300049580 Bacteria 2136
842 Ga0501046_0186904 3300049580 Bacteria 1547
843 Ga0501046_0268467 3300049580 Bacteria 1252
844 Ga0501046_0275366 3300049580 Bacteria 1234
845 Ga0501046_1111720 3300049580 Bacteria 546
846 Ga0501047_0002340 3300049581 Bacteria 18119
847 Ga0501047_0010038 3300049581 Bacteria 8952
848 Ga0501047_0011849 3300049581 Bacteria 8247
849 Ga0501047_0016948 3300049581 Bacteria 6965
850 Ga0501047_0025770 3300049581 Bacteria 5655
851 Ga0501047_0027307 3300049581 Bacteria 5498
852 Ga0501047_0065406 3300049581 Bacteria 3505
853 Ga0501047_0088473 3300049581 Bacteria 2974
854 Ga0501047_0117654 3300049581 Bacteria 2539
855 Ga0501047_0186978 3300049581 Bacteria 1936
856 Ga0501047_0255607 3300049581 Bacteria 1600
857 Ga0501047_0266450 3300049581 Bacteria 1560
858 Ga0501047_0271226 3300049581 Bacteria 1543
859 Ga0501047_0431434 3300049581 Unclassified 1148
860 Ga0501047_0447519 3300049581 Bacteria 1121
861 Ga0501047_0478270 3300049581 Unclassified 1073
862 Ga0501047_0615564 3300049581 Bacteria 907
863 Ga0501047_0788681 3300049581 Bacteria 765
864 Ga0501048_0006987 3300049582 Bacteria 8577
865 Ga0501048_0407615 3300049582 Unclassified 972
866 Ga0501048_0484228 3300049582 Bacteria 887
867 Ga0501067_0000729 3300049583 Bacteria 17689
868 Ga0501067_0134834 3300049583 Bacteria 1374
869 Ga0501067_0263193 3300049583 Bacteria 960
870 Ga0501067_0466790 3300049583 Bacteria 705
871 Ga0501068_0148086 3300049584 Unclassified 1474
872 Ga0501069_0039144 3300049585 Bacteria 2619
873 Ga0501069_0180084 3300049585 Bacteria 1221
874 Ga0501069_0267421 3300049585 Bacteria 999
875 Ga0501069_0277495 3300049585 Bacteria 980
876 Ga0501070_0000017 3300049586 Bacteria 173127
877 Ga0501070_0024751 3300049586 Bacteria 5035
878 Ga0501070_0081519 3300049586 Bacteria 2677
879 Ga0501070_0222675 3300049586 Bacteria 1547
880 Ga0501070_0285547 3300049586 Bacteria 1346
881 Ga0501070_0292146 3300049586 Unclassified 1328
882 Ga0501070_0446511 3300049586 Bacteria 1043
883 Ga0501070_1173709 3300049586 Unclassified 590
884 Ga0501071_0175322 3300049587 Bacteria 1606
885 Ga0501071_0418340 3300049587 Unclassified 1024
886 Ga0501072_0002615 3300049588 Bacteria 13488
887 Ga0501072_0058798 3300049588 Bacteria 3030
888 Ga0501073_0006141 3300049589 Bacteria 8966
889 Ga0501073_0035606 3300049589 Bacteria 3537
890 Ga0501073_0071784 3300049589 Bacteria 2411
891 Ga0501073_0085950 3300049589 Bacteria 2188
892 Ga0501073_0202618 3300049589 Bacteria 1372
893 Ga0501073_0326227 3300049589 Bacteria 1060
894 Ga0501073_0330280 3300049589 Bacteria 1053
895 Ga0501073_0364440 3300049589 Bacteria 998
896 Ga0501074_0006832 3300049590 Bacteria 8245
897 Ga0501074_0283717 3300049590 Bacteria 1177
898 Ga0501074_0356514 3300049590 Bacteria 1038
899 Ga0501076_0392279 3300049592 Bacteria 1141
900 Ga0501077_0485166 3300049593 Bacteria 792
901 Ga0501079_0001593 3300049741 Bacteria 16128
902 Ga0501079_0376949 3300049741 Bacteria 1112
903 Ga0501080_0007075 3300049742 Bacteria 10134
904 Ga0501080_0013155 3300049742 Bacteria 7603
905 Ga0501080_0017054 3300049742 Bacteria 6706
906 Ga0501080_0048297 3300049742 Bacteria 3961
907 Ga0501080_0058102 3300049742 Bacteria 3601
908 Ga0501080_0095938 3300049742 Bacteria 2753
909 Ga0501080_0100351 3300049742 Bacteria 2686
910 Ga0501080_0174060 3300049742 Bacteria 1984
911 Ga0501080_0196256 3300049742 Bacteria 1854
912 Ga0501080_0529677 3300049742 Unclassified 1051
913 Ga0501080_1232045 3300049742 Bacteria 642
914 Ga0501081_1149569 3300049743 Bacteria 588
915 Ga0501083_0023338 3300049744 Bacteria 4291
916 Ga0501083_0024773 3300049744 Bacteria 4156
917 Ga0501083_0077501 3300049744 Bacteria 2206
918 Ga0501083_0078000 3300049744 Bacteria 2198
919 Ga0501083_0273322 3300049744 Bacteria 1099
920 Ga0501035_0014379 3300049822 Bacteria 7306
921 Ga0501035_0016715 3300049822 Bacteria 6764
922 Ga0501035_0022936 3300049822 Bacteria 5730
923 Ga0501035_0028207 3300049822 Bacteria 5124
924 Ga0501035_0037918 3300049822 Bacteria 4363
925 Ga0501035_0098978 3300049822 Bacteria 2560
926 Ga0501035_0105807 3300049822 Bacteria 2467
927 Ga0501035_0112035 3300049822 Bacteria 2390
928 Ga0501035_0114126 3300049822 Bacteria 2366
929 Ga0501035_0248775 3300049822 Bacteria 1510
930 Ga0501035_0288201 3300049822 Bacteria 1386
931 Ga0501035_0307956 3300049822 Bacteria 1333
932 Ga0501035_0502871 3300049822 Bacteria 997
933 Ga0501035_0834230 3300049822 Bacteria 734
934 Ga0501044_0001349 3300049823 Bacteria 28836
935 Ga0501044_0004556 3300049823 Bacteria 15500
936 Ga0501044_0012642 3300049823 Bacteria 9140
937 Ga0501044_0013884 3300049823 Bacteria 8704
938 Ga0501044_0016070 3300049823 Bacteria 8045
939 Ga0501044_0020118 3300049823 Bacteria 7126
940 Ga0501044_0021245 3300049823 Bacteria 6929
941 Ga0501044_0069817 3300049823 Bacteria 3576
942 Ga0501044_0071490 3300049823 Bacteria 3528
943 Ga0501044_0075416 3300049823 Bacteria 3424
944 Ga0501044_0084673 3300049823 Bacteria 3204
945 Ga0501044_0123544 3300049823 Bacteria 2587
946 Ga0501044_0178221 3300049823 Bacteria 2093
947 Ga0501044_0289077 3300049823 Bacteria 1571
948 Ga0501044_0289595 3300049823 Bacteria 1569
949 Ga0501044_0471480 3300049823 Bacteria 1159
950 Ga0501044_1375726 3300049823 Bacteria 571
951 Ga0501045_0117027 3300049824 Bacteria 1978
952 nmdc:mga08y16_96655_c1 3300050511 Bacteria 3076
953 nmdc:mga0n895_508654_c1 3300050512 Bacteria 1213
954 nmdc:mga0rr50_41387_c1 3300050513 Bacteria 2364
955 nmdc:mga0rr50_424049_c1 3300050513 Bacteria 1126
956 nmdc:mga08x19_101598_c1 3300050514 Bacteria 1909
957 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
958 Ga0495601_0000787 3300053077 Bacteria 17135
959 Ga0495612_0001215 3300053078 Bacteria 10624
960 Ga0495595_0001670 3300053084 Bacteria 8684
961 Ga0495595_0138751 3300053084 Bacteria 1192
962 Ga0495619_0000414 3300053085 Bacteria 29022
963 Ga0495619_0101091 3300053085 Bacteria 1963
964 Ga0495619_0853569 3300053085 Unclassified 614
965 Ga0500643_000006 3300053087 Bacteria 479605
966 Ga0500646_0140566 3300053090 Bacteria 792
967 Ga0500566_0286142 3300053094 Bacteria 783
968 Ga0500641_0030149 3300053096 Bacteria 2129
969 Ga0500558_167330 3300053106 Bacteria 799
970 Ga0500593_135782 3300053117 Unclassified 975
971 Ga0500595_013693 3300053119 Bacteria 3102
972 Ga0500595_020325 3300053119 Bacteria 2392
973 Ga0500595_036334 3300053119 Bacteria 1614
974 Ga0500655_004543 3300053133 Bacteria 2498
975 Ga0500655_030114 3300053133 Bacteria 1043
976 Ga0500559_0008077 3300053136 Bacteria 4630
977 Ga0500559_0316253 3300053136 Bacteria 732
978 Ga0500559_0367583 3300053136 Unclassified 672
979 Ga0500568_0048976 3300053139 Bacteria 1669
980 Ga0500573_0000009 3300053140 Bacteria 230823
981 Ga0500577_0083756 3300053142 Bacteria 1277
982 Ga0500590_331774 3300053148 Bacteria 554
983 Ga0500639_133685 3300053163 Bacteria 1171
984 Ga0500645_212142 3300053730 Bacteria 520
985 Ga0501084_0000147 3300054114 Bacteria 53278
986 Ga0501084_0009168 3300054114 Bacteria 8184
987 Ga0501084_0492650 3300054114 Bacteria 1036
988 Ga0501084_1193671 3300054114 Unclassified 638
989 Ga0501082_0008279 3300060353 Bacteria 8968
990 Ga0501082_0131759 3300060353 Bacteria 2169
991 Ga0501082_0357098 3300060353 Bacteria 1274
992 Ga0501082_0388559 3300060353 Bacteria 1218
993 Ga0501082_0391469 3300060353 Bacteria 1213
994 Ga0501082_1141945 3300060353 Bacteria 681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_1149569 Ga0501081_1149569_35_517 129
2 3300031241 Ga0265325_10001558 Ga0265325_100015586 140
3 3300005548 Ga0070665_100122251 Ga0070665_1001222513 142
4 3300005336 Ga0070680_100612609 Ga0070680_1006126092 143
5 3300021441 Ga0213871_10006451 Ga0213871_100064512 143
6 3300039438 Ga0436360_0160041 Ga0436360_0160041_1140_1622 143
7 3300047471 Ga0495684_0568062 Ga0495684_0568062_300_731 143
8 3300005364 Ga0070673_101014556 Ga0070673_1010145561 144
9 3300005441 Ga0070700_100138904 Ga0070700_1001389042 144
10 3300005578 Ga0068854_100740836 Ga0068854_1007408361 144
11 3300006195 Ga0075366_10589639 Ga0075366_105896391 144
12 3300026089 Ga0207648_11565818 Ga0207648_115658181 144
13 3300014497 Ga0182008_10155742 Ga0182008_101557421 146
14 3300015262 Ga0182007_10032517 Ga0182007_100325172 146
15 3300053085 Ga0495619_0853569 Ga0495619_0853569_37_519 146
16 3300049581 Ga0501047_0478270 Ga0501047_0478270_68_550 147
17 3300049742 Ga0501080_0529677 Ga0501080_0529677_519_1001 147
18 3300013105 Ga0157369_10046281 Ga0157369_100462816 148
19 3300037853 Ga0436364_1385246 Ga0436364_1385246_428_910 149
20 3300005844 Ga0068862_101047302 Ga0068862_1010473021 150
21 3300009093 Ga0105240_10097765 Ga0105240_100977653 150
22 3300009176 Ga0105242_10487470 Ga0105242_104874702 150
