F487688

General Info

Members Datasets Scaffolds Average Seq Length
993 499 899 463

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0007972|Ga0316574_0007972_1994_3595
Length 533
Sequence LDEVFIAQICQFRFIQWLELQLVTGRVSQKGGILTSAGRPPDQDTGRVGYSRRIASRNSKKPVWPDTPPTESDRLSYAEAEPEPFWLSGPRPAVRSPLEGPAEADLVVVGGGLTGLWAAIQARQRDPGRAVVLIERRRLAIGASGRNGGFMSSSLVHGIGNGLARFPDEIPLLERLGLDNLAEIKRTIDEQAIACDLVSPGAIEIAYTEHQFAELAEVRDELERYGHQAELLDTEALRAEVASPLFCGGLWQKTGECQVDPVKLTDGLADLAESLGVVIHEQTEMTGLAESGPGVTVTTENGSVEAAGALLATSAFRSPVRAIRSRVVPVFDYVLVTEPLSPAQWDSIGWANRQGLSDSANRFHYFRRTADDRILWGGFDAIYHYGGRVEDSYYQRDQSFAGLAQRFFAAFPQLEGVRFSHRWGGAIDTCSRFFAFYGTAHDGRVAYAVGHTGLGVGASRFSAGVGLDLLDGRESEVTGLDYTRKKPIPFPPEPIRWGAIQFTRNRLAAADHNNGERGLWLNTLDRLGLGFDS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231012 Pseudomonas sp. GM33 Isolate Nodule
3 2511231014 Pseudomonas sp. GM48 Isolate Nodule
4 2511231020 Pseudomonas sp. GM74 Isolate Nodule
5 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
6 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
7 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
8 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
9 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
10 2643221576 Nocardioides sp. Root614 Isolate Unclassified
11 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
12 2643221590 Nocardioides sp. Root682 Isolate Unclassified
13 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
14 2643221604 Nocardioides sp. Root190 Isolate Unclassified
15 2643221641 Nocardioides sp. Root122 Isolate Unclassified
16 2643221647 Streptomyces sp. Root369 Isolate Unclassified
17 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
20 2738541305 Nocardioides sp. CF167 Isolate Unclassified
21 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
22 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
23 2739367898 Nocardioides sp. CF479 Isolate Unclassified
24 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
25 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
26 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
27 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
28 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
29 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
30 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
31 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
32 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
33 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
34 2808606448 Streptomyces sp. 193411 Isolate Unclassified
35 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
36 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
37 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
38 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
39 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
40 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
41 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
42 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
43 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
44 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
45 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
46 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
47 2862574272 Streptomyces sp. AcE210 Isolate Nodule
48 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
49 2867428634 Streptomyces sp. RP5T Isolate Unclassified
50 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
51 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
52 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
53 2891562705 Microbispora tritici MT50 Isolate Unclassified
54 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
55 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
56 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
57 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
58 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
59 2919395869 Microbacterium resistens 2980 Isolate Unclassified
60 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
61 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
62 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
63 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
64 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
65 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
66 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
67 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
68 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
69 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
70 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
71 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
72 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
73 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
74 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
75 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
76 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
77 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
78 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
79 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
80 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
81 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
82 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
83 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
84 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
85 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
86 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
87 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
88 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
89 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
92 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
93 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
97 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
98 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
101 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
102 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
103 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
104 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
105 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
106 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
107 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
108 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
109 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
114 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
120 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
121 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
122 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
123 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
124 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
130 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
131 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
132 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
133 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
137 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
138 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
139 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
140 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
141 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
142 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
143 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
144 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
149 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
165 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
166 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
181 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
187 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
250 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
285 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
286 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
287 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
288 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
289 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
290 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
293 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
296 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
297 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
298 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
299 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
300 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
301 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
302 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
303 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
304 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
305 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
306 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
307 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
308 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
309 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
310 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
311 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
312 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
336 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
337 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
338 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
345 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
374 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
397 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
403 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
408 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
409 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
427 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
428 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
432 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
433 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
434 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
435 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
436 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
437 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
438 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
453 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
454 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
455 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
456 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
460 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
461 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
462 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
465 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
476 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
477 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
478 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
483 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
484 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
489 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
490 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
491 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
492 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
493 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
494 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
495 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
496 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
497 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
498 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
499 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.33
Metatranscriptomes 0.2
Isolates 9.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0.81
Rhizoplane 6.24
Rhizosphere 80.66
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2356726 2162886007 Bacteria 8681
2 JGI24739J22299_10008030 3300001989 Bacteria 3946
3 rootH1_10007774 3300003316 Bacteria 3916
4 Ga0055539_1000005 3300003752 Bacteria 609598
5 Ga0055533_1000001 3300003756 Bacteria 1863437
6 Ga0055525_1000380 3300003759 Bacteria 29022
7 Ga0055541_1004937 3300003841 Bacteria 2375
8 Ga0065704_10000402 3300005289 Bacteria 23340
9 Ga0070683_100001804 3300005329 Bacteria 16684
10 Ga0070683_100005756 3300005329 Bacteria 10356
11 Ga0070683_100007076 3300005329 Bacteria 9447
12 Ga0070683_100047206 3300005329 Bacteria 3979
13 Ga0070690_100011504 3300005330 Bacteria 5176
14 Ga0070680_100123933 3300005336 Bacteria 2159
15 Ga0068868_100088939 3300005338 Bacteria 2486
16 Ga0070660_100004477 3300005339 Bacteria 9658
17 Ga0070689_100014630 3300005340 Bacteria 5704
18 Ga0070689_100045036 3300005340 Bacteria 3396
19 Ga0070689_100173754 3300005340 Bacteria 1747
20 Ga0070691_10046440 3300005341 Bacteria 2063
21 Ga0070691_10046653 3300005341 Bacteria 2058
22 Ga0070692_10006941 3300005345 Bacteria 4954
23 Ga0070675_100088572 3300005354 Bacteria 2590
24 Ga0070674_100014137 3300005356 Bacteria 4956
25 Ga0070688_100013601 3300005365 Bacteria 4594
26 Ga0070659_100019330 3300005366 Bacteria 5160
27 Ga0070659_100037742 3300005366 Bacteria 3767
28 Ga0070659_100090172 3300005366 Bacteria 2457
29 Ga0070667_100004625 3300005367 Bacteria 11557
30 Ga0070714_100158941 3300005435 Bacteria 2043
31 Ga0070714_100236547 3300005435 Bacteria 1684
32 Ga0070713_100018140 3300005436 Bacteria 5347
33 Ga0070710_10021222 3300005437 Bacteria 3381
34 Ga0070710_10092963 3300005437 Bacteria 1782
35 Ga0070701_10009540 3300005438 Bacteria 4256
36 Ga0070700_100005709 3300005441 Bacteria 6606
37 Ga0070700_100084435 3300005441 Bacteria 2058
38 Ga0070694_100046543 3300005444 Bacteria 2912
39 Ga0070694_100053650 3300005444 Bacteria 2729
40 Ga0070694_100182912 3300005444 Bacteria 1551
41 Ga0070663_100001298 3300005455 Bacteria 13667
42 Ga0070663_100026056 3300005455 Bacteria 3955
43 Ga0070678_100054328 3300005456 Bacteria 2918
44 Ga0070678_100119278 3300005456 Bacteria 2077
45 Ga0070662_100052820 3300005457 Bacteria 2940
46 Ga0070685_10037100 3300005466 Bacteria 2759
47 Ga0070706_100002897 3300005467 Bacteria 17079
48 Ga0070698_100027456 3300005471 Bacteria 5920
49 Ga0070698_100052450 3300005471 Bacteria 4149
50 Ga0070699_100122518 3300005518 Bacteria 2287
51 Ga0070679_100003951 3300005530 Bacteria 13647
52 Ga0070679_100181330 3300005530 Bacteria 2078
53 Ga0070679_100229784 3300005530 Bacteria 1815
54 Ga0070684_100010212 3300005535 Bacteria 7429
55 Ga0070672_100012120 3300005543 Bacteria 6036
56 Ga0070686_100018885 3300005544 Bacteria 4054
57 Ga0070696_100052283 3300005546 Bacteria 2842
58 Ga0070693_100088235 3300005547 Bacteria 1864
