F487698

General Info

Members Datasets Scaffolds Average Seq Length
993 614 769 316

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0050265|Ga0496121_0050265_1102_2223
Length 373
Sequence MVLEAMRSIVRETVPSRLLTMRSAGAPGRMRAKRSDDAKRVSPVWEKDAMRLTISIAVLALLALLSPAHAAETYPSRPITVIVPFAAGGPSDAMMRILGEHMRQTLGQPILIENVTGAGGSIGVGRAVHSPPDGYTVSFGHLGTHVANGAVYKLGYDLVADLEPVVLLPSNPMIIVSKNAVPAKSLAELLTWLKAQPTPAAAGTAGNGSGSHIAGLYFEQVTGIKLQYVPYRGTGPALNDLVAGQIDLIVDQTSNSINQVRAGAIRAYAVTDDKRVASAPEIPTTDEAGLPGLHMTLWSGLWVPKGTPKEIVARLNQAAVAALNDSDVQKRLKDLGLQMTPQDQLTPDALGAVQRAEIAKWWPMIKAARVSTE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
37 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
38 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
39 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
40 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
73 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
74 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
75 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
76 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
77 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
78 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
79 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
80 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
81 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
85 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
88 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
89 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
90 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
91 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
94 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
95 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
98 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
99 2904699407
100 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
101 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
102 2906610324
103 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
104 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
105 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
106 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
107 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
108 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
109 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
110 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
111 2922368715
112 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
113 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
118 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
119 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
120 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
121 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
122 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
125 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
126 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
127 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
128 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
131 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
132 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
133 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
134 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
135 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
136 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
137 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
138 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
139 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
140 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
141 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
142 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
143 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
144 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
145 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
146 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
147 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
148 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
149 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
154 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
155 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
156 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
157 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
158 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
159 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
160 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
161 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
162 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
163 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
164 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
165 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
166 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
167 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
168 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
169 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
170 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
171 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
172 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
173 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
174 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
175 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
176 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
177 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
178 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
179 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
180 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
181 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
182 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
183 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
184 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
185 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
188 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
189 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
190 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
191 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
192 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
193 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
194 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
195 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
196 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
197 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
198 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
199 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
200 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
201 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
202 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
203 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
204 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
205 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
206 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
207 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
208 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
209 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
210 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
211 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
212 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
213 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
214 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
215 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
216 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
219 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
220 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
221 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
222 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
223 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
224 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
225 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
226 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
227 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
228 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
229 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
230 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
231 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
232 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
233 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
234 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
238 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
239 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
240 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
241 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
243 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
246 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
247 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
248 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
249 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
251 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
252 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
253 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
254 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
255 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
257 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
258 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
259 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
260 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
261 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
265 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
266 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
268 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
280 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
281 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
282 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
283 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
284 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
285 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
286 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
287 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
288 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
289 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
290 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
291 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
292 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
294 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
297 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
300 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
302 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
348 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
350 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
351 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
356 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
357 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
358 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
359 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
360 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
361 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
362 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
364 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
365 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
366 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
367 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
368 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
369 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
370 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
371 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
372 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
373 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
374 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
375 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
376 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
377 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
378 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
379 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
380 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
381 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
382 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
383 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
384 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
385 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
386 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
387 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
388 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
389 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
390 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
391 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
392 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
393 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
394 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
395 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
396 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
398 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
399 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
400 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
401 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
402 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
403 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
404 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
405 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
406 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
407 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
408 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
409 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
410 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
411 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
412 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
415 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
416 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
417 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
418 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
419 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
420 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
421 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
422 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
423 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
424 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
425 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
426 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
427 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