23 3300010375 Ga0105239_10013335 Ga0105239_100133354 150
24 3300010375 Ga0105239_10155260 Ga0105239_101552604 150
25 3300013105 Ga0157369_10479685 Ga0157369_104796852 150
26 3300013105 Ga0157369_10682016 Ga0157369_106820162 150
27 3300013296 Ga0157374_10257347 Ga0157374_102573473 150
28 3300013306 Ga0163162_10075656 Ga0163162_100756563 150
29 3300013308 Ga0157375_10058531 Ga0157375_100585316 150
30 3300025913 Ga0207695_10300514 Ga0207695_103005142 150
31 3300025949 Ga0207667_10280258 Ga0207667_102802583 150
32 3300026041 Ga0207639_10598537 Ga0207639_105985372 150
33 3300026041 Ga0207639_10993129 Ga0207639_109931291 150
34 3300026121 Ga0207683_10062021 Ga0207683_100620214 150
35 3300028379 Ga0268266_10507701 Ga0268266_105077011 150
36 3300028800 Ga0265338_10001374 Ga0265338_1000137412 150
37 3300031235 Ga0265330_10020152 Ga0265330_100201525 150
38 3300031238 Ga0265332_10011438 Ga0265332_100114386 150
39 3300031247 Ga0265340_10012732 Ga0265340_100127324 150
40 3300031249 Ga0265339_10133225 Ga0265339_101332252 150
41 3300031250 Ga0265331_10007849 Ga0265331_100078496 150
42 3300031344 Ga0265316_10296269 Ga0265316_102962692 150
43 3300031711 Ga0265314_10007438 Ga0265314_100074385 150
44 3300031712 Ga0265342_10015572 Ga0265342_100155726 150
45 3300036401 Ga0373937_1340931 Ga0373937_1340931_54_506 150
46 3300036401 Ga0373937_2067487 Ga0373937_2067487_46_498 150
47 3300037418 Ga0395900_0053179 Ga0395900_0053179_3135_3587 150
48 3300037466 Ga0395898_0008535 Ga0395898_0008535_8825_9277 150
49 3300038443 Ga0395901_0062777 Ga0395901_0062777_2021_2473 150
50 3300039453 Ga0436362_0497344 Ga0436362_0497344_35_487 150
51 3300039453 Ga0436362_0609469 Ga0436362_0609469_662_1114 150
52 3300041452 Ga0451793_1177649 Ga0451793_1177649_584_1036 150
53 3300046539 Ga0495621_0515117 Ga0495621_0515117_41_493 150
54 3300046794 Ga0495589_0386033 Ga0495589_0386033_163_615 150
55 3300048922 Ga0496119_0036704 Ga0496119_0036704_2406_2858 150
56 3300048923 Ga0496120_0116437 Ga0496120_0116437_881_1333 150
57 3300048924 Ga0496121_0053748 Ga0496121_0053748_912_1364 150
58 3300048924 Ga0496121_0137152 Ga0496121_0137152_881_1333 150
59 3300049569 Ga0501032_0019525 Ga0501032_0019525_3970_4422 150
60 3300049570 Ga0501033_0337716 Ga0501033_0337716_367_819 150
61 3300049571 Ga0501034_0030482 Ga0501034_0030482_1837_2289 150
62 3300049571 Ga0501034_0223272 Ga0501034_0223272_643_1095 150
63 3300049572 Ga0501036_0003979 Ga0501036_0003979_7330_7782 150
64 3300049572 Ga0501036_0120952 Ga0501036_0120952_494_946 150
65 3300049573 Ga0501037_0003258 Ga0501037_0003258_7235_7687 150
66 3300049574 Ga0501038_0066451 Ga0501038_0066451_195_647 150
67 3300049574 Ga0501038_0294125 Ga0501038_0294125_398_850 150
68 3300049574 Ga0501038_0964427 Ga0501038_0964427_42_494 150
69 3300049575 Ga0501039_0000722 Ga0501039_0000722_16745_17197 150
70 3300049578 Ga0501042_0029241 Ga0501042_0029241_318_770 150
71 3300049579 Ga0501043_0002787 Ga0501043_0002787_319_771 150
72 3300049580 Ga0501046_0051438 Ga0501046_0051438_2500_2952 150
73 3300049581 Ga0501047_0010038 Ga0501047_0010038_7218_7670 150
74 3300049581 Ga0501047_0431434 Ga0501047_0431434_398_850 150
75 3300049582 Ga0501048_0006987 Ga0501048_0006987_4284_4736 150
76 3300049583 Ga0501067_0000729 Ga0501067_0000729_9905_10357 150
77 3300049584 Ga0501068_0148086 Ga0501068_0148086_273_725 150
78 3300049585 Ga0501069_0039144 Ga0501069_0039144_1663_2115 150
79 3300049586 Ga0501070_0024751 Ga0501070_0024751_299_751 150
80 3300049587 Ga0501071_0175322 Ga0501071_0175322_225_677 150
81 3300049588 Ga0501072_0058798 Ga0501072_0058798_1656_2108 150
82 3300049589 Ga0501073_0006141 Ga0501073_0006141_1975_2427 150
83 3300049589 Ga0501073_0035606 Ga0501073_0035606_2077_2529 150
84 3300049590 Ga0501074_0006832 Ga0501074_0006832_7145_7597 150
85 3300049592 Ga0501076_0392279 Ga0501076_0392279_176_628 150
86 3300049742 Ga0501080_0017054 Ga0501080_0017054_5857_6309 150
87 3300049742 Ga0501080_0196256 Ga0501080_0196256_162_614 150
88 3300049744 Ga0501083_0023338 Ga0501083_0023338_3163_3615 150
89 3300049822 Ga0501035_0112035 Ga0501035_0112035_677_1129 150
90 3300049822 Ga0501035_0248775 Ga0501035_0248775_595_1047 150
91 3300049823 Ga0501044_0012642 Ga0501044_0012642_1506_1958 150
92 3300049824 Ga0501045_0117027 Ga0501045_0117027_980_1432 150
93 3300053163 Ga0500639_133685 Ga0500639_133685_680_1132 150
94 3300053730 Ga0500645_212142 Ga0500645_212142_57_509 150
95 3300054114 Ga0501084_0009168 Ga0501084_0009168_7542_7994 150
96 3300025916 Ga0207663_10409148 Ga0207663_104091482 151
97 3300039450 Ga0436363_0857110 Ga0436363_0857110_35_511 151
98 3300031251 Ga0265327_10270709 Ga0265327_102707092 152
99 3300035083 Ga0373926_0061795 Ga0373926_0061795_80_562 152
100 3300035089 Ga0373944_0017334 Ga0373944_0017334_228_710 152
101 3300035116 Ga0373945_0067629 Ga0373945_0067629_778_1260 152
102 3300035170 Ga0373943_0021651 Ga0373943_0021651_1317_1799 152
103 3300037068 Ga0373925_0473851 Ga0373925_0473851_459_941 152
104 3300046455 Ga0495603_0014799 Ga0495603_0014799_3517_3999 152
105 3300046472 Ga0495580_0168382 Ga0495580_0168382_70_552 152
106 3300046473 Ga0495582_0055510 Ga0495582_0055510_1337_1819 152
107 3300046474 Ga0495605_0137072 Ga0495605_0137072_44_526 152
108 3300046476 Ga0495662_0073329 Ga0495662_0073329_712_1194 152
109 3300046491 Ga0495584_0187340 Ga0495584_0187340_84_566 152
110 3300046492 Ga0495585_0009380 Ga0495585_0009380_2022_2504 152
111 3300046500 Ga0495596_0076830 Ga0495596_0076830_109_591 152
112 3300046513 Ga0495616_0057027 Ga0495616_0057027_742_1224 152
113 3300046525 Ga0495663_0058607 Ga0495663_0058607_133_615 152
114 3300046526 Ga0495666_0084114 Ga0495666_0084114_720_1202 152
115 3300046531 Ga0495665_0136860 Ga0495665_0136860_517_999 152
116 3300046537 Ga0495598_0034670 Ga0495598_0034670_496_978 152
117 3300046539 Ga0495621_0168074 Ga0495621_0168074_347_829 152
118 3300046615 Ga0495656_0007146 Ga0495656_0007146_379_861 152
119 3300046664 Ga0495659_0038061 Ga0495659_0038061_63_545 152
120 3300046665 Ga0495661_0097010 Ga0495661_0097010_716_1198 152
121 3300046674 Ga0495588_0009480 Ga0495588_0009480_3553_4035 152
122 3300046683 Ga0495658_0040998 Ga0495658_0040998_631_1113 152
123 3300046691 Ga0495670_0010448 Ga0495670_0010448_2404_2886 152
124 3300046810 Ga0495660_0095861 Ga0495660_0095861_339_821 152
125 3300047315 Ga0495581_0031931 Ga0495581_0031931_900_1382 152
126 3300047321 Ga0495676_0045481 Ga0495676_0045481_3020_3502 152
127 3300047445 Ga0495677_0105497 Ga0495677_0105497_333_815 152
128 iso_pu_bacteria 2939669807 2939674245 155
129 3300015265 Ga0182005_1006445 Ga0182005_10064452 156
130 iso_pu_bacteria 2818991467 2819721592 156
131 3300005937 Ga0081455_10025361 Ga0081455_100253613 158
132 3300006175 Ga0070712_100099290 Ga0070712_1000992903 158
133 3300025915 Ga0207693_11044357 Ga0207693_110443571 158
134 3300037853 Ga0436364_0630355 Ga0436364_0630355_1333_1809 158
135 3300049568 Ga0501031_0481747 Ga0501031_0481747_192_671 158
136 3300049576 Ga0501040_0705447 Ga0501040_0705447_182_661 158
137 3300049577 Ga0501041_0510738 Ga0501041_0510738_54_533 158
138 3300049587 Ga0501071_0418340 Ga0501071_0418340_258_737 158
139 3300049593 Ga0501077_0485166 Ga0501077_0485166_102_581 158
140 3300014969 Ga0157376_10663790 Ga0157376_106637902 159
141 3300031239 Ga0265328_10000123 Ga0265328_1000012331 159
142 3300031250 Ga0265331_10000026 Ga0265331_1000002654 159
143 3300031901 Ga0307406_10098051 Ga0307406_100980512 159
144 3300049571 Ga0501034_0123280 Ga0501034_0123280_471_950 159
145 3300049574 Ga0501038_0098103 Ga0501038_0098103_1226_1705 159
146 3300049581 Ga0501047_0065406 Ga0501047_0065406_36_515 159
147 3300049582 Ga0501048_0484228 Ga0501048_0484228_14_493 159
148 3300049583 Ga0501067_0466790 Ga0501067_0466790_66_545 159
149 3300049744 Ga0501083_0024773 Ga0501083_0024773_1721_2200 159
150 3300049823 Ga0501044_0071490 Ga0501044_0071490_1532_2011 159
151 3300053136 Ga0500559_0316253 Ga0500559_0316253_81_560 159
152 3300060353 Ga0501082_0131759 Ga0501082_0131759_1519_1998 159
153 3300001978 JGI24747J21853_1037014 JGI24747J21853_10370141 160
154 3300003214 JGI25165J46597_1000047 JGI25165J46597_1000047208 160
155 3300003214 JGI25165J46597_1000066 JGI25165J46597_1000066119 160
156 3300003215 JGI25153J46596_10003510 JGI25153J46596_100035106 160
157 3300003320 rootH2_10048452 rootH2_100484526 160
158 3300003323 rootH1_10213236 rootH1_102132362 160
159 3300003578 Ga0006562J51391_1008604 Ga0006562J51391_10086042 160
160 3300005327 Ga0070658_10004407 Ga0070658_100044077 160
161 3300005327 Ga0070658_10036793 Ga0070658_100367934 160
162 3300005327 Ga0070658_10087273 Ga0070658_100872733 160
163 3300005327 Ga0070658_10206018 Ga0070658_102060181 160
