F487688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 499 | 899 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0007972|Ga0316574_0007972_1994_3595 |
| Length | 533 |
| Sequence | LDEVFIAQICQFRFIQWLELQLVTGRVSQKGGILTSAGRPPDQDTGRVGYSRRIASRNSKKPVWPDTPPTESDRLSYAEAEPEPFWLSGPRPAVRSPLEGPAEADLVVVGGGLTGLWAAIQARQRDPGRAVVLIERRRLAIGASGRNGGFMSSSLVHGIGNGLARFPDEIPLLERLGLDNLAEIKRTIDEQAIACDLVSPGAIEIAYTEHQFAELAEVRDELERYGHQAELLDTEALRAEVASPLFCGGLWQKTGECQVDPVKLTDGLADLAESLGVVIHEQTEMTGLAESGPGVTVTTENGSVEAAGALLATSAFRSPVRAIRSRVVPVFDYVLVTEPLSPAQWDSIGWANRQGLSDSANRFHYFRRTADDRILWGGFDAIYHYGGRVEDSYYQRDQSFAGLAQRFFAAFPQLEGVRFSHRWGGAIDTCSRFFAFYGTAHDGRVAYAVGHTGLGVGASRFSAGVGLDLLDGRESEVTGLDYTRKKPIPFPPEPIRWGAIQFTRNRLAAADHNNGERGLWLNTLDRLGLGFDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 3 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 4 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 5 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 6 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 7 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 8 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 9 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 10 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 11 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 12 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 13 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 14 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 15 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 16 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 17 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 18 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 19 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 20 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 21 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 22 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 23 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 24 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 25 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 26 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 27 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 28 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 29 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 30 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 31 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 32 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 33 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 34 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 35 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 36 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 37 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 38 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 39 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 40 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 41 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 42 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 43 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 44 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 45 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 46 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 47 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 48 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 49 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 50 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 51 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 52 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 53 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 54 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 55 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 56 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 57 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 58 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 59 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 60 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 61 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 62 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 63 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 64 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 65 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 66 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 67 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 68 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 69 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 70 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 71 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 72 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 73 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 74 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 75 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 76 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 77 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 78 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 79 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 80 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 81 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 82 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 83 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 84 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 85 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 86 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 102 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 126 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 128 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 129 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 131 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 132 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 133 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 134 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 135 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 136 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 137 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 138 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 139 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 141 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 142 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 145 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 146 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 149 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 152 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 153 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 183 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 188 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 192 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 247 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 248 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 250 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 254 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 255 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 256 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 258 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 267 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 285 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 286 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 287 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 288 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 289 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 293 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 294 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 295 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 296 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 297 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 298 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 299 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 300 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 301 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 302 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 303 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 304 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 305 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 311 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 312 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 427 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 428 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 429 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 432 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 433 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 434 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 435 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 436 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 483 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 484 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 488 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 489 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 490 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 491 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 492 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 493 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 494 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 495 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 496 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 497 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 498 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 499 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.33 |
| Metatranscriptomes | 0.2 |
| Isolates | 9.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0.81 |
| Rhizoplane | 6.24 |
| Rhizosphere | 80.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2356726 | 2162886007 | Bacteria | 8681 |
| 2 | JGI24739J22299_10008030 | 3300001989 | Bacteria | 3946 |
| 3 | rootH1_10007774 | 3300003316 | Bacteria | 3916 |
| 4 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 5 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 6 | Ga0055525_1000380 | 3300003759 | Bacteria | 29022 |
| 7 | Ga0055541_1004937 | 3300003841 | Bacteria | 2375 |
| 8 | Ga0065704_10000402 | 3300005289 | Bacteria | 23340 |
| 9 | Ga0070683_100001804 | 3300005329 | Bacteria | 16684 |
| 10 | Ga0070683_100005756 | 3300005329 | Bacteria | 10356 |
| 11 | Ga0070683_100007076 | 3300005329 | Bacteria | 9447 |
| 12 | Ga0070683_100047206 | 3300005329 | Bacteria | 3979 |
| 13 | Ga0070690_100011504 | 3300005330 | Bacteria | 5176 |
| 14 | Ga0070680_100123933 | 3300005336 | Bacteria | 2159 |
| 15 | Ga0068868_100088939 | 3300005338 | Bacteria | 2486 |
| 16 | Ga0070660_100004477 | 3300005339 | Bacteria | 9658 |
| 17 | Ga0070689_100014630 | 3300005340 | Bacteria | 5704 |
| 18 | Ga0070689_100045036 | 3300005340 | Bacteria | 3396 |
| 19 | Ga0070689_100173754 | 3300005340 | Bacteria | 1747 |
| 20 | Ga0070691_10046440 | 3300005341 | Bacteria | 2063 |
| 21 | Ga0070691_10046653 | 3300005341 | Bacteria | 2058 |
| 22 | Ga0070692_10006941 | 3300005345 | Bacteria | 4954 |
| 23 | Ga0070675_100088572 | 3300005354 | Bacteria | 2590 |
| 24 | Ga0070674_100014137 | 3300005356 | Bacteria | 4956 |
| 25 | Ga0070688_100013601 | 3300005365 | Bacteria | 4594 |
| 26 | Ga0070659_100019330 | 3300005366 | Bacteria | 5160 |
| 27 | Ga0070659_100037742 | 3300005366 | Bacteria | 3767 |
| 28 | Ga0070659_100090172 | 3300005366 | Bacteria | 2457 |
| 29 | Ga0070667_100004625 | 3300005367 | Bacteria | 11557 |
| 30 | Ga0070714_100158941 | 3300005435 | Bacteria | 2043 |
| 31 | Ga0070714_100236547 | 3300005435 | Bacteria | 1684 |
| 32 | Ga0070713_100018140 | 3300005436 | Bacteria | 5347 |
| 33 | Ga0070710_10021222 | 3300005437 | Bacteria | 3381 |
| 34 | Ga0070710_10092963 | 3300005437 | Bacteria | 1782 |
| 35 | Ga0070701_10009540 | 3300005438 | Bacteria | 4256 |
| 36 | Ga0070700_100005709 | 3300005441 | Bacteria | 6606 |
| 37 | Ga0070700_100084435 | 3300005441 | Bacteria | 2058 |
| 38 | Ga0070694_100046543 | 3300005444 | Bacteria | 2912 |
| 39 | Ga0070694_100053650 | 3300005444 | Bacteria | 2729 |
| 40 | Ga0070694_100182912 | 3300005444 | Bacteria | 1551 |
| 41 | Ga0070663_100001298 | 3300005455 | Bacteria | 13667 |
| 42 | Ga0070663_100026056 | 3300005455 | Bacteria | 3955 |
| 43 | Ga0070678_100054328 | 3300005456 | Bacteria | 2918 |
| 44 | Ga0070678_100119278 | 3300005456 | Bacteria | 2077 |
| 45 | Ga0070662_100052820 | 3300005457 | Bacteria | 2940 |
| 46 | Ga0070685_10037100 | 3300005466 | Bacteria | 2759 |
| 47 | Ga0070706_100002897 | 3300005467 | Bacteria | 17079 |
| 48 | Ga0070698_100027456 | 3300005471 | Bacteria | 5920 |
| 49 | Ga0070698_100052450 | 3300005471 | Bacteria | 4149 |
| 50 | Ga0070699_100122518 | 3300005518 | Bacteria | 2287 |
| 51 | Ga0070679_100003951 | 3300005530 | Bacteria | 13647 |
| 52 | Ga0070679_100181330 | 3300005530 | Bacteria | 2078 |
| 53 | Ga0070679_100229784 | 3300005530 | Bacteria | 1815 |
| 54 | Ga0070684_100010212 | 3300005535 | Bacteria | 7429 |
| 55 | Ga0070672_100012120 | 3300005543 | Bacteria | 6036 |
| 56 | Ga0070686_100018885 | 3300005544 | Bacteria | 4054 |
| 57 | Ga0070696_100052283 | 3300005546 | Bacteria | 2842 |
| 58 | Ga0070693_100088235 | 3300005547 | Bacteria | 1864 |
| 59 | Ga0070665_100005781 | 3300005548 | Bacteria | 12694 |
| 60 | Ga0070665_100076756 | 3300005548 | Bacteria | 3348 |
| 61 | Ga0070704_100025377 | 3300005549 | Bacteria | 3902 |
| 62 | Ga0070704_100041217 | 3300005549 | Bacteria | 3185 |
| 63 | Ga0068855_100005950 | 3300005563 | Bacteria | 14871 |
| 64 | Ga0068855_100010155 | 3300005563 | Bacteria | 11347 |
| 65 | Ga0068855_100078367 | 3300005563 | Bacteria | 3833 |
| 66 | Ga0068855_100264310 | 3300005563 | Bacteria | 1916 |
| 67 | Ga0070664_100216722 | 3300005564 | Bacteria | 1712 |
| 68 | Ga0068857_100001615 | 3300005577 | Bacteria | 18094 |
| 69 | Ga0068856_100006739 | 3300005614 | Bacteria | 11257 |
| 70 | Ga0070702_100002049 | 3300005615 | Bacteria | 8524 |
| 71 | Ga0070702_100088948 | 3300005615 | Bacteria | 1868 |
| 72 | Ga0068852_100014131 | 3300005616 | Bacteria | 6132 |
| 73 | Ga0068859_100197944 | 3300005617 | Bacteria | 2094 |
| 74 | Ga0068870_10013878 | 3300005840 | Bacteria | 3794 |
| 75 | Ga0068863_100171112 | 3300005841 | Bacteria | 2083 |
| 76 | Ga0068860_100027413 | 3300005843 | Bacteria | 5488 |
| 77 | Ga0068860_100255980 | 3300005843 | Bacteria | 1705 |
| 78 | Ga0068862_100175452 | 3300005844 | Bacteria | 1921 |
| 79 | Ga0081455_10170803 | 3300005937 | Bacteria | 1656 |
| 80 | Ga0081538_10002004 | 3300005981 | Bacteria | 20341 |
| 81 | Ga0081538_10003351 | 3300005981 | Bacteria | 15172 |
| 82 | Ga0081539_10012226 | 3300005985 | Bacteria | 6658 |
| 83 | Ga0081539_10013276 | 3300005985 | Bacteria | 6221 |
| 84 | Ga0070717_10006834 | 3300006028 | Bacteria | 8418 |
| 85 | Ga0075365_10000417 | 3300006038 | Bacteria | 15685 |
| 86 | Ga0075365_10017264 | 3300006038 | Bacteria | 4412 |
| 87 | Ga0075364_10175155 | 3300006051 | Bacteria | 1450 |
| 88 | Ga0070715_10033815 | 3300006163 | Bacteria | 2092 |
| 89 | Ga0070712_100034706 | 3300006175 | Bacteria | 3420 |
| 90 | Ga0075362_10035626 | 3300006177 | Bacteria | 2173 |
| 91 | Ga0075367_10002121 | 3300006178 | Bacteria | 8920 |
| 92 | Ga0075370_10012794 | 3300006353 | Bacteria | 4444 |
| 93 | Ga0068871_100073933 | 3300006358 | Bacteria | 2811 |
| 94 | Ga0075428_100047189 | 3300006844 | Bacteria | 4732 |
| 95 | Ga0075430_100005002 | 3300006846 | Bacteria | 11159 |
| 96 | Ga0075434_100000189 | 3300006871 | Bacteria | 40699 |
| 97 | Ga0075434_100166335 | 3300006871 | Bacteria | 2225 |
| 98 | Ga0075429_100001085 | 3300006880 | Bacteria | 21851 |
| 99 | Ga0075429_100244028 | 3300006880 | Bacteria | 1573 |
| 100 | Ga0075436_100156674 | 3300006914 | Bacteria | 1604 |
| 101 | Ga0097620_100197948 | 3300006931 | Bacteria | 2094 |
| 102 | Ga0079104_1000142 | 3300006946 | Bacteria | 101403 |
| 103 | Ga0075435_100001011 | 3300007076 | Bacteria | 17837 |
| 104 | Ga0105251_10000028 | 3300009011 | Bacteria | 126517 |
| 105 | Ga0105251_10005290 | 3300009011 | Bacteria | 8492 |
| 106 | Ga0105244_10035727 | 3300009036 | Bacteria | 2609 |
| 107 | Ga0105250_10016941 | 3300009092 | Bacteria | 2965 |
| 108 | Ga0105240_10097074 | 3300009093 | Bacteria | 3591 |
| 109 | Ga0111539_10014975 | 3300009094 | Bacteria | 9667 |
| 110 | Ga0111539_10045910 | 3300009094 | Bacteria | 5228 |
| 111 | Ga0105245_10012419 | 3300009098 | Bacteria | 7412 |
| 112 | Ga0105245_10043223 | 3300009098 | Bacteria | 4020 |
| 113 | Ga0105245_10051117 | 3300009098 | Bacteria | 3706 |
| 114 | Ga0105245_10080823 | 3300009098 | Bacteria | 2970 |
| 115 | Ga0105247_10005054 | 3300009101 | Bacteria | 8367 |
| 116 | Ga0114129_10038117 | 3300009147 | Bacteria | 6782 |
| 117 | Ga0114129_10047429 | 3300009147 | Bacteria | 6036 |
| 118 | Ga0114129_10130307 | 3300009147 | Bacteria | 3455 |
| 119 | Ga0114129_10203705 | 3300009147 | Bacteria | 2678 |
| 120 | Ga0114129_10213756 | 3300009147 | Bacteria | 2605 |
| 121 | Ga0114129_10337423 | 3300009147 | Bacteria | 2000 |