59 Ga0070665_100005781 3300005548 Bacteria 12694
60 Ga0070665_100076756 3300005548 Bacteria 3348
61 Ga0070704_100025377 3300005549 Bacteria 3902
62 Ga0070704_100041217 3300005549 Bacteria 3185
63 Ga0068855_100005950 3300005563 Bacteria 14871
64 Ga0068855_100010155 3300005563 Bacteria 11347
65 Ga0068855_100078367 3300005563 Bacteria 3833
66 Ga0068855_100264310 3300005563 Bacteria 1916
67 Ga0070664_100216722 3300005564 Bacteria 1712
68 Ga0068857_100001615 3300005577 Bacteria 18094
69 Ga0068856_100006739 3300005614 Bacteria 11257
70 Ga0070702_100002049 3300005615 Bacteria 8524
71 Ga0070702_100088948 3300005615 Bacteria 1868
72 Ga0068852_100014131 3300005616 Bacteria 6132
73 Ga0068859_100197944 3300005617 Bacteria 2094
74 Ga0068870_10013878 3300005840 Bacteria 3794
75 Ga0068863_100171112 3300005841 Bacteria 2083
76 Ga0068860_100027413 3300005843 Bacteria 5488
77 Ga0068860_100255980 3300005843 Bacteria 1705
78 Ga0068862_100175452 3300005844 Bacteria 1921
79 Ga0081455_10170803 3300005937 Bacteria 1656
80 Ga0081538_10002004 3300005981 Bacteria 20341
81 Ga0081538_10003351 3300005981 Bacteria 15172
82 Ga0081539_10012226 3300005985 Bacteria 6658
83 Ga0081539_10013276 3300005985 Bacteria 6221
84 Ga0070717_10006834 3300006028 Bacteria 8418
85 Ga0075365_10000417 3300006038 Bacteria 15685
86 Ga0075365_10017264 3300006038 Bacteria 4412
87 Ga0075364_10175155 3300006051 Bacteria 1450
88 Ga0070715_10033815 3300006163 Bacteria 2092
89 Ga0070712_100034706 3300006175 Bacteria 3420
90 Ga0075362_10035626 3300006177 Bacteria 2173
91 Ga0075367_10002121 3300006178 Bacteria 8920
92 Ga0075370_10012794 3300006353 Bacteria 4444
93 Ga0068871_100073933 3300006358 Bacteria 2811
94 Ga0075428_100047189 3300006844 Bacteria 4732
95 Ga0075430_100005002 3300006846 Bacteria 11159
96 Ga0075434_100000189 3300006871 Bacteria 40699
97 Ga0075434_100166335 3300006871 Bacteria 2225
98 Ga0075429_100001085 3300006880 Bacteria 21851
99 Ga0075429_100244028 3300006880 Bacteria 1573
100 Ga0075436_100156674 3300006914 Bacteria 1604
101 Ga0097620_100197948 3300006931 Bacteria 2094
102 Ga0079104_1000142 3300006946 Bacteria 101403
103 Ga0075435_100001011 3300007076 Bacteria 17837
104 Ga0105251_10000028 3300009011 Bacteria 126517
105 Ga0105251_10005290 3300009011 Bacteria 8492
106 Ga0105244_10035727 3300009036 Bacteria 2609
107 Ga0105250_10016941 3300009092 Bacteria 2965
108 Ga0105240_10097074 3300009093 Bacteria 3591
109 Ga0111539_10014975 3300009094 Bacteria 9667
110 Ga0111539_10045910 3300009094 Bacteria 5228
111 Ga0105245_10012419 3300009098 Bacteria 7412
112 Ga0105245_10043223 3300009098 Bacteria 4020
113 Ga0105245_10051117 3300009098 Bacteria 3706
114 Ga0105245_10080823 3300009098 Bacteria 2970
115 Ga0105247_10005054 3300009101 Bacteria 8367
116 Ga0114129_10038117 3300009147 Bacteria 6782
117 Ga0114129_10047429 3300009147 Bacteria 6036
118 Ga0114129_10130307 3300009147 Bacteria 3455
119 Ga0114129_10203705 3300009147 Bacteria 2678
120 Ga0114129_10213756 3300009147 Bacteria 2605
121 Ga0114129_10337423 3300009147 Bacteria 2000
122 Ga0105243_10153370 3300009148 Bacteria 1979
123 Ga0105241_10016538 3300009174 Bacteria 5410
124 Ga0105242_10008446 3300009176 Bacteria 7912
125 Ga0105248_10130522 3300009177 Bacteria 2835
126 Ga0105237_10028680 3300009545 Bacteria 5666
127 Ga0105238_10006910 3300009551 Bacteria 11335
128 Ga0105249_10003437 3300009553 Bacteria 13716
129 Ga0105249_10061989 3300009553 Bacteria 3432
130 Ga0105249_10119646 3300009553 Bacteria 2501
131 Ga0105239_10011317 3300010375 Bacteria 9956
132 Ga0105239_10079943 3300010375 Bacteria 3597
133 Ga0105239_10166043 3300010375 Bacteria 2468
134 Ga0105239_10221035 3300010375 Bacteria 2124
135 Ga0105246_10001045 3300011119 Bacteria 15971
136 Ga0105246_10028403 3300011119 Bacteria 3675
137 Ga0157373_10007299 3300013100 Bacteria 8231
138 Ga0157373_10145311 3300013100 Bacteria 1668
139 Ga0157370_10000171 3300013104 Bacteria 80526
140 Ga0157370_10002106 3300013104 Bacteria 24313
141 Ga0157369_10254076 3300013105 Bacteria 1834
142 Ga0157374_10006009 3300013296 Bacteria 10274
143 Ga0163162_10039119 3300013306 Bacteria 4737
144 Ga0163162_10234050 3300013306 Bacteria 1968
145 Ga0157372_10081794 3300013307 Bacteria 3656
146 Ga0157375_10007971 3300013308 Bacteria 9271
147 Ga0157375_10031099 3300013308 Bacteria 5040
148 Ga0157375_10040166 3300013308 Bacteria 4508
149 Ga0163163_10001642 3300014325 Bacteria 18835
150 Ga0163163_10035479 3300014325 Bacteria 4838
151 Ga0163163_10115721 3300014325 Bacteria 2713
152 Ga0163163_10168250 3300014325 Bacteria 2238
153 Ga0157380_10014657 3300014326 Bacteria 5740
154 Ga0182008_10005025 3300014497 Bacteria 7607
155 Ga0182008_10040017 3300014497 Bacteria 2341
156 Ga0182008_10041075 3300014497 Bacteria 2308
157 Ga0157377_10003986 3300014745 Bacteria 6736
158 Ga0157377_10133436 3300014745 Bacteria 1519
159 Ga0157379_10023448 3300014968 Bacteria 5477
160 Ga0157379_10030343 3300014968 Bacteria 4812
161 Ga0157379_10076652 3300014968 Bacteria 2994
162 Ga0157376_10134600 3300014969 Bacteria 2210
163 Ga0182007_10002937 3300015262 Bacteria 8276
164 Ga0183367_1013 3300015688 Bacteria 334176
165 Ga0163161_10184772 3300017792 Bacteria 1600
166 Ga0206354_10254398 3300020081 Bacteria 3634
167 Ga0206353_10224325 3300020082 Bacteria 11607
168 Ga0213875_10012540 3300021388 Bacteria 4183
169 Ga0209566_100065 3300025225 Bacteria 190999
170 Ga0209674_100001 3300025226 Bacteria 4013750
171 Ga0209563_100001 3300025230 Bacteria 4013775
172 Ga0209563_100252 3300025230 Bacteria 25149
173 Ga0209677_100001 3300025253 Bacteria 4013787
174 Ga0209455_1001658 3300025272 Bacteria 9644
175 Ga0209676_1002314 3300025292 Bacteria 13841
176 Ga0209758_1004580 3300025297 Bacteria 11393
177 Ga0207426_1027582 3300025302 Bacteria 1891
178 Ga0209051_1004589 3300025303 Bacteria 8433
179 Ga0207655_1017889 3300025728 Bacteria 3797
180 Ga0207713_1001010 3300025735 Bacteria 24522
181 Ga0207713_1009028 3300025735 Bacteria 5666
182 Ga0207692_10017634 3300025898 Bacteria 3188
183 Ga0207688_10006244 3300025901 Bacteria 6484
184 Ga0207688_10025712 3300025901 Bacteria 3235
185 Ga0207680_10001832 3300025903 Bacteria 10001
186 Ga0207685_10006028 3300025905 Bacteria 3263
187 Ga0207643_10004317 3300025908 Bacteria 7642
188 Ga0207684_10000712 3300025910 Bacteria 39185
189 Ga0207684_10017570 3300025910 Bacteria 6134
190 Ga0207707_10040477 3300025912 Bacteria 4070
191 Ga0207695_10161214 3300025913 Bacteria 2174
192 Ga0207671_10029571 3300025914 Bacteria 4091
193 Ga0207663_10036671 3300025916 Bacteria 2951
194 Ga0207660_10107824 3300025917 Bacteria 2091
195 Ga0207662_10044008 3300025918 Bacteria 2635
196 Ga0207657_10001049 3300025919 Bacteria 29285
197 Ga0207657_10236760 3300025919 Bacteria 1458
198 Ga0207652_10001981 3300025921 Bacteria 17723
199 Ga0207652_10065345 3300025921 Bacteria 3150
200 Ga0207646_10003672 3300025922 Bacteria 17140
201 Ga0207650_10089409 3300025925 Bacteria 2350
202 Ga0207687_10020792 3300025927 Bacteria 4355
203 Ga0207687_10033407 3300025927 Bacteria 3490
204 Ga0207687_10036767 3300025927 Bacteria 3336
205 Ga0207687_10079961 3300025927 Bacteria 2358
206 Ga0207700_10067360 3300025928 Bacteria 2740
207 Ga0207700_10073395 3300025928 Bacteria 2642
208 Ga0207690_10021718 3300025932 Bacteria 3984
209 Ga0207709_10071548 3300025935 Bacteria 2203
210 Ga0207670_10057461 3300025936 Bacteria 2639
211 Ga0207669_10011927 3300025937 Bacteria 4252
212 Ga0207691_10002035 3300025940 Bacteria 19784
213 Ga0207661_10009900 3300025944 Bacteria 6846
214 Ga0207661_10025114 3300025944 Bacteria 4526
215 Ga0207661_10087281 3300025944 Bacteria 2590
216 Ga0207679_10027162 3300025945 Bacteria 3956
217 Ga0207667_10004544 3300025949 Bacteria 17001
218 Ga0207667_10022448 3300025949 Bacteria 6971
219 Ga0207667_10042075 3300025949 Bacteria 4859
220 Ga0207667_10138203 3300025949 Bacteria 2509
221 Ga0207667_10288318 3300025949 Bacteria 1677
222 Ga0207712_10027414 3300025961 Bacteria 3804
223 Ga0207658_10005964 3300025986 Bacteria 8325
224 Ga0207677_10002013 3300026023 Bacteria 10722
225 Ga0207703_10017164 3300026035 Bacteria 5647
226 Ga0207703_10102515 3300026035 Bacteria 2428
227 Ga0207678_10013299 3300026067 Bacteria 7221
228 Ga0207678_10153408 3300026067 Bacteria 1967
229 Ga0207678_10183650 3300026067 Bacteria 1786
230 Ga0207708_10002698 3300026075 Bacteria 13040
231 Ga0207708_10010588 3300026075 Bacteria 6849
232 Ga0207708_10020860 3300026075 Bacteria 4943
233 Ga0207708_10062163 3300026075 Bacteria 2852
234 Ga0207708_10103322 3300026075 Bacteria 2207
235 Ga0207702_10059919 3300026078 Bacteria 3244
236 Ga0207702_10254942 3300026078 Bacteria 1649
237 Ga0207648_10007537 3300026089 Bacteria 10678
238 Ga0207648_10009814 3300026089 Bacteria 9142
239 Ga0207674_10003543 3300026116 Bacteria 19056
240 Ga0207674_10041172 3300026116 Bacteria 4780
241 Ga0207675_100003571 3300026118 Bacteria 15149
242 Ga0207683_10015323 3300026121 Bacteria 6529
243 Ga0207683_10029962 3300026121 Bacteria 4713
244 Ga0207698_10117615 3300026142 Bacteria 2243
245 Ga0209281_1000262 3300027111 Bacteria 101417
246 Ga0209813_10012039 3300027866 Bacteria 2275
247 Ga0207428_10021554 3300027907 Bacteria 5454
248 Ga0207428_10049408 3300027907 Bacteria 3371
249 Ga0268266_10000867 3300028379 Bacteria 39343
250 Ga0268264_10021585 3300028381 Bacteria 5257
251 Ga0268264_10116875 3300028381 Bacteria 2345
252 Ga0307517_10027373 3300028786 Bacteria 6849
253 Ga0307515_10004249 3300028794 Bacteria 29735
254 Ga0307515_10044960 3300028794 Bacteria 6802
255 Ga0307515_10181178 3300028794 Bacteria 2056
256 Ga0265338_10014545 3300028800 Bacteria 8744
257 Ga0307511_10000330 3300030521 Bacteria 50161
258 Ga0307512_10007323 3300030522 Bacteria 10962
259 Ga0265325_10002382 3300031241 Bacteria 12701
260 Ga0265340_10001983 3300031247 Bacteria 11708
261 Ga0307513_10082868 3300031456 Bacteria 3300
262 Ga0307509_10046494 3300031507 Bacteria 4672
263 Ga0307509_10188592 3300031507 Bacteria 1916
264 Ga0307509_10205063 3300031507 Bacteria 1803
265 Ga0307508_10004026 3300031616 Bacteria 14548
266 Ga0307508_10010192 3300031616 Bacteria 8600
267 Ga0307508_10019315 3300031616 Bacteria 6195
268 Ga0307508_10086669 3300031616 Bacteria 2715
269 Ga0265342_10073201 3300031712 Bacteria 1993
270 Ga0316576_10000264 3300031727 Bacteria 22816
271 Ga0316576_10004163 3300031727 Bacteria 8633
272 Ga0316576_10008273 3300031727 Bacteria 6621
273 Ga0316576_10020117 3300031727 Bacteria 4585
274 Ga0316576_10028397 3300031727 Bacteria 3943
275 Ga0316576_10048948 3300031727 Bacteria 3068
276 Ga0316578_10010547 3300031728 Bacteria 4800
277 Ga0307516_10013366 3300031730 Bacteria 8759
278 Ga0307516_10042121 3300031730 Bacteria 4532
279 Ga0307516_10084360 3300031730 Bacteria 3016
280 Ga0307405_10080230 3300031731 Bacteria 2130
281 Ga0307405_10119028 3300031731 Bacteria 1804
282 Ga0307518_10022320 3300031838 Bacteria 4553
283 Ga0307518_10063752 3300031838 Bacteria 2675
284 Ga0307406_10069915 3300031901 Bacteria 2297
285 Ga0307412_10074959 3300031911 Bacteria 2320
286 Ga0307409_100018133 3300031995 Bacteria 4718
287 Ga0307416_100002034 3300032002 Bacteria 11380
288 Ga0307416_100187723 3300032002 Bacteria 1945
289 Ga0307415_100047472 3300032126 Bacteria 2891
290 Ga0307415_100114305 3300032126 Bacteria 2009
291 Ga0307507_10007693 3300033179 Bacteria 15412
292 Ga0307507_10115964 3300033179 Bacteria 2165
293 Ga0307510_10108404 3300033180 Bacteria 2531
294 Ga0373926_0009460 3300035083 Bacteria 3257
295 Ga0373934_0057165 3300035086 Bacteria 1552
296 Ga0373934_0063110 3300035086 Bacteria 1477
297 Ga0373955_0023329 3300035172 Bacteria 3150
298 Ga0373955_0043032 3300035172 Bacteria 2428
299 Ga0316574_0001253 3300035398 Bacteria 11837
300 Ga0316574_0007972 3300035398 Bacteria 5848
301 Ga0373933_0007701 3300035724 Bacteria 5881
302 Ga0373937_0076053 3300036401 Bacteria 3100
303 Ga0373937_0156285 3300036401 Bacteria 2137
304 Ga0316584_0065400 3300036712 Bacteria 2724
305 Ga0316584_0077304 3300036712 Bacteria 2494
306 Ga0373925_0005374 3300037068 Bacteria 9549
307 Ga0373925_0007744 3300037068 Bacteria 7819
308 Ga0373925_0059805 3300037068 Bacteria 2859
309 Ga0373925_0122550 3300037068 Bacteria 2019
310 Ga0395900_0071410 3300037418 Bacteria 3569
311 Ga0395898_0002385 3300037466 Bacteria 22303
312 Ga0395898_0004392 3300037466 Bacteria 15422
313 Ga0395898_0028932 3300037466 Bacteria 5553
314 Ga0395898_0062439 3300037466 Bacteria 3618
315 Ga0395898_0086460 3300037466 Bacteria 3022
316 Ga0395905_0164456 3300037471 Bacteria 2085
317 Ga0316581_0000584 3300037588 Bacteria 7164
318 Ga0436364_0643089 3300037853 Bacteria 10909
319 Ga0395901_0098300 3300038443 Bacteria 3069
320 Ga0395901_0160114 3300038443 Bacteria 2364
321 Ga0436365_0850532 3300039437 Bacteria 5119
322 Ga0436365_1352062 3300039437 Bacteria 9199
323 Ga0439436_0000788 3300041404 Bacteria 8575
324 Ga0439436_0003768 3300041404 Bacteria 4633
325 Ga0439438_001614 3300041405 Bacteria 9896
326 Ga0439439_0020440 3300041406 Bacteria 1646
327 Ga0439447_013272 3300041407 Bacteria 2342
328 Ga0439466_0004751 3300041411 Bacteria 5218
329 Ga0439466_0005924 3300041411 Bacteria 4653
330 Ga0451793_0650080 3300041452 Bacteria 2185
331 Ga0451802_0529070 3300041460 Bacteria 1553
332 Ga0451853_1775253 3300041512 Bacteria 4862
333 Ga0439448_0005660 3300042005 Bacteria 3567
334 Ga0439432_005551 3300042006 Bacteria 4537
335 Ga0439449_0001531 3300042007 Bacteria 9045
336 Ga0439449_0028057 3300042007 Bacteria 2099
337 Ga0439452_009596 3300042010 Bacteria 2844
338 Ga0439455_0000305 3300042012 Bacteria 6164
339 Ga0439457_000044 3300042014 Bacteria 26362
340 Ga0450894_000003 3300042131 Bacteria 40719
341 Ga0450903_000229 3300042138 Bacteria 12488
342 Ga0450903_001641 3300042138 Bacteria 4153
343 Ga0450906_001123 3300042145 Bacteria 5933
344 Ga0450907_000306 3300042146 Bacteria 16475
345 Ga0450908_000127 3300042184 Bacteria 15665
346 Ga0450908_005429 3300042184 Bacteria 2443
347 Ga0439434_0015845 3300042435 Bacteria 2248
348 Ga0466969_0000475 3300044656 Bacteria 21978
349 Ga0466972_0009062 3300044658 Bacteria 4997
350 Ga0466972_0009560 3300044658 Bacteria 4869
351 Ga0466965_0002364 3300044683 Bacteria 7990
352 Ga0466965_0012254 3300044683 Bacteria 4030
353 Ga0466966_0002355 3300044684 Bacteria 12341
354 Ga0466966_0002457 3300044684 Bacteria 12116
355 Ga0466966_0019383 3300044684 Bacteria 4476
356 Ga0466961_0001332 3300044693 Bacteria 15220
357 Ga0466961_0009491 3300044693 Bacteria 6195
358 Ga0466961_0046527 3300044693 Bacteria 2774
359 Ga0466961_0075897 3300044693 Bacteria 2130
360 Ga0466961_0091126 3300044693 Bacteria 1925
361 Ga0466961_0091927 3300044693 Bacteria 1916
362 Ga0466963_0000405 3300044694 Bacteria 19720
363 Ga0466963_0001645 3300044694 Bacteria 12172