164 3300005327 Ga0070658_10298341 Ga0070658_102983412 160
165 3300005327 Ga0070658_10730507 Ga0070658_107305071 160
166 3300005327 Ga0070658_10833509 Ga0070658_108335091 160
167 3300005329 Ga0070683_100073837 Ga0070683_1000738374 160
168 3300005329 Ga0070683_100158491 Ga0070683_1001584913 160
169 3300005331 Ga0070670_100200910 Ga0070670_1002009102 160
170 3300005335 Ga0070666_10000186 Ga0070666_1000018639 160
171 3300005335 Ga0070666_10016173 Ga0070666_100161735 160
172 3300005336 Ga0070680_100338169 Ga0070680_1003381692 160
173 3300005337 Ga0070682_101339295 Ga0070682_1013392951 160
174 3300005338 Ga0068868_100146063 Ga0068868_1001460632 160
175 3300005338 Ga0068868_100149671 Ga0068868_1001496713 160
176 3300005339 Ga0070660_100010072 Ga0070660_1000100727 160
177 3300005339 Ga0070660_100039636 Ga0070660_1000396366 160
178 3300005339 Ga0070660_100650468 Ga0070660_1006504681 160
179 3300005340 Ga0070689_100140372 Ga0070689_1001403724 160
180 3300005340 Ga0070689_100410635 Ga0070689_1004106352 160
181 3300005341 Ga0070691_10000233 Ga0070691_1000023311 160
182 3300005341 Ga0070691_10000745 Ga0070691_100007457 160
183 3300005341 Ga0070691_10455750 Ga0070691_104557502 160
184 3300005344 Ga0070661_100000165 Ga0070661_10000016534 160
185 3300005345 Ga0070692_10319679 Ga0070692_103196792 160
186 3300005353 Ga0070669_100503195 Ga0070669_1005031951 160
187 3300005354 Ga0070675_100144883 Ga0070675_1001448832 160
188 3300005355 Ga0070671_100025930 Ga0070671_1000259307 160
189 3300005355 Ga0070671_100383808 Ga0070671_1003838082 160
190 3300005364 Ga0070673_100021993 Ga0070673_1000219933 160
191 3300005366 Ga0070659_100032854 Ga0070659_1000328543 160
192 3300005366 Ga0070659_100683006 Ga0070659_1006830062 160
193 3300005367 Ga0070667_100035730 Ga0070667_1000357304 160
194 3300005367 Ga0070667_100126325 Ga0070667_1001263253 160
195 3300005367 Ga0070667_100127747 Ga0070667_1001277474 160
196 3300005434 Ga0070709_10092958 Ga0070709_100929583 160
197 3300005435 Ga0070714_100077745 Ga0070714_1000777454 160
198 3300005435 Ga0070714_100416058 Ga0070714_1004160582 160
199 3300005436 Ga0070713_100000002 Ga0070713_10000000211 160
200 3300005436 Ga0070713_100125509 Ga0070713_1001255093 160
201 3300005436 Ga0070713_100354936 Ga0070713_1003549362 160
202 3300005436 Ga0070713_100371466 Ga0070713_1003714662 160
203 3300005436 Ga0070713_100701889 Ga0070713_1007018892 160
204 3300005439 Ga0070711_100162649 Ga0070711_1001626492 160
205 3300005439 Ga0070711_100420447 Ga0070711_1004204473 160
206 3300005439 Ga0070711_100430453 Ga0070711_1004304531 160
207 3300005439 Ga0070711_101318116 Ga0070711_1013181161 160
208 3300005441 Ga0070700_100170110 Ga0070700_1001701101 160
209 3300005444 Ga0070694_100963828 Ga0070694_1009638282 160
210 3300005455 Ga0070663_100010410 Ga0070663_1000104102 160
211 3300005455 Ga0070663_100145180 Ga0070663_1001451803 160
212 3300005455 Ga0070663_100275941 Ga0070663_1002759412 160
213 3300005456 Ga0070678_100008084 Ga0070678_1000080846 160
214 3300005456 Ga0070678_100028781 Ga0070678_1000287814 160
215 3300005456 Ga0070678_100044373 Ga0070678_1000443734 160
216 3300005457 Ga0070662_100097136 Ga0070662_1000971362 160
217 3300005458 Ga0070681_10000014 Ga0070681_100000144 160
218 3300005458 Ga0070681_10119942 Ga0070681_101199424 160
219 3300005458 Ga0070681_10138798 Ga0070681_101387984 160
220 3300005458 Ga0070681_10140087 Ga0070681_101400873 160
221 3300005458 Ga0070681_10464866 Ga0070681_104648661 160
222 3300005458 Ga0070681_10668315 Ga0070681_106683152 160
223 3300005458 Ga0070681_10812933 Ga0070681_108129331 160
224 3300005459 Ga0068867_100157813 Ga0068867_1001578131 160
225 3300005459 Ga0068867_100322589 Ga0068867_1003225891 160
226 3300005466 Ga0070685_10246756 Ga0070685_102467562 160
227 3300005518 Ga0070699_100478448 Ga0070699_1004784482 160
228 3300005518 Ga0070699_101567409 Ga0070699_1015674091 160
229 3300005530 Ga0070679_100003975 Ga0070679_1000039754 160
230 3300005530 Ga0070679_100036559 Ga0070679_1000365594 160
231 3300005530 Ga0070679_100046782 Ga0070679_1000467826 160
232 3300005530 Ga0070679_100350510 Ga0070679_1003505102 160
233 3300005530 Ga0070679_100383967 Ga0070679_1003839672 160
234 3300005530 Ga0070679_101858376 Ga0070679_1018583761 160
235 3300005535 Ga0070684_100142656 Ga0070684_1001426565 160
236 3300005539 Ga0068853_100003994 Ga0068853_1000039948 160
237 3300005539 Ga0068853_100211317 Ga0068853_1002113171 160
238 3300005539 Ga0068853_100291717 Ga0068853_1002917171 160
239 3300005539 Ga0068853_100378984 Ga0068853_1003789842 160
240 3300005539 Ga0068853_101617218 Ga0068853_1016172181 160
241 3300005543 Ga0070672_100315352 Ga0070672_1003153522 160
242 3300005544 Ga0070686_101715881 Ga0070686_1017158811 160
243 3300005545 Ga0070695_100002111 Ga0070695_10000211112 160
244 3300005545 Ga0070695_100330101 Ga0070695_1003301012 160
245 3300005546 Ga0070696_101105250 Ga0070696_1011052501 160
246 3300005547 Ga0070693_100220095 Ga0070693_1002200952 160
247 3300005548 Ga0070665_100001530 Ga0070665_10000153019 160
248 3300005548 Ga0070665_100051864 Ga0070665_1000518645 160
249 3300005548 Ga0070665_100077890 Ga0070665_1000778905 160
250 3300005548 Ga0070665_100111159 Ga0070665_1001111593 160
251 3300005548 Ga0070665_100121214 Ga0070665_1001212145 160
252 3300005548 Ga0070665_100151100 Ga0070665_1001511002 160
253 3300005548 Ga0070665_100633014 Ga0070665_1006330142 160
254 3300005548 Ga0070665_101366927 Ga0070665_1013669271 160
255 3300005563 Ga0068855_100002193 Ga0068855_10000219326 160
256 3300005563 Ga0068855_100048766 Ga0068855_1000487664 160
257 3300005563 Ga0068855_100080088 Ga0068855_1000800883 160
258 3300005563 Ga0068855_100111048 Ga0068855_1001110482 160
259 3300005563 Ga0068855_100119698 Ga0068855_1001196983 160
260 3300005563 Ga0068855_100169874 Ga0068855_1001698743 160
261 3300005563 Ga0068855_100470750 Ga0068855_1004707502 160
262 3300005577 Ga0068857_100000488 Ga0068857_10000048822 160
263 3300005577 Ga0068857_100071060 Ga0068857_1000710602 160
264 3300005578 Ga0068854_100110573 Ga0068854_1001105732 160
265 3300005578 Ga0068854_100211766 Ga0068854_1002117663 160
266 3300005614 Ga0068856_100000312 Ga0068856_10000031248 160
267 3300005614 Ga0068856_100015005 Ga0068856_1000150053 160
268 3300005614 Ga0068856_100290201 Ga0068856_1002902012 160
269 3300005614 Ga0068856_100390075 Ga0068856_1003900752 160
270 3300005615 Ga0070702_100978006 Ga0070702_1009780061 160
271 3300005616 Ga0068852_100020713 Ga0068852_1000207135 160
272 3300005616 Ga0068852_100024329 Ga0068852_1000243292 160
273 3300005616 Ga0068852_100399302 Ga0068852_1003993023 160
274 3300005616 Ga0068852_100475000 Ga0068852_1004750002 160
275 3300005618 Ga0068864_100041460 Ga0068864_1000414604 160
276 3300005618 Ga0068864_100173795 Ga0068864_1001737953 160
277 3300005618 Ga0068864_100700039 Ga0068864_1007000392 160
278 3300005840 Ga0068870_10050663 Ga0068870_100506634 160
279 3300005840 Ga0068870_10192425 Ga0068870_101924252 160
280 3300005841 Ga0068863_101378720 Ga0068863_1013787202 160
281 3300005842 Ga0068858_100002481 Ga0068858_10000248114 160
282 3300005842 Ga0068858_100020836 Ga0068858_1000208362 160
283 3300005842 Ga0068858_100034722 Ga0068858_1000347227 160
284 3300005842 Ga0068858_100039125 Ga0068858_1000391254 160
285 3300005842 Ga0068858_100686734 Ga0068858_1006867342 160
286 3300005843 Ga0068860_100045955 Ga0068860_1000459556 160
287 3300005844 Ga0068862_100086116 Ga0068862_1000861165 160
288 3300005844 Ga0068862_101159582 Ga0068862_1011595821 160
289 3300006028 Ga0070717_10047683 Ga0070717_100476833 160
290 3300006173 Ga0070716_100432140 Ga0070716_1004321402 160
291 3300006175 Ga0070712_100000045 Ga0070712_10000004564 160
292 3300006175 Ga0070712_100000272 Ga0070712_1000002728 160
293 3300006175 Ga0070712_100332087 Ga0070712_1003320872 160
294 3300006175 Ga0070712_101809077 Ga0070712_1018090771 160
295 3300006237 Ga0097621_100008952 Ga0097621_1000089525 160
296 3300006237 Ga0097621_100025748 Ga0097621_1000257484 160
297 3300006237 Ga0097621_100083442 Ga0097621_1000834426 160
298 3300006237 Ga0097621_100132495 Ga0097621_1001324953 160
299 3300006237 Ga0097621_100320017 Ga0097621_1003200172 160
300 3300006358 Ga0068871_100021718 Ga0068871_1000217184 160
301 3300006358 Ga0068871_100054046 Ga0068871_1000540464 160
302 3300006358 Ga0068871_100085337 Ga0068871_1000853373 160
303 3300006358 Ga0068871_100287114 Ga0068871_1002871142 160
304 3300006844 Ga0075428_101607414 Ga0075428_1016074142 160
305 3300006871 Ga0075434_100049585 Ga0075434_1000495853 160
306 3300006871 Ga0075434_100111155 Ga0075434_1001111553 160
307 3300006881 Ga0068865_100076460 Ga0068865_1000764602 160