428 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
429 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
430 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
431 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
432 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
433 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
434 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
435 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
436 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
437 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
438 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
439 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
440 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
441 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
442 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
443 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
444 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
445 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
446 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
447 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
448 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
449 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
450 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
451 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
452 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
453 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
454 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
455 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
456 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
457 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
461 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
462 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
469 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
470 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
471 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
472 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
473 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
474 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
475 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
476 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
477 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
478 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
479 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
480 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
481 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
482 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
483 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
484 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
485 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
486 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
487 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
488 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
489 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
490 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
491 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
492 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
493 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
494 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
495 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
496 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
497 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
498 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
499 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
512 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
513 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
514 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
515 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
516 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
517 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
518 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
521 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
523 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
524 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
525 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
526 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
527 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
528 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
529 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
530 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
531 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
532 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
533 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
534 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
535 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
536 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
537 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
538 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
539 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
540 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
541 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
542 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
543 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
544 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
545 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
546 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
547 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
548 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
549 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
550 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
551 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
552 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
553 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
554 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
555 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
556 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
557 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
558 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
559 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
560 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
561 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
562 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
563 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
564 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
565 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
566 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
567 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
568 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
569 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
570 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
571 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
572 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
573 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
574 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
575 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
576 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
577 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
578 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
579 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
580 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
581 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
582 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
583 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
584 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
585 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
586 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
587 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
588 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
589 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
590 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
591 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
592 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
593 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
594 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
595 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
596 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
597 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
598 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
599 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
600 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
601 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
602 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
603 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
604 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
605 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
606 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
607 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
608 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
609 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
610 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
611 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
612 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
613 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
614 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.65
Metatranscriptomes 0.1
Isolates 22.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 18.63
Rhizoplane 5.14
Rhizosphere 53.78
Stem 0
Stem Tuber 0
Unclassified 12.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001011 3300003203 Bacteria 13191
2 JGI25406J46586_10002294 3300003203 Bacteria 9024
3 JGI25153J46596_10000984 3300003215 Bacteria 17295
4 JGI25153J46596_10001284 3300003215 Bacteria 15072
5 JGI25153J46596_10002622 3300003215 Bacteria 10287
6 JGI25160J50197_1002715 3300003354 Bacteria 8140
7 JGI25160J50197_1011205 3300003354 Bacteria 3192
8 JGI25404J52841_10026012 3300003659 Bacteria 1260
9 Ga0055524_1028055 3300003775 Bacteria 1694
10 Ga0055531_10021216 3300003794 Bacteria 2531
11 Ga0055543_1001473 3300004625 Bacteria 9297
12 Ga0065165_1001824 3300005262 Bacteria 20852
13 Ga0065165_1002121 3300005262 Bacteria 18063
14 Ga0065165_1004810 3300005262 Bacteria 8045
15 Ga0070658_10082028 3300005327 Bacteria 2649
16 Ga0070658_10129103 3300005327 Bacteria 2105
17 Ga0070676_10202943 3300005328 Bacteria 1301
18 Ga0070683_100107144 3300005329 Bacteria 2635
19 Ga0070690_100273915 3300005330 Bacteria 1202
20 Ga0070670_100450193 3300005331 Bacteria 1141
21 Ga0068869_100062315 3300005334 Bacteria 2737
22 Ga0070680_100006384 3300005336 Bacteria 8957
23 Ga0070680_100007541 3300005336 Bacteria 8295
24 Ga0070680_100013411 3300005336 Bacteria 6381
25 Ga0070680_100070234 3300005336 Bacteria 2877
26 Ga0068868_100025954 3300005338 Bacteria 4461
27 Ga0068868_100078288 3300005338 Bacteria 2646
28 Ga0068868_100086883 3300005338 Bacteria 2514
29 Ga0068868_100216207 3300005338 Bacteria 1603
30 Ga0070691_10072226 3300005341 Bacteria 1676
31 Ga0070668_100020837 3300005347 Bacteria 4951
32 Ga0070668_100175645 3300005347 Bacteria 1746
33 Ga0070669_100065058 3300005353 Bacteria 2686
34 Ga0070671_100106981 3300005355 Bacteria 2348
35 Ga0070673_100081473 3300005364 Bacteria 2625
36 Ga0070659_100234804 3300005366 Bacteria 1516
37 Ga0070667_100079964 3300005367 Bacteria 2795
38 Ga0070709_10168652 3300005434 Bacteria 1528
39 Ga0070714_100077725 3300005435 Bacteria 2883
40 Ga0070714_100078705 3300005435 Bacteria 2866
41 Ga0070714_100084713 3300005435 Bacteria 2767
42 Ga0070714_100230296 3300005435 Bacteria 1706
43 Ga0070713_100160977 3300005436 Bacteria 2004
44 Ga0070713_100208398 3300005436 Bacteria 1768
45 Ga0070710_10000324 3300005437 Bacteria 22807
46 Ga0070711_100050315 3300005439 Bacteria 2857
47 Ga0070711_100062787 3300005439 Bacteria 2590
48 Ga0070711_100190978 3300005439 Bacteria 1574
49 Ga0070700_100068935 3300005441 Bacteria 2250
50 Ga0070708_100240402 3300005445 Bacteria 1700
51 Ga0070663_100007789 3300005455 Bacteria 6545
52 Ga0070663_100019185 3300005455 Bacteria 4501
53 Ga0070663_100020397 3300005455 Bacteria 4388
54 Ga0070663_100106361 3300005455 Bacteria 2101
55 Ga0070663_100166046 3300005455 Bacteria 1703
56 Ga0070678_100038298 3300005456 Bacteria 3374
57 Ga0070681_10011810 3300005458 Bacteria 8659
58 Ga0070681_10062028 3300005458 Bacteria 3713
59 Ga0068867_100048145 3300005459 Bacteria 3135
60 Ga0070707_100353606 3300005468 Bacteria 1427
61 Ga0070698_100282270 3300005471 Bacteria 1592
62 Ga0070679_100008166 3300005530 Bacteria 9836
63 Ga0070679_100015291 3300005530 Bacteria 7374
64 Ga0070679_100016867 3300005530 Bacteria 7059
65 Ga0070684_100059496 3300005535 Bacteria 3340
66 Ga0070684_100081606 3300005535 Bacteria 2862
67 Ga0068853_100012234 3300005539 Bacteria 6978
68 Ga0068853_100101645 3300005539 Bacteria 2542
69 Ga0068853_100117114 3300005539 Bacteria 2373
70 Ga0068853_100528548 3300005539 Bacteria 1116
71 Ga0070672_100052504 3300005543 Bacteria 3183
72 Ga0070695_100217138 3300005545 Bacteria 1376
73 Ga0070665_100026866 3300005548 Bacteria 5798
74 Ga0070665_100050851 3300005548 Bacteria 4158
75 Ga0070665_100121317 3300005548 Bacteria 2615
76 Ga0070665_100126080 3300005548 Bacteria 2562
77 Ga0070665_100210582 3300005548 Bacteria 1945
78 Ga0068855_100158942 3300005563 Bacteria 2566
79 Ga0068855_100375088 3300005563 Bacteria 1563
80 Ga0068855_100431814 3300005563 Bacteria 1440
81 Ga0070664_100166302 3300005564 Bacteria 1954
82 Ga0070664_100173634 3300005564 Bacteria 1913
83 Ga0068857_100145071 3300005577 Bacteria 2148
84 Ga0068854_100208121 3300005578 Bacteria 1541
85 Ga0068856_100000298 3300005614 Bacteria 54403
86 Ga0068856_100280505 3300005614 Bacteria 1683
87 Ga0068856_100324563 3300005614 Bacteria 1557
88 Ga0068856_100579130 3300005614 Bacteria 1144
89 Ga0068852_100042389 3300005616 Bacteria 3853
90 Ga0068852_100277413 3300005616 Bacteria 1615
91 Ga0068852_100611444 3300005616 Bacteria 1095
92 Ga0068859_100241034 3300005617 Bacteria 1897
93 Ga0068859_100703690 3300005617 Bacteria 1101
94 Ga0068864_100450625 3300005618 Bacteria 1231
95 Ga0068858_100129809 3300005842 Bacteria 2362
96 Ga0068858_100248373 3300005842 Bacteria 1690
97 Ga0068860_100001757 3300005843 Bacteria 23123
98 Ga0068862_100174818 3300005844 Bacteria 1924
99 Ga0081455_10004165 3300005937 Bacteria 16324
100 Ga0081455_10008515 3300005937 Bacteria 10653
101 Ga0081455_10039588 3300005937 Bacteria 4165
102 Ga0081455_10066232 3300005937 Bacteria 3018
103 Ga0081455_10071263 3300005937 Bacteria 2882
104 Ga0081455_10104369 3300005937 Bacteria 2268
105 Ga0081538_10017214 3300005981 Bacteria 5498
106 Ga0081540_1002604 3300005983 Bacteria 14664
107 Ga0081540_1003385 3300005983 Bacteria 12644
108 Ga0081540_1003721 3300005983 Bacteria 11948
109 Ga0081540_1005242 3300005983 Bacteria 9700
110 Ga0081540_1008865 3300005983 Bacteria 6983
111 Ga0081540_1009618 3300005983 Bacteria 6647
112 Ga0081540_1011839 3300005983 Bacteria 5796