364 Ga0466963_0012422 3300044694 Bacteria 5213
365 Ga0466963_0030020 3300044694 Bacteria 3504
366 Ga0466963_0068581 3300044694 Bacteria 2382
367 Ga0466963_0146970 3300044694 Bacteria 1636
368 Ga0466964_0021468 3300044706 Bacteria 2498
369 Ga0466964_0026381 3300044706 Bacteria 2274
370 Ga0453684_0328877 3300044712 Bacteria 1729
371 Ga0466971_0000060 3300044719 Bacteria 42431
372 Ga0466971_0031042 3300044719 Bacteria 2392
373 Ga0466970_0004138 3300044765 Bacteria 7132
374 Ga0466970_0017238 3300044765 Bacteria 3730
375 Ga0466970_0025976 3300044765 Bacteria 3068
376 Ga0466970_0033609 3300044765 Bacteria 2711
377 Ga0466970_0040673 3300044765 Bacteria 2469
378 Ga0466970_0052977 3300044765 Bacteria 2166
379 Ga0466957_0001317 3300044842 Bacteria 12978
380 Ga0466957_0040579 3300044842 Bacteria 2811
381 Ga0466957_0073034 3300044842 Bacteria 2125
382 Ga0466960_0010130 3300044901 Bacteria 3908
383 Ga0466960_0065163 3300044901 Bacteria 1799
384 Ga0466959_0000813 3300045049 Bacteria 18384
385 Ga0466959_0017438 3300045049 Bacteria 5263
386 Ga0466959_0029607 3300045049 Bacteria 4056
387 Ga0466959_0043854 3300045049 Bacteria 3296
388 Ga0466959_0115921 3300045049 Bacteria 1908
389 Ga0451576_0075720 3300045051 Bacteria 3502
390 Ga0466958_0016893 3300045836 Bacteria 4210
391 Ga0466958_0073054 3300045836 Bacteria 2101
392 Ga0466967_0002585 3300045976 Bacteria 11371
393 Ga0466967_0003148 3300045976 Bacteria 10630
394 Ga0466967_0007989 3300045976 Bacteria 7703
395 Ga0466967_0021403 3300045976 Bacteria 5251
396 Ga0466967_0052042 3300045976 Bacteria 3592
397 Ga0466967_0213442 3300045976 Bacteria 1831
398 Ga0466967_0266919 3300045976 Bacteria 1639
399 Ga0495617_000964 3300046452 Bacteria 13348
400 Ga0495617_001697 3300046452 Bacteria 9455
401 Ga0495617_009443 3300046452 Bacteria 3349
402 Ga0495617_021645 3300046452 Bacteria 2171
403 Ga0495617_052351 3300046452 Bacteria 1356
404 Ga0495627_000010 3300046453 Bacteria 381168
405 Ga0495627_005625 3300046453 Bacteria 5013
406 Ga0495592_0012929 3300046454 Bacteria 6346
407 Ga0495603_0004681 3300046455 Bacteria 8173
408 Ga0495603_0006417 3300046455 Bacteria 7040
409 Ga0495603_0010086 3300046455 Bacteria 5716
410 Ga0495603_0013191 3300046455 Bacteria 4995
411 Ga0495603_0015487 3300046455 Bacteria 4615
412 Ga0495590_0003380 3300046457 Bacteria 6527
413 Ga0495590_0016508 3300046457 Bacteria 2665
414 Ga0495591_007604 3300046458 Bacteria 4575
415 Ga0495591_021625 3300046458 Bacteria 2094
416 Ga0495629_0003703 3300046459 Bacteria 11531
417 Ga0495629_0019294 3300046459 Bacteria 4874
418 Ga0495629_0045070 3300046459 Bacteria 3095
419 Ga0495629_0080656 3300046459 Bacteria 2271
420 Ga0495629_0118337 3300046459 Bacteria 1846
421 Ga0495638_0002134 3300046460 Bacteria 16606
422 Ga0495638_0013116 3300046460 Bacteria 5657
423 Ga0495638_0020491 3300046460 Bacteria 4368
424 Ga0495638_0062447 3300046460 Bacteria 2299
425 Ga0495641_0039978 3300046461 Bacteria 2183
426 Ga0495651_0000746 3300046462 Bacteria 25159
427 Ga0495651_0002533 3300046462 Bacteria 14137
428 Ga0495651_0006659 3300046462 Bacteria 8833
429 Ga0495651_0011792 3300046462 Bacteria 6718
430 Ga0495651_0080641 3300046462 Bacteria 2458
431 Ga0495653_0018739 3300046463 Bacteria 5619
432 Ga0495650_0001024 3300046471 Bacteria 31397
433 Ga0495650_0027295 3300046471 Bacteria 2640
434 Ga0495582_0019915 3300046473 Bacteria 3670
435 Ga0495605_0000631 3300046474 Bacteria 27198
436 Ga0495605_0005433 3300046474 Bacteria 7419
437 Ga0495605_0010916 3300046474 Bacteria 5074
438 Ga0495605_0043040 3300046474 Bacteria 2241
439 Ga0495639_0005669 3300046475 Bacteria 5372
440 Ga0495639_0006950 3300046475 Bacteria 4863
441 Ga0495639_0013655 3300046475 Bacteria 3512
442 Ga0495639_0038331 3300046475 Bacteria 2152
443 Ga0495662_0002015 3300046476 Bacteria 10169
444 Ga0495662_0005421 3300046476 Bacteria 6384
445 Ga0495664_0000886 3300046477 Bacteria 15402
446 Ga0495664_0019700 3300046477 Bacteria 3883
447 Ga0495664_0042045 3300046477 Bacteria 2706
448 Ga0495584_0004684 3300046491 Bacteria 7329
449 Ga0495584_0011750 3300046491 Bacteria 4476
450 Ga0495584_0026117 3300046491 Bacteria 2958
451 Ga0495585_0001103 3300046492 Bacteria 22231
452 Ga0495585_0008010 3300046492 Bacteria 6423
453 Ga0495585_0040538 3300046492 Bacteria 2614
454 Ga0495585_0049233 3300046492 Bacteria 2341
455 Ga0495594_0031376 3300046499 Bacteria 2880
456 Ga0495594_0061360 3300046499 Bacteria 2080
457 Ga0495594_0102994 3300046499 Bacteria 1606
458 Ga0495607_0027885 3300046501 Bacteria 3486
459 Ga0495583_0001013 3300046506 Bacteria 32066
460 Ga0495606_0000041 3300046507 Bacteria 220225
461 Ga0495606_0005398 3300046507 Bacteria 12254
462 Ga0495606_0021936 3300046507 Bacteria 4669
463 Ga0495608_0000285 3300046511 Bacteria 35530
464 Ga0495608_0017964 3300046511 Bacteria 4887
465 Ga0495610_0023257 3300046512 Bacteria 3373
466 Ga0495610_0029001 3300046512 Bacteria 2920
467 Ga0495610_0048360 3300046512 Bacteria 2088
468 Ga0495610_0077354 3300046512 Bacteria 1536
469 Ga0495616_0004215 3300046513 Bacteria 9103
470 Ga0495616_0005334 3300046513 Bacteria 7928
471 Ga0495618_0009858 3300046514 Bacteria 5779
472 Ga0495618_0016281 3300046514 Bacteria 4547
473 Ga0495618_0052858 3300046514 Bacteria 2568
474 Ga0495620_0006554 3300046515 Bacteria 6386
475 Ga0495620_0033191 3300046515 Bacteria 2345
476 Ga0495628_0003788 3300046516 Bacteria 13465
477 Ga0495628_0008618 3300046516 Bacteria 8736
478 Ga0495628_0014784 3300046516 Bacteria 6529
479 Ga0495630_0081675 3300046517 Bacteria 2439
480 Ga0495630_0092409 3300046517 Bacteria 2287
481 Ga0495631_0003400 3300046518 Bacteria 8716
482 Ga0495632_0001095 3300046519 Bacteria 23188
483 Ga0495637_0001115 3300046520 Bacteria 16443
484 Ga0495637_0008695 3300046520 Bacteria 4979
485 Ga0495643_0000049 3300046522 Bacteria 212242
486 Ga0495643_0001191 3300046522 Bacteria 25336
487 Ga0495643_0001671 3300046522 Bacteria 19427
488 Ga0495643_0073013 3300046522 Bacteria 1798
489 Ga0495644_0011204 3300046523 Bacteria 3456
490 Ga0495648_0000935 3300046524 Bacteria 30300
491 Ga0495648_0004862 3300046524 Bacteria 11329
492 Ga0495648_0047063 3300046524 Bacteria 2669
493 Ga0495666_0042680 3300046526 Bacteria 2192
494 Ga0495666_0052924 3300046526 Bacteria 1949
495 Ga0495642_0000018 3300046528 Bacteria 108992
496 Ga0495642_0047542 3300046528 Bacteria 1758
497 Ga0495642_0061679 3300046528 Bacteria 1556
498 Ga0495652_0000965 3300046529 Bacteria 32930
499 Ga0495652_0001447 3300046529 Bacteria 26276
500 Ga0495652_0002668 3300046529 Bacteria 18144
501 Ga0495652_0041521 3300046529 Bacteria 3970
502 Ga0495654_0016625 3300046530 Bacteria 3882
503 Ga0495654_0036482 3300046530 Bacteria 2470
504 Ga0495654_0049169 3300046530 Bacteria 2066
505 Ga0495665_0004737 3300046531 Bacteria 7346
506 Ga0495665_0005678 3300046531 Bacteria 6732
507 Ga0495640_0011451 3300046533 Bacteria 6825
508 Ga0495640_0011728 3300046533 Bacteria 6729
509 Ga0495640_0045545 3300046533 Bacteria 3043
510 Ga0495640_0051661 3300046533 Bacteria 2825
511 Ga0495586_0016218 3300046535 Bacteria 3963
512 Ga0495586_0055565 3300046535 Bacteria 2145
513 Ga0495587_0000351 3300046536 Bacteria 32959
514 Ga0495587_0002980 3300046536 Bacteria 11318
515 Ga0495587_0053015 3300046536 Bacteria 2392
516 Ga0495587_0058843 3300046536 Bacteria 2257
517 Ga0495587_0111290 3300046536 Bacteria 1573
518 Ga0495609_0012936 3300046538 Bacteria 3948
519 Ga0495609_0022460 3300046538 Bacteria 2906
520 Ga0495597_0040425 3300046542 Bacteria 2084
521 Ga0495597_0040958 3300046542 Bacteria 2070
522 Ga0495645_0015914 3300046543 Bacteria 5359
523 Ga0495645_0039887 3300046543 Bacteria 3425
524 Ga0495645_0097618 3300046543 Bacteria 2092
525 Ga0495622_0004423 3300046557 Bacteria 6526
526 Ga0495622_0046644 3300046557 Bacteria 2013
527 Ga0495667_0000323 3300046559 Bacteria 30275
528 Ga0495656_0004404 3300046615 Bacteria 4821
529 Ga0495668_0009381 3300046616 Bacteria 6015
530 Ga0495668_0061970 3300046616 Bacteria 2062
531 Ga0495634_0025507 3300046642 Bacteria 4134
532 Ga0495634_0097863 3300046642 Bacteria 1899
533 Ga0495625_0007943 3300046660 Bacteria 9120
534 Ga0495625_0023871 3300046660 Bacteria 4665
535 Ga0495625_0029829 3300046660 Bacteria 4075
536 Ga0495635_0001065 3300046663 Bacteria 18167
537 Ga0495635_0001252 3300046663 Bacteria 16998
538 Ga0495635_0014829 3300046663 Bacteria 5451
539 Ga0495635_0053242 3300046663 Bacteria 2788
540 Ga0495635_0081545 3300046663 Bacteria 2213
541 Ga0495661_0013465 3300046665 Bacteria 5491
542 Ga0495588_0026184 3300046674 Bacteria 2910
543 Ga0495588_0027627 3300046674 Bacteria 2836
544 Ga0495588_0059456 3300046674 Bacteria 1977
545 Ga0495657_0000950 3300046675 Bacteria 25579
546 Ga0495657_0002113 3300046675 Bacteria 16875
547 Ga0495657_0016894 3300046675 Bacteria 5305
548 Ga0495657_0039692 3300046675 Bacteria 3233
549 Ga0495599_0007717 3300046678 Bacteria 6534
550 Ga0495623_0000754 3300046679 Bacteria 21717
551 Ga0495623_0006440 3300046679 Bacteria 7638
552 Ga0495623_0022921 3300046679 Bacteria 4032
553 Ga0495623_0047124 3300046679 Bacteria 2736
554 Ga0495623_0071397 3300046679 Bacteria 2160
555 Ga0495623_0091104 3300046679 Bacteria 1871
556 Ga0495646_0000654 3300046680 Bacteria 18980
557 Ga0495646_0022418 3300046680 Bacteria 3984
558 Ga0495646_0079301 3300046680 Bacteria 1917
559 Ga0495658_0044021 3300046683 Bacteria 2499
560 Ga0495669_0000858 3300046684 Bacteria 12878
561 Ga0495669_0003277 3300046684 Bacteria 6662
562 Ga0495613_0000863 3300046689 Bacteria 23258
563 Ga0495613_0004045 3300046689 Bacteria 10967
564 Ga0495613_0057350 3300046689 Bacteria 2859
565 Ga0495670_0000942 3300046691 Bacteria 14081
566 Ga0495670_0001398 3300046691 Bacteria 11799
567 Ga0495670_0013532 3300046691 Bacteria 4012
568 Ga0495670_0022508 3300046691 Bacteria 3111
569 Ga0495670_0060219 3300046691 Bacteria 1907
570 Ga0495671_0000171 3300046692 Bacteria 57447
571 Ga0495671_0001368 3300046692 Bacteria 16546
572 Ga0495671_0007991 3300046692 Bacteria 5980
573 Ga0495671_0009137 3300046692 Bacteria 5550
574 Ga0495671_0022532 3300046692 Bacteria 3299
575 Ga0495671_0030651 3300046692 Bacteria 2753
576 Ga0495671_0063085 3300046692 Bacteria 1825
577 Ga0495649_0000022 3300046694 Bacteria 179407
578 Ga0495649_0012409 3300046694 Bacteria 4955
579 Ga0495649_0027281 3300046694 Bacteria 3169
580 Ga0495589_0000184 3300046794 Bacteria 55497
581 Ga0495589_0009299 3300046794 Bacteria 5111
582 Ga0495589_0021953 3300046794 Bacteria 3261
583 Ga0495589_0055718 3300046794 Bacteria 1947
584 Ga0495600_0002680 3300046809 Bacteria 10292
585 Ga0495600_0004855 3300046809 Bacteria 8071
586 Ga0495600_0016386 3300046809 Bacteria 4703
587 Ga0495660_0011625 3300046810 Bacteria 5106
588 Ga0495660_0015806 3300046810 Bacteria 4357
589 Ga0495660_0080852 3300046810 Bacteria 1704
590 Ga0495660_0099527 3300046810 Bacteria 1498
591 Ga0495581_0019739 3300047315 Bacteria 3913
592 Ga0495581_0022343 3300047315 Bacteria 3666
593 Ga0495581_0040241 3300047315 Bacteria 2705
594 Ga0495604_0001086 3300047317 Bacteria 22562
595 Ga0495604_0002820 3300047317 Bacteria 13953
596 Ga0495604_0038960 3300047317 Bacteria 3737
597 Ga0495636_0053621 3300047318 Bacteria 1693
598 Ga0495636_0074976 3300047318 Bacteria 1449
599 Ga0495674_0002467 3300047319 Bacteria 18059
600 Ga0495674_0021789 3300047319 Bacteria 5921
601 Ga0495674_0044265 3300047319 Bacteria 3958
602 Ga0495672_0007796 3300047320 Bacteria 8005
603 Ga0495672_0012207 3300047320 Bacteria 6008
604 Ga0495676_0016554 3300047321 Bacteria 6538
605 Ga0495676_0017686 3300047321 Bacteria 6296
606 Ga0495676_0024766 3300047321 Bacteria 5187
607 Ga0495680_0003057 3300047322 Bacteria 16668
608 Ga0495680_0003938 3300047322 Bacteria 14358
609 Ga0495680_0016873 3300047322 Bacteria 6254
610 Ga0495680_0017945 3300047322 Bacteria 6020
611 Ga0495680_0059882 3300047322 Bacteria 2938
612 Ga0495683_0000578 3300047323 Bacteria 27719
613 Ga0495683_0023882 3300047323 Bacteria 3140
614 Ga0495687_000294 3300047443 Bacteria 65644
615 Ga0495687_001298 3300047443 Bacteria 23461
616 Ga0495687_002153 3300047443 Bacteria 16437
617 Ga0495675_0001430 3300047444 Bacteria 14460
618 Ga0495675_0026189 3300047444 Bacteria 3718
619 Ga0495675_0036887 3300047444 Bacteria 3116
620 Ga0495677_0000905 3300047445 Bacteria 11921
621 Ga0495677_0021634 3300047445 Bacteria 2331
622 Ga0495679_003079 3300047446 Bacteria 8179
623 Ga0495685_002436 3300047447 Bacteria 5825
624 Ga0495685_005907 3300047447 Bacteria 3997
625 Ga0495673_0000960 3300047469 Bacteria 26055
626 Ga0495673_0005727 3300047469 Bacteria 7450
627 Ga0495673_0007256 3300047469 Bacteria 6401
628 Ga0495673_0015550 3300047469 Bacteria 3917
629 Ga0495673_0019178 3300047469 Bacteria 3431
630 Ga0495681_0001153 3300047470 Bacteria 20012
631 Ga0495681_0002427 3300047470 Bacteria 13313
632 Ga0495681_0003291 3300047470 Bacteria 11263
633 Ga0495681_0016834 3300047470 Bacteria 4079
634 Ga0495684_0002639 3300047471 Bacteria 14234
635 Ga0495684_0005519 3300047471 Bacteria 9850
636 Ga0495684_0014031 3300047471 Bacteria 6163
637 Ga0495684_0072190 3300047471 Bacteria 2623
638 Ga0495684_0180379 3300047471 Bacteria 1565
639 Ga0495686_0011949 3300047472 Bacteria 6101
640 Ga0495593_0000492 3300047673 Bacteria 22255
641 Ga0495593_0001513 3300047673 Bacteria 13673
642 Ga0495602_0061044 3300048088 Bacteria 3281
643 Ga0495602_0065236 3300048088 Bacteria 3143
644 Ga0495614_0003675 3300048089 Bacteria 6881
645 Ga0495614_0047864 3300048089 Bacteria 1834
646 Ga0495626_0000079 3300048091 Bacteria 129922
647 Ga0495626_0000992 3300048091 Bacteria 24369
648 Ga0495626_0002392 3300048091 Bacteria 13078
649 Ga0495626_0013719 3300048091 Bacteria 4204
650 Ga0496100_0005810 3300048903 Bacteria 6674
651 Ga0496100_0047456 3300048903 Bacteria 2767
652 Ga0496101_0004122 3300048904 Bacteria 9095
653 Ga0496101_0005894 3300048904 Bacteria 7846
654 Ga0496102_0001742 3300048905 Bacteria 19029
655 Ga0496102_0003029 3300048905 Bacteria 14222
656 Ga0496102_0019597 3300048905 Bacteria 5960
657 Ga0496102_0019642 3300048905 Bacteria 5953
658 Ga0496102_0031270 3300048905 Bacteria 4774
659 Ga0496102_0069067 3300048905 Bacteria 3243
660 Ga0496103_0007509 3300048906 Bacteria 6496
661 Ga0496103_0014072 3300048906 Bacteria 4750
662 Ga0496104_0019438 3300048907 Bacteria 6215
663 Ga0496104_0028744 3300048907 Bacteria 5153
664 Ga0496104_0124840 3300048907 Bacteria 2471
665 Ga0496104_0183021 3300048907 Bacteria 2006
666 Ga0496105_0015043 3300048908 Bacteria 6157
667 Ga0496105_0042837 3300048908 Bacteria 3732
668 Ga0496106_0003464 3300048909 Bacteria 11755
669 Ga0496106_0025424 3300048909 Bacteria 4407
670 Ga0496106_0027590 3300048909 Bacteria 4230
671 Ga0496107_0001109 3300048910 Bacteria 16210
672 Ga0496107_0001433 3300048910 Bacteria 14740