308 3300006881 Ga0068865_100406511 Ga0068865_1004065112 160
309 3300006881 Ga0068865_100767937 Ga0068865_1007679372 160
310 3300006881 Ga0068865_101383753 Ga0068865_1013837532 160
311 3300006914 Ga0075436_100000098 Ga0075436_10000009847 160
312 3300006914 Ga0075436_100033900 Ga0075436_1000339002 160
313 3300006914 Ga0075436_101048453 Ga0075436_1010484531 160
314 3300007076 Ga0075435_100223570 Ga0075435_1002235702 160
315 3300007076 Ga0075435_100369560 Ga0075435_1003695603 160
316 3300007788 Ga0099795_10057315 Ga0099795_100573152 160
317 3300009093 Ga0105240_10003190 Ga0105240_100031904 160
318 3300009093 Ga0105240_10008350 Ga0105240_100083508 160
319 3300009093 Ga0105240_10041567 Ga0105240_100415675 160
320 3300009093 Ga0105240_10055978 Ga0105240_100559784 160
321 3300009093 Ga0105240_10131371 Ga0105240_101313712 160
322 3300009093 Ga0105240_10142623 Ga0105240_101426232 160
323 3300009093 Ga0105240_10179371 Ga0105240_101793712 160
324 3300009093 Ga0105240_10206041 Ga0105240_102060412 160
325 3300009093 Ga0105240_10453700 Ga0105240_104537002 160
326 3300009093 Ga0105240_10465984 Ga0105240_104659841 160
327 3300009093 Ga0105240_10722596 Ga0105240_107225962 160
328 3300009093 Ga0105240_10811292 Ga0105240_108112921 160
329 3300009093 Ga0105240_10902905 Ga0105240_109029051 160
330 3300009093 Ga0105240_11255268 Ga0105240_112552682 160
331 3300009093 Ga0105240_11289482 Ga0105240_112894822 160
332 3300009094 Ga0111539_10017891 Ga0111539_1001789110 160
333 3300009098 Ga0105245_10003180 Ga0105245_100031805 160
334 3300009098 Ga0105245_10150733 Ga0105245_101507333 160
335 3300009098 Ga0105245_10502347 Ga0105245_105023472 160
336 3300009098 Ga0105245_11368090 Ga0105245_113680901 160
337 3300009098 Ga0105245_11401351 Ga0105245_114013511 160
338 3300009148 Ga0105243_10001197 Ga0105243_1000119721 160
339 3300009148 Ga0105243_10197578 Ga0105243_101975782 160
340 3300009174 Ga0105241_10021411 Ga0105241_100214115 160
341 3300009174 Ga0105241_10023341 Ga0105241_100233415 160
342 3300009174 Ga0105241_10032104 Ga0105241_100321046 160
343 3300009174 Ga0105241_10037543 Ga0105241_100375434 160
344 3300009174 Ga0105241_10083024 Ga0105241_100830242 160
345 3300009174 Ga0105241_10092007 Ga0105241_100920073 160
346 3300009174 Ga0105241_10897980 Ga0105241_108979801 160
347 3300009174 Ga0105241_11032134 Ga0105241_110321342 160
348 3300009176 Ga0105242_10100872 Ga0105242_101008723 160
349 3300009176 Ga0105242_10209808 Ga0105242_102098082 160
350 3300009176 Ga0105242_10237858 Ga0105242_102378582 160
351 3300009176 Ga0105242_10332987 Ga0105242_103329872 160
352 3300009176 Ga0105242_10458515 Ga0105242_104585153 160
353 3300009177 Ga0105248_10000001 Ga0105248_10000001615 160
354 3300009177 Ga0105248_10046527 Ga0105248_100465274 160
355 3300009177 Ga0105248_10167437 Ga0105248_101674374 160
356 3300009545 Ga0105237_10001328 Ga0105237_1000132834 160
357 3300009545 Ga0105237_10017408 Ga0105237_100174088 160
358 3300009545 Ga0105237_10119270 Ga0105237_101192702 160
359 3300009545 Ga0105237_10124628 Ga0105237_101246282 160
360 3300009545 Ga0105237_10152508 Ga0105237_101525084 160
361 3300009545 Ga0105237_10456066 Ga0105237_104560662 160
362 3300009545 Ga0105237_10479450 Ga0105237_104794502 160
363 3300009545 Ga0105237_10958028 Ga0105237_109580282 160
364 3300009551 Ga0105238_10001442 Ga0105238_1000144219 160
365 3300009551 Ga0105238_10007214 Ga0105238_1000721412 160
366 3300009551 Ga0105238_10029405 Ga0105238_100294055 160
367 3300009551 Ga0105238_10041074 Ga0105238_100410746 160
368 3300009551 Ga0105238_10084835 Ga0105238_100848356 160
369 3300009551 Ga0105238_10108063 Ga0105238_101080634 160
370 3300009551 Ga0105238_10109825 Ga0105238_101098255 160
371 3300009551 Ga0105238_10159880 Ga0105238_101598804 160
372 3300009551 Ga0105238_10194969 Ga0105238_101949692 160
373 3300009551 Ga0105238_10220135 Ga0105238_102201352 160
374 3300009551 Ga0105238_10346649 Ga0105238_103466492 160
375 3300009551 Ga0105238_10364576 Ga0105238_103645762 160
376 3300009551 Ga0105238_10449216 Ga0105238_104492163 160
377 3300009551 Ga0105238_10697084 Ga0105238_106970842 160
378 3300009551 Ga0105238_10918751 Ga0105238_109187512 160
379 3300009551 Ga0105238_11159832 Ga0105238_111598321 160
380 3300009551 Ga0105238_11537992 Ga0105238_115379921 160
381 3300009553 Ga0105249_10447220 Ga0105249_104472204 160
382 3300009553 Ga0105249_10591650 Ga0105249_105916501 160
383 3300010375 Ga0105239_10000733 Ga0105239_1000073323 160
384 3300010375 Ga0105239_10196315 Ga0105239_101963153 160
385 3300010375 Ga0105239_10234079 Ga0105239_102340793 160
386 3300010375 Ga0105239_10240178 Ga0105239_102401782 160
387 3300010375 Ga0105239_10249633 Ga0105239_102496334 160
388 3300010375 Ga0105239_10380124 Ga0105239_103801242 160
389 3300010375 Ga0105239_10435526 Ga0105239_104355262 160
390 3300010375 Ga0105239_10652841 Ga0105239_106528412 160
391 3300010375 Ga0105239_11448524 Ga0105239_114485241 160
392 3300010375 Ga0105239_11741428 Ga0105239_117414282 160
393 3300010375 Ga0105239_12822588 Ga0105239_128225881 160
394 3300011119 Ga0105246_10038893 Ga0105246_100388935 160
395 3300011119 Ga0105246_10240577 Ga0105246_102405772 160
396 3300011119 Ga0105246_10870075 Ga0105246_108700752 160
397 3300013100 Ga0157373_10022768 Ga0157373_100227685 160
398 3300013100 Ga0157373_10077361 Ga0157373_100773613 160
399 3300013100 Ga0157373_10176511 Ga0157373_101765113 160
400 3300013104 Ga0157370_10007427 Ga0157370_100074275 160
401 3300013104 Ga0157370_10015393 Ga0157370_100153937 160
402 3300013104 Ga0157370_10103482 Ga0157370_101034822 160
403 3300013104 Ga0157370_10140928 Ga0157370_101409283 160
404 3300013104 Ga0157370_10504837 Ga0157370_105048372 160
405 3300013105 Ga0157369_10078713 Ga0157369_100787136 160
406 3300013105 Ga0157369_10145336 Ga0157369_101453362 160
407 3300013105 Ga0157369_10269239 Ga0157369_102692392 160
408 3300013105 Ga0157369_11415477 Ga0157369_114154772 160
409 3300013296 Ga0157374_10186664 Ga0157374_101866645 160
410 3300013296 Ga0157374_11136986 Ga0157374_111369862 160
411 3300013297 Ga0157378_10027790 Ga0157378_100277905 160
412 3300013297 Ga0157378_10153330 Ga0157378_101533303 160
413 3300013297 Ga0157378_12083891 Ga0157378_120838911 160
414 3300013306 Ga0163162_10070776 Ga0163162_100707761 160
415 3300013306 Ga0163162_10102916 Ga0163162_101029162 160
416 3300013306 Ga0163162_10177304 Ga0163162_101773044 160
417 3300013307 Ga0157372_10010958 Ga0157372_100109584 160
418 3300013307 Ga0157372_10016824 Ga0157372_1001682410 160
419 3300013307 Ga0157372_10020242 Ga0157372_100202423 160
420 3300013307 Ga0157372_10368401 Ga0157372_103684012 160
421 3300013308 Ga0157375_10119739 Ga0157375_101197392 160
422 3300014325 Ga0163163_10006118 Ga0163163_100061189 160
423 3300014325 Ga0163163_10097247 Ga0163163_100972475 160
424 3300014325 Ga0163163_10103553 Ga0163163_101035534 160
425 3300014325 Ga0163163_10292356 Ga0163163_102923563 160
426 3300014325 Ga0163163_10510237 Ga0163163_105102372 160
427 3300014326 Ga0157380_10608657 Ga0157380_106086572 160
428 3300014497 Ga0182008_10458552 Ga0182008_104585521 160
429 3300014745 Ga0157377_10268231 Ga0157377_102682312 160
430 3300014968 Ga0157379_10005723 Ga0157379_100057238 160
431 3300014968 Ga0157379_10010207 Ga0157379_100102076 160
432 3300014968 Ga0157379_10013038 Ga0157379_100130385 160
433 3300014968 Ga0157379_10023301 Ga0157379_100233015 160
434 3300014968 Ga0157379_10056367 Ga0157379_100563674 160
435 3300014968 Ga0157379_10063538 Ga0157379_100635384 160
436 3300014968 Ga0157379_10288473 Ga0157379_102884732 160
437 3300014968 Ga0157379_11036755 Ga0157379_110367552 160
438 3300014969 Ga0157376_10282182 Ga0157376_102821822 160
439 3300014969 Ga0157376_12630317 Ga0157376_126303171 160
440 3300017792 Ga0163161_10084162 Ga0163161_100841623 160
441 3300021358 Ga0213873_10069974 Ga0213873_100699742 160
442 3300021384 Ga0213876_10000388 Ga0213876_1000038835 160
443 3300021384 Ga0213876_10000483 Ga0213876_100004837 160
444 3300021384 Ga0213876_10061775 Ga0213876_100617753 160
445 3300021388 Ga0213875_10339657 Ga0213875_103396571 160
446 3300024225 Ga0224572_1005619 Ga0224572_10056192 160
447 3300024227 Ga0228598_1032500 Ga0228598_10325002 160
448 3300024227 Ga0228598_1048399 Ga0228598_10483991 160
449 3300025261 Ga0209233_1000045 Ga0209233_1000045315 160
450 3300025261 Ga0209233_1004631 Ga0209233_10046313 160
451 3300025297 Ga0209758_1000008 Ga0209758_1000008956 160
452 3300025302 Ga0207426_1037572 Ga0207426_10375721 160
453 3300025899 Ga0207642_10508668 Ga0207642_105086681 160
454 3300025901 Ga0207688_10116409 Ga0207688_101164093 160
455 3300025903 Ga0207680_10002065 Ga0207680_100020655 160
456 3300025904 Ga0207647_10083618 Ga0207647_100836182 160