113 Ga0081540_1017766 3300005983 Bacteria 4392
114 Ga0081540_1020728 3300005983 Bacteria 3942
115 Ga0081540_1099144 3300005983 Bacteria 1260
116 Ga0081539_10001555 3300005985 Bacteria 38208
117 Ga0081539_10056299 3300005985 Bacteria 2183
118 Ga0070717_10001375 3300006028 Bacteria 16740
119 Ga0070717_10093442 3300006028 Bacteria 2543
120 Ga0075365_10007485 3300006038 Bacteria 6119
121 Ga0075365_10013552 3300006038 Bacteria 4882
122 Ga0075365_10215948 3300006038 Bacteria 1345
123 Ga0075364_10090025 3300006051 Bacteria 2035
124 Ga0070716_100008752 3300006173 Bacteria 5029
125 Ga0070716_100058477 3300006173 Bacteria 2219
126 Ga0070716_100090671 3300006173 Bacteria 1849
127 Ga0075367_10063032 3300006178 Bacteria 2215
128 Ga0075369_10036173 3300006186 Bacteria 2101
129 Ga0075366_10037157 3300006195 Bacteria 2873
130 Ga0075366_10094229 3300006195 Bacteria 1795
131 Ga0075366_10139293 3300006195 Bacteria 1466
132 Ga0097621_100269779 3300006237 Bacteria 1495
133 Ga0075370_10145114 3300006353 Bacteria 1389
134 Ga0068871_100069039 3300006358 Bacteria 2902
135 Ga0068871_100123473 3300006358 Bacteria 2190
136 Ga0068871_100207203 3300006358 Bacteria 1695
137 Ga0075430_100000192 3300006846 Bacteria 41250
138 Ga0075431_100410397 3300006847 Bacteria 1354
139 Ga0075434_100173979 3300006871 Bacteria 2173
140 Ga0097620_100241027 3300006931 Bacteria 1897
141 Ga0097620_100703700 3300006931 Bacteria 1101
142 Ga0099825_1028625 3300006941 Bacteria 2686
143 Ga0099825_1032320 3300006941 Bacteria 2134
144 Ga0099824_1008015 3300006942 Bacteria 13690
145 Ga0099824_1012036 3300006942 Bacteria 9571
146 Ga0099822_1000056 3300006943 Bacteria 56915
147 Ga0099823_1032818 3300006944 Bacteria 4204
148 Ga0075435_100140416 3300007076 Bacteria 2026
149 Ga0099795_10002749 3300007788 Bacteria 4218
150 Ga0099795_10019625 3300007788 Bacteria 2191
151 Ga0099795_10073064 3300007788 Bacteria 1298
152 Ga0105240_10123589 3300009093 Bacteria 3113
153 Ga0105240_10336997 3300009093 Bacteria 1714
154 Ga0111539_10021105 3300009094 Bacteria 8020
155 Ga0105245_10200582 3300009098 Bacteria 1916
156 Ga0105245_10600551 3300009098 Bacteria 1127
157 Ga0105247_10012733 3300009101 Bacteria 5048
158 Ga0105247_10034458 3300009101 Bacteria 3083
159 Ga0105247_10047193 3300009101 Bacteria 2645
160 Ga0105247_10083805 3300009101 Bacteria 2014
161 Ga0114129_10144786 3300009147 Bacteria 3256
162 Ga0114129_10187387 3300009147 Bacteria 2811
163 Ga0105243_10071619 3300009148 Bacteria 2803
164 Ga0105243_10148501 3300009148 Bacteria 2008
165 Ga0105241_10005414 3300009174 Bacteria 9435
166 Ga0105248_10344970 3300009177 Bacteria 1676
167 Ga0105237_10016332 3300009545 Bacteria 7716
168 Ga0105237_10066161 3300009545 Bacteria 3609
169 Ga0105237_10098063 3300009545 Bacteria 2922
170 Ga0105237_10122267 3300009545 Bacteria 2597
171 Ga0105237_10258024 3300009545 Bacteria 1745
172 Ga0105237_10330631 3300009545 Bacteria 1528
173 Ga0105238_10055652 3300009551 Bacteria 3970
174 Ga0105238_10104631 3300009551 Bacteria 2811
175 Ga0105249_10352935 3300009553 Bacteria 1490
176 Ga0099796_10001502 3300010159 Bacteria 4727
177 Ga0105239_10066451 3300010375 Bacteria 3961
178 Ga0105239_10103492 3300010375 Bacteria 3151
179 Ga0105239_10200616 3300010375 Bacteria 2235
180 Ga0105239_10222555 3300010375 Bacteria 2117
181 Ga0105246_10242938 3300011119 Bacteria 1424
182 Ga0157370_10058000 3300013104 Bacteria 3679
183 Ga0157370_10159832 3300013104 Bacteria 2097
184 Ga0157370_10161187 3300013104 Bacteria 2087
185 Ga0157370_10255982 3300013104 Bacteria 1618
186 Ga0157369_10013882 3300013105 Bacteria 9099
187 Ga0157369_10036796 3300013105 Bacteria 5361
188 Ga0157369_10050111 3300013105 Bacteria 4524
189 Ga0157369_10171753 3300013105 Bacteria 2284
190 Ga0157374_10107019 3300013296 Bacteria 2687
191 Ga0157378_10007273 3300013297 Bacteria 9668
192 Ga0157378_10656732 3300013297 Bacteria 1065
193 Ga0157372_10163394 3300013307 Bacteria 2574
194 Ga0157372_10261836 3300013307 Bacteria 2008
195 Ga0157375_10012018 3300013308 Bacteria 7667
196 Ga0157375_10375056 3300013308 Bacteria 1589
197 Ga0163163_10064633 3300014325 Bacteria 3630
198 Ga0163163_10065862 3300014325 Bacteria 3597
199 Ga0163163_10103392 3300014325 Bacteria 2873
200 Ga0163163_10207250 3300014325 Bacteria 2009
201 Ga0157380_10176351 3300014326 Bacteria 1873
202 Ga0157380_10437039 3300014326 Bacteria 1253
203 Ga0157379_10203248 3300014968 Bacteria 1792
204 Ga0157376_10009776 3300014969 Bacteria 6986
205 Ga0157376_10249493 3300014969 Bacteria 1657
206 Ga0157376_10283217 3300014969 Bacteria 1562
207 Ga0214544_1000051 3300021320 Bacteria 134645
208 Ga0214542_1000149 3300021321 Bacteria 102700
209 Ga0214542_1029292 3300021321 Bacteria 2270
210 Ga0214545_1001332 3300021324 Bacteria 45642
211 Ga0214545_1029592 3300021324 Bacteria 2445
212 Ga0214543_1000148 3300021327 Bacteria 98370
213 Ga0213874_10022936 3300021377 Bacteria 1736
214 Ga0213876_10001730 3300021384 Bacteria 13270
215 Ga0213876_10127352 3300021384 Bacteria 1353
216 Ga0213876_10218705 3300021384 Bacteria 1013
217 Ga0209563_102942 3300025230 Bacteria 3674
218 Ga0207425_1013562 3300025245 Bacteria 1879
219 Ga0209677_100680 3300025253 Bacteria 17490
220 Ga0209677_101872 3300025253 Bacteria 8532
221 Ga0209148_1000155 3300025254 Bacteria 143807
222 Ga0209233_1002203 3300025261 Bacteria 7308
223 Ga0209455_1005869 3300025272 Bacteria 3714
224 Ga0209455_1008148 3300025272 Bacteria 2878
225 Ga0209564_1007417 3300025295 Bacteria 5672
226 Ga0209758_1000021 3300025297 Bacteria 697691
227 Ga0209758_1000371 3300025297 Bacteria 78923
228 Ga0209758_1000521 3300025297 Bacteria 61693
229 Ga0209758_1008361 3300025297 Bacteria 6731
230 Ga0209758_1008906 3300025297 Bacteria 6367
231 Ga0209758_1010066 3300025297 Bacteria 5731
232 Ga0209256_1009218 3300025299 Bacteria 4373
233 Ga0207426_1000621 3300025302 Bacteria 45190
234 Ga0207426_1001148 3300025302 Bacteria 23862
235 Ga0209257_1003699 3300025304 Bacteria 12722
236 Ga0207692_10002171 3300025898 Bacteria 7495
237 Ga0207692_10056003 3300025898 Bacteria 2021
238 Ga0207710_10008376 3300025900 Bacteria 4361
239 Ga0207688_10053685 3300025901 Bacteria 2260
240 Ga0207688_10148705 3300025901 Bacteria 1382
241 Ga0207680_10083036 3300025903 Bacteria 2018
242 Ga0207647_10002167 3300025904 Bacteria 14984
243 Ga0207699_10011908 3300025906 Bacteria 4408
244 Ga0207699_10133813 3300025906 Bacteria 1621
245 Ga0207705_10088656 3300025909 Bacteria 2263
246 Ga0207705_10185716 3300025909 Bacteria 1571
247 Ga0207705_10232511 3300025909 Bacteria 1403
248 Ga0207654_10070486 3300025911 Bacteria 2075
249 Ga0207654_10111217 3300025911 Bacteria 1705
250 Ga0207707_10000311 3300025912 Bacteria 51163
251 Ga0207707_10006907 3300025912 Bacteria 9904
252 Ga0207707_10009050 3300025912 Bacteria 8651
253 Ga0207707_10016703 3300025912 Bacteria 6397
254 Ga0207695_10000015 3300025913 Bacteria 803205
255 Ga0207695_10113718 3300025913 Bacteria 2683
256 Ga0207671_10005956 3300025914 Bacteria 11047
257 Ga0207671_10034521 3300025914 Bacteria 3757
258 Ga0207671_10071040 3300025914 Bacteria 2596
259 Ga0207671_10279719 3300025914 Bacteria 1316
260 Ga0207663_10070416 3300025916 Bacteria 2253
261 Ga0207657_10008217 3300025919 Bacteria 10626
262 Ga0207657_10056124 3300025919 Bacteria 3399
263 Ga0207657_10128607 3300025919 Bacteria 2078
264 Ga0207649_10241589 3300025920 Bacteria 1297
265 Ga0207652_10060121 3300025921 Bacteria 3277
266 Ga0207652_10103424 3300025921 Bacteria 2518
267 Ga0207681_10193042 3300025923 Bacteria 1559
268 Ga0207694_10035350 3300025924 Bacteria 3832
269 Ga0207694_10098267 3300025924 Bacteria 2317
270 Ga0207687_10020151 3300025927 Bacteria 4423
271 Ga0207687_10158824 3300025927 Bacteria 1733
272 Ga0207700_10008667 3300025928 Bacteria 6315
273 Ga0207700_10053069 3300025928 Bacteria 3035
274 Ga0207700_10078203 3300025928 Bacteria 2572
275 Ga0207664_10020736 3300025929 Bacteria 4878
276 Ga0207664_10236685 3300025929 Bacteria 1589
277 Ga0207644_10106666 3300025931 Bacteria 2112
278 Ga0207706_10192772 3300025933 Bacteria 1788
279 Ga0207669_10035105 3300025937 Bacteria 2849
280 Ga0207704_10235822 3300025938 Bacteria 1364
281 Ga0207665_10006535 3300025939 Bacteria 7732
282 Ga0207665_10039845 3300025939 Bacteria 3133
283 Ga0207665_10053856 3300025939 Bacteria 2712
284 Ga0207665_10100585 3300025939 Bacteria 2017
285 Ga0207665_10110992 3300025939 Bacteria 1927
286 Ga0207691_10221476 3300025940 Bacteria 1640
287 Ga0207689_10033992 3300025942 Bacteria 4234
288 Ga0207689_10238512 3300025942 Bacteria 1503
289 Ga0207679_10109764 3300025945 Bacteria 2175
290 Ga0207679_10214059 3300025945 Bacteria 1618
291 Ga0207679_10319687 3300025945 Bacteria 1343
292 Ga0207667_10013949 3300025949 Bacteria 9181
293 Ga0207667_10272186 3300025949 Bacteria 1731
294 Ga0207667_10346254 3300025949 Bacteria 1516
295 Ga0207667_10514359 3300025949 Bacteria 1213
296 Ga0207651_10074889 3300025960 Bacteria 2413
297 Ga0207712_10491158 3300025961 Bacteria 1048
298 Ga0207668_10054956 3300025972 Bacteria 2765
299 Ga0207640_10323588 3300025981 Bacteria 1229
300 Ga0207677_10050684 3300026023 Bacteria 2809
301 Ga0207677_10081247 3300026023 Bacteria 2325
302 Ga0207703_10224132 3300026035 Bacteria 1683
303 Ga0207639_10043588 3300026041 Bacteria 3369
304 Ga0207639_10079568 3300026041 Bacteria 2591
305 Ga0207639_10100473 3300026041 Bacteria 2337
306 Ga0207639_10191864 3300026041 Bacteria 1746
307 Ga0207639_10290249 3300026041 Bacteria 1442
308 Ga0207678_10045470 3300026067 Bacteria 3797
309 Ga0207678_10046234 3300026067 Bacteria 3764
310 Ga0207678_10055198 3300026067 Bacteria 3422
311 Ga0207678_10149643 3300026067 Bacteria 1993
312 Ga0207678_10188742 3300026067 Bacteria 1761
313 Ga0207702_10000075 3300026078 Bacteria 112303
314 Ga0207702_10046593 3300026078 Bacteria 3650
315 Ga0207702_10074830 3300026078 Bacteria 2924
316 Ga0207702_10135791 3300026078 Bacteria 2219
317 Ga0207641_10476764 3300026088 Bacteria 1209
318 Ga0207648_10183338 3300026089 Bacteria 1853
319 Ga0207648_10415961 3300026089 Bacteria 1220
320 Ga0207674_10018729 3300026116 Bacteria 7515
321 Ga0207674_10119892 3300026116 Bacteria 2599
322 Ga0207674_10185431 3300026116 Bacteria 2031
323 Ga0207675_100121544 3300026118 Bacteria 2471
324 Ga0207683_10034696 3300026121 Bacteria 4385
325 Ga0207683_10040100 3300026121 Bacteria 4085
326 Ga0207683_10086571 3300026121 Bacteria 2786
327 Ga0207683_10267564 3300026121 Bacteria 1561
328 Ga0207698_10019893 3300026142 Bacteria 4609
329 Ga0207698_10323240 3300026142 Bacteria 1446
330 Ga0207698_10454091 3300026142 Bacteria 1238
331 Ga0207698_10524178 3300026142 Bacteria 1157
332 Ga0209389_1000026 3300027296 Bacteria 147580
333 Ga0209389_1000132 3300027296 Bacteria 66230
334 Ga0209589_1000003 3300027357 Bacteria 629130
335 Ga0209589_1000022 3300027357 Bacteria 180757
336 Ga0209489_100003 3300027361 Bacteria 663105
337 Ga0209489_100058 3300027361 Bacteria 147117
338 Ga0209489_105021 3300027361 Bacteria 23597
339 Ga0209700_100003 3300027363 Bacteria 663105
340 Ga0209700_100281 3300027363 Bacteria 90519
341 Ga0209179_1002734 3300027512 Bacteria 2433
342 Ga0268266_10007910 3300028379 Bacteria 9520
343 Ga0268266_10011695 3300028379 Bacteria 7615
344 Ga0268266_10028846 3300028379 Bacteria 4717
345 Ga0268266_10098987 3300028379 Bacteria 2566
346 Ga0268265_10071943 3300028380 Bacteria 2695
347 Ga0268265_10297060 3300028380 Bacteria 1452
348 Ga0268264_10000022 3300028381 Bacteria 476624
349 Ga0268264_10254418 3300028381 Bacteria 1633
350 Ga0268264_10307983 3300028381 Bacteria 1493
351 Ga0268264_10608058 3300028381 Bacteria 1078
352 Ga0265319_1004278 3300028563 Bacteria 7108
353 Ga0265334_10019030 3300028573 Bacteria 2828
354 Ga0265334_10023807 3300028573 Bacteria 2488
355 Ga0265323_10000507 3300028653 Bacteria 21772
356 Ga0265336_10000113 3300028666 Bacteria 60562
357 Ga0307517_10004197 3300028786 Bacteria 22221
358 Ga0307515_10070921 3300028794 Bacteria 4732
359 Ga0265338_10000146 3300028800 Bacteria 129397
360 Ga0265763_1002014 3300030763 Bacteria 1519
361 Ga0265332_10009325 3300031238 Bacteria 4383
362 Ga0265325_10032812 3300031241 Bacteria 2770
363 Ga0265339_10045559 3300031249 Bacteria 2413
364 Ga0307509_10013462 3300031507 Bacteria 9684
365 Ga0265313_10024648 3300031595 Bacteria 3209
366 Ga0307508_10000001 3300031616 Bacteria 553635
367 Ga0265342_10018653 3300031712 Bacteria 4485
368 Ga0307516_10012352 3300031730 Bacteria 9211
369 Ga0307516_10017716 3300031730 Bacteria 7420
370 Ga0307516_10021129 3300031730 Bacteria 6709
371 Ga0307516_10326606 3300031730 Bacteria 1204
372 Ga0307413_10132593 3300031824 Bacteria 1708
373 Ga0307409_100087070 3300031995 Bacteria 2544
374 Ga0307415_100180886 3300032126 Bacteria 1654
375 Ga0307507_10117090 3300033179 Bacteria 2149
376 Ga0307510_10001063 3300033180 Bacteria 29201
377 Ga0307510_10003508 3300033180 Bacteria 18276
378 Ga0307510_10019251 3300033180 Bacteria 8011
379 Ga0315911_1000001 3300033442 Bacteria 1088602
380 Ga0373930_0022889 3300034816 Bacteria 1239
381 Ga0373934_0013762 3300035086 Bacteria 3061
382 Ga0373940_0047572 3300035088 Bacteria 1196
383 Ga0373923_0015936 3300035111 Bacteria 2845
384 Ga0373936_0001954 3300035113 Bacteria 7629
385 Ga0373953_0004299 3300035117 Bacteria 4527
386 Ga0373954_0002781 3300035118 Bacteria 7369
387 Ga0373954_0083863 3300035118 Bacteria 1525
388 Ga0373956_0001152 3300035119 Bacteria 10929
389 Ga0373957_0000231 3300035120 Bacteria 14036
390 Ga0373943_0016473 3300035170 Bacteria 3371
391 Ga0373943_0039879 3300035170 Bacteria 2265
392 Ga0373946_0006401 3300035171 Bacteria 4267
393 Ga0373955_0000516 3300035172 Bacteria 16465
394 Ga0373924_0004088 3300035410 Bacteria 5074
395 Ga0373931_0019830 3300035691 Bacteria 3359
396 Ga0373931_0030114 3300035691 Bacteria 2792
397 Ga0373931_0111165 3300035691 Bacteria 1555
398 Ga0373935_0002610 3300035692 Bacteria 10355
399 Ga0373935_0055480 3300035692 Bacteria 2524
400 Ga0373935_0063679 3300035692 Bacteria 2364
401 Ga0373935_0248825 3300035692 Bacteria 1243
402 Ga0373927_0000990 3300035695 Bacteria 21639
403 Ga0373927_0006854 3300035695 Bacteria 7746
404 Ga0373927_0009734 3300035695 Bacteria 6442
405 Ga0373927_0010731 3300035695 Bacteria 6102
406 Ga0373927_0035312 3300035695 Bacteria 3251
407 Ga0373927_0044920 3300035695 Bacteria 2858
408 Ga0373933_0000144 3300035724 Bacteria 46119
409 Ga0373933_0005522 3300035724 Bacteria 6888
410 Ga0373947_0054066 3300035725 Bacteria 2423
411 Ga0373947_0055752 3300035725 Bacteria 2387
412 Ga0373947_0124838 3300035725 Bacteria 1638
413 Ga0373937_0005579 3300036401 Bacteria 10798
414 Ga0373937_0141232 3300036401 Bacteria 2253
415 Ga0373937_0226594 3300036401 Bacteria 1760
416 Ga0373925_0000863 3300037068 Bacteria 27740
417 Ga0373925_0056964 3300037068 Bacteria 2928
418 Ga0373925_0069282 3300037068 Bacteria 2664
419 Ga0373925_0111499 3300037068 Bacteria 2114
420 Ga0373925_0130874 3300037068 Bacteria 1956
421 Ga0395900_0004148 3300037418 Bacteria 15420
422 Ga0395900_0105706 3300037418 Bacteria 2892
423 Ga0395900_0174467 3300037418 Bacteria 2187
424 Ga0395898_0038260 3300037466 Bacteria 4756
425 Ga0395898_0080388 3300037466 Bacteria 3144
426 Ga0395898_0104015 3300037466 Bacteria 2723