| 122 | Ga0105243_10153370 | 3300009148 | Bacteria | 1979 |
| 123 | Ga0105241_10016538 | 3300009174 | Bacteria | 5410 |
| 124 | Ga0105242_10008446 | 3300009176 | Bacteria | 7912 |
| 125 | Ga0105248_10130522 | 3300009177 | Bacteria | 2835 |
| 126 | Ga0105237_10028680 | 3300009545 | Bacteria | 5666 |
| 127 | Ga0105238_10006910 | 3300009551 | Bacteria | 11335 |
| 128 | Ga0105249_10003437 | 3300009553 | Bacteria | 13716 |
| 129 | Ga0105249_10061989 | 3300009553 | Bacteria | 3432 |
| 130 | Ga0105249_10119646 | 3300009553 | Bacteria | 2501 |
| 131 | Ga0105239_10011317 | 3300010375 | Bacteria | 9956 |
| 132 | Ga0105239_10079943 | 3300010375 | Bacteria | 3597 |
| 133 | Ga0105239_10166043 | 3300010375 | Bacteria | 2468 |
| 134 | Ga0105239_10221035 | 3300010375 | Bacteria | 2124 |
| 135 | Ga0105246_10001045 | 3300011119 | Bacteria | 15971 |
| 136 | Ga0105246_10028403 | 3300011119 | Bacteria | 3675 |
| 137 | Ga0157373_10007299 | 3300013100 | Bacteria | 8231 |
| 138 | Ga0157373_10145311 | 3300013100 | Bacteria | 1668 |
| 139 | Ga0157370_10000171 | 3300013104 | Bacteria | 80526 |
| 140 | Ga0157370_10002106 | 3300013104 | Bacteria | 24313 |
| 141 | Ga0157369_10254076 | 3300013105 | Bacteria | 1834 |
| 142 | Ga0157374_10006009 | 3300013296 | Bacteria | 10274 |
| 143 | Ga0163162_10039119 | 3300013306 | Bacteria | 4737 |
| 144 | Ga0163162_10234050 | 3300013306 | Bacteria | 1968 |
| 145 | Ga0157372_10081794 | 3300013307 | Bacteria | 3656 |
| 146 | Ga0157375_10007971 | 3300013308 | Bacteria | 9271 |
| 147 | Ga0157375_10031099 | 3300013308 | Bacteria | 5040 |
| 148 | Ga0157375_10040166 | 3300013308 | Bacteria | 4508 |
| 149 | Ga0163163_10001642 | 3300014325 | Bacteria | 18835 |
| 150 | Ga0163163_10035479 | 3300014325 | Bacteria | 4838 |
| 151 | Ga0163163_10115721 | 3300014325 | Bacteria | 2713 |
| 152 | Ga0163163_10168250 | 3300014325 | Bacteria | 2238 |
| 153 | Ga0157380_10014657 | 3300014326 | Bacteria | 5740 |
| 154 | Ga0182008_10005025 | 3300014497 | Bacteria | 7607 |
| 155 | Ga0182008_10040017 | 3300014497 | Bacteria | 2341 |
| 156 | Ga0182008_10041075 | 3300014497 | Bacteria | 2308 |
| 157 | Ga0157377_10003986 | 3300014745 | Bacteria | 6736 |
| 158 | Ga0157377_10133436 | 3300014745 | Bacteria | 1519 |
| 159 | Ga0157379_10023448 | 3300014968 | Bacteria | 5477 |
| 160 | Ga0157379_10030343 | 3300014968 | Bacteria | 4812 |
| 161 | Ga0157379_10076652 | 3300014968 | Bacteria | 2994 |
| 162 | Ga0157376_10134600 | 3300014969 | Bacteria | 2210 |
| 163 | Ga0182007_10002937 | 3300015262 | Bacteria | 8276 |
| 164 | Ga0183367_1013 | 3300015688 | Bacteria | 334176 |
| 165 | Ga0163161_10184772 | 3300017792 | Bacteria | 1600 |
| 166 | Ga0206354_10254398 | 3300020081 | Bacteria | 3634 |
| 167 | Ga0206353_10224325 | 3300020082 | Bacteria | 11607 |
| 168 | Ga0213875_10012540 | 3300021388 | Bacteria | 4183 |
| 169 | Ga0209566_100065 | 3300025225 | Bacteria | 190999 |
| 170 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 171 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 172 | Ga0209563_100252 | 3300025230 | Bacteria | 25149 |
| 173 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 174 | Ga0209455_1001658 | 3300025272 | Bacteria | 9644 |
| 175 | Ga0209676_1002314 | 3300025292 | Bacteria | 13841 |
| 176 | Ga0209758_1004580 | 3300025297 | Bacteria | 11393 |
| 177 | Ga0207426_1027582 | 3300025302 | Bacteria | 1891 |
| 178 | Ga0209051_1004589 | 3300025303 | Bacteria | 8433 |
| 179 | Ga0207655_1017889 | 3300025728 | Bacteria | 3797 |
| 180 | Ga0207713_1001010 | 3300025735 | Bacteria | 24522 |
| 181 | Ga0207713_1009028 | 3300025735 | Bacteria | 5666 |
| 182 | Ga0207692_10017634 | 3300025898 | Bacteria | 3188 |
| 183 | Ga0207688_10006244 | 3300025901 | Bacteria | 6484 |
| 184 | Ga0207688_10025712 | 3300025901 | Bacteria | 3235 |
| 185 | Ga0207680_10001832 | 3300025903 | Bacteria | 10001 |
| 186 | Ga0207685_10006028 | 3300025905 | Bacteria | 3263 |
| 187 | Ga0207643_10004317 | 3300025908 | Bacteria | 7642 |
| 188 | Ga0207684_10000712 | 3300025910 | Bacteria | 39185 |
| 189 | Ga0207684_10017570 | 3300025910 | Bacteria | 6134 |
| 190 | Ga0207707_10040477 | 3300025912 | Bacteria | 4070 |
| 191 | Ga0207695_10161214 | 3300025913 | Bacteria | 2174 |
| 192 | Ga0207671_10029571 | 3300025914 | Bacteria | 4091 |
| 193 | Ga0207663_10036671 | 3300025916 | Bacteria | 2951 |
| 194 | Ga0207660_10107824 | 3300025917 | Bacteria | 2091 |
| 195 | Ga0207662_10044008 | 3300025918 | Bacteria | 2635 |
| 196 | Ga0207657_10001049 | 3300025919 | Bacteria | 29285 |
| 197 | Ga0207657_10236760 | 3300025919 | Bacteria | 1458 |
| 198 | Ga0207652_10001981 | 3300025921 | Bacteria | 17723 |
| 199 | Ga0207652_10065345 | 3300025921 | Bacteria | 3150 |
| 200 | Ga0207646_10003672 | 3300025922 | Bacteria | 17140 |
| 201 | Ga0207650_10089409 | 3300025925 | Bacteria | 2350 |
| 202 | Ga0207687_10020792 | 3300025927 | Bacteria | 4355 |
| 203 | Ga0207687_10033407 | 3300025927 | Bacteria | 3490 |
| 204 | Ga0207687_10036767 | 3300025927 | Bacteria | 3336 |
| 205 | Ga0207687_10079961 | 3300025927 | Bacteria | 2358 |
| 206 | Ga0207700_10067360 | 3300025928 | Bacteria | 2740 |
| 207 | Ga0207700_10073395 | 3300025928 | Bacteria | 2642 |
| 208 | Ga0207690_10021718 | 3300025932 | Bacteria | 3984 |
| 209 | Ga0207709_10071548 | 3300025935 | Bacteria | 2203 |
| 210 | Ga0207670_10057461 | 3300025936 | Bacteria | 2639 |
| 211 | Ga0207669_10011927 | 3300025937 | Bacteria | 4252 |
| 212 | Ga0207691_10002035 | 3300025940 | Bacteria | 19784 |
| 213 | Ga0207661_10009900 | 3300025944 | Bacteria | 6846 |
| 214 | Ga0207661_10025114 | 3300025944 | Bacteria | 4526 |
| 215 | Ga0207661_10087281 | 3300025944 | Bacteria | 2590 |
| 216 | Ga0207679_10027162 | 3300025945 | Bacteria | 3956 |
| 217 | Ga0207667_10004544 | 3300025949 | Bacteria | 17001 |
| 218 | Ga0207667_10022448 | 3300025949 | Bacteria | 6971 |
| 219 | Ga0207667_10042075 | 3300025949 | Bacteria | 4859 |
| 220 | Ga0207667_10138203 | 3300025949 | Bacteria | 2509 |
| 221 | Ga0207667_10288318 | 3300025949 | Bacteria | 1677 |
| 222 | Ga0207712_10027414 | 3300025961 | Bacteria | 3804 |
| 223 | Ga0207658_10005964 | 3300025986 | Bacteria | 8325 |
| 224 | Ga0207677_10002013 | 3300026023 | Bacteria | 10722 |
| 225 | Ga0207703_10017164 | 3300026035 | Bacteria | 5647 |
| 226 | Ga0207703_10102515 | 3300026035 | Bacteria | 2428 |
| 227 | Ga0207678_10013299 | 3300026067 | Bacteria | 7221 |
| 228 | Ga0207678_10153408 | 3300026067 | Bacteria | 1967 |
| 229 | Ga0207678_10183650 | 3300026067 | Bacteria | 1786 |
| 230 | Ga0207708_10002698 | 3300026075 | Bacteria | 13040 |
| 231 | Ga0207708_10010588 | 3300026075 | Bacteria | 6849 |
| 232 | Ga0207708_10020860 | 3300026075 | Bacteria | 4943 |
| 233 | Ga0207708_10062163 | 3300026075 | Bacteria | 2852 |
| 234 | Ga0207708_10103322 | 3300026075 | Bacteria | 2207 |
| 235 | Ga0207702_10059919 | 3300026078 | Bacteria | 3244 |
| 236 | Ga0207702_10254942 | 3300026078 | Bacteria | 1649 |
| 237 | Ga0207648_10007537 | 3300026089 | Bacteria | 10678 |
| 238 | Ga0207648_10009814 | 3300026089 | Bacteria | 9142 |
| 239 | Ga0207674_10003543 | 3300026116 | Bacteria | 19056 |
| 240 | Ga0207674_10041172 | 3300026116 | Bacteria | 4780 |
| 241 | Ga0207675_100003571 | 3300026118 | Bacteria | 15149 |
| 242 | Ga0207683_10015323 | 3300026121 | Bacteria | 6529 |
| 243 | Ga0207683_10029962 | 3300026121 | Bacteria | 4713 |
| 244 | Ga0207698_10117615 | 3300026142 | Bacteria | 2243 |
| 245 | Ga0209281_1000262 | 3300027111 | Bacteria | 101417 |
| 246 | Ga0209813_10012039 | 3300027866 | Bacteria | 2275 |
| 247 | Ga0207428_10021554 | 3300027907 | Bacteria | 5454 |
| 248 | Ga0207428_10049408 | 3300027907 | Bacteria | 3371 |
| 249 | Ga0268266_10000867 | 3300028379 | Bacteria | 39343 |
| 250 | Ga0268264_10021585 | 3300028381 | Bacteria | 5257 |
| 251 | Ga0268264_10116875 | 3300028381 | Bacteria | 2345 |
| 252 | Ga0307517_10027373 | 3300028786 | Bacteria | 6849 |
| 253 | Ga0307515_10004249 | 3300028794 | Bacteria | 29735 |
| 254 | Ga0307515_10044960 | 3300028794 | Bacteria | 6802 |
| 255 | Ga0307515_10181178 | 3300028794 | Bacteria | 2056 |
| 256 | Ga0265338_10014545 | 3300028800 | Bacteria | 8744 |
| 257 | Ga0307511_10000330 | 3300030521 | Bacteria | 50161 |
| 258 | Ga0307512_10007323 | 3300030522 | Bacteria | 10962 |
| 259 | Ga0265325_10002382 | 3300031241 | Bacteria | 12701 |
| 260 | Ga0265340_10001983 | 3300031247 | Bacteria | 11708 |
| 261 | Ga0307513_10082868 | 3300031456 | Bacteria | 3300 |
| 262 | Ga0307509_10046494 | 3300031507 | Bacteria | 4672 |
| 263 | Ga0307509_10188592 | 3300031507 | Bacteria | 1916 |
| 264 | Ga0307509_10205063 | 3300031507 | Bacteria | 1803 |
| 265 | Ga0307508_10004026 | 3300031616 | Bacteria | 14548 |
| 266 | Ga0307508_10010192 | 3300031616 | Bacteria | 8600 |
| 267 | Ga0307508_10019315 | 3300031616 | Bacteria | 6195 |
| 268 | Ga0307508_10086669 | 3300031616 | Bacteria | 2715 |
| 269 | Ga0265342_10073201 | 3300031712 | Bacteria | 1993 |
| 270 | Ga0316576_10000264 | 3300031727 | Bacteria | 22816 |
| 271 | Ga0316576_10004163 | 3300031727 | Bacteria | 8633 |
| 272 | Ga0316576_10008273 | 3300031727 | Bacteria | 6621 |
| 273 | Ga0316576_10020117 | 3300031727 | Bacteria | 4585 |
| 274 | Ga0316576_10028397 | 3300031727 | Bacteria | 3943 |
| 275 | Ga0316576_10048948 | 3300031727 | Bacteria | 3068 |
| 276 | Ga0316578_10010547 | 3300031728 | Bacteria | 4800 |
| 277 | Ga0307516_10013366 | 3300031730 | Bacteria | 8759 |
| 278 | Ga0307516_10042121 | 3300031730 | Bacteria | 4532 |
| 279 | Ga0307516_10084360 | 3300031730 | Bacteria | 3016 |
| 280 | Ga0307405_10080230 | 3300031731 | Bacteria | 2130 |
| 281 | Ga0307405_10119028 | 3300031731 | Bacteria | 1804 |
| 282 | Ga0307518_10022320 | 3300031838 | Bacteria | 4553 |
| 283 | Ga0307518_10063752 | 3300031838 | Bacteria | 2675 |
| 284 | Ga0307406_10069915 | 3300031901 | Bacteria | 2297 |
| 285 | Ga0307412_10074959 | 3300031911 | Bacteria | 2320 |
| 286 | Ga0307409_100018133 | 3300031995 | Bacteria | 4718 |
| 287 | Ga0307416_100002034 | 3300032002 | Bacteria | 11380 |
| 288 | Ga0307416_100187723 | 3300032002 | Bacteria | 1945 |
| 289 | Ga0307415_100047472 | 3300032126 | Bacteria | 2891 |
| 290 | Ga0307415_100114305 | 3300032126 | Bacteria | 2009 |
| 291 | Ga0307507_10007693 | 3300033179 | Bacteria | 15412 |
| 292 | Ga0307507_10115964 | 3300033179 | Bacteria | 2165 |
| 293 | Ga0307510_10108404 | 3300033180 | Bacteria | 2531 |
| 294 | Ga0373926_0009460 | 3300035083 | Bacteria | 3257 |
| 295 | Ga0373934_0057165 | 3300035086 | Bacteria | 1552 |
| 296 | Ga0373934_0063110 | 3300035086 | Bacteria | 1477 |
| 297 | Ga0373955_0023329 | 3300035172 | Bacteria | 3150 |
| 298 | Ga0373955_0043032 | 3300035172 | Bacteria | 2428 |
| 299 | Ga0316574_0001253 | 3300035398 | Bacteria | 11837 |
| 300 | Ga0316574_0007972 | 3300035398 | Bacteria | 5848 |
| 301 | Ga0373933_0007701 | 3300035724 | Bacteria | 5881 |
| 302 | Ga0373937_0076053 | 3300036401 | Bacteria | 3100 |
| 303 | Ga0373937_0156285 | 3300036401 | Bacteria | 2137 |
| 304 | Ga0316584_0065400 | 3300036712 | Bacteria | 2724 |
| 305 | Ga0316584_0077304 | 3300036712 | Bacteria | 2494 |
| 306 | Ga0373925_0005374 | 3300037068 | Bacteria | 9549 |
| 307 | Ga0373925_0007744 | 3300037068 | Bacteria | 7819 |
| 308 | Ga0373925_0059805 | 3300037068 | Bacteria | 2859 |
| 309 | Ga0373925_0122550 | 3300037068 | Bacteria | 2019 |
| 310 | Ga0395900_0071410 | 3300037418 | Bacteria | 3569 |
| 311 | Ga0395898_0002385 | 3300037466 | Bacteria | 22303 |
| 312 | Ga0395898_0004392 | 3300037466 | Bacteria | 15422 |
| 313 | Ga0395898_0028932 | 3300037466 | Bacteria | 5553 |
| 314 | Ga0395898_0062439 | 3300037466 | Bacteria | 3618 |
| 315 | Ga0395898_0086460 | 3300037466 | Bacteria | 3022 |
| 316 | Ga0395905_0164456 | 3300037471 | Bacteria | 2085 |
| 317 | Ga0316581_0000584 | 3300037588 | Bacteria | 7164 |
| 318 | Ga0436364_0643089 | 3300037853 | Bacteria | 10909 |
| 319 | Ga0395901_0098300 | 3300038443 | Bacteria | 3069 |
| 320 | Ga0395901_0160114 | 3300038443 | Bacteria | 2364 |
| 321 | Ga0436365_0850532 | 3300039437 | Bacteria | 5119 |
| 322 | Ga0436365_1352062 | 3300039437 | Bacteria | 9199 |
| 323 | Ga0439436_0000788 | 3300041404 | Bacteria | 8575 |
| 324 | Ga0439436_0003768 | 3300041404 | Bacteria | 4633 |
| 325 | Ga0439438_001614 | 3300041405 | Bacteria | 9896 |
| 326 | Ga0439439_0020440 | 3300041406 | Bacteria | 1646 |
| 327 | Ga0439447_013272 | 3300041407 | Bacteria | 2342 |
| 328 | Ga0439466_0004751 | 3300041411 | Bacteria | 5218 |
| 329 | Ga0439466_0005924 | 3300041411 | Bacteria | 4653 |
| 330 | Ga0451793_0650080 | 3300041452 | Bacteria | 2185 |
| 331 | Ga0451802_0529070 | 3300041460 | Bacteria | 1553 |
| 332 | Ga0451853_1775253 | 3300041512 | Bacteria | 4862 |
| 333 | Ga0439448_0005660 | 3300042005 | Bacteria | 3567 |
| 334 | Ga0439432_005551 | 3300042006 | Bacteria | 4537 |
| 335 | Ga0439449_0001531 | 3300042007 | Bacteria | 9045 |
| 336 | Ga0439449_0028057 | 3300042007 | Bacteria | 2099 |
| 337 | Ga0439452_009596 | 3300042010 | Bacteria | 2844 |
| 338 | Ga0439455_0000305 | 3300042012 | Bacteria | 6164 |
| 339 | Ga0439457_000044 | 3300042014 | Bacteria | 26362 |
| 340 | Ga0450894_000003 | 3300042131 | Bacteria | 40719 |
| 341 | Ga0450903_000229 | 3300042138 | Bacteria | 12488 |
| 342 | Ga0450903_001641 | 3300042138 | Bacteria | 4153 |
| 343 | Ga0450906_001123 | 3300042145 | Bacteria | 5933 |
| 344 | Ga0450907_000306 | 3300042146 | Bacteria | 16475 |
| 345 | Ga0450908_000127 | 3300042184 | Bacteria | 15665 |
| 346 | Ga0450908_005429 | 3300042184 | Bacteria | 2443 |
| 347 | Ga0439434_0015845 | 3300042435 | Bacteria | 2248 |
| 348 | Ga0466969_0000475 | 3300044656 | Bacteria | 21978 |
| 349 | Ga0466972_0009062 | 3300044658 | Bacteria | 4997 |
| 350 | Ga0466972_0009560 | 3300044658 | Bacteria | 4869 |
| 351 | Ga0466965_0002364 | 3300044683 | Bacteria | 7990 |
| 352 | Ga0466965_0012254 | 3300044683 | Bacteria | 4030 |
| 353 | Ga0466966_0002355 | 3300044684 | Bacteria | 12341 |
| 354 | Ga0466966_0002457 | 3300044684 | Bacteria | 12116 |
| 355 | Ga0466966_0019383 | 3300044684 | Bacteria | 4476 |
| 356 | Ga0466961_0001332 | 3300044693 | Bacteria | 15220 |
| 357 | Ga0466961_0009491 | 3300044693 | Bacteria | 6195 |
| 358 | Ga0466961_0046527 | 3300044693 | Bacteria | 2774 |
| 359 | Ga0466961_0075897 | 3300044693 | Bacteria | 2130 |
| 360 | Ga0466961_0091126 | 3300044693 | Bacteria | 1925 |
| 361 | Ga0466961_0091927 | 3300044693 | Bacteria | 1916 |
| 362 | Ga0466963_0000405 | 3300044694 | Bacteria | 19720 |
| 363 | Ga0466963_0001645 | 3300044694 | Bacteria | 12172 |
| 364 | Ga0466963_0012422 | 3300044694 | Bacteria | 5213 |
| 365 | Ga0466963_0030020 | 3300044694 | Bacteria | 3504 |
| 366 | Ga0466963_0068581 | 3300044694 | Bacteria | 2382 |
| 367 | Ga0466963_0146970 | 3300044694 | Bacteria | 1636 |
| 368 | Ga0466964_0021468 | 3300044706 | Bacteria | 2498 |
| 369 | Ga0466964_0026381 | 3300044706 | Bacteria | 2274 |
| 370 | Ga0453684_0328877 | 3300044712 | Bacteria | 1729 |
| 371 | Ga0466971_0000060 | 3300044719 | Bacteria | 42431 |
| 372 | Ga0466971_0031042 | 3300044719 | Bacteria | 2392 |
| 373 | Ga0466970_0004138 | 3300044765 | Bacteria | 7132 |
| 374 | Ga0466970_0017238 | 3300044765 | Bacteria | 3730 |
| 375 | Ga0466970_0025976 | 3300044765 | Bacteria | 3068 |
| 376 | Ga0466970_0033609 | 3300044765 | Bacteria | 2711 |
| 377 | Ga0466970_0040673 | 3300044765 | Bacteria | 2469 |
| 378 | Ga0466970_0052977 | 3300044765 | Bacteria | 2166 |
| 379 | Ga0466957_0001317 | 3300044842 | Bacteria | 12978 |
| 380 | Ga0466957_0040579 | 3300044842 | Bacteria | 2811 |
| 381 | Ga0466957_0073034 | 3300044842 | Bacteria | 2125 |
| 382 | Ga0466960_0010130 | 3300044901 | Bacteria | 3908 |
| 383 | Ga0466960_0065163 | 3300044901 | Bacteria | 1799 |
| 384 | Ga0466959_0000813 | 3300045049 | Bacteria | 18384 |
| 385 | Ga0466959_0017438 | 3300045049 | Bacteria | 5263 |
| 386 | Ga0466959_0029607 | 3300045049 | Bacteria | 4056 |
| 387 | Ga0466959_0043854 | 3300045049 | Bacteria | 3296 |
| 388 | Ga0466959_0115921 | 3300045049 | Bacteria | 1908 |
| 389 | Ga0451576_0075720 | 3300045051 | Bacteria | 3502 |
| 390 | Ga0466958_0016893 | 3300045836 | Bacteria | 4210 |
| 391 | Ga0466958_0073054 | 3300045836 | Bacteria | 2101 |
| 392 | Ga0466967_0002585 | 3300045976 | Bacteria | 11371 |
| 393 | Ga0466967_0003148 | 3300045976 | Bacteria | 10630 |
| 394 | Ga0466967_0007989 | 3300045976 | Bacteria | 7703 |
| 395 | Ga0466967_0021403 | 3300045976 | Bacteria | 5251 |
| 396 | Ga0466967_0052042 | 3300045976 | Bacteria | 3592 |
| 397 | Ga0466967_0213442 | 3300045976 | Bacteria | 1831 |
| 398 | Ga0466967_0266919 | 3300045976 | Bacteria | 1639 |
| 399 | Ga0495617_000964 | 3300046452 | Bacteria | 13348 |
| 400 | Ga0495617_001697 | 3300046452 | Bacteria | 9455 |
| 401 | Ga0495617_009443 | 3300046452 | Bacteria | 3349 |
| 402 | Ga0495617_021645 | 3300046452 | Bacteria | 2171 |
| 403 | Ga0495617_052351 | 3300046452 | Bacteria | 1356 |
| 404 | Ga0495627_000010 | 3300046453 | Bacteria | 381168 |
| 405 | Ga0495627_005625 | 3300046453 | Bacteria | 5013 |
| 406 | Ga0495592_0012929 | 3300046454 | Bacteria | 6346 |
| 407 | Ga0495603_0004681 | 3300046455 | Bacteria | 8173 |
| 408 | Ga0495603_0006417 | 3300046455 | Bacteria | 7040 |
| 409 | Ga0495603_0010086 | 3300046455 | Bacteria | 5716 |
| 410 | Ga0495603_0013191 | 3300046455 | Bacteria | 4995 |