673 Ga0496107_0017720 3300048910 Bacteria 5012
674 Ga0496108_0003468 3300048911 Bacteria 12651
675 Ga0496108_0009592 3300048911 Bacteria 7844
676 Ga0496108_0015083 3300048911 Bacteria 6309
677 Ga0496108_0057415 3300048911 Bacteria 3270
678 Ga0496109_0009204 3300048912 Bacteria 8412
679 Ga0496109_0011288 3300048912 Bacteria 7672
680 Ga0496109_0012514 3300048912 Bacteria 7326
681 Ga0496109_0012931 3300048912 Bacteria 7217
682 Ga0496109_0083585 3300048912 Bacteria 2944
683 Ga0496109_0106125 3300048912 Bacteria 2609
684 Ga0496110_0000626 3300048913 Bacteria 24200
685 Ga0496110_0007505 3300048913 Bacteria 8715
686 Ga0496110_0053821 3300048913 Bacteria 3539
687 Ga0496110_0082773 3300048913 Bacteria 2862
688 Ga0496110_0167819 3300048913 Bacteria 1991
689 Ga0496111_0002176 3300048914 Bacteria 11738
690 Ga0496111_0017782 3300048914 Bacteria 4917
691 Ga0496111_0019438 3300048914 Bacteria 4718
692 Ga0496111_0159987 3300048914 Bacteria 1672
693 Ga0496112_0004855 3300048915 Bacteria 11485
694 Ga0496112_0006081 3300048915 Bacteria 10550
695 Ga0496112_0092581 3300048915 Bacteria 2992
696 Ga0496112_0159799 3300048915 Bacteria 2220
697 Ga0496112_0205095 3300048915 Bacteria 1930
698 Ga0496113_0000221 3300048916 Bacteria 26671
699 Ga0496113_0008913 3300048916 Bacteria 6564
700 Ga0496113_0034990 3300048916 Bacteria 3670
701 Ga0496114_0016746 3300048917 Bacteria 5911
702 Ga0496114_0040296 3300048917 Bacteria 3867
703 Ga0496114_0041945 3300048917 Bacteria 3792
704 Ga0496114_0044606 3300048917 Bacteria 3680
705 Ga0496114_0089399 3300048917 Bacteria 2614
706 Ga0496114_0110821 3300048917 Bacteria 2351
707 Ga0496115_0002679 3300048918 Bacteria 12770
708 Ga0496115_0047657 3300048918 Bacteria 3427
709 Ga0496115_0097216 3300048918 Bacteria 2411
710 Ga0496117_0007927 3300048920 Bacteria 10204
711 Ga0496117_0038515 3300048920 Bacteria 3542
712 Ga0496118_0027862 3300048921 Bacteria 4772
713 Ga0496118_0029643 3300048921 Bacteria 4585
714 Ga0496119_0000055 3300048922 Bacteria 180121
715 Ga0496119_0015245 3300048922 Bacteria 5938
716 Ga0496119_0045002 3300048922 Bacteria 2772
717 Ga0496120_0035633 3300048923 Bacteria 2970
718 Ga0496121_0001931 3300048924 Bacteria 33124
719 Ga0496121_0023239 3300048924 Bacteria 5980
720 Ga0496122_0000043 3300048925 Bacteria 280333
721 Ga0496122_0000116 3300048925 Bacteria 183371
722 Ga0496123_0000009 3300048926 Bacteria 509486
723 Ga0496123_0000090 3300048926 Bacteria 179735
724 Ga0496124_0002284 3300048927 Bacteria 25355
725 Ga0496124_0022995 3300048927 Bacteria 5702
726 Ga0496124_0046311 3300048927 Bacteria 3726
727 Ga0496124_0067892 3300048927 Bacteria 2965
728 Ga0496125_0017036 3300048928 Bacteria 6945
729 Ga0496125_0020034 3300048928 Bacteria 6289
730 Ga0496125_0127627 3300048928 Bacteria 1799
731 Ga0496126_0089492 3300048929 Bacteria 2709
732 Ga0496126_0239479 3300048929 Bacteria 1516
733 Ga0495678_031661 3300049459 Bacteria 2202
734 Ga0495678_038980 3300049459 Bacteria 1918
735 Ga0495682_0001733 3300049460 Bacteria 11073
736 Ga0495682_0027900 3300049460 Bacteria 2093
737 Ga0501031_0004230 3300049568 Bacteria 9274
738 Ga0501031_0036433 3300049568 Bacteria 3209
739 Ga0501031_0050743 3300049568 Bacteria 2702
740 Ga0501031_0059513 3300049568 Bacteria 2490
741 Ga0501032_0000727 3300049569 Bacteria 26753
742 Ga0501032_0036294 3300049569 Bacteria 3365
743 Ga0501032_0041715 3300049569 Bacteria 3115
744 Ga0501032_0047481 3300049569 Bacteria 2898
745 Ga0501032_0080781 3300049569 Bacteria 2163
746 Ga0501033_0000159 3300049570 Bacteria 64757
747 Ga0501033_0049129 3300049570 Bacteria 3132
748 Ga0501033_0090358 3300049570 Bacteria 2240
749 Ga0501034_0002444 3300049571 Bacteria 22408
750 Ga0501034_0015605 3300049571 Bacteria 7802
751 Ga0501034_0015770 3300049571 Bacteria 7759
752 Ga0501034_0016676 3300049571 Bacteria 7530
753 Ga0501034_0017350 3300049571 Bacteria 7384
754 Ga0501034_0025683 3300049571 Bacteria 5999
755 Ga0501034_0039482 3300049571 Bacteria 4781
756 Ga0501034_0046905 3300049571 Bacteria 4365
757 Ga0501034_0123701 3300049571 Bacteria 2572
758 Ga0501034_0210536 3300049571 Bacteria 1899
759 Ga0501034_0278588 3300049571 Bacteria 1612
760 Ga0501036_0000189 3300049572 Bacteria 40908
761 Ga0501036_0006157 3300049572 Bacteria 9732
762 Ga0501036_0015584 3300049572 Bacteria 6349
763 Ga0501036_0016970 3300049572 Bacteria 6083
764 Ga0501036_0028398 3300049572 Bacteria 4728
765 Ga0501036_0141521 3300049572 Bacteria 2030
766 Ga0501037_0000650 3300049573 Bacteria 26827
767 Ga0501037_0102896 3300049573 Bacteria 2060
768 Ga0501038_0005789 3300049574 Bacteria 11450
769 Ga0501038_0009078 3300049574 Bacteria 9127
770 Ga0501038_0013067 3300049574 Bacteria 7573
771 Ga0501038_0020677 3300049574 Bacteria 5916
772 Ga0501038_0022537 3300049574 Bacteria 5642
773 Ga0501038_0030461 3300049574 Bacteria 4775
774 Ga0501038_0037453 3300049574 Bacteria 4252
775 Ga0501039_0027741 3300049575 Bacteria 4355
776 Ga0501039_0065721 3300049575 Bacteria 2814
777 Ga0501040_0039961 3300049576 Bacteria 3192
778 Ga0501042_0151998 3300049578 Bacteria 1669
779 Ga0501043_0000373 3300049579 Bacteria 40611
780 Ga0501043_0001858 3300049579 Bacteria 18078
781 Ga0501043_0015877 3300049579 Bacteria 5902
782 Ga0501043_0134425 3300049579 Bacteria 1937
783 Ga0501043_0137119 3300049579 Bacteria 1917
784 Ga0501043_0155600 3300049579 Bacteria 1788
785 Ga0501043_0173853 3300049579 Bacteria 1679
786 Ga0501046_0001066 3300049580 Bacteria 26864
787 Ga0501046_0008749 3300049580 Bacteria 8794
788 Ga0501046_0033504 3300049580 Bacteria 4150
789 Ga0501046_0085108 3300049580 Bacteria 2438
790 Ga0501046_0123638 3300049580 Bacteria 1967
791 Ga0501047_0000716 3300049581 Bacteria 34570
792 Ga0501047_0004050 3300049581 Bacteria 13782
793 Ga0501047_0045335 3300049581 Bacteria 4252
794 Ga0501047_0045823 3300049581 Bacteria 4227
795 Ga0501047_0064830 3300049581 Bacteria 3523
796 Ga0501047_0075166 3300049581 Bacteria 3251
797 Ga0501047_0087631 3300049581 Bacteria 2990
798 Ga0501047_0129107 3300049581 Bacteria 2408
799 Ga0501048_0001489 3300049582 Bacteria 17772
800 Ga0501048_0037625 3300049582 Bacteria 3475
801 Ga0501048_0145498 3300049582 Bacteria 1676
802 Ga0501067_0003460 3300049583 Bacteria 8680
803 Ga0501069_0009224 3300049585 Bacteria 5206
804 Ga0501069_0032219 3300049585 Bacteria 2884
805 Ga0501070_0000131 3300049586 Bacteria 67175
806 Ga0501070_0002400 3300049586 Bacteria 16438
807 Ga0501070_0002490 3300049586 Bacteria 16130
808 Ga0501070_0003761 3300049586 Bacteria 13104
809 Ga0501070_0005845 3300049586 Bacteria 10493
810 Ga0501070_0009744 3300049586 Bacteria 8125
811 Ga0501070_0055646 3300049586 Bacteria 3279
812 Ga0501070_0133458 3300049586 Bacteria 2050
813 Ga0501071_0003074 3300049587 Bacteria 10340
814 Ga0501071_0012031 3300049587 Bacteria 5850
815 Ga0501071_0052633 3300049587 Bacteria 2936
816 Ga0501071_0070828 3300049587 Bacteria 2541
817 Ga0501071_0093965 3300049587 Bacteria 2205
818 Ga0501071_0120866 3300049587 Bacteria 1941
819 Ga0501072_0007848 3300049588 Bacteria 8108
820 Ga0501072_0090494 3300049588 Bacteria 2429
821 Ga0501072_0156985 3300049588 Bacteria 1814
822 Ga0501073_0010742 3300049589 Bacteria 6704
823 Ga0501073_0148866 3300049589 Bacteria 1622
824 Ga0501074_0002952 3300049590 Bacteria 11950
825 Ga0501074_0003673 3300049590 Bacteria 10885
826 Ga0501074_0011144 3300049590 Bacteria 6532
827 Ga0501074_0016811 3300049590 Bacteria 5309
828 Ga0501075_0016423 3300049591 Bacteria 5333
829 Ga0501075_0033087 3300049591 Bacteria 3845
830 Ga0501075_0043315 3300049591 Bacteria 3376
831 Ga0501075_0093606 3300049591 Bacteria 2281
832 Ga0501076_0018678 3300049592 Bacteria 5291
833 Ga0501076_0045824 3300049592 Bacteria 3453
834 Ga0501076_0052032 3300049592 Bacteria 3243
835 Ga0501076_0136471 3300049592 Bacteria 1991
836 Ga0501076_0158649 3300049592 Bacteria 1842
837 Ga0501077_0090516 3300049593 Bacteria 1939
838 Ga0501079_0020791 3300049741 Bacteria 5019
839 Ga0501079_0036828 3300049741 Bacteria 3768
840 Ga0501080_0001161 3300049742 Bacteria 21753
841 Ga0501080_0008643 3300049742 Bacteria 9243
842 Ga0501081_0022247 3300049743 Bacteria 4240
843 Ga0501081_0154462 3300049743 Bacteria 1650
844 Ga0501083_0001155 3300049744 Bacteria 17779
845 Ga0501083_0043784 3300049744 Bacteria 3032
846 Ga0501035_0000684 3300049822 Bacteria 37075
847 Ga0501035_0000934 3300049822 Bacteria 30908
848 Ga0501035_0004132 3300049822 Bacteria 13795
849 Ga0501035_0011659 3300049822 Bacteria 8149
850 Ga0501035_0023132 3300049822 Bacteria 5702
851 Ga0501035_0034448 3300049822 Bacteria 4601
852 Ga0501035_0116871 3300049822 Bacteria 2334
853 Ga0501035_0119992 3300049822 Bacteria 2300
854 Ga0501044_0000883 3300049823 Bacteria 36150
855 Ga0501044_0020131 3300049823 Bacteria 7122
856 Ga0501044_0048318 3300049823 Bacteria 4395
857 Ga0501044_0134122 3300049823 Bacteria 2468
858 Ga0501044_0164341 3300049823 Bacteria 2194
859 Ga0501045_0014003 3300049824 Bacteria 5677
860 Ga0501045_0046651 3300049824 Bacteria 3155
861 Ga0501045_0055757 3300049824 Bacteria 2890
862 Ga0501045_0075415 3300049824 Bacteria 2484
863 Ga0501045_0088070 3300049824 Bacteria 2293
864 Ga0501045_0090021 3300049824 Bacteria 2267
865 nmdc:mga03683_8957_c1 3300050489 Bacteria 3540
866 nmdc:mga0yw44_4806_c1 3300050492 Bacteria 6267
867 nmdc:mga06z11_7724_c1 3300050494 Bacteria 4441
868 nmdc:mga04h51_3779_c1 3300050495 Bacteria 3712
869 nmdc:mga07m45_31724_c1 3300050496 Bacteria 2928
870 nmdc:mga05p37_187626_c1 3300050507 Bacteria 2513
871 nmdc:mga05p37_230358_c1 3300050507 Bacteria 2233
872 nmdc:mga05p37_44482_c1 3300050507 Bacteria 5462
873 nmdc:mga08y16_12302_c1 3300050511 Bacteria 8998
874 nmdc:mga08y16_12848_c1 3300050511 Bacteria 8804
875 nmdc:mga0n895_1334_c1 3300050512 Bacteria 18282
876 nmdc:mga0n895_193467_c1 3300050512 Bacteria 2065
877 nmdc:mga0n895_95568_c1 3300050512 Bacteria 2976
878 nmdc:mga0rr50_40331_c1 3300050513 Bacteria 3394
879 nmdc:mga08x19_21515_c1 3300050514 Bacteria 3983
880 nmdc:mga0sz30_855_c2 3300050516 Bacteria 4136
881 Ga0495601_0002168 3300053077 Bacteria 11051
882 Ga0495601_0022490 3300053077 Bacteria 3871
883 Ga0495601_0121087 3300053077 Bacteria 1699
884 Ga0495601_0136269 3300053077 Bacteria 1600
885 Ga0495612_0000202 3300053078 Bacteria 25471
886 Ga0500560_001395 3300053107 Bacteria 4173
887 Ga0500559_0000949 3300053136 Bacteria 18263
888 Ga0500616_0000183 3300053153 Bacteria 103074
889 Ga0500616_0000740 3300053153 Bacteria 37626
890 Ga0501084_0075765 3300054114 Bacteria 2819
891 Ga0501084_0115744 3300054114 Bacteria 2253
892 Ga0501084_0231104 3300054114 Bacteria 1561
893 Ga0501082_0012318 3300060353 Bacteria 7350
894 Ga0501082_0013740 3300060353 Bacteria 6960
895 Ga0501082_0133125 3300060353 Bacteria 2157
896 Ga0501082_0225238 3300060353 Bacteria 1632
897 Ga0466962_0001787 3300061719 Bacteria 10113
898 Ga0466962_0059192 3300061719 Bacteria 1828
899 Ga0530510_0000395 3300061734 Bacteria 28388

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10012540 Ga0213875_100125403 386
2 3300006880 Ga0075429_100244028 Ga0075429_1002440282 387
3 3300037853 Ga0436364_0643089 Ga0436364_0643089_6649_7839 387
4 3300039437 Ga0436365_1352062 Ga0436365_1352062_727_1917 387
5 3300046477 Ga0495664_0019700 Ga0495664_0019700_13_1242 393
6 3300035086 Ga0373934_0063110 Ga0373934_0063110_67_1317 404
7 3300037068 Ga0373925_0122550 Ga0373925_0122550_191_1582 405
8 3300046459 Ga0495629_0118337 Ga0495629_0118337_311_1702 405
9 3300046477 Ga0495664_0042045 Ga0495664_0042045_760_2151 405
10 3300046517 Ga0495630_0081675 Ga0495630_0081675_615_2006 405
11 3300047319 Ga0495674_0021789 Ga0495674_0021789_3593_4984 405
12 3300047471 Ga0495684_0180379 Ga0495684_0180379_147_1538 405
13 3300053077 Ga0495601_0002168 Ga0495601_0002168_8729_10120 405
14 3300048905 Ga0496102_0069067 Ga0496102_0069067_91_1482 407
15 3300048918 Ga0496115_0047657 Ga0496115_0047657_658_2049 407
16 3300046530 Ga0495654_0016625 Ga0495654_0016625_11_1261 409
17 3300005339 Ga0070660_100004477 Ga0070660_1000044773 410
18 3300014969 Ga0157376_10134600 Ga0157376_101346002 410
19 3300025919 Ga0207657_10001049 Ga0207657_1000104931 410
20 3300037466 Ga0395898_0086460 Ga0395898_0086460_65_1438 413
21 3300044684 Ga0466966_0002457 Ga0466966_0002457_2216_3514 414
22 3300044684 Ga0466966_0019383 Ga0466966_0019383_1087_2502 415
23 3300044765 Ga0466970_0052977 Ga0466970_0052977_457_1872 415
24 3300039437 Ga0436365_0850532 Ga0436365_0850532_135_1523 416
25 3300046452 Ga0495617_052351 Ga0495617_052351_65_1336 416
26 3300046455 Ga0495603_0006417 Ga0495603_0006417_5694_6965 416
27 3300006846 Ga0075430_100005002 Ga0075430_1000050023 418
28 3300006880 Ga0075429_100001085 Ga0075429_1000010853 418
29 3300044712 Ga0453684_0328877 Ga0453684_0328877_46_1350 422
30 3300046536 Ga0495587_0058843 Ga0495587_0058843_566_1855 422
31 3300047322 Ga0495680_0003057 Ga0495680_0003057_8434_9723 422
32 3300046457 Ga0495590_0003380 Ga0495590_0003380_3026_4318 423
33 3300046512 Ga0495610_0023257 Ga0495610_0023257_881_2173 423
34 3300046616 Ga0495668_0009381 Ga0495668_0009381_1890_3182 423
35 3300046684 Ga0495669_0003277 Ga0495669_0003277_467_1759 423
36 3300046692 Ga0495671_0001368 Ga0495671_0001368_14132_15424 423
37 3300046794 Ga0495589_0055718 Ga0495589_0055718_87_1379 423
38 3300047323 Ga0495683_0023882 Ga0495683_0023882_581_1873 423
39 3300009147 Ga0114129_10038117 Ga0114129_100381174 425
40 3300038443 Ga0395901_0098300 Ga0395901_0098300_1566_3002 425
41 3300028381 Ga0268264_10116875 Ga0268264_101168752 426
42 3300049571 Ga0501034_0039482 Ga0501034_0039482_1315_2814 426
43 iso_pu_bacteria 2867428634 2867437391 426
44 3300009011 Ga0105251_10000028 Ga0105251_1000002817 427
45 3300025302 Ga0207426_1027582 Ga0207426_10275822 427
46 3300048921 Ga0496118_0029643 Ga0496118_0029643_777_2081 427
47 3300048924 Ga0496121_0001931 Ga0496121_0001931_21844_23148 427
48 3300048925 Ga0496122_0000043 Ga0496122_0000043_123402_124706 427
49 3300048926 Ga0496123_0000090 Ga0496123_0000090_155621_156925 427
50 3300005329 Ga0070683_100005756 Ga0070683_1000057562 428
51 3300005366 Ga0070659_100019330 Ga0070659_1000193305 428
52 3300005530 Ga0070679_100181330 Ga0070679_1001813301 428
53 3300005563 Ga0068855_100010155 Ga0068855_10001015513 428
54 3300005843 Ga0068860_100255980 Ga0068860_1002559802 428
55 3300009098 Ga0105245_10012419 Ga0105245_100124197 428
56 3300009551 Ga0105238_10006910 Ga0105238_100069109 428
57 3300010375 Ga0105239_10079943 Ga0105239_100799433 428
58 3300011119 Ga0105246_10001045 Ga0105246_1000104513 428
59 3300013296 Ga0157374_10006009 Ga0157374_1000600910 428
60 3300013308 Ga0157375_10040166 Ga0157375_100401663 428
61 3300014325 Ga0163163_10001642 Ga0163163_1000164216 428
62 3300014745 Ga0157377_10003986 Ga0157377_100039869 428
63 3300025901 Ga0207688_10006244 Ga0207688_100062446 428
64 3300025914 Ga0207671_10029571 Ga0207671_100295712 428
65 3300025927 Ga0207687_10020792 Ga0207687_100207927 428
66 3300025932 Ga0207690_10021718 Ga0207690_100217185 428
67 3300025944 Ga0207661_10087281 Ga0207661_100872812 428
68 3300025949 Ga0207667_10004544 Ga0207667_1000454416 428
69 3300026023 Ga0207677_10002013 Ga0207677_100020139 428
70 3300048904 Ga0496101_0004122 Ga0496101_0004122_7159_8550 428
71 3300048905 Ga0496102_0003029 Ga0496102_0003029_1490_2881 428
72 3300048906 Ga0496103_0007509 Ga0496103_0007509_3671_5062 428
73 3300048907 Ga0496104_0019438 Ga0496104_0019438_4094_5485 428
74 3300048909 Ga0496106_0003464 Ga0496106_0003464_1548_2939 428
75 3300048910 Ga0496107_0001433 Ga0496107_0001433_10118_11509 428
76 3300048912 Ga0496109_0009204 Ga0496109_0009204_6040_7431 428
77 3300048913 Ga0496110_0000626 Ga0496110_0000626_20369_21760 428
78 3300048914 Ga0496111_0002176 Ga0496111_0002176_2234_3625 428
79 3300048915 Ga0496112_0006081 Ga0496112_0006081_6215_7606 428
80 3300048916 Ga0496113_0000221 Ga0496113_0000221_19094_20485 428
81 3300048917 Ga0496114_0110821 Ga0496114_0110821_762_2153 428
82 3300048918 Ga0496115_0097216 Ga0496115_0097216_734_2125 428
83 3300049583 Ga0501067_0003460 Ga0501067_0003460_3354_4745 429
84 3300049585 Ga0501069_0032219 Ga0501069_0032219_1208_2599 429
85 3300005436 Ga0070713_100018140 Ga0070713_1000181404 430
86 3300005437 Ga0070710_10092963 Ga0070710_100929632 430
87 3300006175 Ga0070712_100034706 Ga0070712_1000347062 430
88 3300025898 Ga0207692_10017634 Ga0207692_100176342 430
89 3300025928 Ga0207700_10067360 Ga0207700_100673602 430
90 3300046475 Ga0495639_0013655 Ga0495639_0013655_1793_3184 432
91 3300046514 Ga0495618_0009858 Ga0495618_0009858_2865_4256 432
92 3300046531 Ga0495665_0005678 Ga0495665_0005678_4347_5738 432
93 3300046533 Ga0495640_0011451 Ga0495640_0011451_1122_2513 432
94 3300046663 Ga0495635_0053242 Ga0495635_0053242_307_1698 432
95 3300046679 Ga0495623_0091104 Ga0495623_0091104_42_1433 432
96 3300046689 Ga0495613_0004045 Ga0495613_0004045_5068_6459 432
97 3300047321 Ga0495676_0016554 Ga0495676_0016554_4153_5544 432
98 3300048088 Ga0495602_0065236 Ga0495602_0065236_1441_2832 432
99 3300048903 Ga0496100_0005810 Ga0496100_0005810_3384_4772 433
100 3300048907 Ga0496104_0028744 Ga0496104_0028744_265_1653 433
101 3300048908 Ga0496105_0015043 Ga0496105_0015043_1597_2985 433
102 3300048909 Ga0496106_0025424 Ga0496106_0025424_190_1578 433
103 3300048910 Ga0496107_0017720 Ga0496107_0017720_939_2327 433
104 3300048911 Ga0496108_0003468 Ga0496108_0003468_2645_4033 433
105 3300048912 Ga0496109_0012514 Ga0496109_0012514_2566_3954 433
106 3300048913 Ga0496110_0007505 Ga0496110_0007505_4624_6012 433
107 3300048915 Ga0496112_0004855 Ga0496112_0004855_8249_9637 433
108 3300048916 Ga0496113_0008913 Ga0496113_0008913_3212_4600 433
109 3300048917 Ga0496114_0016746 Ga0496114_0016746_1796_3184 433
110 3300049571 Ga0501034_0017350 Ga0501034_0017350_987_2327 433
111 3300049586 Ga0501070_0005845 Ga0501070_0005845_5935_7275 433
112 3300049590 Ga0501074_0002952 Ga0501074_0002952_8758_10098 433
113 3300049742 Ga0501080_0001161 Ga0501080_0001161_18328_19668 433
114 3300026118 Ga0207675_100003571 Ga0207675_10000357113 435
115 3300044901 Ga0466960_0010130 Ga0466960_0010130_2022_3431 435
116 3300046455 Ga0495603_0015487 Ga0495603_0015487_2794_4206 435
117 3300046459 Ga0495629_0045070 Ga0495629_0045070_1473_2885 435
118 3300046674 Ga0495588_0027627 Ga0495588_0027627_697_2109 435
119 3300005366 Ga0070659_100037742 Ga0070659_1000377423 436
120 3300005616 Ga0068852_100014131 Ga0068852_1000141314 436
121 3300005844 Ga0068862_100175452 Ga0068862_1001754522 436
122 3300006028 Ga0070717_10006834 Ga0070717_100068346 436
123 3300006038 Ga0075365_10000417 Ga0075365_100004174 436
124 3300013307 Ga0157372_10081794 Ga0157372_100817943 436
125 3300025230 Ga0209563_100252 Ga0209563_10025220 436
126 3300048911 Ga0496108_0009592 Ga0496108_0009592_961_2364 436
127 3300048912 Ga0496109_0011288 Ga0496109_0011288_5000_6403 436
128 3300048913 Ga0496110_0167819 Ga0496110_0167819_80_1483 436
129 3300050511 nmdc:mga08y16_12848_c1 nmdc:mga08y16_12848_c1_4562_5899 436
130 3300037418 Ga0395900_0071410 Ga0395900_0071410_516_1874 437
131 3300045976 Ga0466967_0052042 Ga0466967_0052042_1822_3246 437
132 3300044901 Ga0466960_0065163 Ga0466960_0065163_86_1525 438
133 3300046694 Ga0495649_0027281 Ga0495649_0027281_1627_3024 438
134 iso_pu_bacteria 2643221576 2643891381 438
135 iso_pu_bacteria 2643221590 2643960429 438
136 iso_pu_bacteria 2643221604 2644036131 438
137 3300005437 Ga0070710_10021222 Ga0070710_100212222 439
138 3300005466 Ga0070685_10037100 Ga0070685_100371002 439
139 3300025940 Ga0207691_10002035 Ga0207691_100020356 439
140 3300028800 Ga0265338_10014545 Ga0265338_100145457 439
141 3300031241 Ga0265325_10002382 Ga0265325_100023822 439
142 3300031712 Ga0265342_10073201 Ga0265342_100732012 439
143 3300041452 Ga0451793_0650080 Ga0451793_0650080_250_1620 439
144 3300046522 Ga0495643_0000049 Ga0495643_0000049_151257_152654 439
145 3300046660 Ga0495625_0023871 Ga0495625_0023871_2216_3613 439
146 3300046692 Ga0495671_0000171 Ga0495671_0000171_6312_7709 439
147 3300047470 Ga0495681_0016834 Ga0495681_0016834_1364_2761 439
148 3300049581 Ga0501047_0129107 Ga0501047_0129107_955_2367 439
149 3300025272 Ga0209455_1001658 Ga0209455_10016583 440
150 3300026089 Ga0207648_10009814 Ga0207648_100098143 440
151 3300048911 Ga0496108_0015083 Ga0496108_0015083_1610_3019 440
152 3300049586 Ga0501070_0002400 Ga0501070_0002400_13780_15276 440
153 3300060353 Ga0501082_0133125 Ga0501082_0133125_44_1417 440
154 3300003752 Ga0055539_1000005 Ga0055539_1000005169 441
155 3300003756 Ga0055533_1000001 Ga0055533_10000011238 441
156 3300003759 Ga0055525_1000380 Ga0055525_10003803 441
157 3300003841 Ga0055541_1004937 Ga0055541_10049372 441
158 3300005340 Ga0070689_100173754 Ga0070689_1001737541 441
159 3300005548 Ga0070665_100076756 Ga0070665_1000767562 441
160 3300009101 Ga0105247_10005054 Ga0105247_100050547 441
161 3300014968 Ga0157379_10030343 Ga0157379_100303437 441
162 3300025225 Ga0209566_100065 Ga0209566_100065178 441
163 3300025226 Ga0209674_100001 Ga0209674_1000011238 441
164 3300025230 Ga0209563_100001 Ga0209563_1000011238 441
165 3300025253 Ga0209677_100001 Ga0209677_1000011238 441
166 3300025935 Ga0207709_10071548 Ga0207709_100715482 441
167 3300026035 Ga0207703_10102515 Ga0207703_101025152 441
168 3300049571 Ga0501034_0025683 Ga0501034_0025683_1294_2697 441
169 3300049572 Ga0501036_0015584 Ga0501036_0015584_1930_3333 441
170 3300049574 Ga0501038_0037453 Ga0501038_0037453_228_1622 441
171 3300049579 Ga0501043_0015877 Ga0501043_0015877_488_1891 441
172 3300049581 Ga0501047_0087631 Ga0501047_0087631_617_2020 441
173 3300049582 Ga0501048_0145498 Ga0501048_0145498_235_1638 441
174 3300049590 Ga0501074_0016811 Ga0501074_0016811_148_1551 441
175 3300049592 Ga0501076_0136471 Ga0501076_0136471_148_1551 441
176 iso_pu_bacteria 2643221641 2644229535 441
177 iso_pu_bacteria 2739367898 2740168406 441
178 iso_pu_bacteria 2906799679 2906799973 441
179 3300005614 Ga0068856_100006739 Ga0068856_10000673913 442
180 3300006871 Ga0075434_100000189 Ga0075434_1000001899 442
181 3300007076 Ga0075435_100001011 Ga0075435_10000101112 442
182 3300013105 Ga0157369_10254076 Ga0157369_102540762 442
183 3300026078 Ga0207702_10059919 Ga0207702_100599192 442
184 3300031901 Ga0307406_10069915 Ga0307406_100699152 442
185 3300031995 Ga0307409_100018133 Ga0307409_1000181332 442
186 3300048918 Ga0496115_0002679 Ga0496115_0002679_8151_9551 442
187 3300050512 nmdc:mga0n895_1334_c1 nmdc:mga0n895_1334_c1_4705_6096 442
188 3300050513 nmdc:mga0rr50_40331_c1 nmdc:mga0rr50_40331_c1_440_1831 442
189 iso_pu_bacteria 2738541305 2738870802 442
190 iso_pu_bacteria 2844841374 2844842903 442
191 iso_pu_bacteria 2856741275 2856744373 442
192 iso_pu_bacteria 2891562705 2891569244 442
193 3300005341 Ga0070691_10046440 Ga0070691_100464401 443
194 3300005564 Ga0070664_100216722 Ga0070664_1002167222 443
195 3300005841 Ga0068863_100171112 Ga0068863_1001711122 443
196 3300006163 Ga0070715_10033815 Ga0070715_100338152 443
197 3300006358 Ga0068871_100073933 Ga0068871_1000739333 443
198 3300010375 Ga0105239_10166043 Ga0105239_101660432 443
199 3300013306 Ga0163162_10039119 Ga0163162_100391193 443
200 3300014325 Ga0163163_10115721 Ga0163163_101157211 443
201 3300014968 Ga0157379_10076652 Ga0157379_100766521 443
202 3300025916 Ga0207663_10036671 Ga0207663_100366712 443
203 3300025949 Ga0207667_10288318 Ga0207667_102883182 443
204 3300026067 Ga0207678_10183650 Ga0207678_101836501 443
205 3300026078 Ga0207702_10254942 Ga0207702_102549421 443
206 3300035083 Ga0373926_0009460 Ga0373926_0009460_636_2042 443
207 3300046461 Ga0495641_0039978 Ga0495641_0039978_229_1635 443
208 3300046462 Ga0495651_0006659 Ga0495651_0006659_6108_7514 443
209 3300046475 Ga0495639_0038331 Ga0495639_0038331_354_1760 443
210 3300046514 Ga0495618_0052858 Ga0495618_0052858_391_1797 443
211 3300046533 Ga0495640_0045545 Ga0495640_0045545_648_2054 443
212 3300046535 Ga0495586_0055565 Ga0495586_0055565_262_1668 443
213 3300046536 Ga0495587_0002980 Ga0495587_0002980_3765_5171 443
214 3300046663 Ga0495635_0081545 Ga0495635_0081545_300_1706 443
215 3300046675 Ga0495657_0039692 Ga0495657_0039692_692_2098 443
216 3300046679 Ga0495623_0022921 Ga0495623_0022921_2556_3962 443
217 3300046680 Ga0495646_0022418 Ga0495646_0022418_1733_3139 443
218 3300047444 Ga0495675_0026189 Ga0495675_0026189_326_1732 443
219 3300047471 Ga0495684_0005519 Ga0495684_0005519_714_2120 443
220 3300048089 Ga0495614_0047864 Ga0495614_0047864_67_1473 443
221 3300048911 Ga0496108_0057415 Ga0496108_0057415_1714_3120 443
222 3300048912 Ga0496109_0083585 Ga0496109_0083585_855_2261 443
223 3300048914 Ga0496111_0017782 Ga0496111_0017782_66_1472 443
224 3300048922 Ga0496119_0045002 Ga0496119_0045002_709_2106 443
225 3300049822 Ga0501035_0034448 Ga0501035_0034448_433_1839 443
226 3300050512 nmdc:mga0n895_95568_c1 nmdc:mga0n895_95568_c1_50_1456 443
227 3300053077 Ga0495601_0121087 Ga0495601_0121087_103_1509 443
228 iso_pu_bacteria 2919395869 2919396232 443
229 3300031911 Ga0307412_10074959 Ga0307412_100749592 444
230 3300032002 Ga0307416_100002034 Ga0307416_1000020345 444
231 3300032126 Ga0307415_100114305 Ga0307415_1001143052 444
232 3300035172 Ga0373955_0023329 Ga0373955_0023329_1003_2415 444
233 3300035724 Ga0373933_0007701 Ga0373933_0007701_513_1925 444
234 3300036401 Ga0373937_0156285 Ga0373937_0156285_405_1817 444
235 3300044694 Ga0466963_0146970 Ga0466963_0146970_139_1542 444
236 3300044719 Ga0466971_0031042 Ga0466971_0031042_152_1567 444
237 3300044765 Ga0466970_0040673 Ga0466970_0040673_685_2097 444
238 3300045049 Ga0466959_0029607 Ga0466959_0029607_2227_3642 444
239 3300046463 Ga0495653_0018739 Ga0495653_0018739_1781_3193 444
240 3300046507 Ga0495606_0000041 Ga0495606_0000041_41236_42816 444
241 3300046511 Ga0495608_0017964 Ga0495608_0017964_1662_3074 444
242 3300046536 Ga0495587_0053015 Ga0495587_0053015_568_1980 444
243 3300046675 Ga0495657_0016894 Ga0495657_0016894_1661_3073 444
244 3300046679 Ga0495623_0047124 Ga0495623_0047124_704_2116 444
245 3300046680 Ga0495646_0079301 Ga0495646_0079301_134_1546 444
246 3300046694 Ga0495649_0000022 Ga0495649_0000022_177410_178990 444
247 3300046809 Ga0495600_0016386 Ga0495600_0016386_131_1543 444
248 3300047322 Ga0495680_0017945 Ga0495680_0017945_268_1680 444
249 3300047471 Ga0495684_0014031 Ga0495684_0014031_3052_4464 444
250 3300048088 Ga0495602_0061044 Ga0495602_0061044_55_1467 444
251 3300048928 Ga0496125_0127627 Ga0496125_0127627_377_1780 444
252 3300049568 Ga0501031_0036433 Ga0501031_0036433_1530_2939 444
253 3300049568 Ga0501031_0059513 Ga0501031_0059513_803_2212 444
254 3300049572 Ga0501036_0028398 Ga0501036_0028398_1791_3200 444
255 3300049586 Ga0501070_0002490 Ga0501070_0002490_11762_13180 444
256 3300049587 Ga0501071_0012031 Ga0501071_0012031_1879_3288 444
257 3300049587 Ga0501071_0052633 Ga0501071_0052633_968_2353 444
258 3300049591 Ga0501075_0016423 Ga0501075_0016423_253_1662 444
259 3300049592 Ga0501076_0018678 Ga0501076_0018678_3039_4448 444
260 3300049743 Ga0501081_0022247 Ga0501081_0022247_112_1521 444
261 3300049824 Ga0501045_0014003 Ga0501045_0014003_2521_3930 444
262 3300053153 Ga0500616_0000183 Ga0500616_0000183_30679_32097 444
263 3300060353 Ga0501082_0225238 Ga0501082_0225238_152_1537 444
264 3300005330 Ga0070690_100011504 Ga0070690_1000115043 445
265 3300005340 Ga0070689_100014630 Ga0070689_1000146304 445
266 3300005345 Ga0070692_10006941 Ga0070692_100069414 445
267 3300005354 Ga0070675_100088572 Ga0070675_1000885722 445
268 3300005356 Ga0070674_100014137 Ga0070674_1000141374 445
269 3300005365 Ga0070688_100013601 Ga0070688_1000136013 445
270 3300005438 Ga0070701_10009540 Ga0070701_100095404 445
271 3300005441 Ga0070700_100084435 Ga0070700_1000844352 445
272 3300005444 Ga0070694_100053650 Ga0070694_1000536502 445
273 3300005444 Ga0070694_100182912 Ga0070694_1001829121 445
274 3300005455 Ga0070663_100026056 Ga0070663_1000260562 445
275 3300005456 Ga0070678_100054328 Ga0070678_1000543283 445
276 3300005456 Ga0070678_100119278 Ga0070678_1001192782 445
277 3300005457 Ga0070662_100052820 Ga0070662_1000528202 445
278 3300005518 Ga0070699_100122518 Ga0070699_1001225182 445
279 3300005547 Ga0070693_100088235 Ga0070693_1000882352 445
280 3300005549 Ga0070704_100025377 Ga0070704_1000253772 445
281 3300005549 Ga0070704_100041217 Ga0070704_1000412172 445
282 3300005563 Ga0068855_100005950 Ga0068855_1000059507 445
283 3300005563 Ga0068855_100078367 Ga0068855_1000783672 445
284 3300005615 Ga0070702_100002049 Ga0070702_1000020493 445
285 3300005617 Ga0068859_100197944 Ga0068859_1001979442 445
286 3300005840 Ga0068870_10013878 Ga0068870_100138783 445
287 3300005843 Ga0068860_100027413 Ga0068860_1000274134 445
288 3300006931 Ga0097620_100197948 Ga0097620_1001979482 445
289 3300009094 Ga0111539_10014975 Ga0111539_100149753 445
290 3300009098 Ga0105245_10043223 Ga0105245_100432231 445
291 3300009176 Ga0105242_10008446 Ga0105242_100084463 445
292 3300009177 Ga0105248_10130522 Ga0105248_101305222 445
293 3300009553 Ga0105249_10003437 Ga0105249_100034373 445
294 3300010375 Ga0105239_10011317 Ga0105239_100113178 445
295 3300013308 Ga0157375_10007971 Ga0157375_100079716 445
296 3300014325 Ga0163163_10035479 Ga0163163_100354793 445
297 3300014326 Ga0157380_10014657 Ga0157380_100146576 445
298 3300025901 Ga0207688_10025712 Ga0207688_100257122 445
299 3300025908 Ga0207643_10004317 Ga0207643_100043173 445
300 3300025918 Ga0207662_10044008 Ga0207662_100440083 445
301 3300025925 Ga0207650_10089409 Ga0207650_100894092 445
302 3300025927 Ga0207687_10033407 Ga0207687_100334074 445
303 3300025927 Ga0207687_10079961 Ga0207687_100799612 445
304 3300025937 Ga0207669_10011927 Ga0207669_100119272 445
305 3300025945 Ga0207679_10027162 Ga0207679_100271623 445
306 3300025949 Ga0207667_10022448 Ga0207667_100224482 445
307 3300026035 Ga0207703_10017164 Ga0207703_100171642 445
308 3300026075 Ga0207708_10010588 Ga0207708_100105883 445
309 3300026075 Ga0207708_10103322 Ga0207708_101033222 445
310 3300026089 Ga0207648_10007537 Ga0207648_100075376 445
311 3300026116 Ga0207674_10041172 Ga0207674_100411723 445
312 3300026121 Ga0207683_10029962 Ga0207683_100299623 445
313 3300028381 Ga0268264_10021585 Ga0268264_100215853 445
314 3300031727 Ga0316576_10004163 Ga0316576_100041632 445
315 3300045051 Ga0451576_0075720 Ga0451576_0075720_227_1621 445
316 3300048907 Ga0496104_0124840 Ga0496104_0124840_62_1453 445
317 3300048913 Ga0496110_0082773 Ga0496110_0082773_1118_2515 445
318 3300048915 Ga0496112_0092581 Ga0496112_0092581_200_1591 445
319 3300048915 Ga0496112_0205095 Ga0496112_0205095_108_1505 445
320 3300048916 Ga0496113_0034990 Ga0496113_0034990_1181_2578 445
321 3300049579 Ga0501043_0155600 Ga0501043_0155600_276_1670 445
322 3300049580 Ga0501046_0085108 Ga0501046_0085108_372_1766 445
323 3300049587 Ga0501071_0120866 Ga0501071_0120866_329_1723 445
324 3300049590 Ga0501074_0011144 Ga0501074_0011144_2029_3525 445
325 3300049591 Ga0501075_0033087 Ga0501075_0033087_1186_2580 445
326 3300049592 Ga0501076_0052032 Ga0501076_0052032_1307_2701 445
327 3300049741 Ga0501079_0020791 Ga0501079_0020791_3540_4934 445
328 3300049824 Ga0501045_0088070 Ga0501045_0088070_138_1532 445
329 3300053078 Ga0495612_0000202 Ga0495612_0000202_15285_16679 445
330 3300054114 Ga0501084_0075765 Ga0501084_0075765_1156_2550 445
331 iso_pu_bacteria 2995726249 2995726874 445
332 iso_pu_bacteria 8002811521 8002813582 445
333 iso_pu_bacteria 8055034563 8055037000 445
334 iso_pu_bacteria 8055037949 8055040602 445
335 3300009147 Ga0114129_10130307 Ga0114129_101303072 446
336 3300009147 Ga0114129_10213756 Ga0114129_102137562 446
337 3300014745 Ga0157377_10133436 Ga0157377_101334361 446
338 3300025919 Ga0207657_10236760 Ga0207657_102367601 446
339 3300025949 Ga0207667_10138203 Ga0207667_101382032 446
340 3300031731 Ga0307405_10080230 Ga0307405_100802302 446
341 3300031731 Ga0307405_10119028 Ga0307405_101190282 446
342 3300032002 Ga0307416_100187723 Ga0307416_1001877232 446
343 3300049571 Ga0501034_0015770 Ga0501034_0015770_604_2031 446
344 3300049571 Ga0501034_0210536 Ga0501034_0210536_64_1491 446
345 3300049586 Ga0501070_0009744 Ga0501070_0009744_1131_2558 446
346 3300049587 Ga0501071_0003074 Ga0501071_0003074_4091_5518 446
347 3300050507 nmdc:mga05p37_230358_c1 nmdc:mga05p37_230358_c1_565_1956 446
348 3300006844 Ga0075428_100047189 Ga0075428_1000471893 447
349 3300006871 Ga0075434_100166335 Ga0075434_1001663352 447
350 3300037466 Ga0395898_0002385 Ga0395898_0002385_15163_16587 447
351 3300049574 Ga0501038_0022537 Ga0501038_0022537_3895_5304 447
352 3300049580 Ga0501046_0033504 Ga0501046_0033504_738_2147 447
353 3300049587 Ga0501071_0093965 Ga0501071_0093965_304_1698 447
354 3300049588 Ga0501072_0007848 Ga0501072_0007848_486_1895 447
355 3300049591 Ga0501075_0093606 Ga0501075_0093606_223_1617 447
356 3300049592 Ga0501076_0045824 Ga0501076_0045824_1234_2643 447
357 3300049592 Ga0501076_0158649 Ga0501076_0158649_34_1428 447
358 3300049744 Ga0501083_0043784 Ga0501083_0043784_155_1564 447
359 3300049824 Ga0501045_0075415 Ga0501045_0075415_161_1570 447
360 3300050512 nmdc:mga0n895_193467_c1 nmdc:mga0n895_193467_c1_246_1640 447
361 3300053136 Ga0500559_0000949 Ga0500559_0000949_10361_11779 447
362 3300005467 Ga0070706_100002897 Ga0070706_1000028974 448
363 3300005471 Ga0070698_100027456 Ga0070698_1000274563 448
364 3300013308 Ga0157375_10031099 Ga0157375_100310994 448
365 3300014968 Ga0157379_10023448 Ga0157379_100234483 448
366 3300025910 Ga0207684_10000712 Ga0207684_100007124 448
367 3300025922 Ga0207646_10003672 Ga0207646_1000367215 448
368 3300044693 Ga0466961_0075897 Ga0466961_0075897_512_1891 448
369 3300044765 Ga0466970_0025976 Ga0466970_0025976_20_1399 448
370 3300045976 Ga0466967_0266919 Ga0466967_0266919_10_1407 448
371 3300046462 Ga0495651_0000746 Ga0495651_0000746_14392_15771 448
372 3300046516 Ga0495628_0003788 Ga0495628_0003788_10480_11859 448
373 3300046529 Ga0495652_0002668 Ga0495652_0002668_495_1874 448
374 3300047317 Ga0495604_0038960 Ga0495604_0038960_621_2000 448
375 iso_pu_bacteria 2891395885 2891395940 448
376 iso_pu_bacteria 3002998708 3003006958 448
377 3300005329 Ga0070683_100007076 Ga0070683_1000070766 449
378 3300005336 Ga0070680_100123933 Ga0070680_1001239333 449
379 3300005444 Ga0070694_100046543 Ga0070694_1000465432 449
380 3300005471 Ga0070698_100052450 Ga0070698_1000524502 449
381 3300005530 Ga0070679_100229784 Ga0070679_1002297842 449
382 3300005546 Ga0070696_100052283 Ga0070696_1000522832 449
383 3300020081 Ga0206354_10254398 Ga0206354_102543983 449
384 3300020082 Ga0206353_10224325 Ga0206353_1022432510 449
385 3300025910 Ga0207684_10017570 Ga0207684_100175704 449
386 3300025912 Ga0207707_10040477 Ga0207707_100404772 449
387 3300025917 Ga0207660_10107824 Ga0207660_101078243 449
388 3300025921 Ga0207652_10065345 Ga0207652_100653453 449
389 3300025944 Ga0207661_10025114 Ga0207661_100251145 449
390 3300031616 Ga0307508_10004026 Ga0307508_100040266 449
391 3300033179 Ga0307507_10007693 Ga0307507_100076937 449
392 3300037068 Ga0373925_0005374 Ga0373925_0005374_111_1520 449
393 3300046459 Ga0495629_0003703 Ga0495629_0003703_7589_8989 449
394 3300046462 Ga0495651_0002533 Ga0495651_0002533_1508_2908 449
395 3300046473 Ga0495582_0019915 Ga0495582_0019915_546_1946 449
396 3300046476 Ga0495662_0005421 Ga0495662_0005421_3128_4528 449
397 3300046477 Ga0495664_0000886 Ga0495664_0000886_1323_2723 449
398 3300046517 Ga0495630_0092409 Ga0495630_0092409_576_1976 449
399 3300046535 Ga0495586_0016218 Ga0495586_0016218_742_2142 449
400 3300046536 Ga0495587_0000351 Ga0495587_0000351_28132_29532 449
401 3300046543 Ga0495645_0015914 Ga0495645_0015914_2721_4121 449
402 3300046642 Ga0495634_0025507 Ga0495634_0025507_1719_3119 449
403 3300046663 Ga0495635_0001252 Ga0495635_0001252_3856_5256 449
404 3300046675 Ga0495657_0002113 Ga0495657_0002113_4177_5577 449
405 3300046680 Ga0495646_0000654 Ga0495646_0000654_11047_12447 449
406 3300046683 Ga0495658_0044021 Ga0495658_0044021_169_1569 449
407 3300046689 Ga0495613_0000863 Ga0495613_0000863_3082_4482 449
408 3300046809 Ga0495600_0004855 Ga0495600_0004855_2996_4396 449
409 3300047315 Ga0495581_0019739 Ga0495581_0019739_793_2193 449
410 3300047317 Ga0495604_0001086 Ga0495604_0001086_5123_6523 449
411 3300047319 Ga0495674_0044265 Ga0495674_0044265_110_1510 449
412 3300047321 Ga0495676_0017686 Ga0495676_0017686_3446_4846 449
413 3300047444 Ga0495675_0036887 Ga0495675_0036887_1691_3091 449
414 3300047471 Ga0495684_0072190 Ga0495684_0072190_823_2223 449
415 3300047673 Ga0495593_0001513 Ga0495593_0001513_1337_2737 449
416 3300048089 Ga0495614_0003675 Ga0495614_0003675_300_1700 449
417 3300048915 Ga0496112_0159799 Ga0496112_0159799_20_1426 449
418 3300048920 Ga0496117_0007927 Ga0496117_0007927_6313_7740 449
419 3300048925 Ga0496122_0000116 Ga0496122_0000116_139310_140737 449
420 3300048926 Ga0496123_0000009 Ga0496123_0000009_188589_190016 449
421 3300048927 Ga0496124_0002284 Ga0496124_0002284_11356_12783 449
422 3300048928 Ga0496125_0017036 Ga0496125_0017036_5399_6826 449
423 3300048929 Ga0496126_0089492 Ga0496126_0089492_810_2237 449
424 iso_pu_bacteria 2856741275 2856742195 449
425 iso_pu_bacteria 2895427314 2895438921 449
426 3300005435 Ga0070714_100158941 Ga0070714_1001589412 450
427 3300005544 Ga0070686_100018885 Ga0070686_1000188851 450
428 3300005615 Ga0070702_100088948 Ga0070702_1000889482 450
429 3300005981 Ga0081538_10002004 Ga0081538_1000200412 450
430 3300005985 Ga0081539_10013276 Ga0081539_100132763 450
431 3300014497 Ga0182008_10040017 Ga0182008_100400172 450
432 3300031730 Ga0307516_10013366 Ga0307516_100133667 450
433 3300035398 Ga0316574_0007972 Ga0316574_0007972_1994_3595 450
434 3300044694 Ga0466963_0030020 Ga0466963_0030020_1822_3231 450
435 3300044765 Ga0466970_0017238 Ga0466970_0017238_1817_3202 450
436 3300044842 Ga0466957_0040579 Ga0466957_0040579_104_1489 450
437 3300045049 Ga0466959_0043854 Ga0466959_0043854_161_1570 450
438 3300045049 Ga0466959_0115921 Ga0466959_0115921_126_1535 450
439 3300045976 Ga0466967_0213442 Ga0466967_0213442_307_1716 450
440 3300049588 Ga0501072_0156985 Ga0501072_0156985_339_1727 450
441 3300049823 Ga0501044_0000883 Ga0501044_0000883_27682_29073 450
442 iso_pu_bacteria 2643221647 2644269627 450
443 iso_pu_bacteria 2731639228 2731908471 450
444 iso_pu_bacteria 2784746768 2785371842 450
445 iso_pu_bacteria 2862507626 2862514305 450
446 iso_pu_bacteria 2954691527 2954694510 450
447 iso_pu_bacteria 2954701450 2954709713 450
448 iso_pu_bacteria 8011350971 8011354681 450
449 3300005329 Ga0070683_100047206 Ga0070683_1000472063 451
450 3300005338 Ga0068868_100088939 Ga0068868_1000889392 451
451 3300005435 Ga0070714_100236547 Ga0070714_1002365471 451
452 3300005455 Ga0070663_100001298 Ga0070663_1000012981 451
453 3300005530 Ga0070679_100003951 Ga0070679_10000395114 451
454 3300009147 Ga0114129_10337423 Ga0114129_103374232 451
455 3300025921 Ga0207652_10001981 Ga0207652_1000198114 451
456 3300026067 Ga0207678_10013299 Ga0207678_100132991 451
457 3300026067 Ga0207678_10153408 Ga0207678_101534081 451
458 3300028794 Ga0307515_10181178 Ga0307515_101811782 451
459 3300031247 Ga0265340_10001983 Ga0265340_100019837 451
460 3300032126 Ga0307415_100047472 Ga0307415_1000474723 451
461 3300037466 Ga0395898_0028932 Ga0395898_0028932_1526_2929 451
462 3300037466 Ga0395898_0062439 Ga0395898_0062439_538_1941 451
463 3300037471 Ga0395905_0164456 Ga0395905_0164456_69_1472 451
464 3300044694 Ga0466963_0012422 Ga0466963_0012422_3408_4826 451
465 3300048903 Ga0496100_0047456 Ga0496100_0047456_499_1884 451
466 3300048904 Ga0496101_0005894 Ga0496101_0005894_5964_7349 451
467 3300048905 Ga0496102_0001742 Ga0496102_0001742_14516_15901 451
468 3300048909 Ga0496106_0027590 Ga0496106_0027590_319_1704 451
469 3300048910 Ga0496107_0001109 Ga0496107_0001109_3504_4889 451
470 3300048912 Ga0496109_0106125 Ga0496109_0106125_317_1702 451
471 3300048914 Ga0496111_0159987 Ga0496111_0159987_149_1576 451
472 3300048917 Ga0496114_0040296 Ga0496114_0040296_1366_2751 451
473 3300048917 Ga0496114_0044606 Ga0496114_0044606_747_2171 451
474 3300049568 Ga0501031_0050743 Ga0501031_0050743_489_1907 451
475 3300049569 Ga0501032_0080781 Ga0501032_0080781_105_1523 451
476 3300049570 Ga0501033_0049129 Ga0501033_0049129_460_1878 451
477 3300049571 Ga0501034_0123701 Ga0501034_0123701_337_1755 451
478 3300049572 Ga0501036_0141521 Ga0501036_0141521_186_1604 451
479 3300049574 Ga0501038_0030461 Ga0501038_0030461_874_2292 451
480 3300049578 Ga0501042_0151998 Ga0501042_0151998_134_1561 451
481 3300049579 Ga0501043_0134425 Ga0501043_0134425_345_1763 451
482 3300049579 Ga0501043_0137119 Ga0501043_0137119_127_1557 451
483 3300049580 Ga0501046_0008749 Ga0501046_0008749_451_1869 451
484 3300049581 Ga0501047_0004050 Ga0501047_0004050_6642_8075 451
485 3300049582 Ga0501048_0037625 Ga0501048_0037625_656_2074 451
486 3300049593 Ga0501077_0090516 Ga0501077_0090516_466_1896 451
487 3300049743 Ga0501081_0154462 Ga0501081_0154462_49_1479 451
488 3300049822 Ga0501035_0004132 Ga0501035_0004132_919_2337 451
489 3300049822 Ga0501035_0119992 Ga0501035_0119992_327_1757 451
490 3300049823 Ga0501044_0164341 Ga0501044_0164341_323_1741 451
491 3300053153 Ga0500616_0000740 Ga0500616_0000740_19338_20804 451
492 iso_pu_bacteria 2912723979 2912729873 451
493 iso_pu_bacteria 3003930520 3003935050 451
494 3300001989 JGI24739J22299_10008030 JGI24739J22299_100080303 452
495 3300005937 Ga0081455_10170803 Ga0081455_101708032 452
496 3300005981 Ga0081538_10003351 Ga0081538_1000335118 452
497 3300006178 Ga0075367_10002121 Ga0075367_100021215 452
498 3300009147 Ga0114129_10047429 Ga0114129_100474293 452
499 3300011119 Ga0105246_10028403 Ga0105246_100284032 452
500 3300014497 Ga0182008_10005025 Ga0182008_100050256 452
501 3300015262 Ga0182007_10002937 Ga0182007_100029374 452
502 3300026121 Ga0207683_10015323 Ga0207683_100153235 452
503 3300027866 Ga0209813_10012039 Ga0209813_100120393 452
504 3300031727 Ga0316576_10020117 Ga0316576_100201172 452
505 3300031730 Ga0307516_10042121 Ga0307516_100421213 452
506 3300031838 Ga0307518_10063752 Ga0307518_100637522 452
507 3300041460 Ga0451802_0529070 Ga0451802_0529070_84_1487 452
508 3300042005 Ga0439448_0005660 Ga0439448_0005660_1730_3148 452
509 3300042012 Ga0439455_0000305 Ga0439455_0000305_646_2064 452
510 3300042138 Ga0450903_000229 Ga0450903_000229_7330_8748 452
511 3300042435 Ga0439434_0015845 Ga0439434_0015845_169_1566 452
512 3300044693 Ga0466961_0091927 Ga0466961_0091927_273_1676 452
513 3300044694 Ga0466963_0068581 Ga0466963_0068581_67_1482 452
514 3300044842 Ga0466957_0073034 Ga0466957_0073034_386_1786 452
515 3300045976 Ga0466967_0007989 Ga0466967_0007989_3135_4538 452
516 3300045976 Ga0466967_0021403 Ga0466967_0021403_251_1654 452
517 3300049571 Ga0501034_0278588 Ga0501034_0278588_55_1464 452
518 3300049575 Ga0501039_0027741 Ga0501039_0027741_1159_2586 452
519 3300049576 Ga0501040_0039961 Ga0501040_0039961_1514_2941 452
520 3300049585 Ga0501069_0009224 Ga0501069_0009224_1265_2656 452
521 3300049586 Ga0501070_0003761 Ga0501070_0003761_2530_3921 452
522 3300049586 Ga0501070_0055646 Ga0501070_0055646_1256_2665 452
523 3300049591 Ga0501075_0043315 Ga0501075_0043315_1206_2633 452
524 3300049824 Ga0501045_0090021 Ga0501045_0090021_279_1706 452
525 3300050494 nmdc:mga06z11_7724_c1 nmdc:mga06z11_7724_c1_1680_3098 452
526 3300050495 nmdc:mga04h51_3779_c1 nmdc:mga04h51_3779_c1_717_2135 452
527 3300050507 nmdc:mga05p37_44482_c1 nmdc:mga05p37_44482_c1_1454_2887 452
528 3300054114 Ga0501084_0115744 Ga0501084_0115744_391_1818 452
529 3300060353 Ga0501082_0013740 Ga0501082_0013740_824_2251 452
530 3300061734 Ga0530510_0000395 Ga0530510_0000395_1682_3109 452
531 iso_pu_bacteria 2582581313 2585307817 452
532 iso_pu_bacteria 2786546132 2786672955 452
533 iso_pu_bacteria 2808606375 2808913922 452
534 iso_pu_bacteria 2877676314 2877678739 452
535 iso_pu_bacteria 2954380949 2954383710 452
536 iso_pu_bacteria 2954673503 2954679263 452
537 iso_pu_bacteria 2954682443 2954684891 452
538 iso_pu_bacteria 2954711539 2954714002 452
539 iso_pu_bacteria 2954721474 2954723971 452
540 iso_pu_bacteria 2954731030 2954737869 452