427 Ga0395898_0197561 3300037466 Bacteria 1921
428 Ga0395898_0639738 3300037466 Bacteria 1006
429 Ga0395905_0015929 3300037471 Bacteria 7144
430 Ga0395905_0022711 3300037471 Bacteria 5931
431 Ga0395905_0023661 3300037471 Bacteria 5800
432 Ga0395905_0033150 3300037471 Bacteria 4854
433 Ga0395905_0260930 3300037471 Bacteria 1618
434 Ga0436364_0241180 3300037853 Bacteria 3153
435 Ga0395901_0016750 3300038443 Bacteria 7468
436 Ga0395901_0282220 3300038443 Bacteria 1725
437 Ga0395901_0313271 3300038443 Bacteria 1625
438 Ga0436365_0025400 3300039437 Bacteria 2384
439 Ga0436365_0174724 3300039437 Bacteria 1018
440 Ga0436365_0518597 3300039437 Bacteria 15011
441 Ga0436360_0352162 3300039438 Bacteria 2395
442 Ga0436363_0794413 3300039450 Bacteria 3644
443 Ga0451835_0533932 3300041492 Bacteria 1088
444 Ga0466969_0036761 3300044656 Bacteria 2472
445 Ga0466972_0001028 3300044658 Bacteria 13371
446 Ga0466961_0001518 3300044693 Bacteria 14381
447 Ga0466963_0031949 3300044694 Bacteria 3405
448 Ga0466963_0091374 3300044694 Bacteria 2073
449 Ga0466968_0002599 3300044735 Bacteria 6635
450 Ga0466970_0088740 3300044765 Bacteria 1677
451 Ga0466957_0042130 3300044842 Bacteria 2762
452 Ga0466959_0001349 3300045049 Bacteria 14964
453 Ga0466959_0050381 3300045049 Bacteria 3057
454 Ga0466967_0017495 3300045976 Bacteria 5694
455 Ga0466967_0055469 3300045976 Bacteria 3490
456 Ga0466967_0272275 3300045976 Bacteria 1623
457 Ga0466967_0482705 3300045976 Bacteria 1214
458 Ga0495592_0003238 3300046454 Bacteria 11667
459 Ga0495592_0082619 3300046454 Bacteria 2321
460 Ga0495592_0083644 3300046454 Bacteria 2304
461 Ga0495603_0000091 3300046455 Bacteria 41074
462 Ga0495603_0074363 3300046455 Bacteria 1995
463 Ga0495603_0165717 3300046455 Bacteria 1281
464 Ga0495629_0000583 3300046459 Bacteria 29653
465 Ga0495629_0002346 3300046459 Bacteria 14587
466 Ga0495629_0017906 3300046459 Bacteria 5078
467 Ga0495629_0196515 3300046459 Bacteria 1395
468 Ga0495638_0001796 3300046460 Bacteria 18671
469 Ga0495638_0033661 3300046460 Bacteria 3276
470 Ga0495641_0016977 3300046461 Bacteria 3812
471 Ga0495651_0006302 3300046462 Bacteria 9074
472 Ga0495651_0085743 3300046462 Bacteria 2371
473 Ga0495651_0254065 3300046462 Bacteria 1199
474 Ga0495653_0010014 3300046463 Bacteria 7755
475 Ga0495653_0121517 3300046463 Bacteria 1861
476 Ga0495582_0000049 3300046473 Bacteria 59194
477 Ga0495639_0001754 3300046475 Bacteria 9625
478 Ga0495639_0086001 3300046475 Bacteria 1470
479 Ga0495662_0021614 3300046476 Bacteria 3109
480 Ga0495662_0074899 3300046476 Bacteria 1643
481 Ga0495664_0028522 3300046477 Bacteria 3259
482 Ga0495664_0058161 3300046477 Bacteria 2300
483 Ga0495584_0061114 3300046491 Bacteria 1894
484 Ga0495585_0192384 3300046492 Bacteria 1043
485 Ga0495594_0004148 3300046499 Bacteria 7443
486 Ga0495594_0168990 3300046499 Bacteria 1244
487 Ga0495583_0063695 3300046506 Bacteria 1638
488 Ga0495583_0095274 3300046506 Bacteria 1277
489 Ga0495606_0012828 3300046507 Bacteria 6677
490 Ga0495606_0166337 3300046507 Bacteria 1283
491 Ga0495608_0001108 3300046511 Bacteria 19092
492 Ga0495610_0038417 3300046512 Bacteria 2430
493 Ga0495616_0048692 3300046513 Bacteria 2128
494 Ga0495620_0140927 3300046515 Bacteria 943
495 Ga0495628_0019435 3300046516 Bacteria 5616
496 Ga0495628_0053471 3300046516 Bacteria 3187
497 Ga0495628_0192477 3300046516 Bacteria 1539
498 Ga0495630_0002266 3300046517 Bacteria 13399
499 Ga0495631_0080142 3300046518 Bacteria 1409
500 Ga0495648_0000494 3300046524 Bacteria 42434
501 Ga0495666_0005139 3300046526 Bacteria 6618
502 Ga0495652_0002707 3300046529 Bacteria 17994
503 Ga0495652_0038588 3300046529 Bacteria 4137
504 Ga0495652_0044514 3300046529 Bacteria 3821
505 Ga0495665_0000941 3300046531 Bacteria 15352
506 Ga0495665_0011792 3300046531 Bacteria 4737
507 Ga0495640_0000856 3300046533 Bacteria 23288
508 Ga0495640_0008699 3300046533 Bacteria 7956
509 Ga0495640_0033817 3300046533 Bacteria 3631
510 Ga0495640_0040008 3300046533 Bacteria 3286
511 Ga0495587_0000673 3300046536 Bacteria 22877
512 Ga0495645_0002123 3300046543 Bacteria 13454
513 Ga0495645_0244979 3300046543 Bacteria 1194
514 Ga0495622_0056253 3300046557 Bacteria 1824
515 Ga0495633_0138152 3300046558 Bacteria 1127
516 Ga0495667_0003072 3300046559 Bacteria 11199
517 Ga0495667_0026543 3300046559 Bacteria 3904
518 Ga0495667_0046002 3300046559 Bacteria 2887
519 Ga0495656_0042732 3300046615 Bacteria 1899
520 Ga0495634_0021559 3300046642 Bacteria 4551
521 Ga0495635_0000084 3300046663 Bacteria 56456
522 Ga0495635_0000557 3300046663 Bacteria 23734
523 Ga0495635_0017248 3300046663 Bacteria 5043
524 Ga0495635_0266591 3300046663 Bacteria 1152
525 Ga0495588_0087375 3300046674 Bacteria 1631
526 Ga0495657_0002438 3300046675 Bacteria 15655
527 Ga0495657_0044367 3300046675 Bacteria 3024
528 Ga0495599_0000349 3300046678 Bacteria 27260
529 Ga0495599_0009066 3300046678 Bacteria 6063
530 Ga0495623_0002172 3300046679 Bacteria 13074
531 Ga0495623_0005553 3300046679 Bacteria 8240
532 Ga0495646_0013724 3300046680 Bacteria 5150
533 Ga0495646_0048847 3300046680 Bacteria 2569
534 Ga0495646_0071288 3300046680 Bacteria 2044
535 Ga0495647_0000930 3300046681 Bacteria 8791
536 Ga0495658_0000317 3300046683 Bacteria 27183
537 Ga0495613_0006599 3300046689 Bacteria 8673
538 Ga0495613_0024357 3300046689 Bacteria 4510
539 Ga0495613_0092129 3300046689 Bacteria 2195
540 Ga0495624_0001263 3300046690 Bacteria 19959
541 Ga0495624_0058809 3300046690 Bacteria 2413
542 Ga0495649_0153847 3300046694 Bacteria 1207
543 Ga0495600_0000972 3300046809 Bacteria 15439
544 Ga0495600_0005107 3300046809 Bacteria 7887
545 Ga0495600_0092031 3300046809 Bacteria 1978
546 Ga0495581_0001645 3300047315 Bacteria 12456
547 Ga0495581_0057934 3300047315 Bacteria 2236
548 Ga0495604_0001440 3300047317 Bacteria 19524
549 Ga0495604_0003341 3300047317 Bacteria 12788
550 Ga0495604_0065191 3300047317 Bacteria 2773
551 Ga0495674_0004098 3300047319 Bacteria 14079
552 Ga0495674_0004457 3300047319 Bacteria 13472
553 Ga0495674_0100594 3300047319 Bacteria 2460
554 Ga0495672_0027480 3300047320 Bacteria 3615
555 Ga0495676_0063822 3300047321 Bacteria 2869
556 Ga0495680_0004354 3300047322 Bacteria 13564
557 Ga0495680_0013252 3300047322 Bacteria 7203
558 Ga0495675_0001626 3300047444 Bacteria 13517
559 Ga0495675_0003112 3300047444 Bacteria 9968
560 Ga0495673_0048880 3300047469 Bacteria 1863
561 Ga0495681_0072379 3300047470 Bacteria 1559
562 Ga0495684_0001527 3300047471 Bacteria 18543
563 Ga0495684_0033455 3300047471 Bacteria 3942
564 Ga0495684_0194099 3300047471 Bacteria 1500
565 Ga0495593_0000016 3300047673 Bacteria 80178
566 Ga0495593_0054253 3300047673 Bacteria 2113
567 Ga0496100_0005047 3300048903 Bacteria 7063
568 Ga0496100_0056703 3300048903 Bacteria 2564
569 Ga0496101_0066597 3300048904 Bacteria 2628
570 Ga0496101_0253844 3300048904 Bacteria 1370
571 Ga0496102_0015785 3300048905 Bacteria 6584
572 Ga0496102_0292828 3300048905 Bacteria 1534
573 Ga0496102_0576201 3300048905 Bacteria 1048
574 Ga0496103_0015678 3300048906 Bacteria 4518
575 Ga0496103_0258595 3300048906 Bacteria 1120
576 Ga0496104_0000983 3300048907 Bacteria 24362
577 Ga0496104_0021078 3300048907 Bacteria 5978
578 Ga0496104_0049619 3300048907 Bacteria 3958
579 Ga0496105_0121889 3300048908 Bacteria 2150
580 Ga0496105_0436178 3300048908 Bacteria 1035
581 Ga0496106_0001709 3300048909 Bacteria 16390
582 Ga0496106_0011477 3300048909 Bacteria 6552
583 Ga0496106_0020809 3300048909 Bacteria 4868
584 Ga0496107_0012691 3300048910 Bacteria 5884
585 Ga0496107_0031854 3300048910 Bacteria 3765
586 Ga0496107_0214408 3300048910 Bacteria 1432
587 Ga0496108_0021927 3300048911 Bacteria 5250
588 Ga0496108_0043216 3300048911 Bacteria 3764
589 Ga0496108_0150180 3300048911 Bacteria 2010
590 Ga0496109_0058314 3300048912 Bacteria 3526
591 Ga0496109_0093782 3300048912 Bacteria 2778
592 Ga0496109_0132439 3300048912 Bacteria 2328
593 Ga0496110_0035664 3300048913 Bacteria 4316
594 Ga0496110_0080437 3300048913 Bacteria 2904
595 Ga0496110_0095364 3300048913 Bacteria 2664
596 Ga0496110_0123824 3300048913 Bacteria 2331
597 Ga0496110_0227285 3300048913 Bacteria 1697
598 Ga0496112_0015292 3300048915 Bacteria 7156
599 Ga0496112_0049152 3300048915 Bacteria 4134
600 Ga0496112_0057171 3300048915 Bacteria 3840
601 Ga0496112_0166733 3300048915 Bacteria 2168
602 Ga0496112_0224184 3300048915 Bacteria 1835
603 Ga0496113_0014732 3300048916 Bacteria 5347
604 Ga0496113_0031180 3300048916 Bacteria 3866
605 Ga0496113_0136298 3300048916 Bacteria 1929
606 Ga0496113_0323879 3300048916 Bacteria 1235
607 Ga0496114_0028061 3300048917 Bacteria 4616
608 Ga0496114_0058971 3300048917 Bacteria 3206
609 Ga0496114_0072576 3300048917 Bacteria 2895
610 Ga0496114_0091838 3300048917 Bacteria 2579
611 Ga0496114_0141025 3300048917 Bacteria 2087
612 Ga0496114_0257267 3300048917 Bacteria 1537
613 Ga0496115_0003167 3300048918 Bacteria 11824
614 Ga0496115_0100108 3300048918 Bacteria 2376
615 Ga0496115_0186871 3300048918 Bacteria 1712
616 Ga0496115_0206954 3300048918 Bacteria 1621
617 Ga0496116_0079741 3300048919 Bacteria 2036
618 Ga0496116_0086903 3300048919 Bacteria 1916
619 Ga0496117_0019732 3300048920 Bacteria 5524
620 Ga0496117_0185600 3300048920 Bacteria 1190
621 Ga0496118_0005814 3300048921 Bacteria 13827
622 Ga0496118_0022077 3300048921 Bacteria 5578
623 Ga0496118_0053450 3300048921 Bacteria 3070
624 Ga0496118_0187559 3300048921 Bacteria 1241
625 Ga0496119_0064005 3300048922 Bacteria 2185
626 Ga0496120_0025137 3300048923 Bacteria 3701
627 Ga0496121_0000780 3300048924 Bacteria 58378
628 Ga0496121_0002282 3300048924 Bacteria 29839
629 Ga0496121_0004720 3300048924 Bacteria 18004
630 Ga0496121_0010500 3300048924 Bacteria 10433
631 Ga0496121_0047788 3300048924 Bacteria 3647
632 Ga0496121_0050265 3300048924 Bacteria 3524
633 Ga0496121_0075813 3300048924 Bacteria 2685
634 Ga0496121_0131735 3300048924 Bacteria 1869
635 Ga0496121_0158024 3300048924 Bacteria 1661
636 Ga0496123_0185795 3300048926 Bacteria 1080
637 Ga0496124_0001377 3300048927 Bacteria 36428
638 Ga0496124_0029746 3300048927 Bacteria 4859
639 Ga0496124_0111760 3300048927 Bacteria 2198
640 Ga0496124_0123739 3300048927 Bacteria 2063
641 Ga0496125_0044938 3300048928 Bacteria 3726
642 Ga0496125_0116192 3300048928 Bacteria 1922
643 Ga0496125_0148495 3300048928 Bacteria 1615
644 Ga0496125_0175924 3300048928 Bacteria 1432
645 Ga0496126_0007243 3300048929 Bacteria 12197
646 Ga0496126_0011234 3300048929 Bacteria 9290
647 Ga0496126_0013669 3300048929 Bacteria 8241
648 Ga0496126_0022293 3300048929 Bacteria 6166
649 Ga0496126_0055741 3300048929 Bacteria 3574
650 Ga0496126_0075290 3300048929 Bacteria 2996
651 Ga0496126_0094245 3300048929 Bacteria 2628
652 Ga0496126_0098672 3300048929 Bacteria 2559
653 Ga0496126_0149201 3300048929 Bacteria 2005
654 Ga0496126_0156461 3300048929 Bacteria 1950
655 Ga0496126_0171264 3300048929 Bacteria 1849
656 Ga0496126_0245771 3300048929 Bacteria 1493
657 Ga0496126_0298897 3300048929 Bacteria 1329
658 Ga0495682_0092346 3300049460 Bacteria 1087
659 Ga0501031_0008147 3300049568 Bacteria 6824
660 Ga0501032_0001393 3300049569 Bacteria 19192
661 Ga0501033_0000098 3300049570 Bacteria 82803
662 Ga0501034_0001272 3300049571 Bacteria 34179
663 Ga0501036_0000049 3300049572 Bacteria 75400
664 Ga0501037_0000069 3300049573 Bacteria 95277
665 Ga0501038_0000034 3300049574 Bacteria 128854
666 Ga0501039_0000090 3300049575 Bacteria 63919
667 Ga0501043_0000130 3300049579 Bacteria 69795
668 Ga0501043_0223140 3300049579 Bacteria 1457
669 Ga0501046_0000213 3300049580 Bacteria 60602
670 Ga0501046_0132363 3300049580 Bacteria 1891
671 Ga0501047_0000255 3300049581 Bacteria 62993
672 Ga0501047_0074567 3300049581 Bacteria 3266
673 Ga0501047_0152146 3300049581 Bacteria 2189
674 Ga0501048_0001548 3300049582 Bacteria 17463
675 Ga0501067_0001256 3300049583 Bacteria 13799
676 Ga0501067_0083508 3300049583 Bacteria 1772
677 Ga0501068_0000197 3300049584 Bacteria 28590
678 Ga0501070_0008466 3300049586 Bacteria 8690
679 Ga0501070_0039089 3300049586 Bacteria 3958
680 Ga0501072_0000146 3300049588 Bacteria 52958
681 Ga0501073_0000035 3300049589 Bacteria 94077
682 Ga0501073_0084055 3300049589 Bacteria 2215
683 Ga0501074_0001890 3300049590 Bacteria 14387
684 Ga0501074_0025708 3300049590 Bacteria 4272
685 Ga0501076_0259367 3300049592 Bacteria 1423
686 Ga0501079_0011421 3300049741 Bacteria 6778
687 Ga0501080_0000379 3300049742 Bacteria 34215
688 Ga0501080_0014118 3300049742 Bacteria 7353
689 Ga0501080_0158688 3300049742 Bacteria 2089
690 Ga0501083_0001109 3300049744 Bacteria 18027
691 Ga0501035_0000894 3300049822 Bacteria 31549
692 Ga0501044_0000461 3300049823 Bacteria 49470
693 Ga0501044_0321316 3300049823 Bacteria 1472
694 Ga0501044_0329690 3300049823 Bacteria 1449
695 nmdc:mga03n38_30283_c1 3300050490 Bacteria 2274
696 nmdc:mga03n38_31959_c1 3300050490 Bacteria 2225
697 nmdc:mga0yw44_64687_c1 3300050492 Bacteria 2252
698 nmdc:mga0k408_89006_c1 3300050493 Bacteria 1813
699 nmdc:mga06z11_33657_c1 3300050494 Bacteria 2509
700 nmdc:mga04h51_80829_c1 3300050495 Bacteria 1153
701 nmdc:mga04h51_9482_c1 3300050495 Bacteria 2641
702 nmdc:mga07m45_45032_c1 3300050496 Bacteria 2477
703 nmdc:mga05p37_38199_c1 3300050507 Bacteria 5888
704 nmdc:mga0qj67_130_c1 3300050509 Bacteria 49784
705 nmdc:mga06r32_269701_c1 3300050510 Bacteria 1689
706 nmdc:mga06r32_99584_c1 3300050510 Bacteria 2851
707 nmdc:mga0n895_226607_c1 3300050512 Bacteria 1897
708 nmdc:mga0n895_96001_c1 3300050512 Bacteria 2969
709 nmdc:mga0rr50_205805_c1 3300050513 Bacteria 1619
710 nmdc:mga0a205_329253_c1 3300050515 Bacteria 1397
711 nmdc:mga0sz30_70284_c1 3300050516 Bacteria 1506
712 Ga0500635_0074617 3300053080 Bacteria 1209
713 Ga0495595_0001209 3300053084 Bacteria 10038
714 Ga0495619_0000434 3300053085 Bacteria 28423
715 Ga0495619_0173709 3300053085 Bacteria 1490
716 Ga0500578_0030112 3300053086 Bacteria 3486
717 Ga0500578_0259511 3300053086 Bacteria 1044
718 Ga0500643_000343 3300053087 Bacteria 36960
719 Ga0500647_0049078 3300053091 Bacteria 2029
720 Ga0500566_0000050 3300053094 Bacteria 57809
721 Ga0500566_0009209 3300053094 Bacteria 5838
722 Ga0500566_0095325 3300053094 Bacteria 1639
723 Ga0500640_015182 3300053095 Bacteria 3218
724 Ga0500641_0024838 3300053096 Bacteria 2313
725 Ga0500641_0143461 3300053096 Bacteria 1032
726 Ga0500648_113754 3300053097 Bacteria 1491
727 Ga0500555_006337 3300053103 Bacteria 3359
728 Ga0500556_0008147 3300053104 Bacteria 3018
729 Ga0500557_000024 3300053105 Bacteria 84960
730 Ga0500572_001347 3300053111 Bacteria 6809
731 Ga0500572_001914 3300053111 Bacteria 5226
732 Ga0500572_026378 3300053111 Bacteria 1583
733 Ga0500592_009990 3300053116 Bacteria 1512
734 Ga0500595_001213 3300053119 Bacteria 14245
735 Ga0500595_003750 3300053119 Bacteria 7002
736 Ga0500608_015916 3300053122 Bacteria 3388
737 Ga0500614_007563 3300053123 Bacteria 2292
738 Ga0500642_0000214 3300053130 Bacteria 22993
739 Ga0500642_0009585 3300053130 Bacteria 3368
740 Ga0500559_0001369 3300053136 Bacteria 13979
741 Ga0500559_0006962 3300053136 Bacteria 5055
742 Ga0500568_0053376 3300053139 Bacteria 1584
743 Ga0500573_0038225 3300053140 Bacteria 2773