| 411 | Ga0495603_0015487 | 3300046455 | Bacteria | 4615 |
| 412 | Ga0495590_0003380 | 3300046457 | Bacteria | 6527 |
| 413 | Ga0495590_0016508 | 3300046457 | Bacteria | 2665 |
| 414 | Ga0495591_007604 | 3300046458 | Bacteria | 4575 |
| 415 | Ga0495591_021625 | 3300046458 | Bacteria | 2094 |
| 416 | Ga0495629_0003703 | 3300046459 | Bacteria | 11531 |
| 417 | Ga0495629_0019294 | 3300046459 | Bacteria | 4874 |
| 418 | Ga0495629_0045070 | 3300046459 | Bacteria | 3095 |
| 419 | Ga0495629_0080656 | 3300046459 | Bacteria | 2271 |
| 420 | Ga0495629_0118337 | 3300046459 | Bacteria | 1846 |
| 421 | Ga0495638_0002134 | 3300046460 | Bacteria | 16606 |
| 422 | Ga0495638_0013116 | 3300046460 | Bacteria | 5657 |
| 423 | Ga0495638_0020491 | 3300046460 | Bacteria | 4368 |
| 424 | Ga0495638_0062447 | 3300046460 | Bacteria | 2299 |
| 425 | Ga0495641_0039978 | 3300046461 | Bacteria | 2183 |
| 426 | Ga0495651_0000746 | 3300046462 | Bacteria | 25159 |
| 427 | Ga0495651_0002533 | 3300046462 | Bacteria | 14137 |
| 428 | Ga0495651_0006659 | 3300046462 | Bacteria | 8833 |
| 429 | Ga0495651_0011792 | 3300046462 | Bacteria | 6718 |
| 430 | Ga0495651_0080641 | 3300046462 | Bacteria | 2458 |
| 431 | Ga0495653_0018739 | 3300046463 | Bacteria | 5619 |
| 432 | Ga0495650_0001024 | 3300046471 | Bacteria | 31397 |
| 433 | Ga0495650_0027295 | 3300046471 | Bacteria | 2640 |
| 434 | Ga0495582_0019915 | 3300046473 | Bacteria | 3670 |
| 435 | Ga0495605_0000631 | 3300046474 | Bacteria | 27198 |
| 436 | Ga0495605_0005433 | 3300046474 | Bacteria | 7419 |
| 437 | Ga0495605_0010916 | 3300046474 | Bacteria | 5074 |
| 438 | Ga0495605_0043040 | 3300046474 | Bacteria | 2241 |
| 439 | Ga0495639_0005669 | 3300046475 | Bacteria | 5372 |
| 440 | Ga0495639_0006950 | 3300046475 | Bacteria | 4863 |
| 441 | Ga0495639_0013655 | 3300046475 | Bacteria | 3512 |
| 442 | Ga0495639_0038331 | 3300046475 | Bacteria | 2152 |
| 443 | Ga0495662_0002015 | 3300046476 | Bacteria | 10169 |
| 444 | Ga0495662_0005421 | 3300046476 | Bacteria | 6384 |
| 445 | Ga0495664_0000886 | 3300046477 | Bacteria | 15402 |
| 446 | Ga0495664_0019700 | 3300046477 | Bacteria | 3883 |
| 447 | Ga0495664_0042045 | 3300046477 | Bacteria | 2706 |
| 448 | Ga0495584_0004684 | 3300046491 | Bacteria | 7329 |
| 449 | Ga0495584_0011750 | 3300046491 | Bacteria | 4476 |
| 450 | Ga0495584_0026117 | 3300046491 | Bacteria | 2958 |
| 451 | Ga0495585_0001103 | 3300046492 | Bacteria | 22231 |
| 452 | Ga0495585_0008010 | 3300046492 | Bacteria | 6423 |
| 453 | Ga0495585_0040538 | 3300046492 | Bacteria | 2614 |
| 454 | Ga0495585_0049233 | 3300046492 | Bacteria | 2341 |
| 455 | Ga0495594_0031376 | 3300046499 | Bacteria | 2880 |
| 456 | Ga0495594_0061360 | 3300046499 | Bacteria | 2080 |
| 457 | Ga0495594_0102994 | 3300046499 | Bacteria | 1606 |
| 458 | Ga0495607_0027885 | 3300046501 | Bacteria | 3486 |
| 459 | Ga0495583_0001013 | 3300046506 | Bacteria | 32066 |
| 460 | Ga0495606_0000041 | 3300046507 | Bacteria | 220225 |
| 461 | Ga0495606_0005398 | 3300046507 | Bacteria | 12254 |
| 462 | Ga0495606_0021936 | 3300046507 | Bacteria | 4669 |
| 463 | Ga0495608_0000285 | 3300046511 | Bacteria | 35530 |
| 464 | Ga0495608_0017964 | 3300046511 | Bacteria | 4887 |
| 465 | Ga0495610_0023257 | 3300046512 | Bacteria | 3373 |
| 466 | Ga0495610_0029001 | 3300046512 | Bacteria | 2920 |
| 467 | Ga0495610_0048360 | 3300046512 | Bacteria | 2088 |
| 468 | Ga0495610_0077354 | 3300046512 | Bacteria | 1536 |
| 469 | Ga0495616_0004215 | 3300046513 | Bacteria | 9103 |
| 470 | Ga0495616_0005334 | 3300046513 | Bacteria | 7928 |
| 471 | Ga0495618_0009858 | 3300046514 | Bacteria | 5779 |
| 472 | Ga0495618_0016281 | 3300046514 | Bacteria | 4547 |
| 473 | Ga0495618_0052858 | 3300046514 | Bacteria | 2568 |
| 474 | Ga0495620_0006554 | 3300046515 | Bacteria | 6386 |
| 475 | Ga0495620_0033191 | 3300046515 | Bacteria | 2345 |
| 476 | Ga0495628_0003788 | 3300046516 | Bacteria | 13465 |
| 477 | Ga0495628_0008618 | 3300046516 | Bacteria | 8736 |
| 478 | Ga0495628_0014784 | 3300046516 | Bacteria | 6529 |
| 479 | Ga0495630_0081675 | 3300046517 | Bacteria | 2439 |
| 480 | Ga0495630_0092409 | 3300046517 | Bacteria | 2287 |
| 481 | Ga0495631_0003400 | 3300046518 | Bacteria | 8716 |
| 482 | Ga0495632_0001095 | 3300046519 | Bacteria | 23188 |
| 483 | Ga0495637_0001115 | 3300046520 | Bacteria | 16443 |
| 484 | Ga0495637_0008695 | 3300046520 | Bacteria | 4979 |
| 485 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 486 | Ga0495643_0001191 | 3300046522 | Bacteria | 25336 |
| 487 | Ga0495643_0001671 | 3300046522 | Bacteria | 19427 |
| 488 | Ga0495643_0073013 | 3300046522 | Bacteria | 1798 |
| 489 | Ga0495644_0011204 | 3300046523 | Bacteria | 3456 |
| 490 | Ga0495648_0000935 | 3300046524 | Bacteria | 30300 |
| 491 | Ga0495648_0004862 | 3300046524 | Bacteria | 11329 |
| 492 | Ga0495648_0047063 | 3300046524 | Bacteria | 2669 |
| 493 | Ga0495666_0042680 | 3300046526 | Bacteria | 2192 |
| 494 | Ga0495666_0052924 | 3300046526 | Bacteria | 1949 |
| 495 | Ga0495642_0000018 | 3300046528 | Bacteria | 108992 |
| 496 | Ga0495642_0047542 | 3300046528 | Bacteria | 1758 |
| 497 | Ga0495642_0061679 | 3300046528 | Bacteria | 1556 |
| 498 | Ga0495652_0000965 | 3300046529 | Bacteria | 32930 |
| 499 | Ga0495652_0001447 | 3300046529 | Bacteria | 26276 |
| 500 | Ga0495652_0002668 | 3300046529 | Bacteria | 18144 |
| 501 | Ga0495652_0041521 | 3300046529 | Bacteria | 3970 |
| 502 | Ga0495654_0016625 | 3300046530 | Bacteria | 3882 |
| 503 | Ga0495654_0036482 | 3300046530 | Bacteria | 2470 |
| 504 | Ga0495654_0049169 | 3300046530 | Bacteria | 2066 |
| 505 | Ga0495665_0004737 | 3300046531 | Bacteria | 7346 |
| 506 | Ga0495665_0005678 | 3300046531 | Bacteria | 6732 |
| 507 | Ga0495640_0011451 | 3300046533 | Bacteria | 6825 |
| 508 | Ga0495640_0011728 | 3300046533 | Bacteria | 6729 |
| 509 | Ga0495640_0045545 | 3300046533 | Bacteria | 3043 |
| 510 | Ga0495640_0051661 | 3300046533 | Bacteria | 2825 |
| 511 | Ga0495586_0016218 | 3300046535 | Bacteria | 3963 |
| 512 | Ga0495586_0055565 | 3300046535 | Bacteria | 2145 |
| 513 | Ga0495587_0000351 | 3300046536 | Bacteria | 32959 |
| 514 | Ga0495587_0002980 | 3300046536 | Bacteria | 11318 |
| 515 | Ga0495587_0053015 | 3300046536 | Bacteria | 2392 |
| 516 | Ga0495587_0058843 | 3300046536 | Bacteria | 2257 |
| 517 | Ga0495587_0111290 | 3300046536 | Bacteria | 1573 |
| 518 | Ga0495609_0012936 | 3300046538 | Bacteria | 3948 |
| 519 | Ga0495609_0022460 | 3300046538 | Bacteria | 2906 |
| 520 | Ga0495597_0040425 | 3300046542 | Bacteria | 2084 |
| 521 | Ga0495597_0040958 | 3300046542 | Bacteria | 2070 |
| 522 | Ga0495645_0015914 | 3300046543 | Bacteria | 5359 |
| 523 | Ga0495645_0039887 | 3300046543 | Bacteria | 3425 |
| 524 | Ga0495645_0097618 | 3300046543 | Bacteria | 2092 |
| 525 | Ga0495622_0004423 | 3300046557 | Bacteria | 6526 |
| 526 | Ga0495622_0046644 | 3300046557 | Bacteria | 2013 |
| 527 | Ga0495667_0000323 | 3300046559 | Bacteria | 30275 |
| 528 | Ga0495656_0004404 | 3300046615 | Bacteria | 4821 |
| 529 | Ga0495668_0009381 | 3300046616 | Bacteria | 6015 |
| 530 | Ga0495668_0061970 | 3300046616 | Bacteria | 2062 |
| 531 | Ga0495634_0025507 | 3300046642 | Bacteria | 4134 |
| 532 | Ga0495634_0097863 | 3300046642 | Bacteria | 1899 |
| 533 | Ga0495625_0007943 | 3300046660 | Bacteria | 9120 |
| 534 | Ga0495625_0023871 | 3300046660 | Bacteria | 4665 |
| 535 | Ga0495625_0029829 | 3300046660 | Bacteria | 4075 |
| 536 | Ga0495635_0001065 | 3300046663 | Bacteria | 18167 |
| 537 | Ga0495635_0001252 | 3300046663 | Bacteria | 16998 |
| 538 | Ga0495635_0014829 | 3300046663 | Bacteria | 5451 |
| 539 | Ga0495635_0053242 | 3300046663 | Bacteria | 2788 |
| 540 | Ga0495635_0081545 | 3300046663 | Bacteria | 2213 |
| 541 | Ga0495661_0013465 | 3300046665 | Bacteria | 5491 |
| 542 | Ga0495588_0026184 | 3300046674 | Bacteria | 2910 |
| 543 | Ga0495588_0027627 | 3300046674 | Bacteria | 2836 |
| 544 | Ga0495588_0059456 | 3300046674 | Bacteria | 1977 |
| 545 | Ga0495657_0000950 | 3300046675 | Bacteria | 25579 |
| 546 | Ga0495657_0002113 | 3300046675 | Bacteria | 16875 |
| 547 | Ga0495657_0016894 | 3300046675 | Bacteria | 5305 |
| 548 | Ga0495657_0039692 | 3300046675 | Bacteria | 3233 |
| 549 | Ga0495599_0007717 | 3300046678 | Bacteria | 6534 |
| 550 | Ga0495623_0000754 | 3300046679 | Bacteria | 21717 |
| 551 | Ga0495623_0006440 | 3300046679 | Bacteria | 7638 |
| 552 | Ga0495623_0022921 | 3300046679 | Bacteria | 4032 |
| 553 | Ga0495623_0047124 | 3300046679 | Bacteria | 2736 |
| 554 | Ga0495623_0071397 | 3300046679 | Bacteria | 2160 |
| 555 | Ga0495623_0091104 | 3300046679 | Bacteria | 1871 |
| 556 | Ga0495646_0000654 | 3300046680 | Bacteria | 18980 |
| 557 | Ga0495646_0022418 | 3300046680 | Bacteria | 3984 |
| 558 | Ga0495646_0079301 | 3300046680 | Bacteria | 1917 |
| 559 | Ga0495658_0044021 | 3300046683 | Bacteria | 2499 |
| 560 | Ga0495669_0000858 | 3300046684 | Bacteria | 12878 |
| 561 | Ga0495669_0003277 | 3300046684 | Bacteria | 6662 |
| 562 | Ga0495613_0000863 | 3300046689 | Bacteria | 23258 |
| 563 | Ga0495613_0004045 | 3300046689 | Bacteria | 10967 |
| 564 | Ga0495613_0057350 | 3300046689 | Bacteria | 2859 |
| 565 | Ga0495670_0000942 | 3300046691 | Bacteria | 14081 |
| 566 | Ga0495670_0001398 | 3300046691 | Bacteria | 11799 |
| 567 | Ga0495670_0013532 | 3300046691 | Bacteria | 4012 |
| 568 | Ga0495670_0022508 | 3300046691 | Bacteria | 3111 |
| 569 | Ga0495670_0060219 | 3300046691 | Bacteria | 1907 |
| 570 | Ga0495671_0000171 | 3300046692 | Bacteria | 57447 |
| 571 | Ga0495671_0001368 | 3300046692 | Bacteria | 16546 |
| 572 | Ga0495671_0007991 | 3300046692 | Bacteria | 5980 |
| 573 | Ga0495671_0009137 | 3300046692 | Bacteria | 5550 |
| 574 | Ga0495671_0022532 | 3300046692 | Bacteria | 3299 |
| 575 | Ga0495671_0030651 | 3300046692 | Bacteria | 2753 |
| 576 | Ga0495671_0063085 | 3300046692 | Bacteria | 1825 |
| 577 | Ga0495649_0000022 | 3300046694 | Bacteria | 179407 |
| 578 | Ga0495649_0012409 | 3300046694 | Bacteria | 4955 |
| 579 | Ga0495649_0027281 | 3300046694 | Bacteria | 3169 |
| 580 | Ga0495589_0000184 | 3300046794 | Bacteria | 55497 |
| 581 | Ga0495589_0009299 | 3300046794 | Bacteria | 5111 |
| 582 | Ga0495589_0021953 | 3300046794 | Bacteria | 3261 |
| 583 | Ga0495589_0055718 | 3300046794 | Bacteria | 1947 |
| 584 | Ga0495600_0002680 | 3300046809 | Bacteria | 10292 |
| 585 | Ga0495600_0004855 | 3300046809 | Bacteria | 8071 |
| 586 | Ga0495600_0016386 | 3300046809 | Bacteria | 4703 |
| 587 | Ga0495660_0011625 | 3300046810 | Bacteria | 5106 |
| 588 | Ga0495660_0015806 | 3300046810 | Bacteria | 4357 |
| 589 | Ga0495660_0080852 | 3300046810 | Bacteria | 1704 |
| 590 | Ga0495660_0099527 | 3300046810 | Bacteria | 1498 |
| 591 | Ga0495581_0019739 | 3300047315 | Bacteria | 3913 |
| 592 | Ga0495581_0022343 | 3300047315 | Bacteria | 3666 |
| 593 | Ga0495581_0040241 | 3300047315 | Bacteria | 2705 |
| 594 | Ga0495604_0001086 | 3300047317 | Bacteria | 22562 |
| 595 | Ga0495604_0002820 | 3300047317 | Bacteria | 13953 |
| 596 | Ga0495604_0038960 | 3300047317 | Bacteria | 3737 |
| 597 | Ga0495636_0053621 | 3300047318 | Bacteria | 1693 |
| 598 | Ga0495636_0074976 | 3300047318 | Bacteria | 1449 |
| 599 | Ga0495674_0002467 | 3300047319 | Bacteria | 18059 |
| 600 | Ga0495674_0021789 | 3300047319 | Bacteria | 5921 |
| 601 | Ga0495674_0044265 | 3300047319 | Bacteria | 3958 |
| 602 | Ga0495672_0007796 | 3300047320 | Bacteria | 8005 |
| 603 | Ga0495672_0012207 | 3300047320 | Bacteria | 6008 |
| 604 | Ga0495676_0016554 | 3300047321 | Bacteria | 6538 |
| 605 | Ga0495676_0017686 | 3300047321 | Bacteria | 6296 |
| 606 | Ga0495676_0024766 | 3300047321 | Bacteria | 5187 |
| 607 | Ga0495680_0003057 | 3300047322 | Bacteria | 16668 |
| 608 | Ga0495680_0003938 | 3300047322 | Bacteria | 14358 |
| 609 | Ga0495680_0016873 | 3300047322 | Bacteria | 6254 |
| 610 | Ga0495680_0017945 | 3300047322 | Bacteria | 6020 |
| 611 | Ga0495680_0059882 | 3300047322 | Bacteria | 2938 |
| 612 | Ga0495683_0000578 | 3300047323 | Bacteria | 27719 |
| 613 | Ga0495683_0023882 | 3300047323 | Bacteria | 3140 |
| 614 | Ga0495687_000294 | 3300047443 | Bacteria | 65644 |
| 615 | Ga0495687_001298 | 3300047443 | Bacteria | 23461 |
| 616 | Ga0495687_002153 | 3300047443 | Bacteria | 16437 |
| 617 | Ga0495675_0001430 | 3300047444 | Bacteria | 14460 |
| 618 | Ga0495675_0026189 | 3300047444 | Bacteria | 3718 |
| 619 | Ga0495675_0036887 | 3300047444 | Bacteria | 3116 |
| 620 | Ga0495677_0000905 | 3300047445 | Bacteria | 11921 |
| 621 | Ga0495677_0021634 | 3300047445 | Bacteria | 2331 |
| 622 | Ga0495679_003079 | 3300047446 | Bacteria | 8179 |
| 623 | Ga0495685_002436 | 3300047447 | Bacteria | 5825 |
| 624 | Ga0495685_005907 | 3300047447 | Bacteria | 3997 |
| 625 | Ga0495673_0000960 | 3300047469 | Bacteria | 26055 |
| 626 | Ga0495673_0005727 | 3300047469 | Bacteria | 7450 |
| 627 | Ga0495673_0007256 | 3300047469 | Bacteria | 6401 |
| 628 | Ga0495673_0015550 | 3300047469 | Bacteria | 3917 |
| 629 | Ga0495673_0019178 | 3300047469 | Bacteria | 3431 |
| 630 | Ga0495681_0001153 | 3300047470 | Bacteria | 20012 |
| 631 | Ga0495681_0002427 | 3300047470 | Bacteria | 13313 |
| 632 | Ga0495681_0003291 | 3300047470 | Bacteria | 11263 |
| 633 | Ga0495681_0016834 | 3300047470 | Bacteria | 4079 |
| 634 | Ga0495684_0002639 | 3300047471 | Bacteria | 14234 |
| 635 | Ga0495684_0005519 | 3300047471 | Bacteria | 9850 |
| 636 | Ga0495684_0014031 | 3300047471 | Bacteria | 6163 |
| 637 | Ga0495684_0072190 | 3300047471 | Bacteria | 2623 |
| 638 | Ga0495684_0180379 | 3300047471 | Bacteria | 1565 |
| 639 | Ga0495686_0011949 | 3300047472 | Bacteria | 6101 |
| 640 | Ga0495593_0000492 | 3300047673 | Bacteria | 22255 |
| 641 | Ga0495593_0001513 | 3300047673 | Bacteria | 13673 |
| 642 | Ga0495602_0061044 | 3300048088 | Bacteria | 3281 |
| 643 | Ga0495602_0065236 | 3300048088 | Bacteria | 3143 |
| 644 | Ga0495614_0003675 | 3300048089 | Bacteria | 6881 |
| 645 | Ga0495614_0047864 | 3300048089 | Bacteria | 1834 |
| 646 | Ga0495626_0000079 | 3300048091 | Bacteria | 129922 |
| 647 | Ga0495626_0000992 | 3300048091 | Bacteria | 24369 |
| 648 | Ga0495626_0002392 | 3300048091 | Bacteria | 13078 |
| 649 | Ga0495626_0013719 | 3300048091 | Bacteria | 4204 |
| 650 | Ga0496100_0005810 | 3300048903 | Bacteria | 6674 |
| 651 | Ga0496100_0047456 | 3300048903 | Bacteria | 2767 |
| 652 | Ga0496101_0004122 | 3300048904 | Bacteria | 9095 |
| 653 | Ga0496101_0005894 | 3300048904 | Bacteria | 7846 |
| 654 | Ga0496102_0001742 | 3300048905 | Bacteria | 19029 |
| 655 | Ga0496102_0003029 | 3300048905 | Bacteria | 14222 |
| 656 | Ga0496102_0019597 | 3300048905 | Bacteria | 5960 |
| 657 | Ga0496102_0019642 | 3300048905 | Bacteria | 5953 |
| 658 | Ga0496102_0031270 | 3300048905 | Bacteria | 4774 |
| 659 | Ga0496102_0069067 | 3300048905 | Bacteria | 3243 |
| 660 | Ga0496103_0007509 | 3300048906 | Bacteria | 6496 |
| 661 | Ga0496103_0014072 | 3300048906 | Bacteria | 4750 |
| 662 | Ga0496104_0019438 | 3300048907 | Bacteria | 6215 |
| 663 | Ga0496104_0028744 | 3300048907 | Bacteria | 5153 |
| 664 | Ga0496104_0124840 | 3300048907 | Bacteria | 2471 |
| 665 | Ga0496104_0183021 | 3300048907 | Bacteria | 2006 |
| 666 | Ga0496105_0015043 | 3300048908 | Bacteria | 6157 |
| 667 | Ga0496105_0042837 | 3300048908 | Bacteria | 3732 |
| 668 | Ga0496106_0003464 | 3300048909 | Bacteria | 11755 |
| 669 | Ga0496106_0025424 | 3300048909 | Bacteria | 4407 |
| 670 | Ga0496106_0027590 | 3300048909 | Bacteria | 4230 |
| 671 | Ga0496107_0001109 | 3300048910 | Bacteria | 16210 |
| 672 | Ga0496107_0001433 | 3300048910 | Bacteria | 14740 |
| 673 | Ga0496107_0017720 | 3300048910 | Bacteria | 5012 |
| 674 | Ga0496108_0003468 | 3300048911 | Bacteria | 12651 |
| 675 | Ga0496108_0009592 | 3300048911 | Bacteria | 7844 |
| 676 | Ga0496108_0015083 | 3300048911 | Bacteria | 6309 |
| 677 | Ga0496108_0057415 | 3300048911 | Bacteria | 3270 |
| 678 | Ga0496109_0009204 | 3300048912 | Bacteria | 8412 |
| 679 | Ga0496109_0011288 | 3300048912 | Bacteria | 7672 |
| 680 | Ga0496109_0012514 | 3300048912 | Bacteria | 7326 |
| 681 | Ga0496109_0012931 | 3300048912 | Bacteria | 7217 |
| 682 | Ga0496109_0083585 | 3300048912 | Bacteria | 2944 |
| 683 | Ga0496109_0106125 | 3300048912 | Bacteria | 2609 |
| 684 | Ga0496110_0000626 | 3300048913 | Bacteria | 24200 |
| 685 | Ga0496110_0007505 | 3300048913 | Bacteria | 8715 |
| 686 | Ga0496110_0053821 | 3300048913 | Bacteria | 3539 |
| 687 | Ga0496110_0082773 | 3300048913 | Bacteria | 2862 |
| 688 | Ga0496110_0167819 | 3300048913 | Bacteria | 1991 |
| 689 | Ga0496111_0002176 | 3300048914 | Bacteria | 11738 |
| 690 | Ga0496111_0017782 | 3300048914 | Bacteria | 4917 |
| 691 | Ga0496111_0019438 | 3300048914 | Bacteria | 4718 |
| 692 | Ga0496111_0159987 | 3300048914 | Bacteria | 1672 |
| 693 | Ga0496112_0004855 | 3300048915 | Bacteria | 11485 |
| 694 | Ga0496112_0006081 | 3300048915 | Bacteria | 10550 |
| 695 | Ga0496112_0092581 | 3300048915 | Bacteria | 2992 |
| 696 | Ga0496112_0159799 | 3300048915 | Bacteria | 2220 |
| 697 | Ga0496112_0205095 | 3300048915 | Bacteria | 1930 |
| 698 | Ga0496113_0000221 | 3300048916 | Bacteria | 26671 |
| 699 | Ga0496113_0008913 | 3300048916 | Bacteria | 6564 |
| 700 | Ga0496113_0034990 | 3300048916 | Bacteria | 3670 |
| 701 | Ga0496114_0016746 | 3300048917 | Bacteria | 5911 |