457 3300025904 Ga0207647_10253713 Ga0207647_102537131 160
458 3300025906 Ga0207699_10000133 Ga0207699_1000013347 160
459 3300025906 Ga0207699_10083145 Ga0207699_100831453 160
460 3300025908 Ga0207643_10045800 Ga0207643_100458004 160
461 3300025909 Ga0207705_10000058 Ga0207705_10000058118 160
462 3300025909 Ga0207705_10009572 Ga0207705_100095724 160
463 3300025909 Ga0207705_10063229 Ga0207705_100632294 160
464 3300025909 Ga0207705_10198421 Ga0207705_101984212 160
465 3300025911 Ga0207654_10026187 Ga0207654_100261873 160
466 3300025911 Ga0207654_10030302 Ga0207654_100303024 160
467 3300025911 Ga0207654_10279994 Ga0207654_102799942 160
468 3300025911 Ga0207654_10392884 Ga0207654_103928841 160
469 3300025911 Ga0207654_10625563 Ga0207654_106255631 160
470 3300025912 Ga0207707_10000001 Ga0207707_10000001664 160
471 3300025912 Ga0207707_10001851 Ga0207707_1000185112 160
472 3300025912 Ga0207707_10052643 Ga0207707_100526436 160
473 3300025912 Ga0207707_10076001 Ga0207707_100760014 160
474 3300025912 Ga0207707_10089456 Ga0207707_100894563 160
475 3300025912 Ga0207707_10201843 Ga0207707_102018433 160
476 3300025913 Ga0207695_10000004 Ga0207695_10000004978 160
477 3300025913 Ga0207695_10009649 Ga0207695_100096496 160
478 3300025913 Ga0207695_10025972 Ga0207695_100259727 160
479 3300025913 Ga0207695_10185467 Ga0207695_101854672 160
480 3300025913 Ga0207695_10265172 Ga0207695_102651722 160
481 3300025913 Ga0207695_10318130 Ga0207695_103181302 160
482 3300025913 Ga0207695_10510702 Ga0207695_105107022 160
483 3300025913 Ga0207695_11373346 Ga0207695_113733461 160
484 3300025914 Ga0207671_10008524 Ga0207671_100085245 160
485 3300025914 Ga0207671_10039659 Ga0207671_100396594 160
486 3300025914 Ga0207671_10124152 Ga0207671_101241524 160
487 3300025914 Ga0207671_10266508 Ga0207671_102665083 160
488 3300025915 Ga0207693_10000035 Ga0207693_1000003564 160
489 3300025915 Ga0207693_10000145 Ga0207693_1000014526 160
490 3300025915 Ga0207693_10345818 Ga0207693_103458182 160
491 3300025915 Ga0207693_10664415 Ga0207693_106644152 160
492 3300025916 Ga0207663_10132565 Ga0207663_101325653 160
493 3300025916 Ga0207663_10444347 Ga0207663_104443472 160
494 3300025916 Ga0207663_10529375 Ga0207663_105293752 160
495 3300025917 Ga0207660_10000343 Ga0207660_1000034319 160
496 3300025917 Ga0207660_10005636 Ga0207660_100056364 160
497 3300025917 Ga0207660_10260396 Ga0207660_102603962 160
498 3300025919 Ga0207657_10001163 Ga0207657_1000116328 160
499 3300025919 Ga0207657_10031643 Ga0207657_100316432 160
500 3300025919 Ga0207657_10255897 Ga0207657_102558973 160
501 3300025919 Ga0207657_10339033 Ga0207657_103390332 160
502 3300025920 Ga0207649_10000713 Ga0207649_1000071316 160
503 3300025920 Ga0207649_10045683 Ga0207649_100456834 160
504 3300025921 Ga0207652_10001515 Ga0207652_1000151515 160
505 3300025921 Ga0207652_10001611 Ga0207652_100016119 160
506 3300025921 Ga0207652_10037141 Ga0207652_100371415 160
507 3300025921 Ga0207652_10226186 Ga0207652_102261863 160
508 3300025923 Ga0207681_10326529 Ga0207681_103265292 160
509 3300025924 Ga0207694_10000010 Ga0207694_1000001019 160
510 3300025924 Ga0207694_10019979 Ga0207694_100199791 160
511 3300025924 Ga0207694_10031229 Ga0207694_100312292 160
512 3300025924 Ga0207694_10125538 Ga0207694_101255384 160
513 3300025924 Ga0207694_10164227 Ga0207694_101642274 160
514 3300025924 Ga0207694_10174989 Ga0207694_101749892 160
515 3300025924 Ga0207694_10307457 Ga0207694_103074572 160
516 3300025924 Ga0207694_10479462 Ga0207694_104794622 160
517 3300025924 Ga0207694_10578392 Ga0207694_105783922 160
518 3300025924 Ga0207694_10824958 Ga0207694_108249581 160
519 3300025924 Ga0207694_10893792 Ga0207694_108937921 160
520 3300025925 Ga0207650_10078032 Ga0207650_100780323 160
521 3300025925 Ga0207650_10106481 Ga0207650_101064812 160
522 3300025926 Ga0207659_10114725 Ga0207659_101147252 160
523 3300025927 Ga0207687_10006441 Ga0207687_100064415 160
524 3300025927 Ga0207687_10041918 Ga0207687_100419185 160
525 3300025928 Ga0207700_10000887 Ga0207700_1000088711 160
526 3300025928 Ga0207700_10073149 Ga0207700_100731491 160
527 3300025928 Ga0207700_10270732 Ga0207700_102707323 160
528 3300025929 Ga0207664_10034382 Ga0207664_100343822 160
529 3300025929 Ga0207664_10974179 Ga0207664_109741791 160
530 3300025931 Ga0207644_10110370 Ga0207644_101103702 160
531 3300025931 Ga0207644_10148518 Ga0207644_101485183 160
532 3300025932 Ga0207690_10176985 Ga0207690_101769852 160
533 3300025932 Ga0207690_10650126 Ga0207690_106501262 160
534 3300025934 Ga0207686_10069968 Ga0207686_100699682 160
535 3300025934 Ga0207686_10072192 Ga0207686_100721925 160
536 3300025934 Ga0207686_10228583 Ga0207686_102285832 160
537 3300025934 Ga0207686_10297675 Ga0207686_102976751 160
538 3300025935 Ga0207709_10069009 Ga0207709_100690092 160
539 3300025935 Ga0207709_10145616 Ga0207709_101456163 160
540 3300025936 Ga0207670_10884461 Ga0207670_108844612 160
541 3300025939 Ga0207665_10399728 Ga0207665_103997282 160
542 3300025940 Ga0207691_10255183 Ga0207691_102551832 160
543 3300025940 Ga0207691_10322190 Ga0207691_103221901 160
544 3300025941 Ga0207711_10000001 Ga0207711_100000011256 160
545 3300025941 Ga0207711_10103045 Ga0207711_101030454 160
546 3300025941 Ga0207711_10157015 Ga0207711_101570151 160
547 3300025941 Ga0207711_11854189 Ga0207711_118541891 160
548 3300025944 Ga0207661_10245798 Ga0207661_102457982 160
549 3300025944 Ga0207661_10743783 Ga0207661_107437832 160
550 3300025944 Ga0207661_11126067 Ga0207661_111260671 160
551 3300025945 Ga0207679_10693291 Ga0207679_106932912 160
552 3300025949 Ga0207667_10000116 Ga0207667_100001163 160
553 3300025949 Ga0207667_10010486 Ga0207667_100104869 160
554 3300025949 Ga0207667_10051617 Ga0207667_100516174 160
555 3300025949 Ga0207667_10054170 Ga0207667_100541703 160
556 3300025949 Ga0207667_10415966 Ga0207667_104159662 160
557 3300025960 Ga0207651_10060661 Ga0207651_100606614 160
558 3300025961 Ga0207712_10175517 Ga0207712_101755173 160
559 3300025961 Ga0207712_11345309 Ga0207712_113453091 160
560 3300025981 Ga0207640_10181371 Ga0207640_101813713 160
561 3300025981 Ga0207640_11099119 Ga0207640_110991191 160
562 3300025986 Ga0207658_10072101 Ga0207658_100721015 160
563 3300025986 Ga0207658_10153914 Ga0207658_101539144 160
564 3300025986 Ga0207658_10838691 Ga0207658_108386912 160
565 3300026023 Ga0207677_10362415 Ga0207677_103624152 160
566 3300026023 Ga0207677_10402358 Ga0207677_104023582 160
567 3300026035 Ga0207703_10007826 Ga0207703_100078264 160
568 3300026035 Ga0207703_10024046 Ga0207703_100240466 160
569 3300026035 Ga0207703_10028607 Ga0207703_100286074 160
570 3300026035 Ga0207703_10033739 Ga0207703_100337394 160
571 3300026041 Ga0207639_10070415 Ga0207639_100704156 160
572 3300026041 Ga0207639_10094996 Ga0207639_100949963 160
573 3300026041 Ga0207639_10354036 Ga0207639_103540362 160
574 3300026041 Ga0207639_10761296 Ga0207639_107612961 160
575 3300026067 Ga0207678_10024654 Ga0207678_100246542 160
576 3300026067 Ga0207678_10425809 Ga0207678_104258093 160
577 3300026078 Ga0207702_10000007 Ga0207702_10000007122 160
578 3300026078 Ga0207702_10000012 Ga0207702_1000001253 160
579 3300026078 Ga0207702_10019910 Ga0207702_100199106 160
580 3300026078 Ga0207702_10045111 Ga0207702_100451115 160
581 3300026078 Ga0207702_10062926 Ga0207702_100629261 160
582 3300026078 Ga0207702_10516094 Ga0207702_105160942 160
583 3300026078 Ga0207702_10857662 Ga0207702_108576622 160
584 3300026089 Ga0207648_10022114 Ga0207648_100221145 160
585 3300026089 Ga0207648_10808173 Ga0207648_108081732 160
586 3300026095 Ga0207676_10032252 Ga0207676_100322525 160
587 3300026095 Ga0207676_10803188 Ga0207676_108031881 160
588 3300026116 Ga0207674_10000107 Ga0207674_1000010738 160
589 3300026116 Ga0207674_10094261 Ga0207674_100942616 160
590 3300026116 Ga0207674_10136288 Ga0207674_101362885 160
591 3300026116 Ga0207674_10405724 Ga0207674_104057242 160
592 3300026116 Ga0207674_10660046 Ga0207674_106600461 160
593 3300026118 Ga0207675_100115394 Ga0207675_1001153942 160
594 3300026118 Ga0207675_100955280 Ga0207675_1009552802 160
595 3300026121 Ga0207683_10015302 Ga0207683_100153024 160
596 3300026121 Ga0207683_10145708 Ga0207683_101457081 160
597 3300026142 Ga0207698_10002022 Ga0207698_1000202213 160
598 3300026142 Ga0207698_10050270 Ga0207698_100502704 160
599 3300026142 Ga0207698_10206682 Ga0207698_102066822 160
600 3300026142 Ga0207698_10240572 Ga0207698_102405723 160
601 3300027907 Ga0207428_10200811 Ga0207428_102008113 160
602 3300028379 Ga0268266_10000357 Ga0268266_1000035762 160
603 3300028379 Ga0268266_10015674 Ga0268266_100156742 160
604 3300028379 Ga0268266_10017377 Ga0268266_100173774 160