541 iso_pu_bacteria 2954740390 2954742868 452
542 iso_pu_bacteria 2954749733 2954756721 452
543 iso_pu_bacteria 2954759201 2954761825 452
544 3300005985 Ga0081539_10012226 Ga0081539_100122262 453
545 3300031616 Ga0307508_10086669 Ga0307508_100866693 453
546 3300031727 Ga0316576_10000264 Ga0316576_1000026413 453
547 3300031727 Ga0316576_10008273 Ga0316576_100082734 453
548 3300031727 Ga0316576_10048948 Ga0316576_100489482 453
549 3300031728 Ga0316578_10010547 Ga0316578_100105472 453
550 3300033180 Ga0307510_10108404 Ga0307510_101084042 453
551 3300035398 Ga0316574_0001253 Ga0316574_0001253_8872_10287 453
552 3300036712 Ga0316584_0077304 Ga0316584_0077304_1008_2423 453
553 3300037588 Ga0316581_0000584 Ga0316581_0000584_112_1518 453
554 3300044656 Ga0466969_0000475 Ga0466969_0000475_18948_20345 453
555 3300044693 Ga0466961_0001332 Ga0466961_0001332_638_2035 453
556 3300044719 Ga0466971_0000060 Ga0466971_0000060_13879_15276 453
557 3300045049 Ga0466959_0000813 Ga0466959_0000813_3831_5228 453
558 3300045836 Ga0466958_0073054 Ga0466958_0073054_477_1874 453
559 3300046462 Ga0495651_0011792 Ga0495651_0011792_1901_3298 453
560 3300046514 Ga0495618_0016281 Ga0495618_0016281_1979_3376 453
561 3300046516 Ga0495628_0008618 Ga0495628_0008618_166_1563 453
562 3300046529 Ga0495652_0000965 Ga0495652_0000965_29459_30856 453
563 3300046536 Ga0495587_0111290 Ga0495587_0111290_21_1418 453
564 3300046642 Ga0495634_0097863 Ga0495634_0097863_75_1472 453
565 3300046663 Ga0495635_0014829 Ga0495635_0014829_2567_3964 453
566 3300046679 Ga0495623_0006440 Ga0495623_0006440_5388_6785 453
567 3300048905 Ga0496102_0019642 Ga0496102_0019642_4231_5778 453
568 3300048906 Ga0496103_0014072 Ga0496103_0014072_2349_3896 453
569 3300048922 Ga0496119_0015245 Ga0496119_0015245_386_1798 453
570 3300048924 Ga0496121_0023239 Ga0496121_0023239_3531_4943 453
571 3300049569 Ga0501032_0036294 Ga0501032_0036294_1888_3285 453
572 3300049569 Ga0501032_0041715 Ga0501032_0041715_1072_2472 453
573 3300049569 Ga0501032_0047481 Ga0501032_0047481_596_1996 453
574 3300049571 Ga0501034_0016676 Ga0501034_0016676_5535_6935 453
575 3300049572 Ga0501036_0016970 Ga0501036_0016970_500_1897 453
576 3300049574 Ga0501038_0020677 Ga0501038_0020677_4450_5847 453
577 3300049579 Ga0501043_0173853 Ga0501043_0173853_158_1558 453
578 3300049581 Ga0501047_0045335 Ga0501047_0045335_782_2194 453
579 3300049581 Ga0501047_0045823 Ga0501047_0045823_2236_3636 453
580 3300049581 Ga0501047_0064830 Ga0501047_0064830_1865_3262 453
581 3300049586 Ga0501070_0133458 Ga0501070_0133458_470_1870 453
582 3300049822 Ga0501035_0011659 Ga0501035_0011659_827_2227 453
583 3300049822 Ga0501035_0023132 Ga0501035_0023132_1761_3158 453
584 3300049823 Ga0501044_0048318 Ga0501044_0048318_644_2044 453
585 3300053077 Ga0495601_0136269 Ga0495601_0136269_97_1494 453
586 3300003316 rootH1_10007774 rootH1_100077743 454
587 3300006038 Ga0075365_10017264 Ga0075365_100172642 454
588 3300006353 Ga0075370_10012794 Ga0075370_100127943 454
589 3300009011 Ga0105251_10005290 Ga0105251_100052902 454
590 3300013104 Ga0157370_10000171 Ga0157370_1000017148 454
591 3300015688 Ga0183367_1013 Ga0183367_101358 454
592 3300025297 Ga0209758_1004580 Ga0209758_10045804 454
593 3300025928 Ga0207700_10073395 Ga0207700_100733952 454
594 3300028786 Ga0307517_10027373 Ga0307517_100273731 454
595 3300028794 Ga0307515_10004249 Ga0307515_100042497 454
596 3300028794 Ga0307515_10044960 Ga0307515_100449602 454
597 3300030521 Ga0307511_10000330 Ga0307511_100003307 454
598 3300030522 Ga0307512_10007323 Ga0307512_100073235 454
599 3300031456 Ga0307513_10082868 Ga0307513_100828683 454
600 3300031507 Ga0307509_10046494 Ga0307509_100464944 454
601 3300031507 Ga0307509_10188592 Ga0307509_101885922 454
602 3300031507 Ga0307509_10205063 Ga0307509_102050632 454
603 3300031616 Ga0307508_10010192 Ga0307508_100101925 454
604 3300031616 Ga0307508_10019315 Ga0307508_100193155 454
605 3300031730 Ga0307516_10084360 Ga0307516_100843602 454
606 3300031838 Ga0307518_10022320 Ga0307518_100223203 454
607 3300033179 Ga0307507_10115964 Ga0307507_101159642 454
608 3300037068 Ga0373925_0059805 Ga0373925_0059805_910_2328 454
609 3300037466 Ga0395898_0004392 Ga0395898_0004392_5210_6625 454
610 3300038443 Ga0395901_0160114 Ga0395901_0160114_299_1714 454
611 3300041404 Ga0439436_0000788 Ga0439436_0000788_1827_3263 454
612 3300041404 Ga0439436_0003768 Ga0439436_0003768_35_1438 454
613 3300041406 Ga0439439_0020440 Ga0439439_0020440_166_1569 454
614 3300041512 Ga0451853_1775253 Ga0451853_1775253_2200_3618 454
615 3300042007 Ga0439449_0001531 Ga0439449_0001531_771_2189 454
616 3300042007 Ga0439449_0028057 Ga0439449_0028057_104_1507 454
617 3300042014 Ga0439457_000044 Ga0439457_000044_899_2335 454
618 3300042131 Ga0450894_000003 Ga0450894_000003_35702_37120 454
619 3300042145 Ga0450906_001123 Ga0450906_001123_3590_5008 454
620 3300042184 Ga0450908_005429 Ga0450908_005429_371_1774 454
621 3300044658 Ga0466972_0009062 Ga0466972_0009062_1345_2763 454
622 3300044658 Ga0466972_0009560 Ga0466972_0009560_2152_3555 454
623 3300044683 Ga0466965_0002364 Ga0466965_0002364_6195_7697 454
624 3300044683 Ga0466965_0012254 Ga0466965_0012254_276_1679 454
625 3300044684 Ga0466966_0002355 Ga0466966_0002355_6189_7592 454
626 3300044693 Ga0466961_0009491 Ga0466961_0009491_2326_3729 454
627 3300044693 Ga0466961_0046527 Ga0466961_0046527_503_1921 454
628 3300044693 Ga0466961_0091126 Ga0466961_0091126_370_1788 454
629 3300044694 Ga0466963_0000405 Ga0466963_0000405_8086_9489 454
630 3300044694 Ga0466963_0001645 Ga0466963_0001645_5877_7271 454
631 3300044706 Ga0466964_0026381 Ga0466964_0026381_633_2036 454
632 3300044765 Ga0466970_0004138 Ga0466970_0004138_5159_6562 454
633 3300044842 Ga0466957_0001317 Ga0466957_0001317_11043_12446 454
634 3300045049 Ga0466959_0017438 Ga0466959_0017438_2326_3729 454
635 3300045836 Ga0466958_0016893 Ga0466958_0016893_2224_3627 454
636 3300045976 Ga0466967_0002585 Ga0466967_0002585_2042_3448 454
637 3300045976 Ga0466967_0003148 Ga0466967_0003148_1440_2843 454
638 3300046452 Ga0495617_021645 Ga0495617_021645_273_1676 454
639 3300046454 Ga0495592_0012929 Ga0495592_0012929_345_1748 454
640 3300046455 Ga0495603_0004681 Ga0495603_0004681_1758_3170 454
641 3300046455 Ga0495603_0013191 Ga0495603_0013191_1761_3164 454
642 3300046459 Ga0495629_0019294 Ga0495629_0019294_3148_4575 454
643 3300046459 Ga0495629_0080656 Ga0495629_0080656_301_1713 454
644 3300046462 Ga0495651_0080641 Ga0495651_0080641_10_1413 454
645 3300046474 Ga0495605_0010916 Ga0495605_0010916_2331_3734 454
646 3300046475 Ga0495639_0005669 Ga0495639_0005669_2418_3830 454
647 3300046476 Ga0495662_0002015 Ga0495662_0002015_493_1905 454
648 3300046492 Ga0495585_0049233 Ga0495585_0049233_375_1775 454
649 3300046499 Ga0495594_0031376 Ga0495594_0031376_1429_2856 454
650 3300046499 Ga0495594_0061360 Ga0495594_0061360_615_2018 454
651 3300046499 Ga0495594_0102994 Ga0495594_0102994_55_1467 454
652 3300046501 Ga0495607_0027885 Ga0495607_0027885_599_2002 454
653 3300046507 Ga0495606_0005398 Ga0495606_0005398_3175_4578 454
654 3300046512 Ga0495610_0048360 Ga0495610_0048360_473_1876 454
655 3300046513 Ga0495616_0005334 Ga0495616_0005334_4595_5998 454
656 3300046515 Ga0495620_0033191 Ga0495620_0033191_932_2335 454
657 3300046518 Ga0495631_0003400 Ga0495631_0003400_4730_6133 454
658 3300046522 Ga0495643_0001191 Ga0495643_0001191_367_1770 454
659 3300046524 Ga0495648_0047063 Ga0495648_0047063_354_1757 454
660 3300046526 Ga0495666_0052924 Ga0495666_0052924_97_1500 454
661 3300046528 Ga0495642_0047542 Ga0495642_0047542_138_1541 454
662 3300046529 Ga0495652_0041521 Ga0495652_0041521_2103_3506 454
663 3300046533 Ga0495640_0011728 Ga0495640_0011728_3380_4798 454
664 3300046538 Ga0495609_0012936 Ga0495609_0012936_529_1932 454
665 3300046543 Ga0495645_0039887 Ga0495645_0039887_605_2017 454
666 3300046557 Ga0495622_0004423 Ga0495622_0004423_4887_6290 454
667 3300046557 Ga0495622_0046644 Ga0495622_0046644_493_1905 454
668 3300046616 Ga0495668_0061970 Ga0495668_0061970_345_1772 454
669 3300046674 Ga0495588_0059456 Ga0495588_0059456_562_1962 454
670 3300046679 Ga0495623_0071397 Ga0495623_0071397_470_1873 454
671 3300046689 Ga0495613_0057350 Ga0495613_0057350_1220_2623 454
672 3300046691 Ga0495670_0022508 Ga0495670_0022508_1490_2917 454
673 3300046692 Ga0495671_0009137 Ga0495671_0009137_2948_4375 454
674 3300046794 Ga0495589_0009299 Ga0495589_0009299_874_2301 454
675 3300046794 Ga0495589_0021953 Ga0495589_0021953_393_1796 454
676 3300047315 Ga0495581_0040241 Ga0495581_0040241_537_1949 454
677 3300047318 Ga0495636_0053621 Ga0495636_0053621_188_1588 454
678 3300047319 Ga0495674_0002467 Ga0495674_0002467_16563_17981 454
679 3300047321 Ga0495676_0024766 Ga0495676_0024766_2024_3427 454
680 3300047322 Ga0495680_0059882 Ga0495680_0059882_1108_2511 454
681 3300047443 Ga0495687_001298 Ga0495687_001298_530_1942 454
682 3300047443 Ga0495687_002153 Ga0495687_002153_3994_5397 454
683 3300047445 Ga0495677_0021634 Ga0495677_0021634_159_1562 454
684 3300047447 Ga0495685_002436 Ga0495685_002436_2634_4061 454
685 3300047447 Ga0495685_005907 Ga0495685_005907_2330_3733 454
686 3300047470 Ga0495681_0001153 Ga0495681_0001153_12114_13541 454
687 3300048907 Ga0496104_0183021 Ga0496104_0183021_320_1732 454
688 3300048912 Ga0496109_0012931 Ga0496109_0012931_3326_4738 454
689 3300048917 Ga0496114_0089399 Ga0496114_0089399_438_1835 454
690 3300048927 Ga0496124_0046311 Ga0496124_0046311_1904_3289 454
691 3300048929 Ga0496126_0239479 Ga0496126_0239479_33_1505 454
692 3300049459 Ga0495678_031661 Ga0495678_031661_335_1738 454
693 3300049570 Ga0501033_0090358 Ga0501033_0090358_234_1652 454
694 3300049571 Ga0501034_0015605 Ga0501034_0015605_5357_6775 454
695 3300049571 Ga0501034_0046905 Ga0501034_0046905_2852_4270 454
696 3300049572 Ga0501036_0000189 Ga0501036_0000189_17406_18824 454
697 3300049573 Ga0501037_0102896 Ga0501037_0102896_262_1665 454
698 3300049574 Ga0501038_0009078 Ga0501038_0009078_5434_6852 454
699 3300049574 Ga0501038_0013067 Ga0501038_0013067_6094_7512 454
700 3300049575 Ga0501039_0065721 Ga0501039_0065721_309_1727 454
701 3300049579 Ga0501043_0000373 Ga0501043_0000373_8893_10311 454
702 3300049580 Ga0501046_0123638 Ga0501046_0123638_227_1660 454
703 3300049581 Ga0501047_0075166 Ga0501047_0075166_1366_2769 454
704 3300049589 Ga0501073_0148866 Ga0501073_0148866_164_1567 454
705 3300049590 Ga0501074_0003673 Ga0501074_0003673_5780_7198 454
706 3300049822 Ga0501035_0000934 Ga0501035_0000934_22085_23503 454
707 3300049822 Ga0501035_0116871 Ga0501035_0116871_288_1691 454
708 3300049823 Ga0501044_0134122 Ga0501044_0134122_457_1860 454
709 3300050496 nmdc:mga07m45_31724_c1 nmdc:mga07m45_31724_c1_1464_2891 454
710 3300053077 Ga0495601_0022490 Ga0495601_0022490_234_1652 454
711 3300053107 Ga0500560_001395 Ga0500560_001395_543_1970 454
712 3300061719 Ga0466962_0001787 Ga0466962_0001787_5876_7279 454
713 3300061719 Ga0466962_0059192 Ga0466962_0059192_64_1494 454
714 iso_pu_bacteria 2511231012 2511302709 454
715 iso_pu_bacteria 2511231014 2511314100 454
716 iso_pu_bacteria 2511231020 2511350176 454
717 iso_pu_bacteria 2547132111 2547410609 454
718 iso_pu_bacteria 2554235005 2554255987 454
719 iso_pu_bacteria 2582581314 2585316795 454
720 iso_pu_bacteria 2616644814 2616700080 454
721 iso_pu_bacteria 2643221589 2643956723 454
722 iso_pu_bacteria 2643221602 2644021946 454
723 iso_pu_bacteria 2643221678 2644437733 454
724 iso_pu_bacteria 2643221714 2644629879 454
725 iso_pu_bacteria 2738543020 2739287541 454
726 iso_pu_bacteria 2738543021 2739292854 454
727 iso_pu_bacteria 2784132148 2784590672 454
728 iso_pu_bacteria 2784746763 2785340910 454
729 iso_pu_bacteria 2802429296 2804848204 454
730 iso_pu_bacteria 2808606359 2808844344 454
731 iso_pu_bacteria 2808606382 2808960633 454
732 iso_pu_bacteria 2808606385 2808979314 454
733 iso_pu_bacteria 2808606388 2808995238 454
734 iso_pu_bacteria 2808606448 2809234360 454
735 iso_pu_bacteria 2811994879 2812355648 454
736 iso_pu_bacteria 2811994917 2812478489 454
737 iso_pu_bacteria 2818991463 2819698914 454
738 iso_pu_bacteria 2842805378 2842805949 454
739 iso_pu_bacteria 2852612431 2852618319 454
740 iso_pu_bacteria 2852635781 2852639757 454
741 iso_pu_bacteria 2852667396 2852673545 454
742 iso_pu_bacteria 2862281513 2862284302 454
743 iso_pu_bacteria 2862382967 2862388853 454
744 iso_pu_bacteria 2862574272 2862577193 454
745 iso_pu_bacteria 2863404153 2863408935 454
746 iso_pu_bacteria 2873151551 2873153785 454
747 iso_pu_bacteria 2904550169 2904552089 454
748 iso_pu_bacteria 2912715099 2912717306 454
749 iso_pu_bacteria 2919468124 2919472530 454
750 iso_pu_bacteria 2939636861 2939640021 454
751 iso_pu_bacteria 2946064051 2946070142 454
752 iso_pu_bacteria 2946072368 2946078021 454
753 iso_pu_bacteria 2947224130 2947226651 454
754 iso_pu_bacteria 2954002825 2954005830 454
755 iso_pu_bacteria 2966598605 2966600573 454
756 iso_pu_bacteria 2990059506 2990062420 454
757 iso_pu_bacteria 3006393351 3006397950 454
758 iso_pu_bacteria 3006493962 3006500002 454
759 iso_pu_bacteria 8008558824 8008563094 454
760 iso_pu_bacteria 8008574985 8008576860 454
761 iso_pu_bacteria 8023623736 8023625680 454
762 iso_pu_bacteria 8025413630 8025414242 454
763 iso_pu_bacteria 8048406513 8048409823 454
764 iso_pu_bacteria 8056125926 8056129505 454
765 iso_pu_bacteria 8056829672 8056831624 454
766 3300005329 Ga0070683_100001804 Ga0070683_1000018047 455
767 3300005340 Ga0070689_100045036 Ga0070689_1000450363 455
768 3300005366 Ga0070659_100090172 Ga0070659_1000901721 455
769 3300005441 Ga0070700_100005709 Ga0070700_1000057096 455
770 3300005535 Ga0070684_100010212 Ga0070684_1000102127 455
771 3300005543 Ga0070672_100012120 Ga0070672_1000121205 455
772 3300005563 Ga0068855_100264310 Ga0068855_1002643102 455
773 3300005577 Ga0068857_100001615 Ga0068857_10000161510 455
774 3300009093 Ga0105240_10097074 Ga0105240_100970743 455
775 3300009094 Ga0111539_10045910 Ga0111539_100459105 455
776 3300009098 Ga0105245_10051117 Ga0105245_100511172 455
777 3300009147 Ga0114129_10203705 Ga0114129_102037052 455
778 3300009174 Ga0105241_10016538 Ga0105241_100165384 455
779 3300009545 Ga0105237_10028680 Ga0105237_100286805 455
780 3300009553 Ga0105249_10061989 Ga0105249_100619893 455
781 3300009553 Ga0105249_10119646 Ga0105249_101196463 455
782 3300010375 Ga0105239_10221035 Ga0105239_102210352 455
783 3300025913 Ga0207695_10161214 Ga0207695_101612142 455
784 3300025927 Ga0207687_10036767 Ga0207687_100367673 455
785 3300025936 Ga0207670_10057461 Ga0207670_100574613 455
786 3300025944 Ga0207661_10009900 Ga0207661_100099004 455
787 3300025949 Ga0207667_10042075 Ga0207667_100420752 455