744 Ga0500590_044558 3300053148 Bacteria 2273
745 Ga0500603_000181 3300053150 Bacteria 16211
746 Ga0500603_000395 3300053150 Bacteria 11422
747 Ga0500619_050858 3300053154 Bacteria 1340
748 Ga0500627_0057752 3300053158 Bacteria 1703
749 Ga0500627_0131575 3300053158 Bacteria 1130
750 Ga0500630_002739 3300053159 Bacteria 8488
751 Ga0500638_013568 3300053162 Bacteria 3690
752 Ga0500639_000032 3300053163 Bacteria 69113
753 Ga0500639_061482 3300053163 Bacteria 1934
754 Ga0500636_0000514 3300053177 Bacteria 21027
755 Ga0500636_0084940 3300053177 Bacteria 1819
756 Ga0500636_0105674 3300053177 Bacteria 1596
757 Ga0500636_0131859 3300053177 Bacteria 1391
758 Ga0500637_0004846 3300053178 Bacteria 6448
759 Ga0500637_0053806 3300053178 Bacteria 2298
760 Ga0500637_0057179 3300053178 Bacteria 2229
761 Ga0500625_000122 3300053729 Bacteria 15276
762 Ga0500645_062045 3300053730 Bacteria 1079
763 Ga0500596_000019 3300053735 Bacteria 23095
764 Ga0500596_002557 3300053735 Bacteria 3574
765 Ga0500599_000822 3300053736 Bacteria 3427
766 Ga0501084_0002564 3300054114 Bacteria 14640
767 Ga0500661_006386 3300055283 Bacteria 2193
768 Ga0501082_0003475 3300060353 Bacteria 13745
769 Ga0530510_0253069 3300061734 Bacteria 1313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0058971 Ga0496114_0058971_11_802 249
2 3300048919 Ga0496116_0086903 Ga0496116_0086903_1103_1903 252
3 3300035171 Ga0373946_0006401 Ga0373946_0006401_20_862 254
4 3300053086 Ga0500578_0259511 Ga0500578_0259511_26_868 259
5 3300035692 Ga0373935_0248825 Ga0373935_0248825_376_1218 266
6 3300041492 Ga0451835_0533932 Ga0451835_0533932_215_1057 266
7 3300046515 Ga0495620_0140927 Ga0495620_0140927_81_923 266
8 3300046516 Ga0495628_0192477 Ga0495628_0192477_681_1523 266
9 3300050495 nmdc:mga04h51_80829_c1 nmdc:mga04h51_80829_c1_283_1128 266
10 3300047471 Ga0495684_0033455 Ga0495684_0033455_125_976 268
11 3300030763 Ga0265763_1002014 Ga0265763_10020142 290
12 3300048920 Ga0496117_0185600 Ga0496117_0185600_16_936 291
13 3300009147 Ga0114129_10187387 Ga0114129_101873872 292
14 3300050507 nmdc:mga05p37_38199_c1 nmdc:mga05p37_38199_c1_3074_3994 292
15 3300050510 nmdc:mga06r32_99584_c1 nmdc:mga06r32_99584_c1_860_1780 292
16 3300009147 Ga0114129_10144786 Ga0114129_101447863 293
17 3300005439 Ga0070711_100062787 Ga0070711_1000627872 296
18 3300006941 Ga0099825_1028625 Ga0099825_10286252 296
19 3300006942 Ga0099824_1008015 Ga0099824_10080157 296
20 3300025939 Ga0207665_10100585 Ga0207665_101005852 296
21 3300025961 Ga0207712_10491158 Ga0207712_104911581 296
22 3300027357 Ga0209589_1000003 Ga0209589_1000003129 296
23 3300027361 Ga0209489_100003 Ga0209489_100003180 296
24 3300027363 Ga0209700_100003 Ga0209700_100003180 296
25 3300035170 Ga0373943_0039879 Ga0373943_0039879_789_1757 296
26 3300035692 Ga0373935_0063679 Ga0373935_0063679_452_1420 296
27 3300035695 Ga0373927_0035312 Ga0373927_0035312_1987_2955 296
28 3300035725 Ga0373947_0124838 Ga0373947_0124838_571_1539 296
29 3300037068 Ga0373925_0111499 Ga0373925_0111499_1131_2099 296
30 3300037471 Ga0395905_0015929 Ga0395905_0015929_965_1933 296
31 3300038443 Ga0395901_0313271 Ga0395901_0313271_519_1487 296
32 3300048906 Ga0496103_0258595 Ga0496103_0258595_93_1028 296
33 3300048917 Ga0496114_0141025 Ga0496114_0141025_161_1129 296
34 3300048918 Ga0496115_0186871 Ga0496115_0186871_153_1121 296
35 3300037466 Ga0395898_0038260 Ga0395898_0038260_3331_4302 297
36 3300037471 Ga0395905_0023661 Ga0395905_0023661_3033_4004 297
37 3300038443 Ga0395901_0282220 Ga0395901_0282220_174_1145 297
38 3300053096 Ga0500641_0024838 Ga0500641_0024838_108_1043 297
39 3300009093 Ga0105240_10336997 Ga0105240_103369972 298
40 3300009545 Ga0105237_10122267 Ga0105237_101222671 298
41 3300009551 Ga0105238_10104631 Ga0105238_101046312 298
42 3300010375 Ga0105239_10200616 Ga0105239_102006162 298
43 3300013104 Ga0157370_10255982 Ga0157370_102559822 298
44 3300013105 Ga0157369_10013882 Ga0157369_100138827 298
45 3300033442 Ga0315911_1000001 Ga0315911_1000001930 298
46 3300047469 Ga0495673_0048880 Ga0495673_0048880_221_1162 298
47 3300003215 JGI25153J46596_10002622 JGI25153J46596_100026228 299
48 3300003775 Ga0055524_1028055 Ga0055524_10280552 299
49 3300003794 Ga0055531_10021216 Ga0055531_100212162 299
50 3300005262 Ga0065165_1004810 Ga0065165_10048107 299
51 3300025245 Ga0207425_1013562 Ga0207425_10135622 299
52 3300025295 Ga0209564_1007417 Ga0209564_10074173 299
53 3300025297 Ga0209758_1000021 Ga0209758_1000021161 299
54 3300025299 Ga0209256_1009218 Ga0209256_10092182 299
55 3300025304 Ga0209257_1003699 Ga0209257_10036995 299
56 3300031249 Ga0265339_10045559 Ga0265339_100455592 299
57 3300037466 Ga0395898_0639738 Ga0395898_0639738_52_996 299
58 3300049592 Ga0501076_0259367 Ga0501076_0259367_379_1353 299
59 3300006195 Ga0075366_10094229 Ga0075366_100942292 300
60 3300006353 Ga0075370_10145114 Ga0075370_101451142 300
61 3300014325 Ga0163163_10207250 Ga0163163_102072502 300
62 3300035113 Ga0373936_0001954 Ga0373936_0001954_1072_2019 300
63 3300035170 Ga0373943_0016473 Ga0373943_0016473_813_1760 300
64 3300035692 Ga0373935_0002610 Ga0373935_0002610_3262_4209 300
65 3300035695 Ga0373927_0000990 Ga0373927_0000990_17241_18188 300
66 3300036401 Ga0373937_0141232 Ga0373937_0141232_1138_2085 300
67 3300037068 Ga0373925_0000863 Ga0373925_0000863_26009_26956 300
68 3300044765 Ga0466970_0088740 Ga0466970_0088740_595_1566 300
69 3300046454 Ga0495592_0083644 Ga0495592_0083644_940_1887 300
70 3300046455 Ga0495603_0000091 Ga0495603_0000091_10995_11942 300
71 3300046459 Ga0495629_0000583 Ga0495629_0000583_18417_19364 300
72 3300046461 Ga0495641_0016977 Ga0495641_0016977_2812_3759 300
73 3300046462 Ga0495651_0254065 Ga0495651_0254065_28_975 300
74 3300046463 Ga0495653_0121517 Ga0495653_0121517_466_1413 300
75 3300046473 Ga0495582_0000049 Ga0495582_0000049_1384_2331 300
76 3300046475 Ga0495639_0001754 Ga0495639_0001754_6675_7622 300
77 3300046477 Ga0495664_0028522 Ga0495664_0028522_1593_2540 300
78 3300046499 Ga0495594_0004148 Ga0495594_0004148_843_1790 300
79 3300046517 Ga0495630_0002266 Ga0495630_0002266_4932_5879 300
80 3300046526 Ga0495666_0005139 Ga0495666_0005139_2327_3274 300
81 3300046529 Ga0495652_0038588 Ga0495652_0038588_1797_2744 300
82 3300046531 Ga0495665_0000941 Ga0495665_0000941_6911_7858 300
83 3300046533 Ga0495640_0008699 Ga0495640_0008699_4642_5589 300
84 3300046557 Ga0495622_0056253 Ga0495622_0056253_182_1129 300
85 3300046559 Ga0495667_0026543 Ga0495667_0026543_1567_2514 300
86 3300046663 Ga0495635_0000084 Ga0495635_0000084_39192_40139 300
87 3300046680 Ga0495646_0048847 Ga0495646_0048847_951_1898 300
88 3300046681 Ga0495647_0000930 Ga0495647_0000930_242_1189 300
89 3300046683 Ga0495658_0000317 Ga0495658_0000317_2271_3218 300
90 3300046689 Ga0495613_0006599 Ga0495613_0006599_4538_5485 300
91 3300046690 Ga0495624_0001263 Ga0495624_0001263_3370_4317 300
92 3300047315 Ga0495581_0001645 Ga0495581_0001645_9087_10034 300
93 3300047319 Ga0495674_0004457 Ga0495674_0004457_1745_2692 300
94 3300047321 Ga0495676_0063822 Ga0495676_0063822_441_1388 300
95 3300047673 Ga0495593_0000016 Ga0495593_0000016_3956_4903 300
96 3300048907 Ga0496104_0049619 Ga0496104_0049619_2946_3893 300
97 3300048918 Ga0496115_0100108 Ga0496115_0100108_1063_2010 300
98 3300050494 nmdc:mga06z11_33657_c1 nmdc:mga06z11_33657_c1_1401_2348 300
99 3300004625 Ga0055543_1001473 Ga0055543_10014734 301
100 3300005262 Ga0065165_1001824 Ga0065165_100182417 301
101 3300005262 Ga0065165_1002121 Ga0065165_100212112 301
102 3300006847 Ga0075431_100410397 Ga0075431_1004103972 301
103 3300006943 Ga0099822_1000056 Ga0099822_100005633 301
104 3300007788 Ga0099795_10002749 Ga0099795_100027493 301
105 3300009094 Ga0111539_10021105 Ga0111539_100211052 301
106 3300010159 Ga0099796_10001502 Ga0099796_100015022 301
107 3300025302 Ga0207426_1000621 Ga0207426_100062117 301
108 3300037471 Ga0395905_0022711 Ga0395905_0022711_3142_4113 301
109 3300037471 Ga0395905_0260930 Ga0395905_0260930_234_1205 301
110 3300046491 Ga0495584_0061114 Ga0495584_0061114_650_1618 301
111 3300048929 Ga0496126_0156461 Ga0496126_0156461_283_1254 301
112 3300050510 nmdc:mga06r32_269701_c1 nmdc:mga06r32_269701_c1_553_1527 301
113 3300053111 Ga0500572_026378 Ga0500572_026378_386_1390 301
114 3300053154 Ga0500619_050858 Ga0500619_050858_144_1148 301
115 3300053177 Ga0500636_0000514 Ga0500636_0000514_7057_8061 301
116 3300006358 Ga0068871_100207203 Ga0068871_1002072032 303
117 3300009177 Ga0105248_10344970 Ga0105248_103449702 303
118 3300026088 Ga0207641_10476764 Ga0207641_104767642 303
119 3300035118 Ga0373954_0083863 Ga0373954_0083863_558_1514 303
120 3300035695 Ga0373927_0010731 Ga0373927_0010731_979_1935 303
121 3300035725 Ga0373947_0055752 Ga0373947_0055752_513_1469 303
122 3300037068 Ga0373925_0069282 Ga0373925_0069282_1290_2246 303
123 3300046459 Ga0495629_0196515 Ga0495629_0196515_273_1229 303
124 3300046475 Ga0495639_0086001 Ga0495639_0086001_314_1270 303
125 3300046476 Ga0495662_0021614 Ga0495662_0021614_763_1719 303
126 3300046516 Ga0495628_0053471 Ga0495628_0053471_922_1878 303
127 3300046533 Ga0495640_0033817 Ga0495640_0033817_2412_3368 303
128 3300046543 Ga0495645_0244979 Ga0495645_0244979_122_1090 303
129 3300046642 Ga0495634_0021559 Ga0495634_0021559_558_1514 303
130 3300047315 Ga0495581_0057934 Ga0495581_0057934_607_1563 303
131 3300048903 Ga0496100_0056703 Ga0496100_0056703_595_1563 303
132 3300048905 Ga0496102_0292828 Ga0496102_0292828_535_1503 303
133 3300048912 Ga0496109_0132439 Ga0496109_0132439_822_1790 303
134 3300048913 Ga0496110_0095364 Ga0496110_0095364_890_1858 303
135 3300048929 Ga0496126_0075290 Ga0496126_0075290_421_1389 303
136 3300053177 Ga0500636_0105674 Ga0500636_0105674_562_1530 303
137 iso_pu_bacteria 2507262055 2507509213 303
138 iso_pu_bacteria 2508501009 2508543281 303
139 iso_pu_bacteria 2508501042 2508690970 303
140 iso_pu_bacteria 2515154112 2515626629 303
141 iso_pu_bacteria 2847930680 2847935395 303
142 iso_pu_bacteria 2874590934 2874597336 303
143 iso_pu_bacteria 2874620515 2874626761 303
144 iso_pu_bacteria 2874645413 2874649331 303
145 iso_pu_bacteria 2876771140 2876777867 303
146 iso_pu_bacteria 2876818435 2876823112 303
147 iso_pu_bacteria 2879074833 2879078624 303
148 iso_pu_bacteria 2879083081 2879088531 303
149 iso_pu_bacteria 2879127579 2879132899 303
150 iso_pu_bacteria 2879142872 2879148698 303
151 iso_pu_bacteria 2885366525 2885371936 303
152 iso_pu_bacteria 2904666416 2904668339 303
153 iso_pu_bacteria 2906643746 2906651111 303
154 iso_pu_bacteria 2935608549 2935611898 303
155 iso_pu_bacteria 2935648319 2935655064 303
156 iso_pu_bacteria 2935656913 2935664004 303
157 iso_pu_bacteria 2935769743 2935772623 303
158 iso_pu_bacteria 2935777560 2935783173 303
159 iso_pu_bacteria 2935785616 2935790916 303
160 iso_pu_bacteria 2935793552 2935799383 303
161 iso_pu_bacteria 2935819856 2935821378 303
162 iso_pu_bacteria 2935847175 2935850363 303
163 iso_pu_bacteria 2935908558 2935913979 303
164 iso_pu_bacteria 2935916978 2935921121 303
165 iso_pu_bacteria 2935926038 2935931833 303
166 iso_pu_bacteria 2935934488 2935940232 303
167 iso_pu_bacteria 2935942939 2935947943 303
168 iso_pu_bacteria 2935951376 2935956516 303
169 iso_pu_bacteria 2935967501 2935973310 303
170 iso_pu_bacteria 2935975950 2935977558 303
171 iso_pu_bacteria 2935984226 2935990026 303
172 iso_pu_bacteria 2936011229 2936018160 303
173 iso_pu_bacteria 2936019824 2936026663 303
174 iso_pu_bacteria 2936028420 2936035406 303
175 iso_pu_bacteria 2936046547 2936053555 303
176 iso_pu_bacteria 2936055302 2936057087 303
177 iso_pu_bacteria 8016522445 8016530223 303
178 iso_pu_bacteria 8016539877 8016548677 303
179 iso_pu_bacteria 8016548790 8016553456 303
180 iso_pu_bacteria 8016557553 8016561835 303
181 iso_pu_bacteria 8016566248 8016573812 303
182 iso_pu_bacteria 8016575299 8016577937 303
183 iso_pu_bacteria 8016595262 8016599666 303
184 iso_pu_bacteria 8016603502 8016611255 303
185 iso_pu_bacteria 8016613128 8016622454 303
186 iso_pu_bacteria 8016622563 8016627330 303
187 iso_pu_bacteria 8016630954 8016631629 303
188 iso_pu_bacteria 8019530166 8019535215 303
189 iso_pu_bacteria 8019538911 8019544267 303
190 iso_pu_bacteria 8019547302 8019554432 303
191 iso_pu_bacteria 8019619141 8019627480 303
192 iso_pu_bacteria 8019629233 8019635091 303
193 iso_pu_bacteria 8019638758 8019644638 303
194 iso_pu_bacteria 8019659431 8019662933 303
195 iso_pu_bacteria 8019668869 8019672532 303
196 iso_pu_bacteria 8019678201 8019683623 303
197 iso_pu_bacteria 8019687851 8019689366 303
198 3300006846 Ga0075430_100000192 Ga0075430_10000019230 304
199 3300025230 Ga0209563_102942 Ga0209563_1029423 304
200 3300025253 Ga0209677_101872 Ga0209677_1018723 304
201 3300025297 Ga0209758_1008361 Ga0209758_10083612 304
202 3300026041 Ga0207639_10079568 Ga0207639_100795682 304
203 3300050509 nmdc:mga0qj67_130_c1 nmdc:mga0qj67_130_c1_22144_23109 304
204 iso_pu_bacteria 2508501128 2509147436 304
205 iso_pu_bacteria 2511231028 2511399953 304
206 iso_pu_bacteria 2513237092 2513625690 304
207 iso_pu_bacteria 2513237095 2513646803 304
208 iso_pu_bacteria 2513237096 2513656811 304
209 iso_pu_bacteria 2513237098 2513677859 304
210 iso_pu_bacteria 2513237101 2513691962 304
211 iso_pu_bacteria 2513237137 2513858000 304
212 iso_pu_bacteria 2513237139 2513876619 304
213 iso_pu_bacteria 2513237141 2513892826 304
214 iso_pu_bacteria 2513237145 2513917996 304
215 iso_pu_bacteria 2513237161 2514010951 304
216 iso_pu_bacteria 2517093001 2517101858 304
217 iso_pu_bacteria 2517572143 2517892958 304
218 iso_pu_bacteria 2524023205 2524436714 304
219 iso_pu_bacteria 2524023210 2524465152 304
220 iso_pu_bacteria 2528768022 2528852211 304
221 iso_pu_bacteria 2617270735 2617352822 304
222 iso_pu_bacteria 2617270741 2617376325 304
223 iso_pu_bacteria 2667528175 2671117585 304
224 iso_pu_bacteria 2721755755 2723845646 304
225 iso_pu_bacteria 2728368998 2728750469 304
226 iso_pu_bacteria 2791355196 2793063915 304
227 iso_pu_bacteria 2791355197 2793073053 304
228 iso_pu_bacteria 2791355199 2793081800 304
229 iso_pu_bacteria 2802429603 2805919874 304
230 iso_pu_bacteria 2824600985 2824606781 304
231 iso_pu_bacteria 2824609381 2824616677 304
232 iso_pu_bacteria 2824617872 2824621868 304
233 iso_pu_bacteria 2824626560 2824632571 304
234 iso_pu_bacteria 2824635225 2824639475 304
235 iso_pu_bacteria 2824644064 2824650981 304
236 iso_pu_bacteria 2824653114 2824659752 304
237 iso_pu_bacteria 2824661429 2824670375 304
238 iso_pu_bacteria 2824671348 2824677862 304
239 iso_pu_bacteria 2824679649 2824683292 304
240 iso_pu_bacteria 2824687955 2824695213 304
241 iso_pu_bacteria 2824696289 2824703508 304
242 iso_pu_bacteria 2824704595 2824712646 304
243 iso_pu_bacteria 2824714736 2824721415 304
244 iso_pu_bacteria 2824723954 2824731374 304
245 iso_pu_bacteria 2824732956 2824739475 304
246 iso_pu_bacteria 2824746037 2824753171 304
247 iso_pu_bacteria 2824753945 2824761291 304
248 iso_pu_bacteria 2824763712 2824772311 304
249 iso_pu_bacteria 2824773399 2824781073 304
250 iso_pu_bacteria 2838122688 2838126384 304
251 iso_pu_bacteria 2841941048 2841943538 304
252 iso_pu_bacteria 2841949485 2841950511 304