| 702 | Ga0496114_0040296 | 3300048917 | Bacteria | 3867 |
| 703 | Ga0496114_0041945 | 3300048917 | Bacteria | 3792 |
| 704 | Ga0496114_0044606 | 3300048917 | Bacteria | 3680 |
| 705 | Ga0496114_0089399 | 3300048917 | Bacteria | 2614 |
| 706 | Ga0496114_0110821 | 3300048917 | Bacteria | 2351 |
| 707 | Ga0496115_0002679 | 3300048918 | Bacteria | 12770 |
| 708 | Ga0496115_0047657 | 3300048918 | Bacteria | 3427 |
| 709 | Ga0496115_0097216 | 3300048918 | Bacteria | 2411 |
| 710 | Ga0496117_0007927 | 3300048920 | Bacteria | 10204 |
| 711 | Ga0496117_0038515 | 3300048920 | Bacteria | 3542 |
| 712 | Ga0496118_0027862 | 3300048921 | Bacteria | 4772 |
| 713 | Ga0496118_0029643 | 3300048921 | Bacteria | 4585 |
| 714 | Ga0496119_0000055 | 3300048922 | Bacteria | 180121 |
| 715 | Ga0496119_0015245 | 3300048922 | Bacteria | 5938 |
| 716 | Ga0496119_0045002 | 3300048922 | Bacteria | 2772 |
| 717 | Ga0496120_0035633 | 3300048923 | Bacteria | 2970 |
| 718 | Ga0496121_0001931 | 3300048924 | Bacteria | 33124 |
| 719 | Ga0496121_0023239 | 3300048924 | Bacteria | 5980 |
| 720 | Ga0496122_0000043 | 3300048925 | Bacteria | 280333 |
| 721 | Ga0496122_0000116 | 3300048925 | Bacteria | 183371 |
| 722 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 723 | Ga0496123_0000090 | 3300048926 | Bacteria | 179735 |
| 724 | Ga0496124_0002284 | 3300048927 | Bacteria | 25355 |
| 725 | Ga0496124_0022995 | 3300048927 | Bacteria | 5702 |
| 726 | Ga0496124_0046311 | 3300048927 | Bacteria | 3726 |
| 727 | Ga0496124_0067892 | 3300048927 | Bacteria | 2965 |
| 728 | Ga0496125_0017036 | 3300048928 | Bacteria | 6945 |
| 729 | Ga0496125_0020034 | 3300048928 | Bacteria | 6289 |
| 730 | Ga0496125_0127627 | 3300048928 | Bacteria | 1799 |
| 731 | Ga0496126_0089492 | 3300048929 | Bacteria | 2709 |
| 732 | Ga0496126_0239479 | 3300048929 | Bacteria | 1516 |
| 733 | Ga0495678_031661 | 3300049459 | Bacteria | 2202 |
| 734 | Ga0495678_038980 | 3300049459 | Bacteria | 1918 |
| 735 | Ga0495682_0001733 | 3300049460 | Bacteria | 11073 |
| 736 | Ga0495682_0027900 | 3300049460 | Bacteria | 2093 |
| 737 | Ga0501031_0004230 | 3300049568 | Bacteria | 9274 |
| 738 | Ga0501031_0036433 | 3300049568 | Bacteria | 3209 |
| 739 | Ga0501031_0050743 | 3300049568 | Bacteria | 2702 |
| 740 | Ga0501031_0059513 | 3300049568 | Bacteria | 2490 |
| 741 | Ga0501032_0000727 | 3300049569 | Bacteria | 26753 |
| 742 | Ga0501032_0036294 | 3300049569 | Bacteria | 3365 |
| 743 | Ga0501032_0041715 | 3300049569 | Bacteria | 3115 |
| 744 | Ga0501032_0047481 | 3300049569 | Bacteria | 2898 |
| 745 | Ga0501032_0080781 | 3300049569 | Bacteria | 2163 |
| 746 | Ga0501033_0000159 | 3300049570 | Bacteria | 64757 |
| 747 | Ga0501033_0049129 | 3300049570 | Bacteria | 3132 |
| 748 | Ga0501033_0090358 | 3300049570 | Bacteria | 2240 |
| 749 | Ga0501034_0002444 | 3300049571 | Bacteria | 22408 |
| 750 | Ga0501034_0015605 | 3300049571 | Bacteria | 7802 |
| 751 | Ga0501034_0015770 | 3300049571 | Bacteria | 7759 |
| 752 | Ga0501034_0016676 | 3300049571 | Bacteria | 7530 |
| 753 | Ga0501034_0017350 | 3300049571 | Bacteria | 7384 |
| 754 | Ga0501034_0025683 | 3300049571 | Bacteria | 5999 |
| 755 | Ga0501034_0039482 | 3300049571 | Bacteria | 4781 |
| 756 | Ga0501034_0046905 | 3300049571 | Bacteria | 4365 |
| 757 | Ga0501034_0123701 | 3300049571 | Bacteria | 2572 |
| 758 | Ga0501034_0210536 | 3300049571 | Bacteria | 1899 |
| 759 | Ga0501034_0278588 | 3300049571 | Bacteria | 1612 |
| 760 | Ga0501036_0000189 | 3300049572 | Bacteria | 40908 |
| 761 | Ga0501036_0006157 | 3300049572 | Bacteria | 9732 |
| 762 | Ga0501036_0015584 | 3300049572 | Bacteria | 6349 |
| 763 | Ga0501036_0016970 | 3300049572 | Bacteria | 6083 |
| 764 | Ga0501036_0028398 | 3300049572 | Bacteria | 4728 |
| 765 | Ga0501036_0141521 | 3300049572 | Bacteria | 2030 |
| 766 | Ga0501037_0000650 | 3300049573 | Bacteria | 26827 |
| 767 | Ga0501037_0102896 | 3300049573 | Bacteria | 2060 |
| 768 | Ga0501038_0005789 | 3300049574 | Bacteria | 11450 |
| 769 | Ga0501038_0009078 | 3300049574 | Bacteria | 9127 |
| 770 | Ga0501038_0013067 | 3300049574 | Bacteria | 7573 |
| 771 | Ga0501038_0020677 | 3300049574 | Bacteria | 5916 |
| 772 | Ga0501038_0022537 | 3300049574 | Bacteria | 5642 |
| 773 | Ga0501038_0030461 | 3300049574 | Bacteria | 4775 |
| 774 | Ga0501038_0037453 | 3300049574 | Bacteria | 4252 |
| 775 | Ga0501039_0027741 | 3300049575 | Bacteria | 4355 |
| 776 | Ga0501039_0065721 | 3300049575 | Bacteria | 2814 |
| 777 | Ga0501040_0039961 | 3300049576 | Bacteria | 3192 |
| 778 | Ga0501042_0151998 | 3300049578 | Bacteria | 1669 |
| 779 | Ga0501043_0000373 | 3300049579 | Bacteria | 40611 |
| 780 | Ga0501043_0001858 | 3300049579 | Bacteria | 18078 |
| 781 | Ga0501043_0015877 | 3300049579 | Bacteria | 5902 |
| 782 | Ga0501043_0134425 | 3300049579 | Bacteria | 1937 |
| 783 | Ga0501043_0137119 | 3300049579 | Bacteria | 1917 |
| 784 | Ga0501043_0155600 | 3300049579 | Bacteria | 1788 |
| 785 | Ga0501043_0173853 | 3300049579 | Bacteria | 1679 |
| 786 | Ga0501046_0001066 | 3300049580 | Bacteria | 26864 |
| 787 | Ga0501046_0008749 | 3300049580 | Bacteria | 8794 |
| 788 | Ga0501046_0033504 | 3300049580 | Bacteria | 4150 |
| 789 | Ga0501046_0085108 | 3300049580 | Bacteria | 2438 |
| 790 | Ga0501046_0123638 | 3300049580 | Bacteria | 1967 |
| 791 | Ga0501047_0000716 | 3300049581 | Bacteria | 34570 |
| 792 | Ga0501047_0004050 | 3300049581 | Bacteria | 13782 |
| 793 | Ga0501047_0045335 | 3300049581 | Bacteria | 4252 |
| 794 | Ga0501047_0045823 | 3300049581 | Bacteria | 4227 |
| 795 | Ga0501047_0064830 | 3300049581 | Bacteria | 3523 |
| 796 | Ga0501047_0075166 | 3300049581 | Bacteria | 3251 |
| 797 | Ga0501047_0087631 | 3300049581 | Bacteria | 2990 |
| 798 | Ga0501047_0129107 | 3300049581 | Bacteria | 2408 |
| 799 | Ga0501048_0001489 | 3300049582 | Bacteria | 17772 |
| 800 | Ga0501048_0037625 | 3300049582 | Bacteria | 3475 |
| 801 | Ga0501048_0145498 | 3300049582 | Bacteria | 1676 |
| 802 | Ga0501067_0003460 | 3300049583 | Bacteria | 8680 |
| 803 | Ga0501069_0009224 | 3300049585 | Bacteria | 5206 |
| 804 | Ga0501069_0032219 | 3300049585 | Bacteria | 2884 |
| 805 | Ga0501070_0000131 | 3300049586 | Bacteria | 67175 |
| 806 | Ga0501070_0002400 | 3300049586 | Bacteria | 16438 |
| 807 | Ga0501070_0002490 | 3300049586 | Bacteria | 16130 |
| 808 | Ga0501070_0003761 | 3300049586 | Bacteria | 13104 |
| 809 | Ga0501070_0005845 | 3300049586 | Bacteria | 10493 |
| 810 | Ga0501070_0009744 | 3300049586 | Bacteria | 8125 |
| 811 | Ga0501070_0055646 | 3300049586 | Bacteria | 3279 |
| 812 | Ga0501070_0133458 | 3300049586 | Bacteria | 2050 |
| 813 | Ga0501071_0003074 | 3300049587 | Bacteria | 10340 |
| 814 | Ga0501071_0012031 | 3300049587 | Bacteria | 5850 |
| 815 | Ga0501071_0052633 | 3300049587 | Bacteria | 2936 |
| 816 | Ga0501071_0070828 | 3300049587 | Bacteria | 2541 |
| 817 | Ga0501071_0093965 | 3300049587 | Bacteria | 2205 |
| 818 | Ga0501071_0120866 | 3300049587 | Bacteria | 1941 |
| 819 | Ga0501072_0007848 | 3300049588 | Bacteria | 8108 |
| 820 | Ga0501072_0090494 | 3300049588 | Bacteria | 2429 |
| 821 | Ga0501072_0156985 | 3300049588 | Bacteria | 1814 |
| 822 | Ga0501073_0010742 | 3300049589 | Bacteria | 6704 |
| 823 | Ga0501073_0148866 | 3300049589 | Bacteria | 1622 |
| 824 | Ga0501074_0002952 | 3300049590 | Bacteria | 11950 |
| 825 | Ga0501074_0003673 | 3300049590 | Bacteria | 10885 |
| 826 | Ga0501074_0011144 | 3300049590 | Bacteria | 6532 |
| 827 | Ga0501074_0016811 | 3300049590 | Bacteria | 5309 |
| 828 | Ga0501075_0016423 | 3300049591 | Bacteria | 5333 |
| 829 | Ga0501075_0033087 | 3300049591 | Bacteria | 3845 |
| 830 | Ga0501075_0043315 | 3300049591 | Bacteria | 3376 |
| 831 | Ga0501075_0093606 | 3300049591 | Bacteria | 2281 |
| 832 | Ga0501076_0018678 | 3300049592 | Bacteria | 5291 |
| 833 | Ga0501076_0045824 | 3300049592 | Bacteria | 3453 |
| 834 | Ga0501076_0052032 | 3300049592 | Bacteria | 3243 |
| 835 | Ga0501076_0136471 | 3300049592 | Bacteria | 1991 |
| 836 | Ga0501076_0158649 | 3300049592 | Bacteria | 1842 |
| 837 | Ga0501077_0090516 | 3300049593 | Bacteria | 1939 |
| 838 | Ga0501079_0020791 | 3300049741 | Bacteria | 5019 |
| 839 | Ga0501079_0036828 | 3300049741 | Bacteria | 3768 |
| 840 | Ga0501080_0001161 | 3300049742 | Bacteria | 21753 |
| 841 | Ga0501080_0008643 | 3300049742 | Bacteria | 9243 |
| 842 | Ga0501081_0022247 | 3300049743 | Bacteria | 4240 |
| 843 | Ga0501081_0154462 | 3300049743 | Bacteria | 1650 |
| 844 | Ga0501083_0001155 | 3300049744 | Bacteria | 17779 |
| 845 | Ga0501083_0043784 | 3300049744 | Bacteria | 3032 |
| 846 | Ga0501035_0000684 | 3300049822 | Bacteria | 37075 |
| 847 | Ga0501035_0000934 | 3300049822 | Bacteria | 30908 |
| 848 | Ga0501035_0004132 | 3300049822 | Bacteria | 13795 |
| 849 | Ga0501035_0011659 | 3300049822 | Bacteria | 8149 |
| 850 | Ga0501035_0023132 | 3300049822 | Bacteria | 5702 |
| 851 | Ga0501035_0034448 | 3300049822 | Bacteria | 4601 |
| 852 | Ga0501035_0116871 | 3300049822 | Bacteria | 2334 |
| 853 | Ga0501035_0119992 | 3300049822 | Bacteria | 2300 |
| 854 | Ga0501044_0000883 | 3300049823 | Bacteria | 36150 |
| 855 | Ga0501044_0020131 | 3300049823 | Bacteria | 7122 |
| 856 | Ga0501044_0048318 | 3300049823 | Bacteria | 4395 |
| 857 | Ga0501044_0134122 | 3300049823 | Bacteria | 2468 |
| 858 | Ga0501044_0164341 | 3300049823 | Bacteria | 2194 |
| 859 | Ga0501045_0014003 | 3300049824 | Bacteria | 5677 |
| 860 | Ga0501045_0046651 | 3300049824 | Bacteria | 3155 |
| 861 | Ga0501045_0055757 | 3300049824 | Bacteria | 2890 |
| 862 | Ga0501045_0075415 | 3300049824 | Bacteria | 2484 |
| 863 | Ga0501045_0088070 | 3300049824 | Bacteria | 2293 |
| 864 | Ga0501045_0090021 | 3300049824 | Bacteria | 2267 |
| 865 | nmdc:mga03683_8957_c1 | 3300050489 | Bacteria | 3540 |
| 866 | nmdc:mga0yw44_4806_c1 | 3300050492 | Bacteria | 6267 |
| 867 | nmdc:mga06z11_7724_c1 | 3300050494 | Bacteria | 4441 |
| 868 | nmdc:mga04h51_3779_c1 | 3300050495 | Bacteria | 3712 |
| 869 | nmdc:mga07m45_31724_c1 | 3300050496 | Bacteria | 2928 |
| 870 | nmdc:mga05p37_187626_c1 | 3300050507 | Bacteria | 2513 |
| 871 | nmdc:mga05p37_230358_c1 | 3300050507 | Bacteria | 2233 |
| 872 | nmdc:mga05p37_44482_c1 | 3300050507 | Bacteria | 5462 |
| 873 | nmdc:mga08y16_12302_c1 | 3300050511 | Bacteria | 8998 |
| 874 | nmdc:mga08y16_12848_c1 | 3300050511 | Bacteria | 8804 |
| 875 | nmdc:mga0n895_1334_c1 | 3300050512 | Bacteria | 18282 |
| 876 | nmdc:mga0n895_193467_c1 | 3300050512 | Bacteria | 2065 |
| 877 | nmdc:mga0n895_95568_c1 | 3300050512 | Bacteria | 2976 |
| 878 | nmdc:mga0rr50_40331_c1 | 3300050513 | Bacteria | 3394 |
| 879 | nmdc:mga08x19_21515_c1 | 3300050514 | Bacteria | 3983 |
| 880 | nmdc:mga0sz30_855_c2 | 3300050516 | Bacteria | 4136 |
| 881 | Ga0495601_0002168 | 3300053077 | Bacteria | 11051 |
| 882 | Ga0495601_0022490 | 3300053077 | Bacteria | 3871 |
| 883 | Ga0495601_0121087 | 3300053077 | Bacteria | 1699 |
| 884 | Ga0495601_0136269 | 3300053077 | Bacteria | 1600 |
| 885 | Ga0495612_0000202 | 3300053078 | Bacteria | 25471 |
| 886 | Ga0500560_001395 | 3300053107 | Bacteria | 4173 |
| 887 | Ga0500559_0000949 | 3300053136 | Bacteria | 18263 |
| 888 | Ga0500616_0000183 | 3300053153 | Bacteria | 103074 |
| 889 | Ga0500616_0000740 | 3300053153 | Bacteria | 37626 |
| 890 | Ga0501084_0075765 | 3300054114 | Bacteria | 2819 |
| 891 | Ga0501084_0115744 | 3300054114 | Bacteria | 2253 |
| 892 | Ga0501084_0231104 | 3300054114 | Bacteria | 1561 |
| 893 | Ga0501082_0012318 | 3300060353 | Bacteria | 7350 |
| 894 | Ga0501082_0013740 | 3300060353 | Bacteria | 6960 |
| 895 | Ga0501082_0133125 | 3300060353 | Bacteria | 2157 |
| 896 | Ga0501082_0225238 | 3300060353 | Bacteria | 1632 |
| 897 | Ga0466962_0001787 | 3300061719 | Bacteria | 10113 |
| 898 | Ga0466962_0059192 | 3300061719 | Bacteria | 1828 |
| 899 | Ga0530510_0000395 | 3300061734 | Bacteria | 28388 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021388 | Ga0213875_10012540 | Ga0213875_100125403 | 386 |
| 2 | 3300006880 | Ga0075429_100244028 | Ga0075429_1002440282 | 387 |
| 3 | 3300037853 | Ga0436364_0643089 | Ga0436364_0643089_6649_7839 | 387 |
| 4 | 3300039437 | Ga0436365_1352062 | Ga0436365_1352062_727_1917 | 387 |
| 5 | 3300046477 | Ga0495664_0019700 | Ga0495664_0019700_13_1242 | 393 |
| 6 | 3300035086 | Ga0373934_0063110 | Ga0373934_0063110_67_1317 | 404 |
| 7 | 3300037068 | Ga0373925_0122550 | Ga0373925_0122550_191_1582 | 405 |
| 8 | 3300046459 | Ga0495629_0118337 | Ga0495629_0118337_311_1702 | 405 |
| 9 | 3300046477 | Ga0495664_0042045 | Ga0495664_0042045_760_2151 | 405 |
| 10 | 3300046517 | Ga0495630_0081675 | Ga0495630_0081675_615_2006 | 405 |
| 11 | 3300047319 | Ga0495674_0021789 | Ga0495674_0021789_3593_4984 | 405 |
| 12 | 3300047471 | Ga0495684_0180379 | Ga0495684_0180379_147_1538 | 405 |
| 13 | 3300053077 | Ga0495601_0002168 | Ga0495601_0002168_8729_10120 | 405 |
| 14 | 3300048905 | Ga0496102_0069067 | Ga0496102_0069067_91_1482 | 407 |
| 15 | 3300048918 | Ga0496115_0047657 | Ga0496115_0047657_658_2049 | 407 |
| 16 | 3300046530 | Ga0495654_0016625 | Ga0495654_0016625_11_1261 | 409 |
| 17 | 3300005339 | Ga0070660_100004477 | Ga0070660_1000044773 | 410 |
| 18 | 3300014969 | Ga0157376_10134600 | Ga0157376_101346002 | 410 |
| 19 | 3300025919 | Ga0207657_10001049 | Ga0207657_1000104931 | 410 |
| 20 | 3300037466 | Ga0395898_0086460 | Ga0395898_0086460_65_1438 | 413 |
| 21 | 3300044684 | Ga0466966_0002457 | Ga0466966_0002457_2216_3514 | 414 |
| 22 | 3300044684 | Ga0466966_0019383 | Ga0466966_0019383_1087_2502 | 415 |
| 23 | 3300044765 | Ga0466970_0052977 | Ga0466970_0052977_457_1872 | 415 |
| 24 | 3300039437 | Ga0436365_0850532 | Ga0436365_0850532_135_1523 | 416 |
| 25 | 3300046452 | Ga0495617_052351 | Ga0495617_052351_65_1336 | 416 |
| 26 | 3300046455 | Ga0495603_0006417 | Ga0495603_0006417_5694_6965 | 416 |
| 27 | 3300006846 | Ga0075430_100005002 | Ga0075430_1000050023 | 418 |
| 28 | 3300006880 | Ga0075429_100001085 | Ga0075429_1000010853 | 418 |
| 29 | 3300044712 | Ga0453684_0328877 | Ga0453684_0328877_46_1350 | 422 |
| 30 | 3300046536 | Ga0495587_0058843 | Ga0495587_0058843_566_1855 | 422 |
| 31 | 3300047322 | Ga0495680_0003057 | Ga0495680_0003057_8434_9723 | 422 |
| 32 | 3300046457 | Ga0495590_0003380 | Ga0495590_0003380_3026_4318 | 423 |
| 33 | 3300046512 | Ga0495610_0023257 | Ga0495610_0023257_881_2173 | 423 |
| 34 | 3300046616 | Ga0495668_0009381 | Ga0495668_0009381_1890_3182 | 423 |
| 35 | 3300046684 | Ga0495669_0003277 | Ga0495669_0003277_467_1759 | 423 |
| 36 | 3300046692 | Ga0495671_0001368 | Ga0495671_0001368_14132_15424 | 423 |
| 37 | 3300046794 | Ga0495589_0055718 | Ga0495589_0055718_87_1379 | 423 |
| 38 | 3300047323 | Ga0495683_0023882 | Ga0495683_0023882_581_1873 | 423 |
| 39 | 3300009147 | Ga0114129_10038117 | Ga0114129_100381174 | 425 |
| 40 | 3300038443 | Ga0395901_0098300 | Ga0395901_0098300_1566_3002 | 425 |
| 41 | 3300028381 | Ga0268264_10116875 | Ga0268264_101168752 | 426 |
| 42 | 3300049571 | Ga0501034_0039482 | Ga0501034_0039482_1315_2814 | 426 |
| 43 | iso_pu_bacteria | 2867428634 | 2867437391 | 426 |
| 44 | 3300009011 | Ga0105251_10000028 | Ga0105251_1000002817 | 427 |
| 45 | 3300025302 | Ga0207426_1027582 | Ga0207426_10275822 | 427 |
| 46 | 3300048921 | Ga0496118_0029643 | Ga0496118_0029643_777_2081 | 427 |
| 47 | 3300048924 | Ga0496121_0001931 | Ga0496121_0001931_21844_23148 | 427 |
| 48 | 3300048925 | Ga0496122_0000043 | Ga0496122_0000043_123402_124706 | 427 |
| 49 | 3300048926 | Ga0496123_0000090 | Ga0496123_0000090_155621_156925 | 427 |
| 50 | 3300005329 | Ga0070683_100005756 | Ga0070683_1000057562 | 428 |
| 51 | 3300005366 | Ga0070659_100019330 | Ga0070659_1000193305 | 428 |
| 52 | 3300005530 | Ga0070679_100181330 | Ga0070679_1001813301 | 428 |
| 53 | 3300005563 | Ga0068855_100010155 | Ga0068855_10001015513 | 428 |
| 54 | 3300005843 | Ga0068860_100255980 | Ga0068860_1002559802 | 428 |
| 55 | 3300009098 | Ga0105245_10012419 | Ga0105245_100124197 | 428 |
| 56 | 3300009551 | Ga0105238_10006910 | Ga0105238_100069109 | 428 |
| 57 | 3300010375 | Ga0105239_10079943 | Ga0105239_100799433 | 428 |
| 58 | 3300011119 | Ga0105246_10001045 | Ga0105246_1000104513 | 428 |
| 59 | 3300013296 | Ga0157374_10006009 | Ga0157374_1000600910 | 428 |
| 60 | 3300013308 | Ga0157375_10040166 | Ga0157375_100401663 | 428 |
| 61 | 3300014325 | Ga0163163_10001642 | Ga0163163_1000164216 | 428 |
| 62 | 3300014745 | Ga0157377_10003986 | Ga0157377_100039869 | 428 |
| 63 | 3300025901 | Ga0207688_10006244 | Ga0207688_100062446 | 428 |
| 64 | 3300025914 | Ga0207671_10029571 | Ga0207671_100295712 | 428 |
| 65 | 3300025927 | Ga0207687_10020792 | Ga0207687_100207927 | 428 |
| 66 | 3300025932 | Ga0207690_10021718 | Ga0207690_100217185 | 428 |
| 67 | 3300025944 | Ga0207661_10087281 | Ga0207661_100872812 | 428 |
| 68 | 3300025949 | Ga0207667_10004544 | Ga0207667_1000454416 | 428 |
| 69 | 3300026023 | Ga0207677_10002013 | Ga0207677_100020139 | 428 |
| 70 | 3300048904 | Ga0496101_0004122 | Ga0496101_0004122_7159_8550 | 428 |
| 71 | 3300048905 | Ga0496102_0003029 | Ga0496102_0003029_1490_2881 | 428 |
| 72 | 3300048906 | Ga0496103_0007509 | Ga0496103_0007509_3671_5062 | 428 |
| 73 | 3300048907 | Ga0496104_0019438 | Ga0496104_0019438_4094_5485 | 428 |
| 74 | 3300048909 | Ga0496106_0003464 | Ga0496106_0003464_1548_2939 | 428 |