605 3300028379 Ga0268266_10033283 Ga0268266_100332836 160
606 3300028379 Ga0268266_10282334 Ga0268266_102823342 160
607 3300028379 Ga0268266_10311014 Ga0268266_103110143 160
608 3300028379 Ga0268266_10495887 Ga0268266_104958872 160
609 3300028379 Ga0268266_10617939 Ga0268266_106179391 160
610 3300028381 Ga0268264_10094282 Ga0268264_100942824 160
611 3300028381 Ga0268264_10146423 Ga0268264_101464235 160
612 3300028381 Ga0268264_10621808 Ga0268264_106218082 160
613 3300028577 Ga0265318_10000082 Ga0265318_1000008270 160
614 3300028786 Ga0307517_10137249 Ga0307517_101372494 160
615 3300028800 Ga0265338_10000006 Ga0265338_10000006211 160
616 3300028800 Ga0265338_10032945 Ga0265338_100329456 160
617 3300028800 Ga0265338_10039132 Ga0265338_100391325 160
618 3300028800 Ga0265338_10067710 Ga0265338_100677104 160
619 3300028800 Ga0265338_10160012 Ga0265338_101600123 160
620 3300028800 Ga0265338_10172698 Ga0265338_101726982 160
621 3300028800 Ga0265338_10258806 Ga0265338_102588062 160
622 3300028800 Ga0265338_10538297 Ga0265338_105382972 160
623 3300030760 Ga0265762_1022919 Ga0265762_10229192 160
624 3300031090 Ga0265760_10065112 Ga0265760_100651122 160
625 3300031235 Ga0265330_10017766 Ga0265330_100177663 160
626 3300031235 Ga0265330_10117172 Ga0265330_101171721 160
627 3300031235 Ga0265330_10126415 Ga0265330_101264152 160
628 3300031235 Ga0265330_10264748 Ga0265330_102647481 160
629 3300031238 Ga0265332_10045629 Ga0265332_100456293 160
630 3300031238 Ga0265332_10229408 Ga0265332_102294082 160
631 3300031239 Ga0265328_10077249 Ga0265328_100772492 160
632 3300031240 Ga0265320_10000039 Ga0265320_1000003918 160
633 3300031240 Ga0265320_10087964 Ga0265320_100879642 160
634 3300031240 Ga0265320_10133739 Ga0265320_101337392 160
635 3300031240 Ga0265320_10218157 Ga0265320_102181572 160
636 3300031241 Ga0265325_10000007 Ga0265325_10000007212 160
637 3300031241 Ga0265325_10000079 Ga0265325_1000007954 160
638 3300031241 Ga0265325_10000719 Ga0265325_1000071913 160
639 3300031241 Ga0265325_10000967 Ga0265325_100009675 160
640 3300031241 Ga0265325_10011992 Ga0265325_100119921 160
641 3300031241 Ga0265325_10039095 Ga0265325_100390953 160
642 3300031241 Ga0265325_10076961 Ga0265325_100769612 160
643 3300031247 Ga0265340_10000096 Ga0265340_100000968 160
644 3300031247 Ga0265340_10040690 Ga0265340_100406901 160
645 3300031247 Ga0265340_10120477 Ga0265340_101204772 160
646 3300031247 Ga0265340_10230810 Ga0265340_102308102 160
647 3300031247 Ga0265340_10287215 Ga0265340_102872152 160
648 3300031249 Ga0265339_10001422 Ga0265339_100014227 160
649 3300031249 Ga0265339_10009647 Ga0265339_100096473 160
650 3300031249 Ga0265339_10010793 Ga0265339_100107932 160
651 3300031249 Ga0265339_10024789 Ga0265339_100247894 160
652 3300031249 Ga0265339_10033205 Ga0265339_100332054 160
653 3300031249 Ga0265339_10044716 Ga0265339_100447164 160
654 3300031249 Ga0265339_10168870 Ga0265339_101688702 160
655 3300031250 Ga0265331_10000009 Ga0265331_1000000991 160
656 3300031250 Ga0265331_10000212 Ga0265331_1000021226 160
657 3300031250 Ga0265331_10004939 Ga0265331_1000493910 160
658 3300031250 Ga0265331_10033930 Ga0265331_100339302 160
659 3300031250 Ga0265331_10035419 Ga0265331_100354193 160
660 3300031250 Ga0265331_10059058 Ga0265331_100590582 160
661 3300031250 Ga0265331_10095890 Ga0265331_100958902 160
662 3300031251 Ga0265327_10000007 Ga0265327_10000007258 160
663 3300031344 Ga0265316_10000936 Ga0265316_1000093621 160
664 3300031344 Ga0265316_10008650 Ga0265316_100086504 160
665 3300031344 Ga0265316_10022243 Ga0265316_100222435 160
666 3300031344 Ga0265316_10030437 Ga0265316_100304372 160
667 3300031344 Ga0265316_10142806 Ga0265316_101428062 160
668 3300031344 Ga0265316_10170606 Ga0265316_101706062 160
669 3300031344 Ga0265316_10173197 Ga0265316_101731971 160
670 3300031344 Ga0265316_10223662 Ga0265316_102236622 160
671 3300031344 Ga0265316_10223981 Ga0265316_102239812 160
672 3300031344 Ga0265316_10395879 Ga0265316_103958792 160
673 3300031344 Ga0265316_10546327 Ga0265316_105463271 160
674 3300031344 Ga0265316_10598323 Ga0265316_105983232 160
675 3300031344 Ga0265316_10835927 Ga0265316_108359271 160
676 3300031456 Ga0307513_10285806 Ga0307513_102858062 160
677 3300031595 Ga0265313_10001902 Ga0265313_1000190211 160
678 3300031595 Ga0265313_10003138 Ga0265313_1000313811 160
679 3300031595 Ga0265313_10005466 Ga0265313_1000546612 160
680 3300031595 Ga0265313_10022563 Ga0265313_100225635 160
681 3300031595 Ga0265313_10072246 Ga0265313_100722462 160
682 3300031595 Ga0265313_10133665 Ga0265313_101336652 160
683 3300031595 Ga0265313_10143935 Ga0265313_101439352 160
684 3300031595 Ga0265313_10280843 Ga0265313_102808431 160
685 3300031711 Ga0265314_10003096 Ga0265314_1000309616 160
686 3300031711 Ga0265314_10010041 Ga0265314_100100416 160
687 3300031711 Ga0265314_10021019 Ga0265314_100210198 160
688 3300031711 Ga0265314_10049633 Ga0265314_100496334 160
689 3300031711 Ga0265314_10067096 Ga0265314_100670963 160
690 3300031711 Ga0265314_10075023 Ga0265314_100750233 160
691 3300031711 Ga0265314_10090308 Ga0265314_100903083 160
692 3300031711 Ga0265314_10126574 Ga0265314_101265742 160
693 3300031711 Ga0265314_10132386 Ga0265314_101323861 160
694 3300031711 Ga0265314_10145242 Ga0265314_101452422 160
695 3300031711 Ga0265314_10150855 Ga0265314_101508552 160
696 3300031711 Ga0265314_10297721 Ga0265314_102977212 160
697 3300031711 Ga0265314_10359740 Ga0265314_103597401 160
698 3300031712 Ga0265342_10022757 Ga0265342_100227575 160
699 3300031712 Ga0265342_10030960 Ga0265342_100309606 160
700 3300031712 Ga0265342_10044100 Ga0265342_100441004 160
701 3300031712 Ga0265342_10060617 Ga0265342_100606173 160
702 3300031712 Ga0265342_10099607 Ga0265342_100996073 160
703 3300031730 Ga0307516_10007154 Ga0307516_100071545 160
704 3300031730 Ga0307516_10007941 Ga0307516_1000794112 160
705 3300035085 Ga0373929_0229211 Ga0373929_0229211_28_510 160
706 3300035089 Ga0373944_0194262 Ga0373944_0194262_198_680 160
707 3300035092 Ga0373952_0031461 Ga0373952_0031461_516_998 160
708 3300035111 Ga0373923_0012135 Ga0373923_0012135_866_1348 160
709 3300035111 Ga0373923_0054576 Ga0373923_0054576_377_859 160
710 3300035111 Ga0373923_0126678 Ga0373923_0126678_283_765 160
711 3300035116 Ga0373945_0144424 Ga0373945_0144424_370_852 160
712 3300035117 Ga0373953_0050352 Ga0373953_0050352_113_595 160
713 3300035117 Ga0373953_0241486 Ga0373953_0241486_73_555 160
714 3300035118 Ga0373954_0065479 Ga0373954_0065479_287_769 160
715 3300035118 Ga0373954_0066270 Ga0373954_0066270_818_1300 160
716 3300035118 Ga0373954_0136386 Ga0373954_0136386_184_666 160
717 3300035119 Ga0373956_0023081 Ga0373956_0023081_820_1302 160
718 3300035119 Ga0373956_0065371 Ga0373956_0065371_736_1218 160
719 3300035119 Ga0373956_0180208 Ga0373956_0180208_31_513 160
720 3300035120 Ga0373957_0043071 Ga0373957_0043071_206_688 160
721 3300035170 Ga0373943_0390685 Ga0373943_0390685_104_586 160
722 3300035172 Ga0373955_0032059 Ga0373955_0032059_943_1425 160
723 3300035172 Ga0373955_0043618 Ga0373955_0043618_352_834 160
724 3300035172 Ga0373955_0051751 Ga0373955_0051751_684_1166 160
725 3300035410 Ga0373924_0179037 Ga0373924_0179037_213_695 160
726 3300035691 Ga0373931_0029941 Ga0373931_0029941_735_1217 160
727 3300035691 Ga0373931_0633688 Ga0373931_0633688_57_539 160
728 3300035692 Ga0373935_0447515 Ga0373935_0447515_214_696 160
729 3300035695 Ga0373927_0528139 Ga0373927_0528139_122_604 160
730 3300035724 Ga0373933_0025178 Ga0373933_0025178_2662_3144 160
731 3300035724 Ga0373933_0034446 Ga0373933_0034446_1325_1807 160
732 3300035724 Ga0373933_0075443 Ga0373933_0075443_457_939 160
733 3300035724 Ga0373933_0233500 Ga0373933_0233500_236_718 160
734 3300035724 Ga0373933_0821321 Ga0373933_0821321_22_504 160
735 3300035725 Ga0373947_0011553 Ga0373947_0011553_4406_4888 160
736 3300036401 Ga0373937_0009750 Ga0373937_0009750_2412_2894 160
737 3300036401 Ga0373937_0010384 Ga0373937_0010384_2545_3027 160
738 3300036401 Ga0373937_0060950 Ga0373937_0060950_2643_3125 160
739 3300036401 Ga0373937_0071295 Ga0373937_0071295_1400_1882 160
740 3300036401 Ga0373937_0789074 Ga0373937_0789074_95_577 160
741 3300036401 Ga0373937_0825298 Ga0373937_0825298_208_690 160
742 3300037068 Ga0373925_0031160 Ga0373925_0031160_669_1151 160
743 3300037068 Ga0373925_0044126 Ga0373925_0044126_2056_2538 160
744 3300037068 Ga0373925_0054428 Ga0373925_0054428_1594_2076 160
745 3300037068 Ga0373925_0213161 Ga0373925_0213161_395_877 160
746 3300037068 Ga0373925_0236591 Ga0373925_0236591_17_499 160
747 3300037068 Ga0373925_0740031 Ga0373925_0740031_77_559 160
748 3300037068 Ga0373925_1459805 Ga0373925_1459805_49_531 160
749 3300037312 Ga0395899_0060219 Ga0395899_0060219_1232_1714 160
750 3300037418 Ga0395900_0656383 Ga0395900_0656383_473_955 160
751 3300037466 Ga0395898_0818680 Ga0395898_0818680_254_736 160
752 3300037471 Ga0395905_0953991 Ga0395905_0953991_149_631 160
753 3300037853 Ga0436364_0045683 Ga0436364_0045683_156_638 160
754 3300038443 Ga0395901_0448753 Ga0395901_0448753_317_799 160
755 3300039437 Ga0436365_0151405 Ga0436365_0151405_6141_6623 160
756 3300039437 Ga0436365_0412683 Ga0436365_0412683_31461_31943 160
757 3300039437 Ga0436365_0550500 Ga0436365_0550500_829_1311 160
758 3300039437 Ga0436365_0678770 Ga0436365_0678770_1164_1646 160
759 3300039437 Ga0436365_0991473 Ga0436365_0991473_34254_34736 160
760 3300039437 Ga0436365_1551085 Ga0436365_1551085_38_520 160
761 3300039438 Ga0436360_0900296 Ga0436360_0900296_703_1185 160
762 3300039450 Ga0436363_0377217 Ga0436363_0377217_24_506 160
763 3300039450 Ga0436363_1394367 Ga0436363_1394367_87_569 160
764 3300039450 Ga0436363_1716475 Ga0436363_1716475_5219_5701 160
765 3300039453 Ga0436362_0193065 Ga0436362_0193065_760_1242 160
766 3300039453 Ga0436362_0413829 Ga0436362_0413829_276_758 160
767 3300041451 Ga0451791_0308433 Ga0451791_0308433_62_544 160
768 3300041505 Ga0451849_1436860 Ga0451849_1436860_42_524 160
769 3300044842 Ga0466957_0489198 Ga0466957_0489198_66_551 160
770 3300045051 Ga0451576_0238219 Ga0451576_0238219_353_835 160
771 3300046452 Ga0495617_080398 Ga0495617_080398_302_784 160
772 3300046454 Ga0495592_0002029 Ga0495592_0002029_13257_13739 160
773 3300046462 Ga0495651_0088138 Ga0495651_0088138_297_779 160
774 3300046462 Ga0495651_0325111 Ga0495651_0325111_461_943 160
775 3300046472 Ga0495580_0118273 Ga0495580_0118273_1261_1743 160
776 3300046477 Ga0495664_0039971 Ga0495664_0039971_1995_2477 160
777 3300046477 Ga0495664_0212652 Ga0495664_0212652_181_663 160
778 3300046492 Ga0495585_0169679 Ga0495585_0169679_228_710 160
779 3300046507 Ga0495606_0161475 Ga0495606_0161475_660_1142 160
780 3300046511 Ga0495608_0173215 Ga0495608_0173215_831_1313 160
781 3300046516 Ga0495628_0010755 Ga0495628_0010755_6060_6542 160
782 3300046516 Ga0495628_0696989 Ga0495628_0696989_139_621 160
783 3300046529 Ga0495652_0035285 Ga0495652_0035285_925_1407 160
784 3300046529 Ga0495652_0051267 Ga0495652_0051267_316_798 160
785 3300046529 Ga0495652_0080670 Ga0495652_0080670_761_1243 160
786 3300046531 Ga0495665_0332784 Ga0495665_0332784_53_535 160
787 3300046536 Ga0495587_0145848 Ga0495587_0145848_305_787 160
788 3300046543 Ga0495645_0004240 Ga0495645_0004240_3263_3745 160
789 3300046543 Ga0495645_0031707 Ga0495645_0031707_1029_1511 160
790 3300046543 Ga0495645_0406883 Ga0495645_0406883_335_817 160
791 3300046557 Ga0495622_0002481 Ga0495622_0002481_7850_8332 160
792 3300046616 Ga0495668_0254767 Ga0495668_0254767_449_931 160
793 3300046648 Ga0495611_0114925 Ga0495611_0114925_19_501 160
794 3300046660 Ga0495625_0127072 Ga0495625_0127072_1108_1590 160
795 3300046663 Ga0495635_0050975 Ga0495635_0050975_1227_1709 160
796 3300046665 Ga0495661_0208571 Ga0495661_0208571_149_631 160
797 3300046675 Ga0495657_0057811 Ga0495657_0057811_2011_2493 160
798 3300046675 Ga0495657_0082257 Ga0495657_0082257_457_939 160
799 3300046678 Ga0495599_0002546 Ga0495599_0002546_3694_4176 160
800 3300046678 Ga0495599_0069790 Ga0495599_0069790_487_969 160
801 3300046679 Ga0495623_0031161 Ga0495623_0031161_2029_2511 160
802 3300046680 Ga0495646_0477610 Ga0495646_0477610_65_547 160
803 3300046680 Ga0495646_0637313 Ga0495646_0637313_33_515 160
804 3300046681 Ga0495647_0120355 Ga0495647_0120355_22_504 160
805 3300046689 Ga0495613_0372475 Ga0495613_0372475_287_769 160
806 3300046691 Ga0495670_0405797 Ga0495670_0405797_152_634 160
807 3300046809 Ga0495600_0003255 Ga0495600_0003255_4263_4745 160
808 3300047317 Ga0495604_0008492 Ga0495604_0008492_3706_4188 160
809 3300047317 Ga0495604_0471718 Ga0495604_0471718_161_643 160
810 3300047318 Ga0495636_0156828 Ga0495636_0156828_372_854 160
811 3300047319 Ga0495674_0236011 Ga0495674_0236011_405_887 160
812 3300047320 Ga0495672_0261542 Ga0495672_0261542_320_802 160
813 3300047322 Ga0495680_0009974 Ga0495680_0009974_1954_2436 160
814 3300047322 Ga0495680_0186175 Ga0495680_0186175_215_697 160
815 3300047444 Ga0495675_0079273 Ga0495675_0079273_259_741 160
816 3300047444 Ga0495675_0080417 Ga0495675_0080417_819_1301 160
817 3300047469 Ga0495673_0084336 Ga0495673_0084336_141_623 160
818 3300047471 Ga0495684_0139083 Ga0495684_0139083_965_1447 160
819 3300048088 Ga0495602_0012502 Ga0495602_0012502_1331_1813 160
820 3300048088 Ga0495602_0345175 Ga0495602_0345175_102_584 160
821 3300048904 Ga0496101_0115020 Ga0496101_0115020_1398_1880 160
822 3300048907 Ga0496104_0503965 Ga0496104_0503965_332_814 160
823 3300048912 Ga0496109_0665898 Ga0496109_0665898_199_681 160
824 3300048915 Ga0496112_0179882 Ga0496112_0179882_1526_2008 160
825 3300048916 Ga0496113_0092650 Ga0496113_0092650_390_872 160
826 3300048918 Ga0496115_0296705 Ga0496115_0296705_310_792 160
827 3300048924 Ga0496121_0000342 Ga0496121_0000342_64748_65230 160
828 3300048929 Ga0496126_0004475 Ga0496126_0004475_15086_15568 160
829 3300048929 Ga0496126_0085460 Ga0496126_0085460_736_1218 160
830 3300049460 Ga0495682_0014850 Ga0495682_0014850_234_716 160
831 3300049568 Ga0501031_0007188 Ga0501031_0007188_305_787 160
832 3300049569 Ga0501032_0118681 Ga0501032_0118681_53_535 160
833 3300049569 Ga0501032_0163452 Ga0501032_0163452_937_1419 160
834 3300049569 Ga0501032_0222494 Ga0501032_0222494_24_506 160
835 3300049569 Ga0501032_0404806 Ga0501032_0404806_289_771 160
836 3300049570 Ga0501033_0009915 Ga0501033_0009915_6685_7167 160
837 3300049570 Ga0501033_0035884 Ga0501033_0035884_839_1321 160
838 3300049570 Ga0501033_0042084 Ga0501033_0042084_1027_1509 160
839 3300049570 Ga0501033_0090122 Ga0501033_0090122_1607_2089 160
840 3300049570 Ga0501033_0110926 Ga0501033_0110926_339_821 160
841 3300049570 Ga0501033_0129043 Ga0501033_0129043_1150_1632 160
842 3300049570 Ga0501033_0170018 Ga0501033_0170018_285_767 160
843 3300049570 Ga0501033_0189619 Ga0501033_0189619_541_1023 160
844 3300049570 Ga0501033_0208981 Ga0501033_0208981_90_572 160
845 3300049570 Ga0501033_0310960 Ga0501033_0310960_344_826 160
846 3300049570 Ga0501033_0362231 Ga0501033_0362231_157_639 160
847 3300049570 Ga0501033_0803200 Ga0501033_0803200_66_548 160
848 3300049570 Ga0501033_0881066 Ga0501033_0881066_13_495 160
849 3300049571 Ga0501034_0122632 Ga0501034_0122632_104_586 160
850 3300049571 Ga0501034_0187479 Ga0501034_0187479_1444_1926 160
851 3300049571 Ga0501034_0200527 Ga0501034_0200527_464_946 160
852 3300049571 Ga0501034_0226097 Ga0501034_0226097_685_1167 160
853 3300049571 Ga0501034_0478455 Ga0501034_0478455_558_1040 160
854 3300049572 Ga0501036_0260047 Ga0501036_0260047_528_1010 160
855 3300049572 Ga0501036_0289756 Ga0501036_0289756_325_855 160
856 3300049572 Ga0501036_0412702 Ga0501036_0412702_612_1094 160
857 3300049573 Ga0501037_0010726 Ga0501037_0010726_1845_2327 160
858 3300049573 Ga0501037_0011338 Ga0501037_0011338_526_1008 160
859 3300049573 Ga0501037_0151712 Ga0501037_0151712_165_647 160
860 3300049573 Ga0501037_0347874 Ga0501037_0347874_449_979 160
861 3300049574 Ga0501038_0022382 Ga0501038_0022382_1052_1534 160
862 3300049574 Ga0501038_0060653 Ga0501038_0060653_399_881 160
863 3300049574 Ga0501038_0094116 Ga0501038_0094116_246_728 160
864 3300049574 Ga0501038_0108913 Ga0501038_0108913_738_1268 160
865 3300049574 Ga0501038_0123152 Ga0501038_0123152_1235_1717 160
866 3300049574 Ga0501038_0430508 Ga0501038_0430508_78_560 160
867 3300049574 Ga0501038_0954687 Ga0501038_0954687_54_536 160
868 3300049575 Ga0501039_0200760 Ga0501039_0200760_541_1023 160
869 3300049575 Ga0501039_1137685 Ga0501039_1137685_70_552 160
870 3300049576 Ga0501040_0271842 Ga0501040_0271842_65_547 160
871 3300049579 Ga0501043_0072392 Ga0501043_0072392_2135_2617 160
872 3300049579 Ga0501043_0076031 Ga0501043_0076031_1440_1922 160
873 3300049579 Ga0501043_0099636 Ga0501043_0099636_1415_1897 160
874 3300049579 Ga0501043_0110245 Ga0501043_0110245_594_1076 160
875 3300049579 Ga0501043_0152686 Ga0501043_0152686_746_1228 160
876 3300049579 Ga0501043_0340253 Ga0501043_0340253_379_861 160
877 3300049580 Ga0501046_0008706 Ga0501046_0008706_2581_3063 160
878 3300049580 Ga0501046_0011955 Ga0501046_0011955_5983_6465 160
879 3300049580 Ga0501046_0107284 Ga0501046_0107284_989_1519 160
880 3300049580 Ga0501046_0186904 Ga0501046_0186904_266_748 160
881 3300049580 Ga0501046_0268467 Ga0501046_0268467_236_718 160
882 3300049580 Ga0501046_0275366 Ga0501046_0275366_446_928 160
883 3300049580 Ga0501046_1111720 Ga0501046_1111720_19_501 160
884 3300049581 Ga0501047_0002340 Ga0501047_0002340_14547_15029 160