253 iso_pu_bacteria 2841957949 2841958125 304
254 iso_pu_bacteria 2841966195 2841966824 304
255 iso_pu_bacteria 2841974524 2841975579 304
256 iso_pu_bacteria 2841983080 2841988218 304
257 iso_pu_bacteria 2842038055 2842039632 304
258 iso_pu_bacteria 2842045827 2842047422 304
259 iso_pu_bacteria 2844315083 2844318501 304
260 iso_pu_bacteria 2847939898 2847946001 304
261 iso_pu_bacteria 2849076700 2849079893 304
262 iso_pu_bacteria 2857509624 2857513717 304
263 iso_pu_bacteria 2874604998 2874609742 304
264 iso_pu_bacteria 2874612657 2874616374 304
265 iso_pu_bacteria 2874628541 2874631180 304
266 iso_pu_bacteria 2876761206 2876768838 304
267 iso_pu_bacteria 2876808645 2876814082 304
268 iso_pu_bacteria 2879099564 2879108093 304
269 iso_pu_bacteria 2879110137 2879118389 304
270 iso_pu_bacteria 2881364244 2881366813 304
271 iso_pu_bacteria 2881665667 2881669828 304
272 iso_pu_bacteria 2885374607 2885375139 304
273 iso_pu_bacteria 2885383462 2885386290 304
274 iso_pu_bacteria 2885409591 2885415936 304
275 iso_pu_bacteria 2888378607 2888383469 304
276 iso_pu_bacteria 2888388044 2888394473 304
277 iso_pu_bacteria 2888419890 2888423847 304
278 iso_pu_bacteria 2889033259 2889040449 304
279 iso_pu_bacteria 2903727486 2903730134 304
280 iso_pu_bacteria 2903748898 2903757732 304
281 iso_pu_bacteria 2903768456 2903771949 304
282 iso_pu_bacteria 2904690495 2904696364 304
283 iso_pu_bacteria 2904699407 2904703121 304
284 iso_pu_bacteria 2904711408 2904717302 304
285 iso_pu_bacteria 2906602504 2906603519 304
286 iso_pu_bacteria 2906610324 2906618051 304
287 iso_pu_bacteria 2906626472 2906632479 304
288 iso_pu_bacteria 2906635258 2906639429 304
289 iso_pu_bacteria 2906660503 2906661535 304
290 iso_pu_bacteria 2908739725 2908743352 304
291 iso_pu_bacteria 2908756301 2908760851 304
292 iso_pu_bacteria 2908775508 2908779553 304
293 iso_pu_bacteria 2922361189 2922368321 304
294 iso_pu_bacteria 2922368715 2922373658 304
295 iso_pu_bacteria 2922386360 2922388218 304
296 iso_pu_bacteria 2922393267 2922395776 304
297 iso_pu_bacteria 2929615660 2929617389 304
298 iso_pu_bacteria 2929624759 2929627094 304
299 iso_pu_bacteria 2932784394 2932787575 304
300 iso_pu_bacteria 2932794094 2932800758 304
301 iso_pu_bacteria 2932801729 2932803376 304
302 iso_pu_bacteria 2932809354 2932813244 304
303 iso_pu_bacteria 2932818245 2932820841 304
304 iso_pu_bacteria 2932828146 2932834792 304
305 iso_pu_bacteria 2933577622 2933579346 304
306 iso_pu_bacteria 2935616580 2935621751 304
307 iso_pu_bacteria 2935630451 2935633589 304
308 iso_pu_bacteria 2935638405 2935642695 304
309 iso_pu_bacteria 2935665750 2935667797 304
310 iso_pu_bacteria 2935675223 2935682294 304
311 iso_pu_bacteria 2935684952 2935688548 304
312 iso_pu_bacteria 2935694250 2935695899 304
313 iso_pu_bacteria 2935703347 2935706643 304
314 iso_pu_bacteria 2935713505 2935715567 304
315 iso_pu_bacteria 2935722832 2935725869 304
316 iso_pu_bacteria 2935732158 2935734386 304
317 iso_pu_bacteria 2935741537 2935743765 304
318 iso_pu_bacteria 2935750917 2935754198 304
319 iso_pu_bacteria 2935760218 2935763237 304
320 iso_pu_bacteria 2935801545 2935806389 304
321 iso_pu_bacteria 2935810662 2935812988 304
322 iso_pu_bacteria 2935827899 2935830640 304
323 iso_pu_bacteria 2935837841 2935840663 304
324 iso_pu_bacteria 2935855204 2935859998 304
325 iso_pu_bacteria 2935864058 2935869367 304
326 iso_pu_bacteria 2935873716 2935880472 304
327 iso_pu_bacteria 2935883170 2935886448 304
328 iso_pu_bacteria 2935959822 2935960315 304
329 iso_pu_bacteria 2935992306 2935999526 304
330 iso_pu_bacteria 2936002035 2936006491 304
331 iso_pu_bacteria 2936037263 2936041576 304
332 iso_pu_bacteria 2940556831 2940560426 304
333 iso_pu_bacteria 2941507105 2941510480 304
334 iso_pu_bacteria 2941515067 2941517782 304
335 iso_pu_bacteria 2941523033 2941525799 304
336 iso_pu_bacteria 2941531003 2941534252 304
337 iso_pu_bacteria 2941538514 2941541207 304
338 iso_pu_bacteria 3005483717 3005489582 304
339 iso_pu_bacteria 3005506211 3005512009 304
340 iso_pu_bacteria 3005587118 3005590083 304
341 iso_pu_bacteria 3005594810 3005598605 304
342 iso_pu_bacteria 3005710791 3005714271 304
343 iso_pu_bacteria 3005718088 3005721777 304
344 iso_pu_bacteria 8006926726 8006928973 304
345 iso_pu_bacteria 8006933436 8006941403 304
346 iso_pu_bacteria 8006964411 8006967275 304
347 iso_pu_bacteria 8006973647 8006981110 304
348 iso_pu_bacteria 8006984368 8006990235 304
349 iso_pu_bacteria 8006994254 8006997513 304
350 iso_pu_bacteria 8016511872 8016514026 304
351 iso_pu_bacteria 8017057580 8017062383 304
352 iso_pu_bacteria 8019555841 8019557320 304
353 iso_pu_bacteria 8019576017 8019581838 304
354 iso_pu_bacteria 8019586578 8019589514 304
355 iso_pu_bacteria 8019597564 8019601754 304
356 iso_pu_bacteria 8019608314 8019616799 304
357 iso_pu_bacteria 8019648815 8019657656 304
358 iso_pu_bacteria 8055742211 8055746996 304
359 iso_pu_bacteria 8056673599 8056674385 304
360 iso_pu_bacteria 8056681323 8056683292 304
361 iso_pu_bacteria 8056689827 8056690064 304
362 iso_pu_bacteria 8056967851 8056972864 304
363 3300005937 Ga0081455_10004165 Ga0081455_1000416518 305
364 3300007076 Ga0075435_100140416 Ga0075435_1001404162 305
365 3300013105 Ga0157369_10171753 Ga0157369_101717532 305
366 3300013308 Ga0157375_10012018 Ga0157375_100120185 305
367 3300014325 Ga0163163_10064633 Ga0163163_100646332 305
368 3300014969 Ga0157376_10009776 Ga0157376_100097762 305
369 3300014969 Ga0157376_10249493 Ga0157376_102494932 305
370 3300026067 Ga0207678_10149643 Ga0207678_101496431 305
371 3300026078 Ga0207702_10046593 Ga0207702_100465933 305
372 3300035088 Ga0373940_0047572 Ga0373940_0047572_142_1110 305
373 3300035691 Ga0373931_0030114 Ga0373931_0030114_899_1867 305
374 3300035695 Ga0373927_0009734 Ga0373927_0009734_1691_2653 305
375 3300035725 Ga0373947_0054066 Ga0373947_0054066_1341_2303 305
376 3300046455 Ga0495603_0165717 Ga0495603_0165717_270_1238 305
377 3300047470 Ga0495681_0072379 Ga0495681_0072379_61_1020 305
378 3300048907 Ga0496104_0021078 Ga0496104_0021078_3152_4111 305
379 3300048908 Ga0496105_0121889 Ga0496105_0121889_780_1748 305
380 3300048927 Ga0496124_0123739 Ga0496124_0123739_112_1071 305
381 3300048929 Ga0496126_0171264 Ga0496126_0171264_696_1655 305
382 3300049460 Ga0495682_0092346 Ga0495682_0092346_98_1066 305
383 3300050512 nmdc:mga0n895_226607_c1 nmdc:mga0n895_226607_c1_365_1327 305
384 3300050513 nmdc:mga0rr50_205805_c1 nmdc:mga0rr50_205805_c1_578_1540 305
385 3300050515 nmdc:mga0a205_329253_c1 nmdc:mga0a205_329253_c1_220_1182 305
386 3300053080 Ga0500635_0074617 Ga0500635_0074617_204_1166 305
387 3300053085 Ga0495619_0173709 Ga0495619_0173709_350_1324 305
388 3300053091 Ga0500647_0049078 Ga0500647_0049078_599_1561 305
389 3300053094 Ga0500566_0000050 Ga0500566_0000050_1495_2457 305
390 3300053095 Ga0500640_015182 Ga0500640_015182_1480_2442 305
391 3300053111 Ga0500572_001914 Ga0500572_001914_3935_4897 305
392 3300053122 Ga0500608_015916 Ga0500608_015916_1616_2578 305
393 3300053123 Ga0500614_007563 Ga0500614_007563_457_1419 305
394 3300053136 Ga0500559_0006962 Ga0500559_0006962_3470_4432 305
395 3300053148 Ga0500590_044558 Ga0500590_044558_713_1675 305
396 3300053150 Ga0500603_000181 Ga0500603_000181_14693_15655 305
397 3300053159 Ga0500630_002739 Ga0500630_002739_4300_5262 305
398 3300053163 Ga0500639_000032 Ga0500639_000032_46524_47486 305
399 3300053178 Ga0500637_0053806 Ga0500637_0053806_64_1026 305
400 3300053735 Ga0500596_000019 Ga0500596_000019_21533_22495 305
401 iso_pu_bacteria 2524023228 2524536947 305
402 iso_pu_bacteria 3005474847 3005479705 305
403 3300005455 Ga0070663_100166046 Ga0070663_1001660462 306
404 3300005937 Ga0081455_10066232 Ga0081455_100662322 306
405 3300005983 Ga0081540_1005242 Ga0081540_100524210 306
406 3300005983 Ga0081540_1011839 Ga0081540_10118392 306
407 3300025901 Ga0207688_10053685 Ga0207688_100536852 306
408 3300033180 Ga0307510_10003508 Ga0307510_1000350810 306
409 3300035086 Ga0373934_0013762 Ga0373934_0013762_796_1788 306
410 3300035111 Ga0373923_0015936 Ga0373923_0015936_743_1735 306
411 3300035117 Ga0373953_0004299 Ga0373953_0004299_1269_2261 306
412 3300035118 Ga0373954_0002781 Ga0373954_0002781_545_1537 306
413 3300035119 Ga0373956_0001152 Ga0373956_0001152_1604_2596 306
414 3300035120 Ga0373957_0000231 Ga0373957_0000231_4040_5032 306
415 3300035172 Ga0373955_0000516 Ga0373955_0000516_8657_9649 306
416 3300035410 Ga0373924_0004088 Ga0373924_0004088_1741_2733 306
417 3300035724 Ga0373933_0005522 Ga0373933_0005522_4785_5777 306
418 3300036401 Ga0373937_0005579 Ga0373937_0005579_984_1976 306
419 3300044694 Ga0466963_0031949 Ga0466963_0031949_1705_2676 306
420 3300044842 Ga0466957_0042130 Ga0466957_0042130_1513_2484 306
421 3300045976 Ga0466967_0017495 Ga0466967_0017495_4602_5573 306
422 3300046454 Ga0495592_0003238 Ga0495592_0003238_1112_2104 306
423 3300046459 Ga0495629_0002346 Ga0495629_0002346_13164_14156 306
424 3300046462 Ga0495651_0006302 Ga0495651_0006302_5652_6644 306
425 3300046463 Ga0495653_0010014 Ga0495653_0010014_1112_2104 306
426 3300046511 Ga0495608_0001108 Ga0495608_0001108_8788_9780 306
427 3300046516 Ga0495628_0019435 Ga0495628_0019435_4065_5057 306
428 3300046529 Ga0495652_0002707 Ga0495652_0002707_1112_2104 306
429 3300046533 Ga0495640_0000856 Ga0495640_0000856_6192_7184 306
430 3300046536 Ga0495587_0000673 Ga0495587_0000673_14989_15981 306
431 3300046543 Ga0495645_0002123 Ga0495645_0002123_11838_12827 306
432 3300046559 Ga0495667_0003072 Ga0495667_0003072_8821_9813 306
433 3300046663 Ga0495635_0000557 Ga0495635_0000557_7931_8923 306
434 3300046675 Ga0495657_0002438 Ga0495657_0002438_14232_15224 306
435 3300046678 Ga0495599_0000349 Ga0495599_0000349_6461_7453 306
436 3300046679 Ga0495623_0002172 Ga0495623_0002172_5833_6825 306
437 3300046680 Ga0495646_0013724 Ga0495646_0013724_900_1892 306
438 3300046689 Ga0495613_0024357 Ga0495613_0024357_1797_2789 306
439 3300046809 Ga0495600_0000972 Ga0495600_0000972_507_1499 306
440 3300047317 Ga0495604_0003341 Ga0495604_0003341_1694_2686 306
441 3300047319 Ga0495674_0004098 Ga0495674_0004098_6289_7281 306
442 3300047322 Ga0495680_0013252 Ga0495680_0013252_432_1424 306
443 3300047444 Ga0495675_0001626 Ga0495675_0001626_133_1125 306
444 3300047471 Ga0495684_0001527 Ga0495684_0001527_8605_9597 306
445 3300047673 Ga0495593_0054253 Ga0495593_0054253_228_1220 306
446 3300053084 Ga0495595_0001209 Ga0495595_0001209_442_1434 306
447 3300053085 Ga0495619_0000434 Ga0495619_0000434_2622_3614 306
448 3300003215 JGI25153J46596_10000984 JGI25153J46596_100009845 307
449 3300003215 JGI25153J46596_10001284 JGI25153J46596_1000128414 307
450 3300005327 Ga0070658_10129103 Ga0070658_101291031 307
451 3300005329 Ga0070683_100107144 Ga0070683_1001071442 307
452 3300005336 Ga0070680_100007541 Ga0070680_1000075412 307
453 3300005530 Ga0070679_100016867 Ga0070679_1000168672 307
454 3300005535 Ga0070684_100059496 Ga0070684_1000594963 307
455 3300005545 Ga0070695_100217138 Ga0070695_1002171381 307
456 3300005563 Ga0068855_100375088 Ga0068855_1003750882 307
457 3300005937 Ga0081455_10039588 Ga0081455_100395882 307
458 3300005981 Ga0081538_10017214 Ga0081538_100172142 307
459 3300005983 Ga0081540_1003385 Ga0081540_10033852 307
460 3300006038 Ga0075365_10007485 Ga0075365_100074852 307
461 3300006186 Ga0075369_10036173 Ga0075369_100361732 307
462 3300006941 Ga0099825_1032320 Ga0099825_10323202 307
463 3300006944 Ga0099823_1032818 Ga0099823_10328184 307
464 3300009098 Ga0105245_10200582 Ga0105245_102005822 307
465 3300009545 Ga0105237_10258024 Ga0105237_102580242 307
466 3300009551 Ga0105238_10055652 Ga0105238_100556524 307
467 3300013297 Ga0157378_10656732 Ga0157378_106567321 307
468 3300014326 Ga0157380_10437039 Ga0157380_104370391 307
469 3300021384 Ga0213876_10127352 Ga0213876_101273521 307
470 3300025272 Ga0209455_1008148 Ga0209455_10081481 307
471 3300025297 Ga0209758_1000521 Ga0209758_100052133 307
472 3300025909 Ga0207705_10088656 Ga0207705_100886562 307
473 3300025912 Ga0207707_10006907 Ga0207707_100069073 307
474 3300025919 Ga0207657_10056124 Ga0207657_100561242 307
475 3300025924 Ga0207694_10035350 Ga0207694_100353503 307
476 3300025949 Ga0207667_10514359 Ga0207667_105143591 307
477 3300027296 Ga0209389_1000132 Ga0209389_100013215 307
478 3300027361 Ga0209489_105021 Ga0209489_10502115 307
479 3300027363 Ga0209700_100281 Ga0209700_10028115 307
480 3300039437 Ga0436365_0025400 Ga0436365_0025400_429_1403 307
481 3300046460 Ga0495638_0001796 Ga0495638_0001796_16735_17703 307
482 3300047471 Ga0495684_0194099 Ga0495684_0194099_506_1480 307
483 3300048910 Ga0496107_0031854 Ga0496107_0031854_100_1068 307
484 3300049581 Ga0501047_0152146 Ga0501047_0152146_387_1358 307
485 3300049742 Ga0501080_0158688 Ga0501080_0158688_314_1285 307
486 3300049823 Ga0501044_0329690 Ga0501044_0329690_92_1063 307
487 3300050492 nmdc:mga0yw44_64687_c1 nmdc:mga0yw44_64687_c1_1166_2134 307
488 3300050516 nmdc:mga0sz30_70284_c1 nmdc:mga0sz30_70284_c1_333_1301 307
489 3300053104 Ga0500556_0008147 Ga0500556_0008147_414_1382 307
490 3300053105 Ga0500557_000024 Ga0500557_000024_71180_72148 307
491 3300053130 Ga0500642_0000214 Ga0500642_0000214_12702_13670 307
492 3300053729 Ga0500625_000122 Ga0500625_000122_13_981 307
493 3300053736 Ga0500599_000822 Ga0500599_000822_162_1130 307
494 3300003203 JGI25406J46586_10001011 JGI25406J46586_100010119 308
495 3300003203 JGI25406J46586_10002294 JGI25406J46586_100022947 308
496 3300003354 JGI25160J50197_1002715 JGI25160J50197_100271510 308
497 3300003354 JGI25160J50197_1011205 JGI25160J50197_10112052 308
498 3300003659 JGI25404J52841_10026012 JGI25404J52841_100260121 308
499 3300005327 Ga0070658_10082028 Ga0070658_100820282 308
500 3300005328 Ga0070676_10202943 Ga0070676_102029431 308
501 3300005330 Ga0070690_100273915 Ga0070690_1002739151 308
502 3300005331 Ga0070670_100450193 Ga0070670_1004501931 308
503 3300005334 Ga0068869_100062315 Ga0068869_1000623152 308
504 3300005336 Ga0070680_100006384 Ga0070680_1000063842 308
505 3300005336 Ga0070680_100013411 Ga0070680_1000134114 308
506 3300005336 Ga0070680_100070234 Ga0070680_1000702342 308
507 3300005338 Ga0068868_100025954 Ga0068868_1000259542 308
508 3300005338 Ga0068868_100078288 Ga0068868_1000782882 308
509 3300005338 Ga0068868_100086883 Ga0068868_1000868832 308
510 3300005338 Ga0068868_100216207 Ga0068868_1002162071 308
511 3300005341 Ga0070691_10072226 Ga0070691_100722261 308
512 3300005347 Ga0070668_100020837 Ga0070668_1000208372 308
513 3300005347 Ga0070668_100175645 Ga0070668_1001756451 308
514 3300005353 Ga0070669_100065058 Ga0070669_1000650582 308
515 3300005355 Ga0070671_100106981 Ga0070671_1001069812 308
516 3300005364 Ga0070673_100081473 Ga0070673_1000814732 308
517 3300005366 Ga0070659_100234804 Ga0070659_1002348041 308
518 3300005367 Ga0070667_100079964 Ga0070667_1000799642 308
519 3300005434 Ga0070709_10168652 Ga0070709_101686522 308
520 3300005435 Ga0070714_100077725 Ga0070714_1000777253 308
521 3300005435 Ga0070714_100078705 Ga0070714_1000787052 308
522 3300005435 Ga0070714_100084713 Ga0070714_1000847132 308