| 75 | 3300048910 | Ga0496107_0001433 | Ga0496107_0001433_10118_11509 | 428 |
| 76 | 3300048912 | Ga0496109_0009204 | Ga0496109_0009204_6040_7431 | 428 |
| 77 | 3300048913 | Ga0496110_0000626 | Ga0496110_0000626_20369_21760 | 428 |
| 78 | 3300048914 | Ga0496111_0002176 | Ga0496111_0002176_2234_3625 | 428 |
| 79 | 3300048915 | Ga0496112_0006081 | Ga0496112_0006081_6215_7606 | 428 |
| 80 | 3300048916 | Ga0496113_0000221 | Ga0496113_0000221_19094_20485 | 428 |
| 81 | 3300048917 | Ga0496114_0110821 | Ga0496114_0110821_762_2153 | 428 |
| 82 | 3300048918 | Ga0496115_0097216 | Ga0496115_0097216_734_2125 | 428 |
| 83 | 3300049583 | Ga0501067_0003460 | Ga0501067_0003460_3354_4745 | 429 |
| 84 | 3300049585 | Ga0501069_0032219 | Ga0501069_0032219_1208_2599 | 429 |
| 85 | 3300005436 | Ga0070713_100018140 | Ga0070713_1000181404 | 430 |
| 86 | 3300005437 | Ga0070710_10092963 | Ga0070710_100929632 | 430 |
| 87 | 3300006175 | Ga0070712_100034706 | Ga0070712_1000347062 | 430 |
| 88 | 3300025898 | Ga0207692_10017634 | Ga0207692_100176342 | 430 |
| 89 | 3300025928 | Ga0207700_10067360 | Ga0207700_100673602 | 430 |
| 90 | 3300046475 | Ga0495639_0013655 | Ga0495639_0013655_1793_3184 | 432 |
| 91 | 3300046514 | Ga0495618_0009858 | Ga0495618_0009858_2865_4256 | 432 |
| 92 | 3300046531 | Ga0495665_0005678 | Ga0495665_0005678_4347_5738 | 432 |
| 93 | 3300046533 | Ga0495640_0011451 | Ga0495640_0011451_1122_2513 | 432 |
| 94 | 3300046663 | Ga0495635_0053242 | Ga0495635_0053242_307_1698 | 432 |
| 95 | 3300046679 | Ga0495623_0091104 | Ga0495623_0091104_42_1433 | 432 |
| 96 | 3300046689 | Ga0495613_0004045 | Ga0495613_0004045_5068_6459 | 432 |
| 97 | 3300047321 | Ga0495676_0016554 | Ga0495676_0016554_4153_5544 | 432 |
| 98 | 3300048088 | Ga0495602_0065236 | Ga0495602_0065236_1441_2832 | 432 |
| 99 | 3300048903 | Ga0496100_0005810 | Ga0496100_0005810_3384_4772 | 433 |
| 100 | 3300048907 | Ga0496104_0028744 | Ga0496104_0028744_265_1653 | 433 |
| 101 | 3300048908 | Ga0496105_0015043 | Ga0496105_0015043_1597_2985 | 433 |
| 102 | 3300048909 | Ga0496106_0025424 | Ga0496106_0025424_190_1578 | 433 |
| 103 | 3300048910 | Ga0496107_0017720 | Ga0496107_0017720_939_2327 | 433 |
| 104 | 3300048911 | Ga0496108_0003468 | Ga0496108_0003468_2645_4033 | 433 |
| 105 | 3300048912 | Ga0496109_0012514 | Ga0496109_0012514_2566_3954 | 433 |
| 106 | 3300048913 | Ga0496110_0007505 | Ga0496110_0007505_4624_6012 | 433 |
| 107 | 3300048915 | Ga0496112_0004855 | Ga0496112_0004855_8249_9637 | 433 |
| 108 | 3300048916 | Ga0496113_0008913 | Ga0496113_0008913_3212_4600 | 433 |
| 109 | 3300048917 | Ga0496114_0016746 | Ga0496114_0016746_1796_3184 | 433 |
| 110 | 3300049571 | Ga0501034_0017350 | Ga0501034_0017350_987_2327 | 433 |
| 111 | 3300049586 | Ga0501070_0005845 | Ga0501070_0005845_5935_7275 | 433 |
| 112 | 3300049590 | Ga0501074_0002952 | Ga0501074_0002952_8758_10098 | 433 |
| 113 | 3300049742 | Ga0501080_0001161 | Ga0501080_0001161_18328_19668 | 433 |
| 114 | 3300026118 | Ga0207675_100003571 | Ga0207675_10000357113 | 435 |
| 115 | 3300044901 | Ga0466960_0010130 | Ga0466960_0010130_2022_3431 | 435 |
| 116 | 3300046455 | Ga0495603_0015487 | Ga0495603_0015487_2794_4206 | 435 |
| 117 | 3300046459 | Ga0495629_0045070 | Ga0495629_0045070_1473_2885 | 435 |
| 118 | 3300046674 | Ga0495588_0027627 | Ga0495588_0027627_697_2109 | 435 |
| 119 | 3300005366 | Ga0070659_100037742 | Ga0070659_1000377423 | 436 |
| 120 | 3300005616 | Ga0068852_100014131 | Ga0068852_1000141314 | 436 |
| 121 | 3300005844 | Ga0068862_100175452 | Ga0068862_1001754522 | 436 |
| 122 | 3300006028 | Ga0070717_10006834 | Ga0070717_100068346 | 436 |
| 123 | 3300006038 | Ga0075365_10000417 | Ga0075365_100004174 | 436 |
| 124 | 3300013307 | Ga0157372_10081794 | Ga0157372_100817943 | 436 |
| 125 | 3300025230 | Ga0209563_100252 | Ga0209563_10025220 | 436 |
| 126 | 3300048911 | Ga0496108_0009592 | Ga0496108_0009592_961_2364 | 436 |
| 127 | 3300048912 | Ga0496109_0011288 | Ga0496109_0011288_5000_6403 | 436 |
| 128 | 3300048913 | Ga0496110_0167819 | Ga0496110_0167819_80_1483 | 436 |
| 129 | 3300050511 | nmdc:mga08y16_12848_c1 | nmdc:mga08y16_12848_c1_4562_5899 | 436 |
| 130 | 3300037418 | Ga0395900_0071410 | Ga0395900_0071410_516_1874 | 437 |
| 131 | 3300045976 | Ga0466967_0052042 | Ga0466967_0052042_1822_3246 | 437 |
| 132 | 3300044901 | Ga0466960_0065163 | Ga0466960_0065163_86_1525 | 438 |
| 133 | 3300046694 | Ga0495649_0027281 | Ga0495649_0027281_1627_3024 | 438 |
| 134 | iso_pu_bacteria | 2643221576 | 2643891381 | 438 |
| 135 | iso_pu_bacteria | 2643221590 | 2643960429 | 438 |
| 136 | iso_pu_bacteria | 2643221604 | 2644036131 | 438 |
| 137 | 3300005437 | Ga0070710_10021222 | Ga0070710_100212222 | 439 |
| 138 | 3300005466 | Ga0070685_10037100 | Ga0070685_100371002 | 439 |
| 139 | 3300025940 | Ga0207691_10002035 | Ga0207691_100020356 | 439 |
| 140 | 3300028800 | Ga0265338_10014545 | Ga0265338_100145457 | 439 |
| 141 | 3300031241 | Ga0265325_10002382 | Ga0265325_100023822 | 439 |
| 142 | 3300031712 | Ga0265342_10073201 | Ga0265342_100732012 | 439 |
| 143 | 3300041452 | Ga0451793_0650080 | Ga0451793_0650080_250_1620 | 439 |
| 144 | 3300046522 | Ga0495643_0000049 | Ga0495643_0000049_151257_152654 | 439 |
| 145 | 3300046660 | Ga0495625_0023871 | Ga0495625_0023871_2216_3613 | 439 |
| 146 | 3300046692 | Ga0495671_0000171 | Ga0495671_0000171_6312_7709 | 439 |
| 147 | 3300047470 | Ga0495681_0016834 | Ga0495681_0016834_1364_2761 | 439 |
| 148 | 3300049581 | Ga0501047_0129107 | Ga0501047_0129107_955_2367 | 439 |
| 149 | 3300025272 | Ga0209455_1001658 | Ga0209455_10016583 | 440 |
| 150 | 3300026089 | Ga0207648_10009814 | Ga0207648_100098143 | 440 |
| 151 | 3300048911 | Ga0496108_0015083 | Ga0496108_0015083_1610_3019 | 440 |
| 152 | 3300049586 | Ga0501070_0002400 | Ga0501070_0002400_13780_15276 | 440 |
| 153 | 3300060353 | Ga0501082_0133125 | Ga0501082_0133125_44_1417 | 440 |
| 154 | 3300003752 | Ga0055539_1000005 | Ga0055539_1000005169 | 441 |
| 155 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011238 | 441 |
| 156 | 3300003759 | Ga0055525_1000380 | Ga0055525_10003803 | 441 |
| 157 | 3300003841 | Ga0055541_1004937 | Ga0055541_10049372 | 441 |
| 158 | 3300005340 | Ga0070689_100173754 | Ga0070689_1001737541 | 441 |
| 159 | 3300005548 | Ga0070665_100076756 | Ga0070665_1000767562 | 441 |
| 160 | 3300009101 | Ga0105247_10005054 | Ga0105247_100050547 | 441 |
| 161 | 3300014968 | Ga0157379_10030343 | Ga0157379_100303437 | 441 |
| 162 | 3300025225 | Ga0209566_100065 | Ga0209566_100065178 | 441 |
| 163 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011238 | 441 |
| 164 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011238 | 441 |
| 165 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011238 | 441 |
| 166 | 3300025935 | Ga0207709_10071548 | Ga0207709_100715482 | 441 |
| 167 | 3300026035 | Ga0207703_10102515 | Ga0207703_101025152 | 441 |
| 168 | 3300049571 | Ga0501034_0025683 | Ga0501034_0025683_1294_2697 | 441 |
| 169 | 3300049572 | Ga0501036_0015584 | Ga0501036_0015584_1930_3333 | 441 |
| 170 | 3300049574 | Ga0501038_0037453 | Ga0501038_0037453_228_1622 | 441 |
| 171 | 3300049579 | Ga0501043_0015877 | Ga0501043_0015877_488_1891 | 441 |
| 172 | 3300049581 | Ga0501047_0087631 | Ga0501047_0087631_617_2020 | 441 |
| 173 | 3300049582 | Ga0501048_0145498 | Ga0501048_0145498_235_1638 | 441 |
| 174 | 3300049590 | Ga0501074_0016811 | Ga0501074_0016811_148_1551 | 441 |
| 175 | 3300049592 | Ga0501076_0136471 | Ga0501076_0136471_148_1551 | 441 |
| 176 | iso_pu_bacteria | 2643221641 | 2644229535 | 441 |
| 177 | iso_pu_bacteria | 2739367898 | 2740168406 | 441 |
| 178 | iso_pu_bacteria | 2906799679 | 2906799973 | 441 |
| 179 | 3300005614 | Ga0068856_100006739 | Ga0068856_10000673913 | 442 |
| 180 | 3300006871 | Ga0075434_100000189 | Ga0075434_1000001899 | 442 |
| 181 | 3300007076 | Ga0075435_100001011 | Ga0075435_10000101112 | 442 |
| 182 | 3300013105 | Ga0157369_10254076 | Ga0157369_102540762 | 442 |
| 183 | 3300026078 | Ga0207702_10059919 | Ga0207702_100599192 | 442 |
| 184 | 3300031901 | Ga0307406_10069915 | Ga0307406_100699152 | 442 |
| 185 | 3300031995 | Ga0307409_100018133 | Ga0307409_1000181332 | 442 |
| 186 | 3300048918 | Ga0496115_0002679 | Ga0496115_0002679_8151_9551 | 442 |
| 187 | 3300050512 | nmdc:mga0n895_1334_c1 | nmdc:mga0n895_1334_c1_4705_6096 | 442 |
| 188 | 3300050513 | nmdc:mga0rr50_40331_c1 | nmdc:mga0rr50_40331_c1_440_1831 | 442 |
| 189 | iso_pu_bacteria | 2738541305 | 2738870802 | 442 |
| 190 | iso_pu_bacteria | 2844841374 | 2844842903 | 442 |
| 191 | iso_pu_bacteria | 2856741275 | 2856744373 | 442 |
| 192 | iso_pu_bacteria | 2891562705 | 2891569244 | 442 |
| 193 | 3300005341 | Ga0070691_10046440 | Ga0070691_100464401 | 443 |
| 194 | 3300005564 | Ga0070664_100216722 | Ga0070664_1002167222 | 443 |
| 195 | 3300005841 | Ga0068863_100171112 | Ga0068863_1001711122 | 443 |
| 196 | 3300006163 | Ga0070715_10033815 | Ga0070715_100338152 | 443 |
| 197 | 3300006358 | Ga0068871_100073933 | Ga0068871_1000739333 | 443 |
| 198 | 3300010375 | Ga0105239_10166043 | Ga0105239_101660432 | 443 |
| 199 | 3300013306 | Ga0163162_10039119 | Ga0163162_100391193 | 443 |
| 200 | 3300014325 | Ga0163163_10115721 | Ga0163163_101157211 | 443 |
| 201 | 3300014968 | Ga0157379_10076652 | Ga0157379_100766521 | 443 |
| 202 | 3300025916 | Ga0207663_10036671 | Ga0207663_100366712 | 443 |
| 203 | 3300025949 | Ga0207667_10288318 | Ga0207667_102883182 | 443 |
| 204 | 3300026067 | Ga0207678_10183650 | Ga0207678_101836501 | 443 |
| 205 | 3300026078 | Ga0207702_10254942 | Ga0207702_102549421 | 443 |
| 206 | 3300035083 | Ga0373926_0009460 | Ga0373926_0009460_636_2042 | 443 |
| 207 | 3300046461 | Ga0495641_0039978 | Ga0495641_0039978_229_1635 | 443 |
| 208 | 3300046462 | Ga0495651_0006659 | Ga0495651_0006659_6108_7514 | 443 |
| 209 | 3300046475 | Ga0495639_0038331 | Ga0495639_0038331_354_1760 | 443 |
| 210 | 3300046514 | Ga0495618_0052858 | Ga0495618_0052858_391_1797 | 443 |
| 211 | 3300046533 | Ga0495640_0045545 | Ga0495640_0045545_648_2054 | 443 |
| 212 | 3300046535 | Ga0495586_0055565 | Ga0495586_0055565_262_1668 | 443 |
| 213 | 3300046536 | Ga0495587_0002980 | Ga0495587_0002980_3765_5171 | 443 |
| 214 | 3300046663 | Ga0495635_0081545 | Ga0495635_0081545_300_1706 | 443 |
| 215 | 3300046675 | Ga0495657_0039692 | Ga0495657_0039692_692_2098 | 443 |
| 216 | 3300046679 | Ga0495623_0022921 | Ga0495623_0022921_2556_3962 | 443 |
| 217 | 3300046680 | Ga0495646_0022418 | Ga0495646_0022418_1733_3139 | 443 |
| 218 | 3300047444 | Ga0495675_0026189 | Ga0495675_0026189_326_1732 | 443 |
| 219 | 3300047471 | Ga0495684_0005519 | Ga0495684_0005519_714_2120 | 443 |
| 220 | 3300048089 | Ga0495614_0047864 | Ga0495614_0047864_67_1473 | 443 |
| 221 | 3300048911 | Ga0496108_0057415 | Ga0496108_0057415_1714_3120 | 443 |
| 222 | 3300048912 | Ga0496109_0083585 | Ga0496109_0083585_855_2261 | 443 |
| 223 | 3300048914 | Ga0496111_0017782 | Ga0496111_0017782_66_1472 | 443 |
| 224 | 3300048922 | Ga0496119_0045002 | Ga0496119_0045002_709_2106 | 443 |
| 225 | 3300049822 | Ga0501035_0034448 | Ga0501035_0034448_433_1839 | 443 |
| 226 | 3300050512 | nmdc:mga0n895_95568_c1 | nmdc:mga0n895_95568_c1_50_1456 | 443 |
| 227 | 3300053077 | Ga0495601_0121087 | Ga0495601_0121087_103_1509 | 443 |
| 228 | iso_pu_bacteria | 2919395869 | 2919396232 | 443 |
| 229 | 3300031911 | Ga0307412_10074959 | Ga0307412_100749592 | 444 |
| 230 | 3300032002 | Ga0307416_100002034 | Ga0307416_1000020345 | 444 |
| 231 | 3300032126 | Ga0307415_100114305 | Ga0307415_1001143052 | 444 |
| 232 | 3300035172 | Ga0373955_0023329 | Ga0373955_0023329_1003_2415 | 444 |
| 233 | 3300035724 | Ga0373933_0007701 | Ga0373933_0007701_513_1925 | 444 |
| 234 | 3300036401 | Ga0373937_0156285 | Ga0373937_0156285_405_1817 | 444 |
| 235 | 3300044694 | Ga0466963_0146970 | Ga0466963_0146970_139_1542 | 444 |
| 236 | 3300044719 | Ga0466971_0031042 | Ga0466971_0031042_152_1567 | 444 |
| 237 | 3300044765 | Ga0466970_0040673 | Ga0466970_0040673_685_2097 | 444 |
| 238 | 3300045049 | Ga0466959_0029607 | Ga0466959_0029607_2227_3642 | 444 |
| 239 | 3300046463 | Ga0495653_0018739 | Ga0495653_0018739_1781_3193 | 444 |
| 240 | 3300046507 | Ga0495606_0000041 | Ga0495606_0000041_41236_42816 | 444 |
| 241 | 3300046511 | Ga0495608_0017964 | Ga0495608_0017964_1662_3074 | 444 |
| 242 | 3300046536 | Ga0495587_0053015 | Ga0495587_0053015_568_1980 | 444 |
| 243 | 3300046675 | Ga0495657_0016894 | Ga0495657_0016894_1661_3073 | 444 |
| 244 | 3300046679 | Ga0495623_0047124 | Ga0495623_0047124_704_2116 | 444 |
| 245 | 3300046680 | Ga0495646_0079301 | Ga0495646_0079301_134_1546 | 444 |
| 246 | 3300046694 | Ga0495649_0000022 | Ga0495649_0000022_177410_178990 | 444 |
| 247 | 3300046809 | Ga0495600_0016386 | Ga0495600_0016386_131_1543 | 444 |
| 248 | 3300047322 | Ga0495680_0017945 | Ga0495680_0017945_268_1680 | 444 |
| 249 | 3300047471 | Ga0495684_0014031 | Ga0495684_0014031_3052_4464 | 444 |
| 250 | 3300048088 | Ga0495602_0061044 | Ga0495602_0061044_55_1467 | 444 |
| 251 | 3300048928 | Ga0496125_0127627 | Ga0496125_0127627_377_1780 | 444 |
| 252 | 3300049568 | Ga0501031_0036433 | Ga0501031_0036433_1530_2939 | 444 |
| 253 | 3300049568 | Ga0501031_0059513 | Ga0501031_0059513_803_2212 | 444 |
| 254 | 3300049572 | Ga0501036_0028398 | Ga0501036_0028398_1791_3200 | 444 |
| 255 | 3300049586 | Ga0501070_0002490 | Ga0501070_0002490_11762_13180 | 444 |
| 256 | 3300049587 | Ga0501071_0012031 | Ga0501071_0012031_1879_3288 | 444 |
| 257 | 3300049587 | Ga0501071_0052633 | Ga0501071_0052633_968_2353 | 444 |
| 258 | 3300049591 | Ga0501075_0016423 | Ga0501075_0016423_253_1662 | 444 |
| 259 | 3300049592 | Ga0501076_0018678 | Ga0501076_0018678_3039_4448 | 444 |
| 260 | 3300049743 | Ga0501081_0022247 | Ga0501081_0022247_112_1521 | 444 |
| 261 | 3300049824 | Ga0501045_0014003 | Ga0501045_0014003_2521_3930 | 444 |
| 262 | 3300053153 | Ga0500616_0000183 | Ga0500616_0000183_30679_32097 | 444 |
| 263 | 3300060353 | Ga0501082_0225238 | Ga0501082_0225238_152_1537 | 444 |
| 264 | 3300005330 | Ga0070690_100011504 | Ga0070690_1000115043 | 445 |
| 265 | 3300005340 | Ga0070689_100014630 | Ga0070689_1000146304 | 445 |
| 266 | 3300005345 | Ga0070692_10006941 | Ga0070692_100069414 | 445 |
| 267 | 3300005354 | Ga0070675_100088572 | Ga0070675_1000885722 | 445 |
| 268 | 3300005356 | Ga0070674_100014137 | Ga0070674_1000141374 | 445 |
| 269 | 3300005365 | Ga0070688_100013601 | Ga0070688_1000136013 | 445 |
| 270 | 3300005438 | Ga0070701_10009540 | Ga0070701_100095404 | 445 |
| 271 | 3300005441 | Ga0070700_100084435 | Ga0070700_1000844352 | 445 |
| 272 | 3300005444 | Ga0070694_100053650 | Ga0070694_1000536502 | 445 |
| 273 | 3300005444 | Ga0070694_100182912 | Ga0070694_1001829121 | 445 |
| 274 | 3300005455 | Ga0070663_100026056 | Ga0070663_1000260562 | 445 |
| 275 | 3300005456 | Ga0070678_100054328 | Ga0070678_1000543283 | 445 |
| 276 | 3300005456 | Ga0070678_100119278 | Ga0070678_1001192782 | 445 |
| 277 | 3300005457 | Ga0070662_100052820 | Ga0070662_1000528202 | 445 |
| 278 | 3300005518 | Ga0070699_100122518 | Ga0070699_1001225182 | 445 |
| 279 | 3300005547 | Ga0070693_100088235 | Ga0070693_1000882352 | 445 |
| 280 | 3300005549 | Ga0070704_100025377 | Ga0070704_1000253772 | 445 |
| 281 | 3300005549 | Ga0070704_100041217 | Ga0070704_1000412172 | 445 |
| 282 | 3300005563 | Ga0068855_100005950 | Ga0068855_1000059507 | 445 |
| 283 | 3300005563 | Ga0068855_100078367 | Ga0068855_1000783672 | 445 |
| 284 | 3300005615 | Ga0070702_100002049 | Ga0070702_1000020493 | 445 |
| 285 | 3300005617 | Ga0068859_100197944 | Ga0068859_1001979442 | 445 |
| 286 | 3300005840 | Ga0068870_10013878 | Ga0068870_100138783 | 445 |
| 287 | 3300005843 | Ga0068860_100027413 | Ga0068860_1000274134 | 445 |
| 288 | 3300006931 | Ga0097620_100197948 | Ga0097620_1001979482 | 445 |
| 289 | 3300009094 | Ga0111539_10014975 | Ga0111539_100149753 | 445 |
| 290 | 3300009098 | Ga0105245_10043223 | Ga0105245_100432231 | 445 |
| 291 | 3300009176 | Ga0105242_10008446 | Ga0105242_100084463 | 445 |
| 292 | 3300009177 | Ga0105248_10130522 | Ga0105248_101305222 | 445 |
| 293 | 3300009553 | Ga0105249_10003437 | Ga0105249_100034373 | 445 |
| 294 | 3300010375 | Ga0105239_10011317 | Ga0105239_100113178 | 445 |
| 295 | 3300013308 | Ga0157375_10007971 | Ga0157375_100079716 | 445 |
| 296 | 3300014325 | Ga0163163_10035479 | Ga0163163_100354793 | 445 |
| 297 | 3300014326 | Ga0157380_10014657 | Ga0157380_100146576 | 445 |
| 298 | 3300025901 | Ga0207688_10025712 | Ga0207688_100257122 | 445 |
| 299 | 3300025908 | Ga0207643_10004317 | Ga0207643_100043173 | 445 |
| 300 | 3300025918 | Ga0207662_10044008 | Ga0207662_100440083 | 445 |
| 301 | 3300025925 | Ga0207650_10089409 | Ga0207650_100894092 | 445 |
| 302 | 3300025927 | Ga0207687_10033407 | Ga0207687_100334074 | 445 |
| 303 | 3300025927 | Ga0207687_10079961 | Ga0207687_100799612 | 445 |
| 304 | 3300025937 | Ga0207669_10011927 | Ga0207669_100119272 | 445 |
| 305 | 3300025945 | Ga0207679_10027162 | Ga0207679_100271623 | 445 |
| 306 | 3300025949 | Ga0207667_10022448 | Ga0207667_100224482 | 445 |
| 307 | 3300026035 | Ga0207703_10017164 | Ga0207703_100171642 | 445 |
| 308 | 3300026075 | Ga0207708_10010588 | Ga0207708_100105883 | 445 |
| 309 | 3300026075 | Ga0207708_10103322 | Ga0207708_101033222 | 445 |