885 3300049581 Ga0501047_0011849 Ga0501047_0011849_3440_3922 160
886 3300049581 Ga0501047_0016948 Ga0501047_0016948_1667_2149 160
887 3300049581 Ga0501047_0025770 Ga0501047_0025770_3016_3498 160
888 3300049581 Ga0501047_0027307 Ga0501047_0027307_1484_1966 160
889 3300049581 Ga0501047_0088473 Ga0501047_0088473_204_686 160
890 3300049581 Ga0501047_0117654 Ga0501047_0117654_206_736 160
891 3300049581 Ga0501047_0186978 Ga0501047_0186978_981_1463 160
892 3300049581 Ga0501047_0255607 Ga0501047_0255607_1038_1520 160
893 3300049581 Ga0501047_0266450 Ga0501047_0266450_163_645 160
894 3300049581 Ga0501047_0271226 Ga0501047_0271226_276_758 160
895 3300049581 Ga0501047_0447519 Ga0501047_0447519_25_507 160
896 3300049581 Ga0501047_0615564 Ga0501047_0615564_334_816 160
897 3300049581 Ga0501047_0788681 Ga0501047_0788681_227_709 160
898 3300049582 Ga0501048_0407615 Ga0501048_0407615_11_493 160
899 3300049583 Ga0501067_0134834 Ga0501067_0134834_58_540 160
900 3300049583 Ga0501067_0263193 Ga0501067_0263193_65_547 160
901 3300049585 Ga0501069_0180084 Ga0501069_0180084_11_493 160
902 3300049585 Ga0501069_0267421 Ga0501069_0267421_121_603 160
903 3300049585 Ga0501069_0277495 Ga0501069_0277495_414_896 160
904 3300049586 Ga0501070_0000017 Ga0501070_0000017_5077_5559 160
905 3300049586 Ga0501070_0081519 Ga0501070_0081519_403_885 160
906 3300049586 Ga0501070_0222675 Ga0501070_0222675_982_1464 160
907 3300049586 Ga0501070_0285547 Ga0501070_0285547_641_1123 160
908 3300049586 Ga0501070_0292146 Ga0501070_0292146_129_611 160
909 3300049586 Ga0501070_0446511 Ga0501070_0446511_523_1005 160
910 3300049586 Ga0501070_1173709 Ga0501070_1173709_12_494 160
911 3300049588 Ga0501072_0002615 Ga0501072_0002615_733_1215 160
912 3300049589 Ga0501073_0071784 Ga0501073_0071784_1474_1956 160
913 3300049589 Ga0501073_0085950 Ga0501073_0085950_46_528 160
914 3300049589 Ga0501073_0202618 Ga0501073_0202618_69_551 160
915 3300049589 Ga0501073_0326227 Ga0501073_0326227_416_898 160
916 3300049589 Ga0501073_0330280 Ga0501073_0330280_99_581 160
917 3300049589 Ga0501073_0364440 Ga0501073_0364440_375_857 160
918 3300049590 Ga0501074_0283717 Ga0501074_0283717_298_780 160
919 3300049590 Ga0501074_0356514 Ga0501074_0356514_398_880 160
920 3300049741 Ga0501079_0001593 Ga0501079_0001593_8552_9034 160
921 3300049741 Ga0501079_0376949 Ga0501079_0376949_129_611 160
922 3300049742 Ga0501080_0007075 Ga0501080_0007075_7772_8254 160
923 3300049742 Ga0501080_0013155 Ga0501080_0013155_2712_3194 160
924 3300049742 Ga0501080_0048297 Ga0501080_0048297_1318_1800 160
925 3300049742 Ga0501080_0058102 Ga0501080_0058102_461_943 160
926 3300049742 Ga0501080_0095938 Ga0501080_0095938_2234_2716 160
927 3300049742 Ga0501080_0100351 Ga0501080_0100351_240_722 160
928 3300049742 Ga0501080_0174060 Ga0501080_0174060_146_628 160
929 3300049742 Ga0501080_1232045 Ga0501080_1232045_127_609 160
930 3300049744 Ga0501083_0077501 Ga0501083_0077501_146_628 160
931 3300049744 Ga0501083_0078000 Ga0501083_0078000_1232_1714 160
932 3300049744 Ga0501083_0273322 Ga0501083_0273322_568_1050 160
933 3300049822 Ga0501035_0014379 Ga0501035_0014379_4619_5101 160
934 3300049822 Ga0501035_0016715 Ga0501035_0016715_3413_3895 160
935 3300049822 Ga0501035_0022936 Ga0501035_0022936_1094_1576 160
936 3300049822 Ga0501035_0028207 Ga0501035_0028207_2579_3061 160
937 3300049822 Ga0501035_0037918 Ga0501035_0037918_3206_3736 160
938 3300049822 Ga0501035_0098978 Ga0501035_0098978_148_630 160
939 3300049822 Ga0501035_0105807 Ga0501035_0105807_1270_1752 160
940 3300049822 Ga0501035_0114126 Ga0501035_0114126_790_1272 160
941 3300049822 Ga0501035_0288201 Ga0501035_0288201_168_650 160
942 3300049822 Ga0501035_0307956 Ga0501035_0307956_721_1203 160
943 3300049822 Ga0501035_0502871 Ga0501035_0502871_44_526 160
944 3300049822 Ga0501035_0834230 Ga0501035_0834230_119_601 160
945 3300049823 Ga0501044_0001349 Ga0501044_0001349_20389_20871 160
946 3300049823 Ga0501044_0004556 Ga0501044_0004556_9513_9995 160
947 3300049823 Ga0501044_0013884 Ga0501044_0013884_4294_4776 160
948 3300049823 Ga0501044_0016070 Ga0501044_0016070_1808_2290 160
949 3300049823 Ga0501044_0020118 Ga0501044_0020118_5148_5630 160
950 3300049823 Ga0501044_0021245 Ga0501044_0021245_4273_4755 160
951 3300049823 Ga0501044_0069817 Ga0501044_0069817_578_1060 160
952 3300049823 Ga0501044_0075416 Ga0501044_0075416_983_1513 160
953 3300049823 Ga0501044_0084673 Ga0501044_0084673_2381_2863 160
954 3300049823 Ga0501044_0123544 Ga0501044_0123544_1982_2464 160
955 3300049823 Ga0501044_0178221 Ga0501044_0178221_836_1318 160
956 3300049823 Ga0501044_0289077 Ga0501044_0289077_321_803 160
957 3300049823 Ga0501044_0289595 Ga0501044_0289595_1036_1518 160
958 3300049823 Ga0501044_0471480 Ga0501044_0471480_538_1020 160
959 3300049823 Ga0501044_1375726 Ga0501044_1375726_11_493 160
960 3300050511 nmdc:mga08y16_96655_c1 nmdc:mga08y16_96655_c1_1572_2054 160
961 3300050512 nmdc:mga0n895_508654_c1 nmdc:mga0n895_508654_c1_362_844 160
962 3300050513 nmdc:mga0rr50_41387_c1 nmdc:mga0rr50_41387_c1_487_969 160
963 3300050513 nmdc:mga0rr50_424049_c1 nmdc:mga0rr50_424049_c1_425_907 160
964 3300050514 nmdc:mga08x19_101598_c1 nmdc:mga08x19_101598_c1_393_875 160
965 3300050514 nmdc:mga08x19_99_c1 nmdc:mga08x19_99_c1_66123_66605 160
966 3300053077 Ga0495601_0000787 Ga0495601_0000787_11072_11554 160
967 3300053078 Ga0495612_0001215 Ga0495612_0001215_3013_3495 160
968 3300053084 Ga0495595_0001670 Ga0495595_0001670_2654_3136 160
969 3300053084 Ga0495595_0138751 Ga0495595_0138751_175_657 160
970 3300053085 Ga0495619_0000414 Ga0495619_0000414_2301_2783 160
971 3300053085 Ga0495619_0101091 Ga0495619_0101091_953_1435 160
972 3300053087 Ga0500643_000006 Ga0500643_000006_55538_56020 160
973 3300053090 Ga0500646_0140566 Ga0500646_0140566_236_718 160
974 3300053094 Ga0500566_0286142 Ga0500566_0286142_166_648 160
975 3300053096 Ga0500641_0030149 Ga0500641_0030149_646_1128 160
976 3300053106 Ga0500558_167330 Ga0500558_167330_17_499 160
977 3300053117 Ga0500593_135782 Ga0500593_135782_353_835 160
978 3300053119 Ga0500595_013693 Ga0500595_013693_2186_2668 160
979 3300053119 Ga0500595_020325 Ga0500595_020325_1814_2296 160
980 3300053119 Ga0500595_036334 Ga0500595_036334_804_1286 160
981 3300053133 Ga0500655_004543 Ga0500655_004543_1584_2066 160
982 3300053133 Ga0500655_030114 Ga0500655_030114_150_632 160
983 3300053136 Ga0500559_0008077 Ga0500559_0008077_2902_3384 160
984 3300053136 Ga0500559_0367583 Ga0500559_0367583_86_568 160
985 3300053139 Ga0500568_0048976 Ga0500568_0048976_1113_1595 160
986 3300053140 Ga0500573_0000009 Ga0500573_0000009_28990_29472 160
987 3300053142 Ga0500577_0083756 Ga0500577_0083756_142_624 160
988 3300053148 Ga0500590_331774 Ga0500590_331774_26_508 160
989 3300054114 Ga0501084_0000147 Ga0501084_0000147_43_525 160
990 3300054114 Ga0501084_0492650 Ga0501084_0492650_544_1026 160
991 3300054114 Ga0501084_1193671 Ga0501084_1193671_27_509 160
992 3300060353 Ga0501082_0008279 Ga0501082_0008279_6638_7120 160
993 3300060353 Ga0501082_0357098 Ga0501082_0357098_48_530 160
994 3300060353 Ga0501082_0388559 Ga0501082_0388559_49_531 160
995 3300060353 Ga0501082_0391469 Ga0501082_0391469_395_877 160
996 3300060353 Ga0501082_1141945 Ga0501082_1141945_27_509 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

1

158

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9269 1 157
1to0-assembly2.cif.gz_C x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9221 1 155
1to0-assembly3.cif.gz_F x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.921 1 152
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.921 1 157
1to0-assembly2.cif.gz_C x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9162 1 155
ID Description Score Start End Superfamily
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9222 3 152 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9171 1 159 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.906 1 159 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8968 3 152 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.885 1 155 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1Q3JP34-F1-model_v4 deleted 0.9891 1 160
AF-A0A7Y2EG16-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9583 1 160 GO:0005737
GO:0070038
AF-A0A7V2WNM6-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9563 1 160 GO:0005737
GO:0070038
AF-A0A1H8W7Y8-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9541 1 160 GO:0005737
GO:0070038
AF-A0A7C9VJD1-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.954 21 160 GO:0006364
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
95.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map