523 3300005435 Ga0070714_100230296 Ga0070714_1002302961 308
524 3300005436 Ga0070713_100160977 Ga0070713_1001609772 308
525 3300005436 Ga0070713_100208398 Ga0070713_1002083982 308
526 3300005437 Ga0070710_10000324 Ga0070710_1000032410 308
527 3300005439 Ga0070711_100050315 Ga0070711_1000503153 308
528 3300005439 Ga0070711_100190978 Ga0070711_1001909782 308
529 3300005441 Ga0070700_100068935 Ga0070700_1000689352 308
530 3300005445 Ga0070708_100240402 Ga0070708_1002404022 308
531 3300005455 Ga0070663_100007789 Ga0070663_1000077895 308
532 3300005455 Ga0070663_100019185 Ga0070663_1000191853 308
533 3300005455 Ga0070663_100020397 Ga0070663_1000203973 308
534 3300005455 Ga0070663_100106361 Ga0070663_1001063611 308
535 3300005456 Ga0070678_100038298 Ga0070678_1000382982 308
536 3300005458 Ga0070681_10011810 Ga0070681_100118102 308
537 3300005458 Ga0070681_10062028 Ga0070681_100620283 308
538 3300005459 Ga0068867_100048145 Ga0068867_1000481452 308
539 3300005468 Ga0070707_100353606 Ga0070707_1003536061 308
540 3300005471 Ga0070698_100282270 Ga0070698_1002822702 308
541 3300005530 Ga0070679_100008166 Ga0070679_1000081663 308
542 3300005530 Ga0070679_100015291 Ga0070679_1000152913 308
543 3300005535 Ga0070684_100081606 Ga0070684_1000816062 308
544 3300005539 Ga0068853_100012234 Ga0068853_1000122343 308
545 3300005539 Ga0068853_100101645 Ga0068853_1001016453 308
546 3300005539 Ga0068853_100117114 Ga0068853_1001171142 308
547 3300005539 Ga0068853_100528548 Ga0068853_1005285481 308
548 3300005543 Ga0070672_100052504 Ga0070672_1000525042 308
549 3300005548 Ga0070665_100026866 Ga0070665_1000268663 308
550 3300005548 Ga0070665_100050851 Ga0070665_1000508513 308
551 3300005548 Ga0070665_100121317 Ga0070665_1001213172 308
552 3300005548 Ga0070665_100126080 Ga0070665_1001260802 308
553 3300005548 Ga0070665_100210582 Ga0070665_1002105822 308
554 3300005563 Ga0068855_100158942 Ga0068855_1001589422 308
555 3300005563 Ga0068855_100431814 Ga0068855_1004318141 308
556 3300005564 Ga0070664_100166302 Ga0070664_1001663022 308
557 3300005564 Ga0070664_100173634 Ga0070664_1001736342 308
558 3300005577 Ga0068857_100145071 Ga0068857_1001450712 308
559 3300005578 Ga0068854_100208121 Ga0068854_1002081212 308
560 3300005614 Ga0068856_100000298 Ga0068856_10000029837 308
561 3300005614 Ga0068856_100280505 Ga0068856_1002805052 308
562 3300005614 Ga0068856_100324563 Ga0068856_1003245632 308
563 3300005614 Ga0068856_100579130 Ga0068856_1005791301 308
564 3300005616 Ga0068852_100042389 Ga0068852_1000423892 308
565 3300005616 Ga0068852_100277413 Ga0068852_1002774132 308
566 3300005616 Ga0068852_100611444 Ga0068852_1006114441 308
567 3300005617 Ga0068859_100241034 Ga0068859_1002410342 308
568 3300005617 Ga0068859_100703690 Ga0068859_1007036901 308
569 3300005618 Ga0068864_100450625 Ga0068864_1004506251 308
570 3300005842 Ga0068858_100129809 Ga0068858_1001298092 308
571 3300005842 Ga0068858_100248373 Ga0068858_1002483732 308
572 3300005843 Ga0068860_100001757 Ga0068860_1000017575 308
573 3300005844 Ga0068862_100174818 Ga0068862_1001748182 308
574 3300005937 Ga0081455_10008515 Ga0081455_100085154 308
575 3300005937 Ga0081455_10071263 Ga0081455_100712632 308
576 3300005937 Ga0081455_10104369 Ga0081455_101043692 308
577 3300005983 Ga0081540_1002604 Ga0081540_10026042 308
578 3300005983 Ga0081540_1003721 Ga0081540_10037217 308
579 3300005983 Ga0081540_1008865 Ga0081540_10088654 308
580 3300005983 Ga0081540_1009618 Ga0081540_10096183 308
581 3300005983 Ga0081540_1017766 Ga0081540_10177664 308
582 3300005983 Ga0081540_1020728 Ga0081540_10207281 308
583 3300005983 Ga0081540_1099144 Ga0081540_10991441 308
584 3300005985 Ga0081539_10001555 Ga0081539_1000155536 308
585 3300005985 Ga0081539_10056299 Ga0081539_100562992 308
586 3300006028 Ga0070717_10001375 Ga0070717_1000137513 308
587 3300006028 Ga0070717_10093442 Ga0070717_100934422 308
588 3300006038 Ga0075365_10013552 Ga0075365_100135524 308
589 3300006038 Ga0075365_10215948 Ga0075365_102159481 308
590 3300006051 Ga0075364_10090025 Ga0075364_100900252 308
591 3300006173 Ga0070716_100008752 Ga0070716_1000087524 308
592 3300006173 Ga0070716_100058477 Ga0070716_1000584772 308
593 3300006173 Ga0070716_100090671 Ga0070716_1000906712 308
594 3300006178 Ga0075367_10063032 Ga0075367_100630322 308
595 3300006195 Ga0075366_10037157 Ga0075366_100371574 308
596 3300006195 Ga0075366_10139293 Ga0075366_101392932 308
597 3300006237 Ga0097621_100269779 Ga0097621_1002697792 308
598 3300006358 Ga0068871_100069039 Ga0068871_1000690392 308
599 3300006358 Ga0068871_100123473 Ga0068871_1001234733 308
600 3300006871 Ga0075434_100173979 Ga0075434_1001739792 308
601 3300006931 Ga0097620_100241027 Ga0097620_1002410272 308
602 3300006931 Ga0097620_100703700 Ga0097620_1007037001 308
603 3300006942 Ga0099824_1012036 Ga0099824_10120368 308
604 3300007788 Ga0099795_10019625 Ga0099795_100196252 308
605 3300007788 Ga0099795_10073064 Ga0099795_100730641 308
606 3300009093 Ga0105240_10123589 Ga0105240_101235892 308
607 3300009098 Ga0105245_10600551 Ga0105245_106005511 308
608 3300009101 Ga0105247_10012733 Ga0105247_100127332 308
609 3300009101 Ga0105247_10034458 Ga0105247_100344583 308
610 3300009101 Ga0105247_10047193 Ga0105247_100471932 308
611 3300009101 Ga0105247_10083805 Ga0105247_100838051 308
612 3300009148 Ga0105243_10071619 Ga0105243_100716193 308
613 3300009148 Ga0105243_10148501 Ga0105243_101485012 308
614 3300009174 Ga0105241_10005414 Ga0105241_100054145 308
615 3300009545 Ga0105237_10016332 Ga0105237_100163322 308
616 3300009545 Ga0105237_10066161 Ga0105237_100661612 308
617 3300009545 Ga0105237_10098063 Ga0105237_100980632 308
618 3300009545 Ga0105237_10330631 Ga0105237_103306312 308
619 3300009553 Ga0105249_10352935 Ga0105249_103529352 308
620 3300010375 Ga0105239_10066451 Ga0105239_100664512 308
621 3300010375 Ga0105239_10103492 Ga0105239_101034922 308
622 3300010375 Ga0105239_10222555 Ga0105239_102225552 308
623 3300011119 Ga0105246_10242938 Ga0105246_102429381 308
624 3300013104 Ga0157370_10058000 Ga0157370_100580002 308
625 3300013104 Ga0157370_10159832 Ga0157370_101598322 308
626 3300013104 Ga0157370_10161187 Ga0157370_101611872 308
627 3300013105 Ga0157369_10036796 Ga0157369_100367964 308
628 3300013105 Ga0157369_10050111 Ga0157369_100501113 308
629 3300013296 Ga0157374_10107019 Ga0157374_101070192 308
630 3300013297 Ga0157378_10007273 Ga0157378_100072738 308
631 3300013307 Ga0157372_10163394 Ga0157372_101633942 308
632 3300013307 Ga0157372_10261836 Ga0157372_102618361 308
633 3300013308 Ga0157375_10375056 Ga0157375_103750561 308
634 3300014325 Ga0163163_10065862 Ga0163163_100658624 308
635 3300014325 Ga0163163_10103392 Ga0163163_101033922 308
636 3300014326 Ga0157380_10176351 Ga0157380_101763512 308
637 3300014968 Ga0157379_10203248 Ga0157379_102032481 308
638 3300014969 Ga0157376_10283217 Ga0157376_102832171 308
639 3300021320 Ga0214544_1000051 Ga0214544_100005133 308
640 3300021321 Ga0214542_1000149 Ga0214542_100014971 308
641 3300021321 Ga0214542_1029292 Ga0214542_10292923 308
642 3300021324 Ga0214545_1001332 Ga0214545_100133232 308
643 3300021324 Ga0214545_1029592 Ga0214545_10295923 308
644 3300021327 Ga0214543_1000148 Ga0214543_100014876 308
645 3300021377 Ga0213874_10022936 Ga0213874_100229362 308
646 3300021384 Ga0213876_10001730 Ga0213876_1000173010 308
647 3300021384 Ga0213876_10218705 Ga0213876_102187051 308
648 3300025253 Ga0209677_100680 Ga0209677_1006807 308
649 3300025254 Ga0209148_1000155 Ga0209148_10001554 308
650 3300025261 Ga0209233_1002203 Ga0209233_10022035 308
651 3300025272 Ga0209455_1005869 Ga0209455_10058692 308
652 3300025297 Ga0209758_1000371 Ga0209758_100037161 308
653 3300025297 Ga0209758_1008906 Ga0209758_10089063 308
654 3300025297 Ga0209758_1010066 Ga0209758_10100662 308
655 3300025302 Ga0207426_1001148 Ga0207426_100114823 308
656 3300025898 Ga0207692_10002171 Ga0207692_100021714 308
657 3300025898 Ga0207692_10056003 Ga0207692_100560032 308
658 3300025900 Ga0207710_10008376 Ga0207710_100083763 308
659 3300025901 Ga0207688_10148705 Ga0207688_101487052 308
660 3300025903 Ga0207680_10083036 Ga0207680_100830362 308
661 3300025904 Ga0207647_10002167 Ga0207647_1000216713 308
662 3300025906 Ga0207699_10011908 Ga0207699_100119084 308
663 3300025906 Ga0207699_10133813 Ga0207699_101338132 308
664 3300025909 Ga0207705_10185716 Ga0207705_101857163 308
665 3300025909 Ga0207705_10232511 Ga0207705_102325112 308
666 3300025911 Ga0207654_10070486 Ga0207654_100704862 308
667 3300025911 Ga0207654_10111217 Ga0207654_101112172 308
668 3300025912 Ga0207707_10000311 Ga0207707_1000031128 308
669 3300025912 Ga0207707_10009050 Ga0207707_100090503 308
670 3300025912 Ga0207707_10016703 Ga0207707_100167033 308
671 3300025913 Ga0207695_10000015 Ga0207695_10000015695 308
672 3300025913 Ga0207695_10113718 Ga0207695_101137182 308
673 3300025914 Ga0207671_10005956 Ga0207671_100059562 308
674 3300025914 Ga0207671_10034521 Ga0207671_100345212 308
675 3300025914 Ga0207671_10071040 Ga0207671_100710401 308
676 3300025914 Ga0207671_10279719 Ga0207671_102797192 308
677 3300025916 Ga0207663_10070416 Ga0207663_100704162 308
678 3300025919 Ga0207657_10008217 Ga0207657_100082173 308
679 3300025919 Ga0207657_10128607 Ga0207657_101286072 308
680 3300025920 Ga0207649_10241589 Ga0207649_102415892 308
681 3300025921 Ga0207652_10060121 Ga0207652_100601212 308
682 3300025921 Ga0207652_10103424 Ga0207652_101034242 308
683 3300025923 Ga0207681_10193042 Ga0207681_101930422 308
684 3300025924 Ga0207694_10098267 Ga0207694_100982672 308
685 3300025927 Ga0207687_10020151 Ga0207687_100201511 308
686 3300025927 Ga0207687_10158824 Ga0207687_101588242 308
687 3300025928 Ga0207700_10008667 Ga0207700_100086676 308
688 3300025928 Ga0207700_10053069 Ga0207700_100530692 308
689 3300025928 Ga0207700_10078203 Ga0207700_100782032 308
690 3300025929 Ga0207664_10020736 Ga0207664_100207363 308
691 3300025929 Ga0207664_10236685 Ga0207664_102366852 308
692 3300025931 Ga0207644_10106666 Ga0207644_101066662 308
693 3300025933 Ga0207706_10192772 Ga0207706_101927721 308
694 3300025937 Ga0207669_10035105 Ga0207669_100351052 308
695 3300025938 Ga0207704_10235822 Ga0207704_102358222 308
696 3300025939 Ga0207665_10006535 Ga0207665_100065357 308
697 3300025939 Ga0207665_10039845 Ga0207665_100398452 308
698 3300025939 Ga0207665_10053856 Ga0207665_100538562 308
699 3300025939 Ga0207665_10110992 Ga0207665_101109922 308
700 3300025940 Ga0207691_10221476 Ga0207691_102214761 308
701 3300025942 Ga0207689_10033992 Ga0207689_100339922 308
702 3300025942 Ga0207689_10238512 Ga0207689_102385121 308
703 3300025945 Ga0207679_10109764 Ga0207679_101097642 308
704 3300025945 Ga0207679_10214059 Ga0207679_102140592 308
705 3300025945 Ga0207679_10319687 Ga0207679_103196872 308
706 3300025949 Ga0207667_10013949 Ga0207667_100139492 308
707 3300025949 Ga0207667_10272186 Ga0207667_102721863 308
708 3300025949 Ga0207667_10346254 Ga0207667_103462542 308
709 3300025960 Ga0207651_10074889 Ga0207651_100748892 308
710 3300025972 Ga0207668_10054956 Ga0207668_100549563 308
711 3300025981 Ga0207640_10323588 Ga0207640_103235881 308
712 3300026023 Ga0207677_10050684 Ga0207677_100506842 308
713 3300026023 Ga0207677_10081247 Ga0207677_100812471 308
714 3300026035 Ga0207703_10224132 Ga0207703_102241322 308
715 3300026041 Ga0207639_10043588 Ga0207639_100435881 308
716 3300026041 Ga0207639_10100473 Ga0207639_101004733 308
717 3300026041 Ga0207639_10191864 Ga0207639_101918643 308
718 3300026041 Ga0207639_10290249 Ga0207639_102902491 308
719 3300026067 Ga0207678_10045470 Ga0207678_100454703 308
720 3300026067 Ga0207678_10046234 Ga0207678_100462343 308
721 3300026067 Ga0207678_10055198 Ga0207678_100551983 308
722 3300026067 Ga0207678_10188742 Ga0207678_101887422 308
723 3300026078 Ga0207702_10000075 Ga0207702_10000075101 308
724 3300026078 Ga0207702_10074830 Ga0207702_100748302 308
725 3300026078 Ga0207702_10135791 Ga0207702_101357912 308
726 3300026089 Ga0207648_10183338 Ga0207648_101833382 308
727 3300026089 Ga0207648_10415961 Ga0207648_104159612 308
728 3300026116 Ga0207674_10018729 Ga0207674_100187292 308
729 3300026116 Ga0207674_10119892 Ga0207674_101198921 308
730 3300026116 Ga0207674_10185431 Ga0207674_101854312 308
731 3300026118 Ga0207675_100121544 Ga0207675_1001215442 308
732 3300026121 Ga0207683_10034696 Ga0207683_100346962 308
733 3300026121 Ga0207683_10040100 Ga0207683_100401002 308
734 3300026121 Ga0207683_10086571 Ga0207683_100865712 308
735 3300026121 Ga0207683_10267564 Ga0207683_102675642 308
736 3300026142 Ga0207698_10019893 Ga0207698_100198932 308
737 3300026142 Ga0207698_10323240 Ga0207698_103232402 308
738 3300026142 Ga0207698_10454091 Ga0207698_104540911 308
739 3300026142 Ga0207698_10524178 Ga0207698_105241781 308
740 3300027296 Ga0209389_1000026 Ga0209389_100002613 308
741 3300027357 Ga0209589_1000022 Ga0209589_100002213 308
742 3300027361 Ga0209489_100058 Ga0209489_10005814 308
743 3300027512 Ga0209179_1002734 Ga0209179_10027342 308
744 3300028379 Ga0268266_10007910 Ga0268266_100079107 308
745 3300028379 Ga0268266_10011695 Ga0268266_100116955 308
746 3300028379 Ga0268266_10028846 Ga0268266_100288462 308
747 3300028379 Ga0268266_10098987 Ga0268266_100989871 308
748 3300028380 Ga0268265_10071943 Ga0268265_100719432 308
749 3300028380 Ga0268265_10297060 Ga0268265_102970601 308
750 3300028381 Ga0268264_10000022 Ga0268264_10000022113 308
751 3300028381 Ga0268264_10254418 Ga0268264_102544182 308
752 3300028381 Ga0268264_10307983 Ga0268264_103079832 308
753 3300028381 Ga0268264_10608058 Ga0268264_106080581 308
754 3300028563 Ga0265319_1004278 Ga0265319_10042786 308
755 3300028573 Ga0265334_10019030 Ga0265334_100190302 308
756 3300028573 Ga0265334_10023807 Ga0265334_100238071 308
757 3300028653 Ga0265323_10000507 Ga0265323_1000050710 308
758 3300028666 Ga0265336_10000113 Ga0265336_1000011325 308
759 3300028786 Ga0307517_10004197 Ga0307517_100041972 308
760 3300028794 Ga0307515_10070921 Ga0307515_100709215 308
761 3300028800 Ga0265338_10000146 Ga0265338_1000014628 308
762 3300031238 Ga0265332_10009325 Ga0265332_100093252 308
763 3300031241 Ga0265325_10032812 Ga0265325_100328121 308
764 3300031507 Ga0307509_10013462 Ga0307509_100134628 308
765 3300031595 Ga0265313_10024648 Ga0265313_100246482 308
766 3300031616 Ga0307508_10000001 Ga0307508_1000000134 308
767 3300031712 Ga0265342_10018653 Ga0265342_100186533 308
768 3300031730 Ga0307516_10012352 Ga0307516_100123523 308
769 3300031730 Ga0307516_10017716 Ga0307516_100177162 308
770 3300031730 Ga0307516_10021129 Ga0307516_100211294 308
771 3300031730 Ga0307516_10326606 Ga0307516_103266062 308
772 3300031824 Ga0307413_10132593 Ga0307413_101325932 308
773 3300031995 Ga0307409_100087070 Ga0307409_1000870702 308
774 3300032126 Ga0307415_100180886 Ga0307415_1001808862 308
775 3300033179 Ga0307507_10117090 Ga0307507_101170902 308
776 3300033180 Ga0307510_10001063 Ga0307510_1000106312 308
777 3300033180 Ga0307510_10019251 Ga0307510_100192517 308
778 3300034816 Ga0373930_0022889 Ga0373930_0022889_18_992 308
779 3300035691 Ga0373931_0019830 Ga0373931_0019830_1659_2627 308
780 3300035691 Ga0373931_0111165 Ga0373931_0111165_518_1489 308
781 3300035692 Ga0373935_0055480 Ga0373935_0055480_257_1312 308
782 3300035695 Ga0373927_0006854 Ga0373927_0006854_6007_6978 308
783 3300035695 Ga0373927_0044920 Ga0373927_0044920_1286_2320 308
784 3300035724 Ga0373933_0000144 Ga0373933_0000144_8710_9714 308
785 3300036401 Ga0373937_0226594 Ga0373937_0226594_279_1274 308
786 3300037068 Ga0373925_0056964 Ga0373925_0056964_1705_2739 308
787 3300037068 Ga0373925_0130874 Ga0373925_0130874_211_1182 308
788 3300037418 Ga0395900_0004148 Ga0395900_0004148_11030_12001 308
789 3300037418 Ga0395900_0105706 Ga0395900_0105706_1249_2223 308
790 3300037418 Ga0395900_0174467 Ga0395900_0174467_862_1833 308
791 3300037466 Ga0395898_0080388 Ga0395898_0080388_683_1657 308
792 3300037466 Ga0395898_0104015 Ga0395898_0104015_220_1191 308
793 3300037466 Ga0395898_0197561 Ga0395898_0197561_255_1226 308
794 3300037471 Ga0395905_0033150 Ga0395905_0033150_17_988 308
795 3300037853 Ga0436364_0241180 Ga0436364_0241180_639_1625 308
796 3300038443 Ga0395901_0016750 Ga0395901_0016750_332_1303 308
797 3300039437 Ga0436365_0174724 Ga0436365_0174724_23_994 308
798 3300039437 Ga0436365_0518597 Ga0436365_0518597_5351_6322 308
799 3300039438 Ga0436360_0352162 Ga0436360_0352162_97_1098 308
800 3300039450 Ga0436363_0794413 Ga0436363_0794413_869_1840 308
801 3300044656 Ga0466969_0036761 Ga0466969_0036761_940_1911 308
802 3300044658 Ga0466972_0001028 Ga0466972_0001028_5815_6786 308
803 3300044693 Ga0466961_0001518 Ga0466961_0001518_12156_13127 308
804 3300044694 Ga0466963_0091374 Ga0466963_0091374_68_1129 308
805 3300044735 Ga0466968_0002599 Ga0466968_0002599_46_1017 308
806 3300045049 Ga0466959_0001349 Ga0466959_0001349_1748_2719 308
807 3300045049 Ga0466959_0050381 Ga0466959_0050381_1762_2745 308
808 3300045976 Ga0466967_0055469 Ga0466967_0055469_1724_2746 308
809 3300045976 Ga0466967_0272275 Ga0466967_0272275_312_1373 308
810 3300045976 Ga0466967_0482705 Ga0466967_0482705_123_1094 308
811 3300046454 Ga0495592_0082619 Ga0495592_0082619_293_1264 308
812 3300046455 Ga0495603_0074363 Ga0495603_0074363_414_1478 308
813 3300046459 Ga0495629_0017906 Ga0495629_0017906_386_1354 308
814 3300046460 Ga0495638_0033661 Ga0495638_0033661_337_1401 308
815 3300046462 Ga0495651_0085743 Ga0495651_0085743_181_1152 308
816 3300046476 Ga0495662_0074899 Ga0495662_0074899_588_1559 308
817 3300046477 Ga0495664_0058161 Ga0495664_0058161_1132_2100 308
818 3300046492 Ga0495585_0192384 Ga0495585_0192384_27_998 308
819 3300046499 Ga0495594_0168990 Ga0495594_0168990_177_1211 308
820 3300046506 Ga0495583_0063695 Ga0495583_0063695_602_1573 308
821 3300046506 Ga0495583_0095274 Ga0495583_0095274_298_1266 308
822 3300046507 Ga0495606_0012828 Ga0495606_0012828_5401_6372 308
823 3300046507 Ga0495606_0166337 Ga0495606_0166337_61_1032 308
824 3300046512 Ga0495610_0038417 Ga0495610_0038417_1007_1978 308
825 3300046513 Ga0495616_0048692 Ga0495616_0048692_1126_2097 308
826 3300046518 Ga0495631_0080142 Ga0495631_0080142_291_1355 308
827 3300046524 Ga0495648_0000494 Ga0495648_0000494_30882_31853 308
828 3300046529 Ga0495652_0044514 Ga0495652_0044514_677_1648 308
829 3300046531 Ga0495665_0011792 Ga0495665_0011792_3462_4517 308
830 3300046533 Ga0495640_0040008 Ga0495640_0040008_785_1756 308
831 3300046558 Ga0495633_0138152 Ga0495633_0138152_90_1058 308
832 3300046559 Ga0495667_0046002 Ga0495667_0046002_1518_2489 308
833 3300046615 Ga0495656_0042732 Ga0495656_0042732_167_1138 308
834 3300046663 Ga0495635_0017248 Ga0495635_0017248_1288_2259 308
835 3300046663 Ga0495635_0266591 Ga0495635_0266591_165_1136 308
836 3300046674 Ga0495588_0087375 Ga0495588_0087375_95_1129 308
837 3300046675 Ga0495657_0044367 Ga0495657_0044367_1389_2360 308
838 3300046678 Ga0495599_0009066 Ga0495599_0009066_1109_2080 308
839 3300046679 Ga0495623_0005553 Ga0495623_0005553_1220_2191 308
840 3300046680 Ga0495646_0071288 Ga0495646_0071288_958_1929 308
841 3300046689 Ga0495613_0092129 Ga0495613_0092129_1159_2130 308
842 3300046690 Ga0495624_0058809 Ga0495624_0058809_1319_2290 308
843 3300046694 Ga0495649_0153847 Ga0495649_0153847_53_1024 308
844 3300046809 Ga0495600_0005107 Ga0495600_0005107_1407_2378 308
845 3300046809 Ga0495600_0092031 Ga0495600_0092031_286_1254 308
846 3300047317 Ga0495604_0001440 Ga0495604_0001440_14027_14998 308
847 3300047317 Ga0495604_0065191 Ga0495604_0065191_580_1551 308
848 3300047319 Ga0495674_0100594 Ga0495674_0100594_380_1351 308
849 3300047320 Ga0495672_0027480 Ga0495672_0027480_142_1143 308
850 3300047322 Ga0495680_0004354 Ga0495680_0004354_7270_8241 308
851 3300047444 Ga0495675_0003112 Ga0495675_0003112_8354_9325 308
852 3300048903 Ga0496100_0005047 Ga0496100_0005047_3789_4769 308
853 3300048904 Ga0496101_0066597 Ga0496101_0066597_1566_2534 308
854 3300048904 Ga0496101_0253844 Ga0496101_0253844_282_1262 308
855 3300048905 Ga0496102_0015785 Ga0496102_0015785_2495_3475 308
856 3300048905 Ga0496102_0576201 Ga0496102_0576201_43_1011 308
857 3300048906 Ga0496103_0015678 Ga0496103_0015678_2417_3397 308
858 3300048907 Ga0496104_0000983 Ga0496104_0000983_152_1123 308
859 3300048908 Ga0496105_0436178 Ga0496105_0436178_32_1000 308
860 3300048909 Ga0496106_0001709 Ga0496106_0001709_7162_8133 308
861 3300048909 Ga0496106_0011477 Ga0496106_0011477_3720_4700 308
862 3300048909 Ga0496106_0020809 Ga0496106_0020809_1587_2558 308
863 3300048910 Ga0496107_0012691 Ga0496107_0012691_4713_5693 308
864 3300048910 Ga0496107_0214408 Ga0496107_0214408_96_1067 308
865 3300048911 Ga0496108_0021927 Ga0496108_0021927_3007_3987 308
866 3300048911 Ga0496108_0043216 Ga0496108_0043216_811_1782 308
867 3300048911 Ga0496108_0150180 Ga0496108_0150180_721_1692 308
868 3300048912 Ga0496109_0058314 Ga0496109_0058314_2148_3128 308
869 3300048912 Ga0496109_0093782 Ga0496109_0093782_1734_2705 308
870 3300048913 Ga0496110_0035664 Ga0496110_0035664_3059_4039 308
871 3300048913 Ga0496110_0080437 Ga0496110_0080437_881_1852 308
872 3300048913 Ga0496110_0123824 Ga0496110_0123824_1198_2169 308
873 3300048913 Ga0496110_0227285 Ga0496110_0227285_334_1302 308
874 3300048915 Ga0496112_0015292 Ga0496112_0015292_4556_5527 308
875 3300048915 Ga0496112_0049152 Ga0496112_0049152_941_1909 308
876 3300048915 Ga0496112_0057171 Ga0496112_0057171_911_1990 308
877 3300048915 Ga0496112_0166733 Ga0496112_0166733_1068_2039 308
878 3300048915 Ga0496112_0224184 Ga0496112_0224184_719_1687 308
879 3300048916 Ga0496113_0014732 Ga0496113_0014732_483_1451 308
880 3300048916 Ga0496113_0031180 Ga0496113_0031180_1524_2504 308
881 3300048916 Ga0496113_0136298 Ga0496113_0136298_612_1580 308
882 3300048916 Ga0496113_0323879 Ga0496113_0323879_59_1138 308
883 3300048917 Ga0496114_0028061 Ga0496114_0028061_3440_4411 308
884 3300048917 Ga0496114_0072576 Ga0496114_0072576_1555_2535 308
885 3300048917 Ga0496114_0091838 Ga0496114_0091838_668_1636 308
886 3300048917 Ga0496114_0257267 Ga0496114_0257267_43_1011 308
887 3300048918 Ga0496115_0003167 Ga0496115_0003167_8038_9018 308
888 3300048918 Ga0496115_0206954 Ga0496115_0206954_465_1433 308
889 3300048919 Ga0496116_0079741 Ga0496116_0079741_193_1164 308
890 3300048920 Ga0496117_0019732 Ga0496117_0019732_1318_2289 308
891 3300048921 Ga0496118_0005814 Ga0496118_0005814_5979_6965 308
892 3300048921 Ga0496118_0022077 Ga0496118_0022077_1419_2390 308
893 3300048921 Ga0496118_0053450 Ga0496118_0053450_1241_2212 308
894 3300048921 Ga0496118_0187559 Ga0496118_0187559_190_1176 308
895 3300048922 Ga0496119_0064005 Ga0496119_0064005_1086_2057 308
896 3300048923 Ga0496120_0025137 Ga0496120_0025137_71_1042 308
897 3300048924 Ga0496121_0000780 Ga0496121_0000780_26826_27797 308
898 3300048924 Ga0496121_0002282 Ga0496121_0002282_27200_28174 308
899 3300048924 Ga0496121_0004720 Ga0496121_0004720_11410_12381 308
900 3300048924 Ga0496121_0010500 Ga0496121_0010500_3062_4033 308
901 3300048924 Ga0496121_0047788 Ga0496121_0047788_2475_3461 308
902 3300048924 Ga0496121_0050265 Ga0496121_0050265_1102_2223 308
903 3300048924 Ga0496121_0075813 Ga0496121_0075813_131_1102 308
904 3300048924 Ga0496121_0131735 Ga0496121_0131735_186_1250 308
905 3300048924 Ga0496121_0158024 Ga0496121_0158024_272_1240 308
906 3300048926 Ga0496123_0185795 Ga0496123_0185795_42_1010 308
907 3300048927 Ga0496124_0001377 Ga0496124_0001377_21915_22886 308
908 3300048927 Ga0496124_0029746 Ga0496124_0029746_2520_3494 308
909 3300048927 Ga0496124_0111760 Ga0496124_0111760_92_1063 308
910 3300048928 Ga0496125_0044938 Ga0496125_0044938_2501_3472 308
911 3300048928 Ga0496125_0116192 Ga0496125_0116192_718_1686 308
912 3300048928 Ga0496125_0148495 Ga0496125_0148495_392_1366 308
913 3300048928 Ga0496125_0175924 Ga0496125_0175924_160_1131 308
914 3300048929 Ga0496126_0007243 Ga0496126_0007243_9072_10136 308
915 3300048929 Ga0496126_0011234 Ga0496126_0011234_4188_5156 308
916 3300048929 Ga0496126_0013669 Ga0496126_0013669_120_1091 308
917 3300048929 Ga0496126_0022293 Ga0496126_0022293_3696_4667 308
918 3300048929 Ga0496126_0055741 Ga0496126_0055741_295_1263 308
919 3300048929 Ga0496126_0094245 Ga0496126_0094245_550_1521 308
920 3300048929 Ga0496126_0098672 Ga0496126_0098672_84_1124 308
921 3300048929 Ga0496126_0149201 Ga0496126_0149201_531_1505 308
922 3300048929 Ga0496126_0245771 Ga0496126_0245771_87_1058 308
923 3300048929 Ga0496126_0298897 Ga0496126_0298897_123_1094 308
924 3300049568 Ga0501031_0008147 Ga0501031_0008147_5029_6000 308
925 3300049569 Ga0501032_0001393 Ga0501032_0001393_15271_16242 308
926 3300049570 Ga0501033_0000098 Ga0501033_0000098_31180_32151 308
927 3300049571 Ga0501034_0001272 Ga0501034_0001272_7901_8872 308
928 3300049572 Ga0501036_0000049 Ga0501036_0000049_42200_43171 308
929 3300049573 Ga0501037_0000069 Ga0501037_0000069_36166_37137 308
930 3300049574 Ga0501038_0000034 Ga0501038_0000034_72806_73777 308
931 3300049575 Ga0501039_0000090 Ga0501039_0000090_30316_31287 308
932 3300049579 Ga0501043_0000130 Ga0501043_0000130_23987_24958 308
933 3300049579 Ga0501043_0223140 Ga0501043_0223140_158_1129 308
934 3300049580 Ga0501046_0000213 Ga0501046_0000213_24667_25638 308
935 3300049580 Ga0501046_0132363 Ga0501046_0132363_394_1368 308
936 3300049581 Ga0501047_0000255 Ga0501047_0000255_61638_62609 308
937 3300049581 Ga0501047_0074567 Ga0501047_0074567_1702_2676 308
938 3300049582 Ga0501048_0001548 Ga0501048_0001548_6579_7550 308
939 3300049583 Ga0501067_0001256 Ga0501067_0001256_7165_8136 308
940 3300049583 Ga0501067_0083508 Ga0501067_0083508_377_1405 308
941 3300049584 Ga0501068_0000197 Ga0501068_0000197_23482_24453 308
942 3300049586 Ga0501070_0008466 Ga0501070_0008466_5029_6000 308
943 3300049586 Ga0501070_0039089 Ga0501070_0039089_1887_2861 308
944 3300049588 Ga0501072_0000146 Ga0501072_0000146_20731_21702 308
945 3300049589 Ga0501073_0000035 Ga0501073_0000035_90416_91387 308
946 3300049589 Ga0501073_0084055 Ga0501073_0084055_376_1350 308
947 3300049590 Ga0501074_0001890 Ga0501074_0001890_4087_5058 308
948 3300049590 Ga0501074_0025708 Ga0501074_0025708_2981_3955 308
949 3300049741 Ga0501079_0011421 Ga0501079_0011421_4772_5743 308
950 3300049742 Ga0501080_0000379 Ga0501080_0000379_8689_9660 308
951 3300049742 Ga0501080_0014118 Ga0501080_0014118_5923_6897 308
952 3300049744 Ga0501083_0001109 Ga0501083_0001109_725_1696 308
953 3300049822 Ga0501035_0000894 Ga0501035_0000894_2691_3662 308
954 3300049823 Ga0501044_0000461 Ga0501044_0000461_385_1356 308
955 3300049823 Ga0501044_0321316 Ga0501044_0321316_133_1104 308
956 3300050490 nmdc:mga03n38_30283_c1 nmdc:mga03n38_30283_c1_1237_2208 308
957 3300050490 nmdc:mga03n38_31959_c1 nmdc:mga03n38_31959_c1_699_1667 308
958 3300050493 nmdc:mga0k408_89006_c1 nmdc:mga0k408_89006_c1_820_1788 308
959 3300050495 nmdc:mga04h51_9482_c1 nmdc:mga04h51_9482_c1_1616_2587 308
960 3300050496 nmdc:mga07m45_45032_c1 nmdc:mga07m45_45032_c1_396_1364 308
961 3300050512 nmdc:mga0n895_96001_c1 nmdc:mga0n895_96001_c1_1158_2126 308
962 3300053086 Ga0500578_0030112 Ga0500578_0030112_411_1382 308
963 3300053087 Ga0500643_000343 Ga0500643_000343_18832_19803 308
964 3300053094 Ga0500566_0009209 Ga0500566_0009209_1430_2401 308
965 3300053094 Ga0500566_0095325 Ga0500566_0095325_169_1137 308
966 3300053096 Ga0500641_0143461 Ga0500641_0143461_40_1011 308
967 3300053097 Ga0500648_113754 Ga0500648_113754_247_1218 308
968 3300053103 Ga0500555_006337 Ga0500555_006337_905_1876 308
969 3300053111 Ga0500572_001347 Ga0500572_001347_2717_3688 308
970 3300053116 Ga0500592_009990 Ga0500592_009990_173_1144 308
971 3300053119 Ga0500595_001213 Ga0500595_001213_1620_2588 308
972 3300053119 Ga0500595_003750 Ga0500595_003750_593_1567 308
973 3300053130 Ga0500642_0009585 Ga0500642_0009585_92_1063 308
974 3300053136 Ga0500559_0001369 Ga0500559_0001369_5892_6863 308
975 3300053139 Ga0500568_0053376 Ga0500568_0053376_477_1448 308
976 3300053140 Ga0500573_0038225 Ga0500573_0038225_817_1788 308
977 3300053150 Ga0500603_000395 Ga0500603_000395_9430_10401 308
978 3300053158 Ga0500627_0057752 Ga0500627_0057752_335_1306 308
979 3300053158 Ga0500627_0131575 Ga0500627_0131575_143_1114 308
980 3300053162 Ga0500638_013568 Ga0500638_013568_905_1873 308
981 3300053163 Ga0500639_061482 Ga0500639_061482_535_1506 308
982 3300053177 Ga0500636_0084940 Ga0500636_0084940_383_1399 308
983 3300053177 Ga0500636_0131859 Ga0500636_0131859_167_1135 308
984 3300053178 Ga0500637_0004846 Ga0500637_0004846_1934_2902 308
985 3300053178 Ga0500637_0057179 Ga0500637_0057179_236_1207 308
986 3300053730 Ga0500645_062045 Ga0500645_062045_59_1027 308
987 3300053735 Ga0500596_002557 Ga0500596_002557_438_1409 308
988 3300054114 Ga0501084_0002564 Ga0501084_0002564_7120_8091 308
989 3300055283 Ga0500661_006386 Ga0500661_006386_605_1573 308
990 3300060353 Ga0501082_0003475 Ga0501082_0003475_8689_9660 308
991 3300061734 Ga0530510_0253069 Ga0530510_0253069_261_1229 308
992 iso_pu_bacteria 2513237104 2513717270 308
993 iso_pu_bacteria 2816332527 2818242818 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

94

369

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.8917 23 304
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.8893 23 308
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.8862 23 306
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.8821 23 300
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.8742 27 308
ID Description Score Start End Superfamily
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9179 23 308 3.40.190.150
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9173 23 306 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9126 23 308 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9094 23 308 3.40.190.150
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9069 23 306 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537AHF9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9404 13 308
AF-A0A537BUW1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9275 20 305
AF-A0A537BUW1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9051 20 305
AF-A0A3N5NRH6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9027 15 306
AF-A0A5C8A5A1-F1-model_v4 deleted 0.9006 15 267

Feature Viewer

pLDDT pTM Quality
88.41 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map