| 310 | 3300026089 | Ga0207648_10007537 | Ga0207648_100075376 | 445 |
| 311 | 3300026116 | Ga0207674_10041172 | Ga0207674_100411723 | 445 |
| 312 | 3300026121 | Ga0207683_10029962 | Ga0207683_100299623 | 445 |
| 313 | 3300028381 | Ga0268264_10021585 | Ga0268264_100215853 | 445 |
| 314 | 3300031727 | Ga0316576_10004163 | Ga0316576_100041632 | 445 |
| 315 | 3300045051 | Ga0451576_0075720 | Ga0451576_0075720_227_1621 | 445 |
| 316 | 3300048907 | Ga0496104_0124840 | Ga0496104_0124840_62_1453 | 445 |
| 317 | 3300048913 | Ga0496110_0082773 | Ga0496110_0082773_1118_2515 | 445 |
| 318 | 3300048915 | Ga0496112_0092581 | Ga0496112_0092581_200_1591 | 445 |
| 319 | 3300048915 | Ga0496112_0205095 | Ga0496112_0205095_108_1505 | 445 |
| 320 | 3300048916 | Ga0496113_0034990 | Ga0496113_0034990_1181_2578 | 445 |
| 321 | 3300049579 | Ga0501043_0155600 | Ga0501043_0155600_276_1670 | 445 |
| 322 | 3300049580 | Ga0501046_0085108 | Ga0501046_0085108_372_1766 | 445 |
| 323 | 3300049587 | Ga0501071_0120866 | Ga0501071_0120866_329_1723 | 445 |
| 324 | 3300049590 | Ga0501074_0011144 | Ga0501074_0011144_2029_3525 | 445 |
| 325 | 3300049591 | Ga0501075_0033087 | Ga0501075_0033087_1186_2580 | 445 |
| 326 | 3300049592 | Ga0501076_0052032 | Ga0501076_0052032_1307_2701 | 445 |
| 327 | 3300049741 | Ga0501079_0020791 | Ga0501079_0020791_3540_4934 | 445 |
| 328 | 3300049824 | Ga0501045_0088070 | Ga0501045_0088070_138_1532 | 445 |
| 329 | 3300053078 | Ga0495612_0000202 | Ga0495612_0000202_15285_16679 | 445 |
| 330 | 3300054114 | Ga0501084_0075765 | Ga0501084_0075765_1156_2550 | 445 |
| 331 | iso_pu_bacteria | 2995726249 | 2995726874 | 445 |
| 332 | iso_pu_bacteria | 8002811521 | 8002813582 | 445 |
| 333 | iso_pu_bacteria | 8055034563 | 8055037000 | 445 |
| 334 | iso_pu_bacteria | 8055037949 | 8055040602 | 445 |
| 335 | 3300009147 | Ga0114129_10130307 | Ga0114129_101303072 | 446 |
| 336 | 3300009147 | Ga0114129_10213756 | Ga0114129_102137562 | 446 |
| 337 | 3300014745 | Ga0157377_10133436 | Ga0157377_101334361 | 446 |
| 338 | 3300025919 | Ga0207657_10236760 | Ga0207657_102367601 | 446 |
| 339 | 3300025949 | Ga0207667_10138203 | Ga0207667_101382032 | 446 |
| 340 | 3300031731 | Ga0307405_10080230 | Ga0307405_100802302 | 446 |
| 341 | 3300031731 | Ga0307405_10119028 | Ga0307405_101190282 | 446 |
| 342 | 3300032002 | Ga0307416_100187723 | Ga0307416_1001877232 | 446 |
| 343 | 3300049571 | Ga0501034_0015770 | Ga0501034_0015770_604_2031 | 446 |
| 344 | 3300049571 | Ga0501034_0210536 | Ga0501034_0210536_64_1491 | 446 |
| 345 | 3300049586 | Ga0501070_0009744 | Ga0501070_0009744_1131_2558 | 446 |
| 346 | 3300049587 | Ga0501071_0003074 | Ga0501071_0003074_4091_5518 | 446 |
| 347 | 3300050507 | nmdc:mga05p37_230358_c1 | nmdc:mga05p37_230358_c1_565_1956 | 446 |
| 348 | 3300006844 | Ga0075428_100047189 | Ga0075428_1000471893 | 447 |
| 349 | 3300006871 | Ga0075434_100166335 | Ga0075434_1001663352 | 447 |
| 350 | 3300037466 | Ga0395898_0002385 | Ga0395898_0002385_15163_16587 | 447 |
| 351 | 3300049574 | Ga0501038_0022537 | Ga0501038_0022537_3895_5304 | 447 |
| 352 | 3300049580 | Ga0501046_0033504 | Ga0501046_0033504_738_2147 | 447 |
| 353 | 3300049587 | Ga0501071_0093965 | Ga0501071_0093965_304_1698 | 447 |
| 354 | 3300049588 | Ga0501072_0007848 | Ga0501072_0007848_486_1895 | 447 |
| 355 | 3300049591 | Ga0501075_0093606 | Ga0501075_0093606_223_1617 | 447 |
| 356 | 3300049592 | Ga0501076_0045824 | Ga0501076_0045824_1234_2643 | 447 |
| 357 | 3300049592 | Ga0501076_0158649 | Ga0501076_0158649_34_1428 | 447 |
| 358 | 3300049744 | Ga0501083_0043784 | Ga0501083_0043784_155_1564 | 447 |
| 359 | 3300049824 | Ga0501045_0075415 | Ga0501045_0075415_161_1570 | 447 |
| 360 | 3300050512 | nmdc:mga0n895_193467_c1 | nmdc:mga0n895_193467_c1_246_1640 | 447 |
| 361 | 3300053136 | Ga0500559_0000949 | Ga0500559_0000949_10361_11779 | 447 |
| 362 | 3300005467 | Ga0070706_100002897 | Ga0070706_1000028974 | 448 |
| 363 | 3300005471 | Ga0070698_100027456 | Ga0070698_1000274563 | 448 |
| 364 | 3300013308 | Ga0157375_10031099 | Ga0157375_100310994 | 448 |
| 365 | 3300014968 | Ga0157379_10023448 | Ga0157379_100234483 | 448 |
| 366 | 3300025910 | Ga0207684_10000712 | Ga0207684_100007124 | 448 |
| 367 | 3300025922 | Ga0207646_10003672 | Ga0207646_1000367215 | 448 |
| 368 | 3300044693 | Ga0466961_0075897 | Ga0466961_0075897_512_1891 | 448 |
| 369 | 3300044765 | Ga0466970_0025976 | Ga0466970_0025976_20_1399 | 448 |
| 370 | 3300045976 | Ga0466967_0266919 | Ga0466967_0266919_10_1407 | 448 |
| 371 | 3300046462 | Ga0495651_0000746 | Ga0495651_0000746_14392_15771 | 448 |
| 372 | 3300046516 | Ga0495628_0003788 | Ga0495628_0003788_10480_11859 | 448 |
| 373 | 3300046529 | Ga0495652_0002668 | Ga0495652_0002668_495_1874 | 448 |
| 374 | 3300047317 | Ga0495604_0038960 | Ga0495604_0038960_621_2000 | 448 |
| 375 | iso_pu_bacteria | 2891395885 | 2891395940 | 448 |
| 376 | iso_pu_bacteria | 3002998708 | 3003006958 | 448 |
| 377 | 3300005329 | Ga0070683_100007076 | Ga0070683_1000070766 | 449 |
| 378 | 3300005336 | Ga0070680_100123933 | Ga0070680_1001239333 | 449 |
| 379 | 3300005444 | Ga0070694_100046543 | Ga0070694_1000465432 | 449 |
| 380 | 3300005471 | Ga0070698_100052450 | Ga0070698_1000524502 | 449 |
| 381 | 3300005530 | Ga0070679_100229784 | Ga0070679_1002297842 | 449 |
| 382 | 3300005546 | Ga0070696_100052283 | Ga0070696_1000522832 | 449 |
| 383 | 3300020081 | Ga0206354_10254398 | Ga0206354_102543983 | 449 |
| 384 | 3300020082 | Ga0206353_10224325 | Ga0206353_1022432510 | 449 |
| 385 | 3300025910 | Ga0207684_10017570 | Ga0207684_100175704 | 449 |
| 386 | 3300025912 | Ga0207707_10040477 | Ga0207707_100404772 | 449 |
| 387 | 3300025917 | Ga0207660_10107824 | Ga0207660_101078243 | 449 |
| 388 | 3300025921 | Ga0207652_10065345 | Ga0207652_100653453 | 449 |
| 389 | 3300025944 | Ga0207661_10025114 | Ga0207661_100251145 | 449 |
| 390 | 3300031616 | Ga0307508_10004026 | Ga0307508_100040266 | 449 |
| 391 | 3300033179 | Ga0307507_10007693 | Ga0307507_100076937 | 449 |
| 392 | 3300037068 | Ga0373925_0005374 | Ga0373925_0005374_111_1520 | 449 |
| 393 | 3300046459 | Ga0495629_0003703 | Ga0495629_0003703_7589_8989 | 449 |
| 394 | 3300046462 | Ga0495651_0002533 | Ga0495651_0002533_1508_2908 | 449 |
| 395 | 3300046473 | Ga0495582_0019915 | Ga0495582_0019915_546_1946 | 449 |
| 396 | 3300046476 | Ga0495662_0005421 | Ga0495662_0005421_3128_4528 | 449 |
| 397 | 3300046477 | Ga0495664_0000886 | Ga0495664_0000886_1323_2723 | 449 |
| 398 | 3300046517 | Ga0495630_0092409 | Ga0495630_0092409_576_1976 | 449 |
| 399 | 3300046535 | Ga0495586_0016218 | Ga0495586_0016218_742_2142 | 449 |
| 400 | 3300046536 | Ga0495587_0000351 | Ga0495587_0000351_28132_29532 | 449 |
| 401 | 3300046543 | Ga0495645_0015914 | Ga0495645_0015914_2721_4121 | 449 |
| 402 | 3300046642 | Ga0495634_0025507 | Ga0495634_0025507_1719_3119 | 449 |
| 403 | 3300046663 | Ga0495635_0001252 | Ga0495635_0001252_3856_5256 | 449 |
| 404 | 3300046675 | Ga0495657_0002113 | Ga0495657_0002113_4177_5577 | 449 |
| 405 | 3300046680 | Ga0495646_0000654 | Ga0495646_0000654_11047_12447 | 449 |
| 406 | 3300046683 | Ga0495658_0044021 | Ga0495658_0044021_169_1569 | 449 |
| 407 | 3300046689 | Ga0495613_0000863 | Ga0495613_0000863_3082_4482 | 449 |
| 408 | 3300046809 | Ga0495600_0004855 | Ga0495600_0004855_2996_4396 | 449 |
| 409 | 3300047315 | Ga0495581_0019739 | Ga0495581_0019739_793_2193 | 449 |
| 410 | 3300047317 | Ga0495604_0001086 | Ga0495604_0001086_5123_6523 | 449 |
| 411 | 3300047319 | Ga0495674_0044265 | Ga0495674_0044265_110_1510 | 449 |
| 412 | 3300047321 | Ga0495676_0017686 | Ga0495676_0017686_3446_4846 | 449 |
| 413 | 3300047444 | Ga0495675_0036887 | Ga0495675_0036887_1691_3091 | 449 |
| 414 | 3300047471 | Ga0495684_0072190 | Ga0495684_0072190_823_2223 | 449 |
| 415 | 3300047673 | Ga0495593_0001513 | Ga0495593_0001513_1337_2737 | 449 |
| 416 | 3300048089 | Ga0495614_0003675 | Ga0495614_0003675_300_1700 | 449 |
| 417 | 3300048915 | Ga0496112_0159799 | Ga0496112_0159799_20_1426 | 449 |
| 418 | 3300048920 | Ga0496117_0007927 | Ga0496117_0007927_6313_7740 | 449 |
| 419 | 3300048925 | Ga0496122_0000116 | Ga0496122_0000116_139310_140737 | 449 |
| 420 | 3300048926 | Ga0496123_0000009 | Ga0496123_0000009_188589_190016 | 449 |
| 421 | 3300048927 | Ga0496124_0002284 | Ga0496124_0002284_11356_12783 | 449 |
| 422 | 3300048928 | Ga0496125_0017036 | Ga0496125_0017036_5399_6826 | 449 |
| 423 | 3300048929 | Ga0496126_0089492 | Ga0496126_0089492_810_2237 | 449 |
| 424 | iso_pu_bacteria | 2856741275 | 2856742195 | 449 |
| 425 | iso_pu_bacteria | 2895427314 | 2895438921 | 449 |
| 426 | 3300005435 | Ga0070714_100158941 | Ga0070714_1001589412 | 450 |
| 427 | 3300005544 | Ga0070686_100018885 | Ga0070686_1000188851 | 450 |
| 428 | 3300005615 | Ga0070702_100088948 | Ga0070702_1000889482 | 450 |
| 429 | 3300005981 | Ga0081538_10002004 | Ga0081538_1000200412 | 450 |
| 430 | 3300005985 | Ga0081539_10013276 | Ga0081539_100132763 | 450 |
| 431 | 3300014497 | Ga0182008_10040017 | Ga0182008_100400172 | 450 |
| 432 | 3300031730 | Ga0307516_10013366 | Ga0307516_100133667 | 450 |
| 433 | 3300035398 | Ga0316574_0007972 | Ga0316574_0007972_1994_3595 | 450 |
| 434 | 3300044694 | Ga0466963_0030020 | Ga0466963_0030020_1822_3231 | 450 |
| 435 | 3300044765 | Ga0466970_0017238 | Ga0466970_0017238_1817_3202 | 450 |
| 436 | 3300044842 | Ga0466957_0040579 | Ga0466957_0040579_104_1489 | 450 |
| 437 | 3300045049 | Ga0466959_0043854 | Ga0466959_0043854_161_1570 | 450 |
| 438 | 3300045049 | Ga0466959_0115921 | Ga0466959_0115921_126_1535 | 450 |
| 439 | 3300045976 | Ga0466967_0213442 | Ga0466967_0213442_307_1716 | 450 |
| 440 | 3300049588 | Ga0501072_0156985 | Ga0501072_0156985_339_1727 | 450 |
| 441 | 3300049823 | Ga0501044_0000883 | Ga0501044_0000883_27682_29073 | 450 |
| 442 | iso_pu_bacteria | 2643221647 | 2644269627 | 450 |
| 443 | iso_pu_bacteria | 2731639228 | 2731908471 | 450 |
| 444 | iso_pu_bacteria | 2784746768 | 2785371842 | 450 |
| 445 | iso_pu_bacteria | 2862507626 | 2862514305 | 450 |
| 446 | iso_pu_bacteria | 2954691527 | 2954694510 | 450 |
| 447 | iso_pu_bacteria | 2954701450 | 2954709713 | 450 |
| 448 | iso_pu_bacteria | 8011350971 | 8011354681 | 450 |
| 449 | 3300005329 | Ga0070683_100047206 | Ga0070683_1000472063 | 451 |
| 450 | 3300005338 | Ga0068868_100088939 | Ga0068868_1000889392 | 451 |
| 451 | 3300005435 | Ga0070714_100236547 | Ga0070714_1002365471 | 451 |
| 452 | 3300005455 | Ga0070663_100001298 | Ga0070663_1000012981 | 451 |
| 453 | 3300005530 | Ga0070679_100003951 | Ga0070679_10000395114 | 451 |
| 454 | 3300009147 | Ga0114129_10337423 | Ga0114129_103374232 | 451 |
| 455 | 3300025921 | Ga0207652_10001981 | Ga0207652_1000198114 | 451 |
| 456 | 3300026067 | Ga0207678_10013299 | Ga0207678_100132991 | 451 |
| 457 | 3300026067 | Ga0207678_10153408 | Ga0207678_101534081 | 451 |
| 458 | 3300028794 | Ga0307515_10181178 | Ga0307515_101811782 | 451 |
| 459 | 3300031247 | Ga0265340_10001983 | Ga0265340_100019837 | 451 |
| 460 | 3300032126 | Ga0307415_100047472 | Ga0307415_1000474723 | 451 |
| 461 | 3300037466 | Ga0395898_0028932 | Ga0395898_0028932_1526_2929 | 451 |
| 462 | 3300037466 | Ga0395898_0062439 | Ga0395898_0062439_538_1941 | 451 |
| 463 | 3300037471 | Ga0395905_0164456 | Ga0395905_0164456_69_1472 | 451 |
| 464 | 3300044694 | Ga0466963_0012422 | Ga0466963_0012422_3408_4826 | 451 |
| 465 | 3300048903 | Ga0496100_0047456 | Ga0496100_0047456_499_1884 | 451 |
| 466 | 3300048904 | Ga0496101_0005894 | Ga0496101_0005894_5964_7349 | 451 |
| 467 | 3300048905 | Ga0496102_0001742 | Ga0496102_0001742_14516_15901 | 451 |
| 468 | 3300048909 | Ga0496106_0027590 | Ga0496106_0027590_319_1704 | 451 |
| 469 | 3300048910 | Ga0496107_0001109 | Ga0496107_0001109_3504_4889 | 451 |
| 470 | 3300048912 | Ga0496109_0106125 | Ga0496109_0106125_317_1702 | 451 |
| 471 | 3300048914 | Ga0496111_0159987 | Ga0496111_0159987_149_1576 | 451 |
| 472 | 3300048917 | Ga0496114_0040296 | Ga0496114_0040296_1366_2751 | 451 |
| 473 | 3300048917 | Ga0496114_0044606 | Ga0496114_0044606_747_2171 | 451 |
| 474 | 3300049568 | Ga0501031_0050743 | Ga0501031_0050743_489_1907 | 451 |
| 475 | 3300049569 | Ga0501032_0080781 | Ga0501032_0080781_105_1523 | 451 |
| 476 | 3300049570 | Ga0501033_0049129 | Ga0501033_0049129_460_1878 | 451 |
| 477 | 3300049571 | Ga0501034_0123701 | Ga0501034_0123701_337_1755 | 451 |
| 478 | 3300049572 | Ga0501036_0141521 | Ga0501036_0141521_186_1604 | 451 |
| 479 | 3300049574 | Ga0501038_0030461 | Ga0501038_0030461_874_2292 | 451 |
| 480 | 3300049578 | Ga0501042_0151998 | Ga0501042_0151998_134_1561 | 451 |
| 481 | 3300049579 | Ga0501043_0134425 | Ga0501043_0134425_345_1763 | 451 |
| 482 | 3300049579 | Ga0501043_0137119 | Ga0501043_0137119_127_1557 | 451 |
| 483 | 3300049580 | Ga0501046_0008749 | Ga0501046_0008749_451_1869 | 451 |
| 484 | 3300049581 | Ga0501047_0004050 | Ga0501047_0004050_6642_8075 | 451 |
| 485 | 3300049582 | Ga0501048_0037625 | Ga0501048_0037625_656_2074 | 451 |
| 486 | 3300049593 | Ga0501077_0090516 | Ga0501077_0090516_466_1896 | 451 |
| 487 | 3300049743 | Ga0501081_0154462 | Ga0501081_0154462_49_1479 | 451 |
| 488 | 3300049822 | Ga0501035_0004132 | Ga0501035_0004132_919_2337 | 451 |
| 489 | 3300049822 | Ga0501035_0119992 | Ga0501035_0119992_327_1757 | 451 |
| 490 | 3300049823 | Ga0501044_0164341 | Ga0501044_0164341_323_1741 | 451 |
| 491 | 3300053153 | Ga0500616_0000740 | Ga0500616_0000740_19338_20804 | 451 |
| 492 | iso_pu_bacteria | 2912723979 | 2912729873 | 451 |
| 493 | iso_pu_bacteria | 3003930520 | 3003935050 | 451 |
| 494 | 3300001989 | JGI24739J22299_10008030 | JGI24739J22299_100080303 | 452 |
| 495 | 3300005937 | Ga0081455_10170803 | Ga0081455_101708032 | 452 |
| 496 | 3300005981 | Ga0081538_10003351 | Ga0081538_1000335118 | 452 |
| 497 | 3300006178 | Ga0075367_10002121 | Ga0075367_100021215 | 452 |
| 498 | 3300009147 | Ga0114129_10047429 | Ga0114129_100474293 | 452 |
| 499 | 3300011119 | Ga0105246_10028403 | Ga0105246_100284032 | 452 |
| 500 | 3300014497 | Ga0182008_10005025 | Ga0182008_100050256 | 452 |
| 501 | 3300015262 | Ga0182007_10002937 | Ga0182007_100029374 | 452 |
| 502 | 3300026121 | Ga0207683_10015323 | Ga0207683_100153235 | 452 |
| 503 | 3300027866 | Ga0209813_10012039 | Ga0209813_100120393 | 452 |
| 504 | 3300031727 | Ga0316576_10020117 | Ga0316576_100201172 | 452 |
| 505 | 3300031730 | Ga0307516_10042121 | Ga0307516_100421213 | 452 |
| 506 | 3300031838 | Ga0307518_10063752 | Ga0307518_100637522 | 452 |
| 507 | 3300041460 | Ga0451802_0529070 | Ga0451802_0529070_84_1487 | 452 |
| 508 | 3300042005 | Ga0439448_0005660 | Ga0439448_0005660_1730_3148 | 452 |
| 509 | 3300042012 | Ga0439455_0000305 | Ga0439455_0000305_646_2064 | 452 |
| 510 | 3300042138 | Ga0450903_000229 | Ga0450903_000229_7330_8748 | 452 |
| 511 | 3300042435 | Ga0439434_0015845 | Ga0439434_0015845_169_1566 | 452 |
| 512 | 3300044693 | Ga0466961_0091927 | Ga0466961_0091927_273_1676 | 452 |
| 513 | 3300044694 | Ga0466963_0068581 | Ga0466963_0068581_67_1482 | 452 |
| 514 | 3300044842 | Ga0466957_0073034 | Ga0466957_0073034_386_1786 | 452 |
| 515 | 3300045976 | Ga0466967_0007989 | Ga0466967_0007989_3135_4538 | 452 |
| 516 | 3300045976 | Ga0466967_0021403 | Ga0466967_0021403_251_1654 | 452 |
| 517 | 3300049571 | Ga0501034_0278588 | Ga0501034_0278588_55_1464 | 452 |
| 518 | 3300049575 | Ga0501039_0027741 | Ga0501039_0027741_1159_2586 | 452 |
| 519 | 3300049576 | Ga0501040_0039961 | Ga0501040_0039961_1514_2941 | 452 |
| 520 | 3300049585 | Ga0501069_0009224 | Ga0501069_0009224_1265_2656 | 452 |
| 521 | 3300049586 | Ga0501070_0003761 | Ga0501070_0003761_2530_3921 | 452 |
| 522 | 3300049586 | Ga0501070_0055646 | Ga0501070_0055646_1256_2665 | 452 |
| 523 | 3300049591 | Ga0501075_0043315 | Ga0501075_0043315_1206_2633 | 452 |
| 524 | 3300049824 | Ga0501045_0090021 | Ga0501045_0090021_279_1706 | 452 |
| 525 | 3300050494 | nmdc:mga06z11_7724_c1 | nmdc:mga06z11_7724_c1_1680_3098 | 452 |
| 526 | 3300050495 | nmdc:mga04h51_3779_c1 | nmdc:mga04h51_3779_c1_717_2135 | 452 |
| 527 | 3300050507 | nmdc:mga05p37_44482_c1 | nmdc:mga05p37_44482_c1_1454_2887 | 452 |
| 528 | 3300054114 | Ga0501084_0115744 | Ga0501084_0115744_391_1818 | 452 |
| 529 | 3300060353 | Ga0501082_0013740 | Ga0501082_0013740_824_2251 | 452 |
| 530 | 3300061734 | Ga0530510_0000395 | Ga0530510_0000395_1682_3109 | 452 |
| 531 | iso_pu_bacteria | 2582581313 | 2585307817 | 452 |
| 532 | iso_pu_bacteria | 2786546132 | 2786672955 | 452 |
| 533 | iso_pu_bacteria | 2808606375 | 2808913922 | 452 |
| 534 | iso_pu_bacteria | 2877676314 | 2877678739 | 452 |
| 535 | iso_pu_bacteria | 2954380949 | 2954383710 | 452 |
| 536 | iso_pu_bacteria | 2954673503 | 2954679263 | 452 |
| 537 | iso_pu_bacteria | 2954682443 | 2954684891 | 452 |
| 538 | iso_pu_bacteria | 2954711539 | 2954714002 | 452 |
| 539 | iso_pu_bacteria | 2954721474 | 2954723971 | 452 |
| 540 | iso_pu_bacteria | 2954731030 | 2954737869 | 452 |
| 541 | iso_pu_bacteria | 2954740390 | 2954742868 | 452 |
| 542 | iso_pu_bacteria | 2954749733 | 2954756721 | 452 |
| 543 | iso_pu_bacteria | 2954759201 | 2954761825 | 452 |
| 544 | 3300005985 | Ga0081539_10012226 | Ga0081539_100122262 | 453 |
| 545 | 3300031616 | Ga0307508_10086669 | Ga0307508_100866693 | 453 |
| 546 | 3300031727 | Ga0316576_10000264 | Ga0316576_1000026413 | 453 |