788 3300025961 Ga0207712_10027414 Ga0207712_100274142 455
789 3300026075 Ga0207708_10002698 Ga0207708_100026984 455
790 3300026075 Ga0207708_10020860 Ga0207708_100208602 455
791 3300026116 Ga0207674_10003543 Ga0207674_1000354317 455
792 3300026142 Ga0207698_10117615 Ga0207698_101176152 455
793 3300027907 Ga0207428_10021554 Ga0207428_100215542 455
794 3300031727 Ga0316576_10028397 Ga0316576_100283972 455
795 3300035086 Ga0373934_0057165 Ga0373934_0057165_12_1454 455
796 3300035172 Ga0373955_0043032 Ga0373955_0043032_500_1924 455
797 3300036401 Ga0373937_0076053 Ga0373937_0076053_295_1719 455
798 3300037068 Ga0373925_0007744 Ga0373925_0007744_6234_7658 455
799 3300044706 Ga0466964_0021468 Ga0466964_0021468_534_1931 455
800 3300044765 Ga0466970_0033609 Ga0466970_0033609_987_2399 455
801 3300046455 Ga0495603_0010086 Ga0495603_0010086_752_2158 455
802 3300046511 Ga0495608_0000285 Ga0495608_0000285_17319_18743 455
803 3300046516 Ga0495628_0014784 Ga0495628_0014784_2394_3818 455
804 3300046522 Ga0495643_0001671 Ga0495643_0001671_445_1833 455
805 3300046529 Ga0495652_0001447 Ga0495652_0001447_12167_13591 455
806 3300046531 Ga0495665_0004737 Ga0495665_0004737_4064_5470 455
807 3300046533 Ga0495640_0051661 Ga0495640_0051661_143_1567 455
808 3300046543 Ga0495645_0097618 Ga0495645_0097618_366_1793 455
809 3300046559 Ga0495667_0000323 Ga0495667_0000323_16190_17614 455
810 3300046663 Ga0495635_0001065 Ga0495635_0001065_4104_5528 455
811 3300046675 Ga0495657_0000950 Ga0495657_0000950_18403_19827 455
812 3300046678 Ga0495599_0007717 Ga0495599_0007717_62_1486 455
813 3300046694 Ga0495649_0012409 Ga0495649_0012409_3210_4598 455
814 3300046809 Ga0495600_0002680 Ga0495600_0002680_2989_4413 455
815 3300047315 Ga0495581_0022343 Ga0495581_0022343_2078_3484 455
816 3300047317 Ga0495604_0002820 Ga0495604_0002820_8167_9591 455
817 3300047322 Ga0495680_0003938 Ga0495680_0003938_225_1649 455
818 3300048905 Ga0496102_0031270 Ga0496102_0031270_479_1879 455
819 3300048922 Ga0496119_0000055 Ga0496119_0000055_58515_59912 455
820 3300048923 Ga0496120_0035633 Ga0496120_0035633_811_2208 455
821 3300050492 nmdc:mga0yw44_4806_c1 nmdc:mga0yw44_4806_c1_4691_6097 455
822 3300050507 nmdc:mga05p37_187626_c1 nmdc:mga05p37_187626_c1_275_1687 455
823 3300050511 nmdc:mga08y16_12302_c1 nmdc:mga08y16_12302_c1_4128_5534 455
824 3300005341 Ga0070691_10046653 Ga0070691_100466531 456
825 3300005367 Ga0070667_100004625 Ga0070667_1000046253 456
826 3300005548 Ga0070665_100005781 Ga0070665_1000057812 456
827 3300009098 Ga0105245_10080823 Ga0105245_100808233 456
828 3300014325 Ga0163163_10168250 Ga0163163_101682502 456
829 3300025903 Ga0207680_10001832 Ga0207680_100018322 456
830 3300025905 Ga0207685_10006028 Ga0207685_100060282 456
831 3300025986 Ga0207658_10005964 Ga0207658_100059644 456
832 3300026075 Ga0207708_10062163 Ga0207708_100621632 456
833 3300028379 Ga0268266_10000867 Ga0268266_1000086725 456
834 3300036712 Ga0316584_0065400 Ga0316584_0065400_806_2236 456
835 3300041407 Ga0439447_013272 Ga0439447_013272_156_1550 456
836 3300041411 Ga0439466_0004751 Ga0439466_0004751_1925_3319 456
837 3300048905 Ga0496102_0019597 Ga0496102_0019597_4295_5698 456
838 3300048908 Ga0496105_0042837 Ga0496105_0042837_1536_2939 456
839 3300048913 Ga0496110_0053821 Ga0496110_0053821_53_1456 456
840 3300048914 Ga0496111_0019438 Ga0496111_0019438_1693_3096 456
841 3300048917 Ga0496114_0041945 Ga0496114_0041945_1650_3053 456
842 3300048927 Ga0496124_0067892 Ga0496124_0067892_104_1558 456
843 3300049568 Ga0501031_0004230 Ga0501031_0004230_7731_9182 456
844 3300049569 Ga0501032_0000727 Ga0501032_0000727_8831_10282 456
845 3300049570 Ga0501033_0000159 Ga0501033_0000159_54780_56231 456
846 3300049571 Ga0501034_0002444 Ga0501034_0002444_18728_20179 456
847 3300049572 Ga0501036_0006157 Ga0501036_0006157_8196_9647 456
848 3300049573 Ga0501037_0000650 Ga0501037_0000650_16574_18025 456
849 3300049574 Ga0501038_0005789 Ga0501038_0005789_2268_3719 456
850 3300049579 Ga0501043_0001858 Ga0501043_0001858_54_1505 456
851 3300049580 Ga0501046_0001066 Ga0501046_0001066_8807_10258 456
852 3300049581 Ga0501047_0000716 Ga0501047_0000716_33039_34490 456
853 3300049582 Ga0501048_0001489 Ga0501048_0001489_7788_9239 456
854 3300049586 Ga0501070_0000131 Ga0501070_0000131_57161_58612 456
855 3300049587 Ga0501071_0070828 Ga0501071_0070828_89_1504 456
856 3300049588 Ga0501072_0090494 Ga0501072_0090494_539_1954 456
857 3300049589 Ga0501073_0010742 Ga0501073_0010742_88_1539 456
858 3300049741 Ga0501079_0036828 Ga0501079_0036828_2244_3695 456
859 3300049742 Ga0501080_0008643 Ga0501080_0008643_48_1499 456
860 3300049744 Ga0501083_0001155 Ga0501083_0001155_7752_9203 456
861 3300049822 Ga0501035_0000684 Ga0501035_0000684_16622_18073 456
862 3300049823 Ga0501044_0020131 Ga0501044_0020131_505_1956 456
863 3300049824 Ga0501045_0046651 Ga0501045_0046651_41_1456 456
864 3300049824 Ga0501045_0055757 Ga0501045_0055757_1351_2802 456
865 3300054114 Ga0501084_0231104 Ga0501084_0231104_77_1528 456
866 3300060353 Ga0501082_0012318 Ga0501082_0012318_5883_7334 456
867 3300046453 Ga0495627_000010 Ga0495627_000010_211467_212861 457
868 2162886007 SwRhRL2b_contig_2356726 SwRhRL2b_0242.00001450 458
869 3300005289 Ga0065704_10000402 Ga0065704_1000040211 458
870 3300006051 Ga0075364_10175155 Ga0075364_101751551 458
871 3300006177 Ga0075362_10035626 Ga0075362_100356262 458
872 3300006914 Ga0075436_100156674 Ga0075436_1001566742 458
873 3300006946 Ga0079104_1000142 Ga0079104_100014251 458
874 3300009036 Ga0105244_10035727 Ga0105244_100357272 458
875 3300009092 Ga0105250_10016941 Ga0105250_100169412 458
876 3300009148 Ga0105243_10153370 Ga0105243_101533702 458
877 3300013100 Ga0157373_10007299 Ga0157373_100072994 458
878 3300013100 Ga0157373_10145311 Ga0157373_101453111 458
879 3300013104 Ga0157370_10002106 Ga0157370_1000210614 458
880 3300013306 Ga0163162_10234050 Ga0163162_102340502 458
881 3300014497 Ga0182008_10041075 Ga0182008_100410752 458
882 3300017792 Ga0163161_10184772 Ga0163161_101847721 458
883 3300025292 Ga0209676_1002314 Ga0209676_10023149 458
884 3300025303 Ga0209051_1004589 Ga0209051_10045896 458
885 3300025728 Ga0207655_1017889 Ga0207655_10178894 458
886 3300025735 Ga0207713_1001010 Ga0207713_100101017 458
887 3300025735 Ga0207713_1009028 Ga0207713_10090285 458
888 3300027111 Ga0209281_1000262 Ga0209281_100026254 458
889 3300027907 Ga0207428_10049408 Ga0207428_100494083 458
890 3300041405 Ga0439438_001614 Ga0439438_001614_3950_5347 458
891 3300041411 Ga0439466_0005924 Ga0439466_0005924_2093_3490 458
892 3300042006 Ga0439432_005551 Ga0439432_005551_2634_4031 458
893 3300042010 Ga0439452_009596 Ga0439452_009596_506_1903 458
894 3300042138 Ga0450903_001641 Ga0450903_001641_955_2352 458
895 3300042146 Ga0450907_000306 Ga0450907_000306_14573_15970 458
896 3300042184 Ga0450908_000127 Ga0450908_000127_13763_15160 458
897 3300046452 Ga0495617_000964 Ga0495617_000964_5408_6805 458
898 3300046452 Ga0495617_001697 Ga0495617_001697_3332_4729 458
899 3300046452 Ga0495617_009443 Ga0495617_009443_1550_2971 458
900 3300046453 Ga0495627_005625 Ga0495627_005625_1160_2581 458
901 3300046457 Ga0495590_0016508 Ga0495590_0016508_884_2281 458
902 3300046458 Ga0495591_007604 Ga0495591_007604_3006_4403 458
903 3300046458 Ga0495591_021625 Ga0495591_021625_643_2040 458
904 3300046460 Ga0495638_0002134 Ga0495638_0002134_13654_15075 458
905 3300046460 Ga0495638_0013116 Ga0495638_0013116_1258_2655 458
906 3300046460 Ga0495638_0020491 Ga0495638_0020491_2720_4117 458
907 3300046460 Ga0495638_0062447 Ga0495638_0062447_326_1723 458
908 3300046471 Ga0495650_0001024 Ga0495650_0001024_21249_22646 458
909 3300046471 Ga0495650_0027295 Ga0495650_0027295_487_1884 458
910 3300046474 Ga0495605_0000631 Ga0495605_0000631_23940_25337 458
911 3300046474 Ga0495605_0005433 Ga0495605_0005433_1982_3379 458
912 3300046474 Ga0495605_0043040 Ga0495605_0043040_471_1868 458
913 3300046475 Ga0495639_0006950 Ga0495639_0006950_2191_3612 458
914 3300046491 Ga0495584_0004684 Ga0495584_0004684_467_1864 458
915 3300046491 Ga0495584_0011750 Ga0495584_0011750_2562_3959 458
916 3300046491 Ga0495584_0026117 Ga0495584_0026117_1059_2456 458
917 3300046492 Ga0495585_0001103 Ga0495585_0001103_20050_21471 458
918 3300046492 Ga0495585_0008010 Ga0495585_0008010_2282_3679 458
919 3300046492 Ga0495585_0040538 Ga0495585_0040538_469_1866 458
920 3300046506 Ga0495583_0001013 Ga0495583_0001013_3936_5333 458
921 3300046507 Ga0495606_0021936 Ga0495606_0021936_1917_3314 458
922 3300046512 Ga0495610_0029001 Ga0495610_0029001_174_1571 458
923 3300046512 Ga0495610_0077354 Ga0495610_0077354_85_1482 458
924 3300046513 Ga0495616_0004215 Ga0495616_0004215_6244_7641 458
925 3300046515 Ga0495620_0006554 Ga0495620_0006554_2369_3766 458
926 3300046519 Ga0495632_0001095 Ga0495632_0001095_6154_7551 458
927 3300046520 Ga0495637_0001115 Ga0495637_0001115_11369_12766 458
928 3300046520 Ga0495637_0008695 Ga0495637_0008695_99_1496 458
929 3300046522 Ga0495643_0073013 Ga0495643_0073013_52_1449 458
930 3300046523 Ga0495644_0011204 Ga0495644_0011204_545_1942 458
931 3300046524 Ga0495648_0000935 Ga0495648_0000935_25908_27305 458
932 3300046524 Ga0495648_0004862 Ga0495648_0004862_6916_8313 458
933 3300046526 Ga0495666_0042680 Ga0495666_0042680_209_1606 458
934 3300046528 Ga0495642_0000018 Ga0495642_0000018_58228_59625 458
935 3300046528 Ga0495642_0061679 Ga0495642_0061679_75_1472 458
936 3300046530 Ga0495654_0036482 Ga0495654_0036482_916_2313 458
937 3300046530 Ga0495654_0049169 Ga0495654_0049169_54_1451 458
938 3300046538 Ga0495609_0022460 Ga0495609_0022460_203_1600 458
939 3300046542 Ga0495597_0040425 Ga0495597_0040425_465_1862 458
940 3300046542 Ga0495597_0040958 Ga0495597_0040958_648_2045 458
941 3300046615 Ga0495656_0004404 Ga0495656_0004404_1188_2585 458
942 3300046660 Ga0495625_0007943 Ga0495625_0007943_5875_7272 458
943 3300046660 Ga0495625_0029829 Ga0495625_0029829_2482_3903 458
944 3300046665 Ga0495661_0013465 Ga0495661_0013465_929_2326 458
945 3300046674 Ga0495588_0026184 Ga0495588_0026184_1011_2408 458
946 3300046679 Ga0495623_0000754 Ga0495623_0000754_14638_16035 458
947 3300046684 Ga0495669_0000858 Ga0495669_0000858_201_1598 458
948 3300046691 Ga0495670_0000942 Ga0495670_0000942_6176_7573 458
949 3300046691 Ga0495670_0001398 Ga0495670_0001398_1613_3034 458
950 3300046691 Ga0495670_0013532 Ga0495670_0013532_1436_2857 458
951 3300046691 Ga0495670_0060219 Ga0495670_0060219_141_1538 458
952 3300046692 Ga0495671_0007991 Ga0495671_0007991_2098_3495 458
953 3300046692 Ga0495671_0022532 Ga0495671_0022532_919_2316 458
954 3300046692 Ga0495671_0030651 Ga0495671_0030651_935_2356 458
955 3300046692 Ga0495671_0063085 Ga0495671_0063085_50_1447 458
956 3300046794 Ga0495589_0000184 Ga0495589_0000184_3317_4714 458
957 3300046810 Ga0495660_0011625 Ga0495660_0011625_398_1819 458
958 3300046810 Ga0495660_0015806 Ga0495660_0015806_2068_3465 458
959 3300046810 Ga0495660_0080852 Ga0495660_0080852_47_1444 458
960 3300046810 Ga0495660_0099527 Ga0495660_0099527_55_1452 458
961 3300047318 Ga0495636_0074976 Ga0495636_0074976_38_1435 458
962 3300047320 Ga0495672_0007796 Ga0495672_0007796_445_1866 458
963 3300047320 Ga0495672_0012207 Ga0495672_0012207_1423_2820 458
964 3300047322 Ga0495680_0016873 Ga0495680_0016873_2911_4308 458
965 3300047323 Ga0495683_0000578 Ga0495683_0000578_12021_13418 458
966 3300047443 Ga0495687_000294 Ga0495687_000294_56261_57658 458
967 3300047444 Ga0495675_0001430 Ga0495675_0001430_703_2100 458
968 3300047445 Ga0495677_0000905 Ga0495677_0000905_4386_5783 458
969 3300047446 Ga0495679_003079 Ga0495679_003079_2939_4336 458
970 3300047469 Ga0495673_0000960 Ga0495673_0000960_15264_16661 458
971 3300047469 Ga0495673_0005727 Ga0495673_0005727_3648_5045 458
972 3300047469 Ga0495673_0007256 Ga0495673_0007256_2671_4068 458
973 3300047469 Ga0495673_0015550 Ga0495673_0015550_2045_3442 458
974 3300047469 Ga0495673_0019178 Ga0495673_0019178_1264_2661 458
975 3300047470 Ga0495681_0002427 Ga0495681_0002427_3692_5089 458
976 3300047470 Ga0495681_0003291 Ga0495681_0003291_4915_6312 458
977 3300047471 Ga0495684_0002639 Ga0495684_0002639_12361_13758 458
978 3300047472 Ga0495686_0011949 Ga0495686_0011949_520_1917 458
979 3300047673 Ga0495593_0000492 Ga0495593_0000492_6730_8127 458
980 3300048091 Ga0495626_0000079 Ga0495626_0000079_59522_60919 458
981 3300048091 Ga0495626_0000992 Ga0495626_0000992_16058_17455 458
982 3300048091 Ga0495626_0002392 Ga0495626_0002392_965_2362 458
983 3300048091 Ga0495626_0013719 Ga0495626_0013719_1751_3148 458
984 3300048920 Ga0496117_0038515 Ga0496117_0038515_392_1789 458
985 3300048921 Ga0496118_0027862 Ga0496118_0027862_180_1577 458
986 3300048927 Ga0496124_0022995 Ga0496124_0022995_1611_3008 458
987 3300048928 Ga0496125_0020034 Ga0496125_0020034_4083_5504 458
988 3300049459 Ga0495678_038980 Ga0495678_038980_58_1455 458
989 3300049460 Ga0495682_0001733 Ga0495682_0001733_8851_10272 458
990 3300049460 Ga0495682_0027900 Ga0495682_0027900_655_2052 458
991 3300050489 nmdc:mga03683_8957_c1 nmdc:mga03683_8957_c1_2123_3520 458
992 3300050514 nmdc:mga08x19_21515_c1 nmdc:mga08x19_21515_c1_2501_3898 458
993 3300050516 nmdc:mga0sz30_855_c2 nmdc:mga0sz30_855_c2_2285_3682 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

105

466

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9338 39 70
3dzb-assembly1.cif.gz_B crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9309 39 70
1guz-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9146 39 70
3b1f-assembly1.cif.gz_A-2 crystal structure of prephenate dehydrogenase from streptococcus mutans 0.8959 37 71
3p7m-assembly1.cif.gz_C structure of putative lactate dehydrogenase from francisella tularensis subsp. tularensis schu s4 0.8891 36 71
ID Description Score Start End Superfamily
af_Q9VIP2_8_110_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9796 42 71 3.50.50.60
3iwaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9443 39 68 3.50.50.60
1yqzB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9416 39 69 3.50.50.60
3c4aA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9341 39 71 3.50.50.60
3dzbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9338 39 70 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1M4XDM1-F1-model_v4 Glycine/D-amino acid oxidase 0.9799 8 458 GO:0005737
AF-A0A353KKS1-F1-model_v4 deleted 0.9692 154 458
AF-A0A6J7DTI1-F1-model_v4 Unannotated protein 0.9682 5 458 GO:0005737
AF-A0A7K1J0U6-F1-model_v4 FAD-dependent oxidoreductase 0.9663 1 393 GO:0005737
AF-A0A124E1L2-F1-model_v4 FAD dependent oxidoreductase 0.9652 5 458 GO:0005737

Feature Viewer

pLDDT pTM Quality
90.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map