| 547 | 3300031727 | Ga0316576_10008273 | Ga0316576_100082734 | 453 |
| 548 | 3300031727 | Ga0316576_10048948 | Ga0316576_100489482 | 453 |
| 549 | 3300031728 | Ga0316578_10010547 | Ga0316578_100105472 | 453 |
| 550 | 3300033180 | Ga0307510_10108404 | Ga0307510_101084042 | 453 |
| 551 | 3300035398 | Ga0316574_0001253 | Ga0316574_0001253_8872_10287 | 453 |
| 552 | 3300036712 | Ga0316584_0077304 | Ga0316584_0077304_1008_2423 | 453 |
| 553 | 3300037588 | Ga0316581_0000584 | Ga0316581_0000584_112_1518 | 453 |
| 554 | 3300044656 | Ga0466969_0000475 | Ga0466969_0000475_18948_20345 | 453 |
| 555 | 3300044693 | Ga0466961_0001332 | Ga0466961_0001332_638_2035 | 453 |
| 556 | 3300044719 | Ga0466971_0000060 | Ga0466971_0000060_13879_15276 | 453 |
| 557 | 3300045049 | Ga0466959_0000813 | Ga0466959_0000813_3831_5228 | 453 |
| 558 | 3300045836 | Ga0466958_0073054 | Ga0466958_0073054_477_1874 | 453 |
| 559 | 3300046462 | Ga0495651_0011792 | Ga0495651_0011792_1901_3298 | 453 |
| 560 | 3300046514 | Ga0495618_0016281 | Ga0495618_0016281_1979_3376 | 453 |
| 561 | 3300046516 | Ga0495628_0008618 | Ga0495628_0008618_166_1563 | 453 |
| 562 | 3300046529 | Ga0495652_0000965 | Ga0495652_0000965_29459_30856 | 453 |
| 563 | 3300046536 | Ga0495587_0111290 | Ga0495587_0111290_21_1418 | 453 |
| 564 | 3300046642 | Ga0495634_0097863 | Ga0495634_0097863_75_1472 | 453 |
| 565 | 3300046663 | Ga0495635_0014829 | Ga0495635_0014829_2567_3964 | 453 |
| 566 | 3300046679 | Ga0495623_0006440 | Ga0495623_0006440_5388_6785 | 453 |
| 567 | 3300048905 | Ga0496102_0019642 | Ga0496102_0019642_4231_5778 | 453 |
| 568 | 3300048906 | Ga0496103_0014072 | Ga0496103_0014072_2349_3896 | 453 |
| 569 | 3300048922 | Ga0496119_0015245 | Ga0496119_0015245_386_1798 | 453 |
| 570 | 3300048924 | Ga0496121_0023239 | Ga0496121_0023239_3531_4943 | 453 |
| 571 | 3300049569 | Ga0501032_0036294 | Ga0501032_0036294_1888_3285 | 453 |
| 572 | 3300049569 | Ga0501032_0041715 | Ga0501032_0041715_1072_2472 | 453 |
| 573 | 3300049569 | Ga0501032_0047481 | Ga0501032_0047481_596_1996 | 453 |
| 574 | 3300049571 | Ga0501034_0016676 | Ga0501034_0016676_5535_6935 | 453 |
| 575 | 3300049572 | Ga0501036_0016970 | Ga0501036_0016970_500_1897 | 453 |
| 576 | 3300049574 | Ga0501038_0020677 | Ga0501038_0020677_4450_5847 | 453 |
| 577 | 3300049579 | Ga0501043_0173853 | Ga0501043_0173853_158_1558 | 453 |
| 578 | 3300049581 | Ga0501047_0045335 | Ga0501047_0045335_782_2194 | 453 |
| 579 | 3300049581 | Ga0501047_0045823 | Ga0501047_0045823_2236_3636 | 453 |
| 580 | 3300049581 | Ga0501047_0064830 | Ga0501047_0064830_1865_3262 | 453 |
| 581 | 3300049586 | Ga0501070_0133458 | Ga0501070_0133458_470_1870 | 453 |
| 582 | 3300049822 | Ga0501035_0011659 | Ga0501035_0011659_827_2227 | 453 |
| 583 | 3300049822 | Ga0501035_0023132 | Ga0501035_0023132_1761_3158 | 453 |
| 584 | 3300049823 | Ga0501044_0048318 | Ga0501044_0048318_644_2044 | 453 |
| 585 | 3300053077 | Ga0495601_0136269 | Ga0495601_0136269_97_1494 | 453 |
| 586 | 3300003316 | rootH1_10007774 | rootH1_100077743 | 454 |
| 587 | 3300006038 | Ga0075365_10017264 | Ga0075365_100172642 | 454 |
| 588 | 3300006353 | Ga0075370_10012794 | Ga0075370_100127943 | 454 |
| 589 | 3300009011 | Ga0105251_10005290 | Ga0105251_100052902 | 454 |
| 590 | 3300013104 | Ga0157370_10000171 | Ga0157370_1000017148 | 454 |
| 591 | 3300015688 | Ga0183367_1013 | Ga0183367_101358 | 454 |
| 592 | 3300025297 | Ga0209758_1004580 | Ga0209758_10045804 | 454 |
| 593 | 3300025928 | Ga0207700_10073395 | Ga0207700_100733952 | 454 |
| 594 | 3300028786 | Ga0307517_10027373 | Ga0307517_100273731 | 454 |
| 595 | 3300028794 | Ga0307515_10004249 | Ga0307515_100042497 | 454 |
| 596 | 3300028794 | Ga0307515_10044960 | Ga0307515_100449602 | 454 |
| 597 | 3300030521 | Ga0307511_10000330 | Ga0307511_100003307 | 454 |
| 598 | 3300030522 | Ga0307512_10007323 | Ga0307512_100073235 | 454 |
| 599 | 3300031456 | Ga0307513_10082868 | Ga0307513_100828683 | 454 |
| 600 | 3300031507 | Ga0307509_10046494 | Ga0307509_100464944 | 454 |
| 601 | 3300031507 | Ga0307509_10188592 | Ga0307509_101885922 | 454 |
| 602 | 3300031507 | Ga0307509_10205063 | Ga0307509_102050632 | 454 |
| 603 | 3300031616 | Ga0307508_10010192 | Ga0307508_100101925 | 454 |
| 604 | 3300031616 | Ga0307508_10019315 | Ga0307508_100193155 | 454 |
| 605 | 3300031730 | Ga0307516_10084360 | Ga0307516_100843602 | 454 |
| 606 | 3300031838 | Ga0307518_10022320 | Ga0307518_100223203 | 454 |
| 607 | 3300033179 | Ga0307507_10115964 | Ga0307507_101159642 | 454 |
| 608 | 3300037068 | Ga0373925_0059805 | Ga0373925_0059805_910_2328 | 454 |
| 609 | 3300037466 | Ga0395898_0004392 | Ga0395898_0004392_5210_6625 | 454 |
| 610 | 3300038443 | Ga0395901_0160114 | Ga0395901_0160114_299_1714 | 454 |
| 611 | 3300041404 | Ga0439436_0000788 | Ga0439436_0000788_1827_3263 | 454 |
| 612 | 3300041404 | Ga0439436_0003768 | Ga0439436_0003768_35_1438 | 454 |
| 613 | 3300041406 | Ga0439439_0020440 | Ga0439439_0020440_166_1569 | 454 |
| 614 | 3300041512 | Ga0451853_1775253 | Ga0451853_1775253_2200_3618 | 454 |
| 615 | 3300042007 | Ga0439449_0001531 | Ga0439449_0001531_771_2189 | 454 |
| 616 | 3300042007 | Ga0439449_0028057 | Ga0439449_0028057_104_1507 | 454 |
| 617 | 3300042014 | Ga0439457_000044 | Ga0439457_000044_899_2335 | 454 |
| 618 | 3300042131 | Ga0450894_000003 | Ga0450894_000003_35702_37120 | 454 |
| 619 | 3300042145 | Ga0450906_001123 | Ga0450906_001123_3590_5008 | 454 |
| 620 | 3300042184 | Ga0450908_005429 | Ga0450908_005429_371_1774 | 454 |
| 621 | 3300044658 | Ga0466972_0009062 | Ga0466972_0009062_1345_2763 | 454 |
| 622 | 3300044658 | Ga0466972_0009560 | Ga0466972_0009560_2152_3555 | 454 |
| 623 | 3300044683 | Ga0466965_0002364 | Ga0466965_0002364_6195_7697 | 454 |
| 624 | 3300044683 | Ga0466965_0012254 | Ga0466965_0012254_276_1679 | 454 |
| 625 | 3300044684 | Ga0466966_0002355 | Ga0466966_0002355_6189_7592 | 454 |
| 626 | 3300044693 | Ga0466961_0009491 | Ga0466961_0009491_2326_3729 | 454 |
| 627 | 3300044693 | Ga0466961_0046527 | Ga0466961_0046527_503_1921 | 454 |
| 628 | 3300044693 | Ga0466961_0091126 | Ga0466961_0091126_370_1788 | 454 |
| 629 | 3300044694 | Ga0466963_0000405 | Ga0466963_0000405_8086_9489 | 454 |
| 630 | 3300044694 | Ga0466963_0001645 | Ga0466963_0001645_5877_7271 | 454 |
| 631 | 3300044706 | Ga0466964_0026381 | Ga0466964_0026381_633_2036 | 454 |
| 632 | 3300044765 | Ga0466970_0004138 | Ga0466970_0004138_5159_6562 | 454 |
| 633 | 3300044842 | Ga0466957_0001317 | Ga0466957_0001317_11043_12446 | 454 |
| 634 | 3300045049 | Ga0466959_0017438 | Ga0466959_0017438_2326_3729 | 454 |
| 635 | 3300045836 | Ga0466958_0016893 | Ga0466958_0016893_2224_3627 | 454 |
| 636 | 3300045976 | Ga0466967_0002585 | Ga0466967_0002585_2042_3448 | 454 |
| 637 | 3300045976 | Ga0466967_0003148 | Ga0466967_0003148_1440_2843 | 454 |
| 638 | 3300046452 | Ga0495617_021645 | Ga0495617_021645_273_1676 | 454 |
| 639 | 3300046454 | Ga0495592_0012929 | Ga0495592_0012929_345_1748 | 454 |
| 640 | 3300046455 | Ga0495603_0004681 | Ga0495603_0004681_1758_3170 | 454 |
| 641 | 3300046455 | Ga0495603_0013191 | Ga0495603_0013191_1761_3164 | 454 |
| 642 | 3300046459 | Ga0495629_0019294 | Ga0495629_0019294_3148_4575 | 454 |
| 643 | 3300046459 | Ga0495629_0080656 | Ga0495629_0080656_301_1713 | 454 |
| 644 | 3300046462 | Ga0495651_0080641 | Ga0495651_0080641_10_1413 | 454 |
| 645 | 3300046474 | Ga0495605_0010916 | Ga0495605_0010916_2331_3734 | 454 |
| 646 | 3300046475 | Ga0495639_0005669 | Ga0495639_0005669_2418_3830 | 454 |
| 647 | 3300046476 | Ga0495662_0002015 | Ga0495662_0002015_493_1905 | 454 |
| 648 | 3300046492 | Ga0495585_0049233 | Ga0495585_0049233_375_1775 | 454 |
| 649 | 3300046499 | Ga0495594_0031376 | Ga0495594_0031376_1429_2856 | 454 |
| 650 | 3300046499 | Ga0495594_0061360 | Ga0495594_0061360_615_2018 | 454 |
| 651 | 3300046499 | Ga0495594_0102994 | Ga0495594_0102994_55_1467 | 454 |
| 652 | 3300046501 | Ga0495607_0027885 | Ga0495607_0027885_599_2002 | 454 |
| 653 | 3300046507 | Ga0495606_0005398 | Ga0495606_0005398_3175_4578 | 454 |
| 654 | 3300046512 | Ga0495610_0048360 | Ga0495610_0048360_473_1876 | 454 |
| 655 | 3300046513 | Ga0495616_0005334 | Ga0495616_0005334_4595_5998 | 454 |
| 656 | 3300046515 | Ga0495620_0033191 | Ga0495620_0033191_932_2335 | 454 |
| 657 | 3300046518 | Ga0495631_0003400 | Ga0495631_0003400_4730_6133 | 454 |
| 658 | 3300046522 | Ga0495643_0001191 | Ga0495643_0001191_367_1770 | 454 |
| 659 | 3300046524 | Ga0495648_0047063 | Ga0495648_0047063_354_1757 | 454 |
| 660 | 3300046526 | Ga0495666_0052924 | Ga0495666_0052924_97_1500 | 454 |
| 661 | 3300046528 | Ga0495642_0047542 | Ga0495642_0047542_138_1541 | 454 |
| 662 | 3300046529 | Ga0495652_0041521 | Ga0495652_0041521_2103_3506 | 454 |
| 663 | 3300046533 | Ga0495640_0011728 | Ga0495640_0011728_3380_4798 | 454 |
| 664 | 3300046538 | Ga0495609_0012936 | Ga0495609_0012936_529_1932 | 454 |
| 665 | 3300046543 | Ga0495645_0039887 | Ga0495645_0039887_605_2017 | 454 |
| 666 | 3300046557 | Ga0495622_0004423 | Ga0495622_0004423_4887_6290 | 454 |
| 667 | 3300046557 | Ga0495622_0046644 | Ga0495622_0046644_493_1905 | 454 |
| 668 | 3300046616 | Ga0495668_0061970 | Ga0495668_0061970_345_1772 | 454 |
| 669 | 3300046674 | Ga0495588_0059456 | Ga0495588_0059456_562_1962 | 454 |
| 670 | 3300046679 | Ga0495623_0071397 | Ga0495623_0071397_470_1873 | 454 |
| 671 | 3300046689 | Ga0495613_0057350 | Ga0495613_0057350_1220_2623 | 454 |
| 672 | 3300046691 | Ga0495670_0022508 | Ga0495670_0022508_1490_2917 | 454 |
| 673 | 3300046692 | Ga0495671_0009137 | Ga0495671_0009137_2948_4375 | 454 |
| 674 | 3300046794 | Ga0495589_0009299 | Ga0495589_0009299_874_2301 | 454 |
| 675 | 3300046794 | Ga0495589_0021953 | Ga0495589_0021953_393_1796 | 454 |
| 676 | 3300047315 | Ga0495581_0040241 | Ga0495581_0040241_537_1949 | 454 |
| 677 | 3300047318 | Ga0495636_0053621 | Ga0495636_0053621_188_1588 | 454 |
| 678 | 3300047319 | Ga0495674_0002467 | Ga0495674_0002467_16563_17981 | 454 |
| 679 | 3300047321 | Ga0495676_0024766 | Ga0495676_0024766_2024_3427 | 454 |
| 680 | 3300047322 | Ga0495680_0059882 | Ga0495680_0059882_1108_2511 | 454 |
| 681 | 3300047443 | Ga0495687_001298 | Ga0495687_001298_530_1942 | 454 |
| 682 | 3300047443 | Ga0495687_002153 | Ga0495687_002153_3994_5397 | 454 |
| 683 | 3300047445 | Ga0495677_0021634 | Ga0495677_0021634_159_1562 | 454 |
| 684 | 3300047447 | Ga0495685_002436 | Ga0495685_002436_2634_4061 | 454 |
| 685 | 3300047447 | Ga0495685_005907 | Ga0495685_005907_2330_3733 | 454 |
| 686 | 3300047470 | Ga0495681_0001153 | Ga0495681_0001153_12114_13541 | 454 |
| 687 | 3300048907 | Ga0496104_0183021 | Ga0496104_0183021_320_1732 | 454 |
| 688 | 3300048912 | Ga0496109_0012931 | Ga0496109_0012931_3326_4738 | 454 |
| 689 | 3300048917 | Ga0496114_0089399 | Ga0496114_0089399_438_1835 | 454 |
| 690 | 3300048927 | Ga0496124_0046311 | Ga0496124_0046311_1904_3289 | 454 |
| 691 | 3300048929 | Ga0496126_0239479 | Ga0496126_0239479_33_1505 | 454 |
| 692 | 3300049459 | Ga0495678_031661 | Ga0495678_031661_335_1738 | 454 |
| 693 | 3300049570 | Ga0501033_0090358 | Ga0501033_0090358_234_1652 | 454 |
| 694 | 3300049571 | Ga0501034_0015605 | Ga0501034_0015605_5357_6775 | 454 |
| 695 | 3300049571 | Ga0501034_0046905 | Ga0501034_0046905_2852_4270 | 454 |
| 696 | 3300049572 | Ga0501036_0000189 | Ga0501036_0000189_17406_18824 | 454 |
| 697 | 3300049573 | Ga0501037_0102896 | Ga0501037_0102896_262_1665 | 454 |
| 698 | 3300049574 | Ga0501038_0009078 | Ga0501038_0009078_5434_6852 | 454 |
| 699 | 3300049574 | Ga0501038_0013067 | Ga0501038_0013067_6094_7512 | 454 |
| 700 | 3300049575 | Ga0501039_0065721 | Ga0501039_0065721_309_1727 | 454 |
| 701 | 3300049579 | Ga0501043_0000373 | Ga0501043_0000373_8893_10311 | 454 |
| 702 | 3300049580 | Ga0501046_0123638 | Ga0501046_0123638_227_1660 | 454 |
| 703 | 3300049581 | Ga0501047_0075166 | Ga0501047_0075166_1366_2769 | 454 |
| 704 | 3300049589 | Ga0501073_0148866 | Ga0501073_0148866_164_1567 | 454 |
| 705 | 3300049590 | Ga0501074_0003673 | Ga0501074_0003673_5780_7198 | 454 |
| 706 | 3300049822 | Ga0501035_0000934 | Ga0501035_0000934_22085_23503 | 454 |
| 707 | 3300049822 | Ga0501035_0116871 | Ga0501035_0116871_288_1691 | 454 |
| 708 | 3300049823 | Ga0501044_0134122 | Ga0501044_0134122_457_1860 | 454 |
| 709 | 3300050496 | nmdc:mga07m45_31724_c1 | nmdc:mga07m45_31724_c1_1464_2891 | 454 |
| 710 | 3300053077 | Ga0495601_0022490 | Ga0495601_0022490_234_1652 | 454 |
| 711 | 3300053107 | Ga0500560_001395 | Ga0500560_001395_543_1970 | 454 |
| 712 | 3300061719 | Ga0466962_0001787 | Ga0466962_0001787_5876_7279 | 454 |
| 713 | 3300061719 | Ga0466962_0059192 | Ga0466962_0059192_64_1494 | 454 |
| 714 | iso_pu_bacteria | 2511231012 | 2511302709 | 454 |
| 715 | iso_pu_bacteria | 2511231014 | 2511314100 | 454 |
| 716 | iso_pu_bacteria | 2511231020 | 2511350176 | 454 |
| 717 | iso_pu_bacteria | 2547132111 | 2547410609 | 454 |
| 718 | iso_pu_bacteria | 2554235005 | 2554255987 | 454 |
| 719 | iso_pu_bacteria | 2582581314 | 2585316795 | 454 |
| 720 | iso_pu_bacteria | 2616644814 | 2616700080 | 454 |
| 721 | iso_pu_bacteria | 2643221589 | 2643956723 | 454 |
| 722 | iso_pu_bacteria | 2643221602 | 2644021946 | 454 |
| 723 | iso_pu_bacteria | 2643221678 | 2644437733 | 454 |
| 724 | iso_pu_bacteria | 2643221714 | 2644629879 | 454 |
| 725 | iso_pu_bacteria | 2738543020 | 2739287541 | 454 |
| 726 | iso_pu_bacteria | 2738543021 | 2739292854 | 454 |
| 727 | iso_pu_bacteria | 2784132148 | 2784590672 | 454 |
| 728 | iso_pu_bacteria | 2784746763 | 2785340910 | 454 |
| 729 | iso_pu_bacteria | 2802429296 | 2804848204 | 454 |
| 730 | iso_pu_bacteria | 2808606359 | 2808844344 | 454 |
| 731 | iso_pu_bacteria | 2808606382 | 2808960633 | 454 |
| 732 | iso_pu_bacteria | 2808606385 | 2808979314 | 454 |
| 733 | iso_pu_bacteria | 2808606388 | 2808995238 | 454 |
| 734 | iso_pu_bacteria | 2808606448 | 2809234360 | 454 |
| 735 | iso_pu_bacteria | 2811994879 | 2812355648 | 454 |
| 736 | iso_pu_bacteria | 2811994917 | 2812478489 | 454 |
| 737 | iso_pu_bacteria | 2818991463 | 2819698914 | 454 |
| 738 | iso_pu_bacteria | 2842805378 | 2842805949 | 454 |
| 739 | iso_pu_bacteria | 2852612431 | 2852618319 | 454 |
| 740 | iso_pu_bacteria | 2852635781 | 2852639757 | 454 |
| 741 | iso_pu_bacteria | 2852667396 | 2852673545 | 454 |
| 742 | iso_pu_bacteria | 2862281513 | 2862284302 | 454 |
| 743 | iso_pu_bacteria | 2862382967 | 2862388853 | 454 |
| 744 | iso_pu_bacteria | 2862574272 | 2862577193 | 454 |
| 745 | iso_pu_bacteria | 2863404153 | 2863408935 | 454 |
| 746 | iso_pu_bacteria | 2873151551 | 2873153785 | 454 |
| 747 | iso_pu_bacteria | 2904550169 | 2904552089 | 454 |
| 748 | iso_pu_bacteria | 2912715099 | 2912717306 | 454 |
| 749 | iso_pu_bacteria | 2919468124 | 2919472530 | 454 |
| 750 | iso_pu_bacteria | 2939636861 | 2939640021 | 454 |
| 751 | iso_pu_bacteria | 2946064051 | 2946070142 | 454 |
| 752 | iso_pu_bacteria | 2946072368 | 2946078021 | 454 |
| 753 | iso_pu_bacteria | 2947224130 | 2947226651 | 454 |
| 754 | iso_pu_bacteria | 2954002825 | 2954005830 | 454 |
| 755 | iso_pu_bacteria | 2966598605 | 2966600573 | 454 |
| 756 | iso_pu_bacteria | 2990059506 | 2990062420 | 454 |
| 757 | iso_pu_bacteria | 3006393351 | 3006397950 | 454 |
| 758 | iso_pu_bacteria | 3006493962 | 3006500002 | 454 |
| 759 | iso_pu_bacteria | 8008558824 | 8008563094 | 454 |
| 760 | iso_pu_bacteria | 8008574985 | 8008576860 | 454 |
| 761 | iso_pu_bacteria | 8023623736 | 8023625680 | 454 |
| 762 | iso_pu_bacteria | 8025413630 | 8025414242 | 454 |
| 763 | iso_pu_bacteria | 8048406513 | 8048409823 | 454 |
| 764 | iso_pu_bacteria | 8056125926 | 8056129505 | 454 |
| 765 | iso_pu_bacteria | 8056829672 | 8056831624 | 454 |
| 766 | 3300005329 | Ga0070683_100001804 | Ga0070683_1000018047 | 455 |
| 767 | 3300005340 | Ga0070689_100045036 | Ga0070689_1000450363 | 455 |
| 768 | 3300005366 | Ga0070659_100090172 | Ga0070659_1000901721 | 455 |
| 769 | 3300005441 | Ga0070700_100005709 | Ga0070700_1000057096 | 455 |
| 770 | 3300005535 | Ga0070684_100010212 | Ga0070684_1000102127 | 455 |
| 771 | 3300005543 | Ga0070672_100012120 | Ga0070672_1000121205 | 455 |
| 772 | 3300005563 | Ga0068855_100264310 | Ga0068855_1002643102 | 455 |
| 773 | 3300005577 | Ga0068857_100001615 | Ga0068857_10000161510 | 455 |
| 774 | 3300009093 | Ga0105240_10097074 | Ga0105240_100970743 | 455 |
| 775 | 3300009094 | Ga0111539_10045910 | Ga0111539_100459105 | 455 |
| 776 | 3300009098 | Ga0105245_10051117 | Ga0105245_100511172 | 455 |
| 777 | 3300009147 | Ga0114129_10203705 | Ga0114129_102037052 | 455 |
| 778 | 3300009174 | Ga0105241_10016538 | Ga0105241_100165384 | 455 |
| 779 | 3300009545 | Ga0105237_10028680 | Ga0105237_100286805 | 455 |
| 780 | 3300009553 | Ga0105249_10061989 | Ga0105249_100619893 | 455 |
| 781 | 3300009553 | Ga0105249_10119646 | Ga0105249_101196463 | 455 |
| 782 | 3300010375 | Ga0105239_10221035 | Ga0105239_102210352 | 455 |
| 783 | 3300025913 | Ga0207695_10161214 | Ga0207695_101612142 | 455 |
| 784 | 3300025927 | Ga0207687_10036767 | Ga0207687_100367673 | 455 |
| 785 | 3300025936 | Ga0207670_10057461 | Ga0207670_100574613 | 455 |
| 786 | 3300025944 | Ga0207661_10009900 | Ga0207661_100099004 | 455 |
| 787 | 3300025949 | Ga0207667_10042075 | Ga0207667_100420752 | 455 |
| 788 | 3300025961 | Ga0207712_10027414 | Ga0207712_100274142 | 455 |
| 789 | 3300026075 | Ga0207708_10002698 | Ga0207708_100026984 | 455 |
| 790 | 3300026075 | Ga0207708_10020860 | Ga0207708_100208602 | 455 |
| 791 | 3300026116 | Ga0207674_10003543 | Ga0207674_1000354317 | 455 |
| 792 | 3300026142 | Ga0207698_10117615 | Ga0207698_101176152 | 455 |
| 793 | 3300027907 | Ga0207428_10021554 | Ga0207428_100215542 | 455 |
| 794 | 3300031727 | Ga0316576_10028397 | Ga0316576_100283972 | 455 |
| 795 | 3300035086 | Ga0373934_0057165 | Ga0373934_0057165_12_1454 | 455 |
| 796 | 3300035172 | Ga0373955_0043032 | Ga0373955_0043032_500_1924 | 455 |
| 797 | 3300036401 | Ga0373937_0076053 | Ga0373937_0076053_295_1719 | 455 |
| 798 | 3300037068 | Ga0373925_0007744 | Ga0373925_0007744_6234_7658 | 455 |
| 799 | 3300044706 | Ga0466964_0021468 | Ga0466964_0021468_534_1931 | 455 |
| 800 | 3300044765 | Ga0466970_0033609 | Ga0466970_0033609_987_2399 | 455 |
| 801 | 3300046455 | Ga0495603_0010086 | Ga0495603_0010086_752_2158 | 455 |
| 802 | 3300046511 | Ga0495608_0000285 | Ga0495608_0000285_17319_18743 | 455 |
| 803 | 3300046516 | Ga0495628_0014784 | Ga0495628_0014784_2394_3818 | 455 |
| 804 | 3300046522 | Ga0495643_0001671 | Ga0495643_0001671_445_1833 | 455 |
| 805 | 3300046529 | Ga0495652_0001447 | Ga0495652_0001447_12167_13591 | 455 |
| 806 | 3300046531 | Ga0495665_0004737 | Ga0495665_0004737_4064_5470 | 455 |
| 807 | 3300046533 | Ga0495640_0051661 | Ga0495640_0051661_143_1567 | 455 |
| 808 | 3300046543 | Ga0495645_0097618 | Ga0495645_0097618_366_1793 | 455 |
| 809 | 3300046559 | Ga0495667_0000323 | Ga0495667_0000323_16190_17614 | 455 |
| 810 | 3300046663 | Ga0495635_0001065 | Ga0495635_0001065_4104_5528 | 455 |
| 811 | 3300046675 | Ga0495657_0000950 | Ga0495657_0000950_18403_19827 | 455 |
| 812 | 3300046678 | Ga0495599_0007717 | Ga0495599_0007717_62_1486 | 455 |
| 813 | 3300046694 | Ga0495649_0012409 | Ga0495649_0012409_3210_4598 | 455 |
| 814 | 3300046809 | Ga0495600_0002680 | Ga0495600_0002680_2989_4413 | 455 |
| 815 | 3300047315 | Ga0495581_0022343 | Ga0495581_0022343_2078_3484 | 455 |
| 816 | 3300047317 | Ga0495604_0002820 | Ga0495604_0002820_8167_9591 | 455 |
| 817 | 3300047322 | Ga0495680_0003938 | Ga0495680_0003938_225_1649 | 455 |
| 818 | 3300048905 | Ga0496102_0031270 | Ga0496102_0031270_479_1879 | 455 |
| 819 | 3300048922 | Ga0496119_0000055 | Ga0496119_0000055_58515_59912 | 455 |
| 820 | 3300048923 | Ga0496120_0035633 | Ga0496120_0035633_811_2208 | 455 |
| 821 | 3300050492 | nmdc:mga0yw44_4806_c1 | nmdc:mga0yw44_4806_c1_4691_6097 | 455 |
| 822 | 3300050507 | nmdc:mga05p37_187626_c1 | nmdc:mga05p37_187626_c1_275_1687 | 455 |
| 823 | 3300050511 | nmdc:mga08y16_12302_c1 | nmdc:mga08y16_12302_c1_4128_5534 | 455 |
| 824 | 3300005341 | Ga0070691_10046653 | Ga0070691_100466531 | 456 |
| 825 | 3300005367 | Ga0070667_100004625 | Ga0070667_1000046253 | 456 |
| 826 | 3300005548 | Ga0070665_100005781 | Ga0070665_1000057812 | 456 |
| 827 | 3300009098 | Ga0105245_10080823 | Ga0105245_100808233 | 456 |
| 828 | 3300014325 | Ga0163163_10168250 | Ga0163163_101682502 | 456 |
| 829 | 3300025903 | Ga0207680_10001832 | Ga0207680_100018322 | 456 |
| 830 | 3300025905 | Ga0207685_10006028 | Ga0207685_100060282 | 456 |
| 831 | 3300025986 | Ga0207658_10005964 | Ga0207658_100059644 | 456 |
| 832 | 3300026075 | Ga0207708_10062163 | Ga0207708_100621632 | 456 |
| 833 | 3300028379 | Ga0268266_10000867 | Ga0268266_1000086725 | 456 |
| 834 | 3300036712 | Ga0316584_0065400 | Ga0316584_0065400_806_2236 | 456 |
| 835 | 3300041407 | Ga0439447_013272 | Ga0439447_013272_156_1550 | 456 |
| 836 | 3300041411 | Ga0439466_0004751 | Ga0439466_0004751_1925_3319 | 456 |
| 837 | 3300048905 | Ga0496102_0019597 | Ga0496102_0019597_4295_5698 | 456 |
| 838 | 3300048908 | Ga0496105_0042837 | Ga0496105_0042837_1536_2939 | 456 |
| 839 | 3300048913 | Ga0496110_0053821 | Ga0496110_0053821_53_1456 | 456 |
| 840 | 3300048914 | Ga0496111_0019438 | Ga0496111_0019438_1693_3096 | 456 |
| 841 | 3300048917 | Ga0496114_0041945 | Ga0496114_0041945_1650_3053 | 456 |
| 842 | 3300048927 | Ga0496124_0067892 | Ga0496124_0067892_104_1558 | 456 |
| 843 | 3300049568 | Ga0501031_0004230 | Ga0501031_0004230_7731_9182 | 456 |
| 844 | 3300049569 | Ga0501032_0000727 | Ga0501032_0000727_8831_10282 | 456 |
| 845 | 3300049570 | Ga0501033_0000159 | Ga0501033_0000159_54780_56231 | 456 |
| 846 | 3300049571 | Ga0501034_0002444 | Ga0501034_0002444_18728_20179 | 456 |
| 847 | 3300049572 | Ga0501036_0006157 | Ga0501036_0006157_8196_9647 | 456 |
| 848 | 3300049573 | Ga0501037_0000650 | Ga0501037_0000650_16574_18025 | 456 |
| 849 | 3300049574 | Ga0501038_0005789 | Ga0501038_0005789_2268_3719 | 456 |
| 850 | 3300049579 | Ga0501043_0001858 | Ga0501043_0001858_54_1505 | 456 |
| 851 | 3300049580 | Ga0501046_0001066 | Ga0501046_0001066_8807_10258 | 456 |
| 852 | 3300049581 | Ga0501047_0000716 | Ga0501047_0000716_33039_34490 | 456 |
| 853 | 3300049582 | Ga0501048_0001489 | Ga0501048_0001489_7788_9239 | 456 |
| 854 | 3300049586 | Ga0501070_0000131 | Ga0501070_0000131_57161_58612 | 456 |
| 855 | 3300049587 | Ga0501071_0070828 | Ga0501071_0070828_89_1504 | 456 |
| 856 | 3300049588 | Ga0501072_0090494 | Ga0501072_0090494_539_1954 | 456 |
| 857 | 3300049589 | Ga0501073_0010742 | Ga0501073_0010742_88_1539 | 456 |
| 858 | 3300049741 | Ga0501079_0036828 | Ga0501079_0036828_2244_3695 | 456 |
| 859 | 3300049742 | Ga0501080_0008643 | Ga0501080_0008643_48_1499 | 456 |
| 860 | 3300049744 | Ga0501083_0001155 | Ga0501083_0001155_7752_9203 | 456 |
| 861 | 3300049822 | Ga0501035_0000684 | Ga0501035_0000684_16622_18073 | 456 |
| 862 | 3300049823 | Ga0501044_0020131 | Ga0501044_0020131_505_1956 | 456 |
| 863 | 3300049824 | Ga0501045_0046651 | Ga0501045_0046651_41_1456 | 456 |
| 864 | 3300049824 | Ga0501045_0055757 | Ga0501045_0055757_1351_2802 | 456 |
| 865 | 3300054114 | Ga0501084_0231104 | Ga0501084_0231104_77_1528 | 456 |
| 866 | 3300060353 | Ga0501082_0012318 | Ga0501082_0012318_5883_7334 | 456 |
| 867 | 3300046453 | Ga0495627_000010 | Ga0495627_000010_211467_212861 | 457 |
| 868 | 2162886007 | SwRhRL2b_contig_2356726 | SwRhRL2b_0242.00001450 | 458 |
| 869 | 3300005289 | Ga0065704_10000402 | Ga0065704_1000040211 | 458 |
| 870 | 3300006051 | Ga0075364_10175155 | Ga0075364_101751551 | 458 |
| 871 | 3300006177 | Ga0075362_10035626 | Ga0075362_100356262 | 458 |
| 872 | 3300006914 | Ga0075436_100156674 | Ga0075436_1001566742 | 458 |
| 873 | 3300006946 | Ga0079104_1000142 | Ga0079104_100014251 | 458 |
| 874 | 3300009036 | Ga0105244_10035727 | Ga0105244_100357272 | 458 |
| 875 | 3300009092 | Ga0105250_10016941 | Ga0105250_100169412 | 458 |
| 876 | 3300009148 | Ga0105243_10153370 | Ga0105243_101533702 | 458 |
| 877 | 3300013100 | Ga0157373_10007299 | Ga0157373_100072994 | 458 |
| 878 | 3300013100 | Ga0157373_10145311 | Ga0157373_101453111 | 458 |
| 879 | 3300013104 | Ga0157370_10002106 | Ga0157370_1000210614 | 458 |
| 880 | 3300013306 | Ga0163162_10234050 | Ga0163162_102340502 | 458 |
| 881 | 3300014497 | Ga0182008_10041075 | Ga0182008_100410752 | 458 |
| 882 | 3300017792 | Ga0163161_10184772 | Ga0163161_101847721 | 458 |
| 883 | 3300025292 | Ga0209676_1002314 | Ga0209676_10023149 | 458 |
| 884 | 3300025303 | Ga0209051_1004589 | Ga0209051_10045896 | 458 |
| 885 | 3300025728 | Ga0207655_1017889 | Ga0207655_10178894 | 458 |
| 886 | 3300025735 | Ga0207713_1001010 | Ga0207713_100101017 | 458 |
| 887 | 3300025735 | Ga0207713_1009028 | Ga0207713_10090285 | 458 |
| 888 | 3300027111 | Ga0209281_1000262 | Ga0209281_100026254 | 458 |
| 889 | 3300027907 | Ga0207428_10049408 | Ga0207428_100494083 | 458 |
| 890 | 3300041405 | Ga0439438_001614 | Ga0439438_001614_3950_5347 | 458 |
| 891 | 3300041411 | Ga0439466_0005924 | Ga0439466_0005924_2093_3490 | 458 |
| 892 | 3300042006 | Ga0439432_005551 | Ga0439432_005551_2634_4031 | 458 |
| 893 | 3300042010 | Ga0439452_009596 | Ga0439452_009596_506_1903 | 458 |
| 894 | 3300042138 | Ga0450903_001641 | Ga0450903_001641_955_2352 | 458 |
| 895 | 3300042146 | Ga0450907_000306 | Ga0450907_000306_14573_15970 | 458 |
| 896 | 3300042184 | Ga0450908_000127 | Ga0450908_000127_13763_15160 | 458 |
| 897 | 3300046452 | Ga0495617_000964 | Ga0495617_000964_5408_6805 | 458 |
| 898 | 3300046452 | Ga0495617_001697 | Ga0495617_001697_3332_4729 | 458 |
| 899 | 3300046452 | Ga0495617_009443 | Ga0495617_009443_1550_2971 | 458 |
| 900 | 3300046453 | Ga0495627_005625 | Ga0495627_005625_1160_2581 | 458 |
| 901 | 3300046457 | Ga0495590_0016508 | Ga0495590_0016508_884_2281 | 458 |
| 902 | 3300046458 | Ga0495591_007604 | Ga0495591_007604_3006_4403 | 458 |
| 903 | 3300046458 | Ga0495591_021625 | Ga0495591_021625_643_2040 | 458 |
| 904 | 3300046460 | Ga0495638_0002134 | Ga0495638_0002134_13654_15075 | 458 |
| 905 | 3300046460 | Ga0495638_0013116 | Ga0495638_0013116_1258_2655 | 458 |
| 906 | 3300046460 | Ga0495638_0020491 | Ga0495638_0020491_2720_4117 | 458 |
| 907 | 3300046460 | Ga0495638_0062447 | Ga0495638_0062447_326_1723 | 458 |
| 908 | 3300046471 | Ga0495650_0001024 | Ga0495650_0001024_21249_22646 | 458 |
| 909 | 3300046471 | Ga0495650_0027295 | Ga0495650_0027295_487_1884 | 458 |
| 910 | 3300046474 | Ga0495605_0000631 | Ga0495605_0000631_23940_25337 | 458 |
| 911 | 3300046474 | Ga0495605_0005433 | Ga0495605_0005433_1982_3379 | 458 |
| 912 | 3300046474 | Ga0495605_0043040 | Ga0495605_0043040_471_1868 | 458 |
| 913 | 3300046475 | Ga0495639_0006950 | Ga0495639_0006950_2191_3612 | 458 |
| 914 | 3300046491 | Ga0495584_0004684 | Ga0495584_0004684_467_1864 | 458 |
| 915 | 3300046491 | Ga0495584_0011750 | Ga0495584_0011750_2562_3959 | 458 |
| 916 | 3300046491 | Ga0495584_0026117 | Ga0495584_0026117_1059_2456 | 458 |
| 917 | 3300046492 | Ga0495585_0001103 | Ga0495585_0001103_20050_21471 | 458 |
| 918 | 3300046492 | Ga0495585_0008010 | Ga0495585_0008010_2282_3679 | 458 |
| 919 | 3300046492 | Ga0495585_0040538 | Ga0495585_0040538_469_1866 | 458 |
| 920 | 3300046506 | Ga0495583_0001013 | Ga0495583_0001013_3936_5333 | 458 |
| 921 | 3300046507 | Ga0495606_0021936 | Ga0495606_0021936_1917_3314 | 458 |
| 922 | 3300046512 | Ga0495610_0029001 | Ga0495610_0029001_174_1571 | 458 |
| 923 | 3300046512 | Ga0495610_0077354 | Ga0495610_0077354_85_1482 | 458 |
| 924 | 3300046513 | Ga0495616_0004215 | Ga0495616_0004215_6244_7641 | 458 |
| 925 | 3300046515 | Ga0495620_0006554 | Ga0495620_0006554_2369_3766 | 458 |
| 926 | 3300046519 | Ga0495632_0001095 | Ga0495632_0001095_6154_7551 | 458 |
| 927 | 3300046520 | Ga0495637_0001115 | Ga0495637_0001115_11369_12766 | 458 |
| 928 | 3300046520 | Ga0495637_0008695 | Ga0495637_0008695_99_1496 | 458 |
| 929 | 3300046522 | Ga0495643_0073013 | Ga0495643_0073013_52_1449 | 458 |
| 930 | 3300046523 | Ga0495644_0011204 | Ga0495644_0011204_545_1942 | 458 |
| 931 | 3300046524 | Ga0495648_0000935 | Ga0495648_0000935_25908_27305 | 458 |
| 932 | 3300046524 | Ga0495648_0004862 | Ga0495648_0004862_6916_8313 | 458 |
| 933 | 3300046526 | Ga0495666_0042680 | Ga0495666_0042680_209_1606 | 458 |
| 934 | 3300046528 | Ga0495642_0000018 | Ga0495642_0000018_58228_59625 | 458 |
| 935 | 3300046528 | Ga0495642_0061679 | Ga0495642_0061679_75_1472 | 458 |
| 936 | 3300046530 | Ga0495654_0036482 | Ga0495654_0036482_916_2313 | 458 |
| 937 | 3300046530 | Ga0495654_0049169 | Ga0495654_0049169_54_1451 | 458 |
| 938 | 3300046538 | Ga0495609_0022460 | Ga0495609_0022460_203_1600 | 458 |
| 939 | 3300046542 | Ga0495597_0040425 | Ga0495597_0040425_465_1862 | 458 |
| 940 | 3300046542 | Ga0495597_0040958 | Ga0495597_0040958_648_2045 | 458 |
| 941 | 3300046615 | Ga0495656_0004404 | Ga0495656_0004404_1188_2585 | 458 |
| 942 | 3300046660 | Ga0495625_0007943 | Ga0495625_0007943_5875_7272 | 458 |
| 943 | 3300046660 | Ga0495625_0029829 | Ga0495625_0029829_2482_3903 | 458 |
| 944 | 3300046665 | Ga0495661_0013465 | Ga0495661_0013465_929_2326 | 458 |
| 945 | 3300046674 | Ga0495588_0026184 | Ga0495588_0026184_1011_2408 | 458 |
| 946 | 3300046679 | Ga0495623_0000754 | Ga0495623_0000754_14638_16035 | 458 |
| 947 | 3300046684 | Ga0495669_0000858 | Ga0495669_0000858_201_1598 | 458 |
| 948 | 3300046691 | Ga0495670_0000942 | Ga0495670_0000942_6176_7573 | 458 |
| 949 | 3300046691 | Ga0495670_0001398 | Ga0495670_0001398_1613_3034 | 458 |
| 950 | 3300046691 | Ga0495670_0013532 | Ga0495670_0013532_1436_2857 | 458 |
| 951 | 3300046691 | Ga0495670_0060219 | Ga0495670_0060219_141_1538 | 458 |
| 952 | 3300046692 | Ga0495671_0007991 | Ga0495671_0007991_2098_3495 | 458 |
| 953 | 3300046692 | Ga0495671_0022532 | Ga0495671_0022532_919_2316 | 458 |
| 954 | 3300046692 | Ga0495671_0030651 | Ga0495671_0030651_935_2356 | 458 |
| 955 | 3300046692 | Ga0495671_0063085 | Ga0495671_0063085_50_1447 | 458 |
| 956 | 3300046794 | Ga0495589_0000184 | Ga0495589_0000184_3317_4714 | 458 |
| 957 | 3300046810 | Ga0495660_0011625 | Ga0495660_0011625_398_1819 | 458 |
| 958 | 3300046810 | Ga0495660_0015806 | Ga0495660_0015806_2068_3465 | 458 |
| 959 | 3300046810 | Ga0495660_0080852 | Ga0495660_0080852_47_1444 | 458 |
| 960 | 3300046810 | Ga0495660_0099527 | Ga0495660_0099527_55_1452 | 458 |
| 961 | 3300047318 | Ga0495636_0074976 | Ga0495636_0074976_38_1435 | 458 |
| 962 | 3300047320 | Ga0495672_0007796 | Ga0495672_0007796_445_1866 | 458 |
| 963 | 3300047320 | Ga0495672_0012207 | Ga0495672_0012207_1423_2820 | 458 |
| 964 | 3300047322 | Ga0495680_0016873 | Ga0495680_0016873_2911_4308 | 458 |
| 965 | 3300047323 | Ga0495683_0000578 | Ga0495683_0000578_12021_13418 | 458 |
| 966 | 3300047443 | Ga0495687_000294 | Ga0495687_000294_56261_57658 | 458 |
| 967 | 3300047444 | Ga0495675_0001430 | Ga0495675_0001430_703_2100 | 458 |
| 968 | 3300047445 | Ga0495677_0000905 | Ga0495677_0000905_4386_5783 | 458 |
| 969 | 3300047446 | Ga0495679_003079 | Ga0495679_003079_2939_4336 | 458 |
| 970 | 3300047469 | Ga0495673_0000960 | Ga0495673_0000960_15264_16661 | 458 |
| 971 | 3300047469 | Ga0495673_0005727 | Ga0495673_0005727_3648_5045 | 458 |
| 972 | 3300047469 | Ga0495673_0007256 | Ga0495673_0007256_2671_4068 | 458 |
| 973 | 3300047469 | Ga0495673_0015550 | Ga0495673_0015550_2045_3442 | 458 |
| 974 | 3300047469 | Ga0495673_0019178 | Ga0495673_0019178_1264_2661 | 458 |
| 975 | 3300047470 | Ga0495681_0002427 | Ga0495681_0002427_3692_5089 | 458 |
| 976 | 3300047470 | Ga0495681_0003291 | Ga0495681_0003291_4915_6312 | 458 |
| 977 | 3300047471 | Ga0495684_0002639 | Ga0495684_0002639_12361_13758 | 458 |
| 978 | 3300047472 | Ga0495686_0011949 | Ga0495686_0011949_520_1917 | 458 |
| 979 | 3300047673 | Ga0495593_0000492 | Ga0495593_0000492_6730_8127 | 458 |
| 980 | 3300048091 | Ga0495626_0000079 | Ga0495626_0000079_59522_60919 | 458 |
| 981 | 3300048091 | Ga0495626_0000992 | Ga0495626_0000992_16058_17455 | 458 |
| 982 | 3300048091 | Ga0495626_0002392 | Ga0495626_0002392_965_2362 | 458 |
| 983 | 3300048091 | Ga0495626_0013719 | Ga0495626_0013719_1751_3148 | 458 |
| 984 | 3300048920 | Ga0496117_0038515 | Ga0496117_0038515_392_1789 | 458 |
| 985 | 3300048921 | Ga0496118_0027862 | Ga0496118_0027862_180_1577 | 458 |
| 986 | 3300048927 | Ga0496124_0022995 | Ga0496124_0022995_1611_3008 | 458 |
| 987 | 3300048928 | Ga0496125_0020034 | Ga0496125_0020034_4083_5504 | 458 |
| 988 | 3300049459 | Ga0495678_038980 | Ga0495678_038980_58_1455 | 458 |
| 989 | 3300049460 | Ga0495682_0001733 | Ga0495682_0001733_8851_10272 | 458 |
| 990 | 3300049460 | Ga0495682_0027900 | Ga0495682_0027900_655_2052 | 458 |
| 991 | 3300050489 | nmdc:mga03683_8957_c1 | nmdc:mga03683_8957_c1_2123_3520 | 458 |
| 992 | 3300050514 | nmdc:mga08x19_21515_c1 | nmdc:mga08x19_21515_c1_2501_3898 | 458 |
| 993 | 3300050516 | nmdc:mga0sz30_855_c2 | nmdc:mga0sz30_855_c2_2285_3682 | 458 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dzb-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from streptococcus thermophilus | 0.9338 | 39 | 70 |
| 3dzb-assembly1.cif.gz_B | crystal structure of prephenate dehydrogenase from streptococcus thermophilus | 0.9309 | 39 | 70 |
| 1guz-assembly1.cif.gz_C | structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases | 0.9146 | 39 | 70 |
| 3b1f-assembly1.cif.gz_A-2 | crystal structure of prephenate dehydrogenase from streptococcus mutans | 0.8959 | 37 | 71 |
| 3p7m-assembly1.cif.gz_C | structure of putative lactate dehydrogenase from francisella tularensis subsp. tularensis schu s4 | 0.8891 | 36 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VIP2_8_110_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9796 | 42 | 71 | 3.50.50.60 |
| 3iwaA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9443 | 39 | 68 | 3.50.50.60 |
| 1yqzB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9416 | 39 | 69 | 3.50.50.60 |
| 3c4aA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9341 | 39 | 71 | 3.50.50.60 |
| 3dzbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9338 | 39 | 70 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M4XDM1-F1-model_v4 | Glycine/D-amino acid oxidase | 0.9799 | 8 | 458 |
GO:0005737
|
| AF-A0A353KKS1-F1-model_v4 | deleted | 0.9692 | 154 | 458 |
|
| AF-A0A6J7DTI1-F1-model_v4 | Unannotated protein | 0.9682 | 5 | 458 |
GO:0005737
|
| AF-A0A7K1J0U6-F1-model_v4 | FAD-dependent oxidoreductase | 0.9663 | 1 | 393 |
GO:0005737
|
| AF-A0A124E1L2-F1-model_v4 | FAD dependent oxidoreductase | 0.9652 | 5 | 458 |
GO:0005737
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar