F487657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 992 | 341 | 1984 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10072518|Ga0075366_100725182 |
| Length | 446 |
| Sequence | LKSWKEVRCVEKCKVIKGKDTTVFKLVFRTFRLSLTEISFIYATDFHNQALVAFYAADFLRTIRRIFAPGMTMQLKDLYDKASAFGFLSVEEGVFLYHHAPLTDLMFIADELRKKQVPHGKVTWQIDRNVNTTNVCIANCKFCNFYRIPGHAEAYITDMPVYRKKIEETLKYGGDQLLLQGGHHPELGLQFYIDTFSQIKKEFPAIKLHALGPPEVAHITKLEKSTHREVLMALKEAGLDSLPGAGAEILIDRVRRLISKGKCGAQEWLDIMHEAHKLNITTSATMMFGHVETIEERFEHLVRIREVQSRKPENAKGFLAFIPWTFQDVDTLLARIRGVHNLTTPEEYIRMIALSRIMLPNVKNIQASWLTVGKQTAQLCLNAGANDFGSIMIEENVVSAAGAPHRFTYKTIQEAIAEAGFEPQLRNQQYEWRKIPEMIEEQVINY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 213 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 214 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 221 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 285 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 287 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 309 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 318 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 319 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 320 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 323 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 324 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 325 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 326 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 327 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 328 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 329 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 330 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 331 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 332 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 333 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 334 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 335 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 336 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 337 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 338 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 339 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 340 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 341 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.85 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 88.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075366_10072518 | 3300006195 | Bacteria | 2052 |
| 2 | SwRhRL2b_contig_1759593 | 2162886007 | Bacteria | 266684 |
| 3 | MRS1b_contig_9249380 | 2162886011 | Bacteria | 1473 |
| 4 | JGI24740J21852_10000620 | 3300001979 | Bacteria | 15330 |
| 5 | JGI24735J21928_10008821 | 3300002067 | Bacteria | 3253 |
| 6 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 7 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 8 | JGI25157J39369_1003320 | 3300002741 | Bacteria | 3339 |
| 9 | JGI25406J46586_10014065 | 3300003203 | Bacteria | 3412 |
| 10 | JGI25153J46596_10006783 | 3300003215 | Bacteria | 5736 |
| 11 | JGI25153J46596_10006883 | 3300003215 | Bacteria | 5677 |
| 12 | rootH2_10002397 | 3300003320 | Bacteria | 11163 |
| 13 | rootH2_10003850 | 3300003320 | Bacteria | 18349 |
| 14 | rootH2_10004303 | 3300003320 | Bacteria | 17692 |
| 15 | rootH2_10062115 | 3300003320 | Bacteria | 9673 |
| 16 | rootL2_10004867 | 3300003322 | Bacteria | 14604 |
| 17 | rootL2_10130539 | 3300003322 | Bacteria | 8645 |
| 18 | rootL2_10214933 | 3300003322 | Bacteria | 3689 |
| 19 | rootH1_10007286 | 3300003323 | Bacteria | 47189 |
| 20 | rootH1_10018718 | 3300003323 | Bacteria | 7309 |
| 21 | JGI25160J50197_1001213 | 3300003354 | Bacteria | 13110 |
| 22 | JGI25160J50197_1004488 | 3300003354 | Bacteria | 6022 |
| 23 | JGI25160J50197_1012247 | 3300003354 | Bacteria | 2991 |
| 24 | Ga0055526_1012624 | 3300003771 | Bacteria | 3663 |
| 25 | Ga0055528_1000532 | 3300003790 | Bacteria | 29352 |
| 26 | Ga0055530_10000185 | 3300003791 | Bacteria | 55895 |
| 27 | Ga0055531_10000080 | 3300003794 | Bacteria | 103922 |
| 28 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 29 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 30 | Ga0065704_10071007 | 3300005289 | Bacteria | 13788 |
| 31 | Ga0065712_10000319 | 3300005290 | Bacteria | 14732 |
| 32 | Ga0065712_10008603 | 3300005290 | Bacteria | 2639 |
| 33 | Ga0065707_10091011 | 3300005295 | Bacteria | 4022 |
| 34 | Ga0070658_10001898 | 3300005327 | Bacteria | 17643 |
| 35 | Ga0070658_10007770 | 3300005327 | Bacteria | 8642 |
| 36 | Ga0070676_10001559 | 3300005328 | Bacteria | 11616 |
| 37 | Ga0070676_10028455 | 3300005328 | Bacteria | 3174 |
| 38 | Ga0070676_10063039 | 3300005328 | Bacteria | 2207 |
| 39 | Ga0070683_100008327 | 3300005329 | Bacteria | 8810 |
| 40 | Ga0070683_100013501 | 3300005329 | Bacteria | 7125 |
| 41 | Ga0070683_100015722 | 3300005329 | Bacteria | 6652 |
| 42 | Ga0070683_100084320 | 3300005329 | Bacteria | 2977 |
| 43 | Ga0070683_100099149 | 3300005329 | Bacteria | 2742 |
| 44 | Ga0070690_100070034 | 3300005330 | Unclassified | 2277 |
| 45 | Ga0070670_100015731 | 3300005331 | Bacteria | 6495 |
| 46 | Ga0070670_100015901 | 3300005331 | Bacteria | 6457 |
| 47 | Ga0070670_100076518 | 3300005331 | Bacteria | 2875 |
| 48 | Ga0070670_100237273 | 3300005331 | Bacteria | 1587 |
| 49 | Ga0070677_10012377 | 3300005333 | Bacteria | 2964 |
| 50 | Ga0068869_100004070 | 3300005334 | Bacteria | 9050 |
| 51 | Ga0068869_100045335 | 3300005334 | Bacteria | 3165 |
| 52 | Ga0068869_100083234 | 3300005334 | Bacteria | 2392 |
| 53 | Ga0068869_100094712 | 3300005334 | Bacteria | 2252 |
| 54 | Ga0070666_10001268 | 3300005335 | Bacteria | 15277 |
| 55 | Ga0070666_10003016 | 3300005335 | Bacteria | 10214 |
| 56 | Ga0070666_10017735 | 3300005335 | Bacteria | 4567 |
| 57 | Ga0070666_10022057 | 3300005335 | Bacteria | 4132 |
| 58 | Ga0070680_100016131 | 3300005336 | Bacteria | 5872 |
| 59 | Ga0070680_100196714 | 3300005336 | Bacteria | 1700 |
| 60 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 61 | Ga0068868_100011564 | 3300005338 | Bacteria | 6428 |
| 62 | Ga0068868_100017757 | 3300005338 | Bacteria | 5306 |
| 63 | Ga0068868_100054019 | 3300005338 | Bacteria | 3165 |
| 64 | Ga0068868_100094299 | 3300005338 | Bacteria | 2414 |
| 65 | Ga0068868_100100219 | 3300005338 | Bacteria | 2344 |
| 66 | Ga0068868_100167366 | 3300005338 | Bacteria | 1819 |
| 67 | Ga0070660_100099920 | 3300005339 | Bacteria | 2297 |
| 68 | Ga0070660_100201295 | 3300005339 | Bacteria | 1615 |
| 69 | Ga0070660_100218286 | 3300005339 | Bacteria | 1549 |
| 70 | Ga0070660_100237410 | 3300005339 | Bacteria | 1484 |
| 71 | Ga0070691_10000368 | 3300005341 | Bacteria | 16322 |
| 72 | Ga0070691_10036152 | 3300005341 | Bacteria | 2327 |
| 73 | Ga0070661_100002162 | 3300005344 | Bacteria | 13543 |
| 74 | Ga0070661_100023481 | 3300005344 | Bacteria | 4420 |
| 75 | Ga0070661_100025094 | 3300005344 | Bacteria | 4281 |
| 76 | Ga0070661_100072439 | 3300005344 | Bacteria | 2535 |
| 77 | Ga0070668_100000758 | 3300005347 | Bacteria | 22156 |
| 78 | Ga0070668_100021157 | 3300005347 | Bacteria | 4918 |
| 79 | Ga0070668_100067597 | 3300005347 | Bacteria | 2776 |
| 80 | Ga0070669_100007886 | 3300005353 | Bacteria | 7610 |
| 81 | Ga0070669_100019079 | 3300005353 | Bacteria | 4902 |
| 82 | Ga0070669_100034935 | 3300005353 | Unclassified | 3640 |
| 83 | Ga0070669_100094299 | 3300005353 | Bacteria | 2249 |
| 84 | Ga0070669_100217694 | 3300005353 | Bacteria | 1509 |
| 85 | Ga0070675_100003918 | 3300005354 | Bacteria | 11275 |
| 86 | Ga0070675_100024343 | 3300005354 | Bacteria | 4849 |
| 87 | Ga0070675_100033999 | 3300005354 | Bacteria | 4135 |
| 88 | Ga0070675_100219334 | 3300005354 | Bacteria | 1656 |
| 89 | Ga0070671_100027845 | 3300005355 | Bacteria | 4652 |
| 90 | Ga0070671_100041838 | 3300005355 | Bacteria | 3808 |
| 91 | Ga0070674_100022485 | 3300005356 | Bacteria | 4067 |
| 92 | Ga0070674_100033034 | 3300005356 | Bacteria | 3441 |
| 93 | Ga0070674_100037333 | 3300005356 | Bacteria | 3267 |
| 94 | Ga0070673_100000723 | 3300005364 | Bacteria | 18243 |
| 95 | Ga0070673_100018982 | 3300005364 | Bacteria | 4929 |
| 96 | Ga0070673_100019081 | 3300005364 | Unclassified | 4919 |
| 97 | Ga0070673_100068947 | 3300005364 | Unclassified | 2833 |
| 98 | Ga0070659_100018691 | 3300005366 | Bacteria | 5232 |
| 99 | Ga0070659_100039892 | 3300005366 | Bacteria | 3667 |
| 100 | Ga0070659_100051274 | 3300005366 | Bacteria | 3244 |
| 101 | Ga0070659_100052195 | 3300005366 | Bacteria | 3215 |
| 102 | Ga0070659_100083411 | 3300005366 | Bacteria | 2554 |
| 103 | Ga0070659_100128194 | 3300005366 | Bacteria | 2059 |
| 104 | Ga0070667_100000567 | 3300005367 | Bacteria | 36566 |
| 105 | Ga0070667_100197209 | 3300005367 | Unclassified | 1785 |
| 106 | Ga0070701_10021006 | 3300005438 | Bacteria | 3109 |
| 107 | Ga0070678_100065915 | 3300005456 | Bacteria | 2691 |
| 108 | Ga0070678_100123155 | 3300005456 | Bacteria | 2048 |
| 109 | Ga0070662_100000103 | 3300005457 | Bacteria | 46838 |
| 110 | Ga0070662_100006612 | 3300005457 | Bacteria | 7484 |
| 111 | Ga0070662_100008420 | 3300005457 | Bacteria | 6722 |
| 112 | Ga0070662_100171448 | 3300005457 | Unclassified | 1704 |
| 113 | Ga0070681_10120521 | 3300005458 | Bacteria | 2558 |
| 114 | Ga0070681_10331018 | 3300005458 | Bacteria | 1433 |
| 115 | Ga0068867_100002223 | 3300005459 | Bacteria | 13626 |
| 116 | Ga0068867_100010325 | 3300005459 | Bacteria | 6588 |
| 117 | Ga0068867_100011794 | 3300005459 | Bacteria | 6170 |
| 118 | Ga0068867_100016164 | 3300005459 | Bacteria | 5300 |
| 119 | Ga0068867_100042351 | 3300005459 | Bacteria | 3331 |
| 120 | Ga0070707_100173914 | 3300005468 | Bacteria | 2099 |
| 121 | Ga0070698_100003494 | 3300005471 | Bacteria | 17298 |
| 122 | Ga0070698_100003801 | 3300005471 | Bacteria | 16588 |
| 123 | Ga0070698_100010038 | 3300005471 | Bacteria | 10114 |
| 124 | Ga0070679_100047590 | 3300005530 | Bacteria | 4273 |
| 125 | Ga0070684_100005000 | 3300005535 | Bacteria | 10126 |
| 126 | Ga0070684_100007172 | 3300005535 | Bacteria | 8661 |
| 127 | Ga0070684_100014504 | 3300005535 | Bacteria | 6387 |
| 128 | Ga0070684_100028792 | 3300005535 | Bacteria | 4701 |
| 129 | Ga0070684_100038344 | 3300005535 | Bacteria | 4116 |
| 130 | Ga0070684_100055466 | 3300005535 | Bacteria | 3455 |
| 131 | Ga0070684_100159009 | 3300005535 | Bacteria | 2049 |
| 132 | Ga0070684_100168144 | 3300005535 | Bacteria | 1991 |
| 133 | Ga0068853_100004093 | 3300005539 | Bacteria | 11234 |
| 134 | Ga0068853_100007073 | 3300005539 | Bacteria | 8974 |
| 135 | Ga0068853_100011486 | 3300005539 | Bacteria | 7198 |
| 136 | Ga0068853_100013878 | 3300005539 | Bacteria | 6585 |
| 137 | Ga0068853_100017952 | 3300005539 | Bacteria | 5847 |
| 138 | Ga0068853_100018681 | 3300005539 | Bacteria | 5740 |
| 139 | Ga0068853_100019980 | 3300005539 | Bacteria | 5564 |
| 140 | Ga0070672_100000449 | 3300005543 | Bacteria | 24094 |
| 141 | Ga0070672_100011379 | 3300005543 | Bacteria | 6204 |
| 142 | Ga0070672_100057129 | 3300005543 | Bacteria | 3062 |
| 143 | Ga0070672_100074177 | 3300005543 | Bacteria | 2714 |
| 144 | Ga0070686_100042789 | 3300005544 | Bacteria | 2839 |
| 145 | Ga0070693_100003807 | 3300005547 | Bacteria | 7064 |
| 146 | Ga0070693_100144493 | 3300005547 | Bacteria | 1501 |
| 147 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 148 | Ga0070665_100000083 | 3300005548 | Bacteria | 181044 |
| 149 | Ga0070665_100023502 | 3300005548 | Bacteria | 6206 |
| 150 | Ga0070665_100042302 | 3300005548 | Bacteria | 4579 |
| 151 | Ga0070665_100114888 | 3300005548 | Bacteria | 2694 |
| 152 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 153 | Ga0068855_100001235 | 3300005563 | Bacteria | 31705 |
| 154 | Ga0068855_100013077 | 3300005563 | Bacteria | 10009 |
| 155 | Ga0068855_100016424 | 3300005563 | Bacteria | 8900 |
| 156 | Ga0068855_100023260 | 3300005563 | Bacteria | 7423 |
| 157 | Ga0068855_100060717 | 3300005563 | Bacteria | 4420 |
| 158 | Ga0068855_100204091 | 3300005563 | Bacteria | 2224 |
| 159 | Ga0070664_100001578 | 3300005564 | Bacteria | 18220 |
| 160 | Ga0070664_100013993 | 3300005564 | Bacteria | 6543 |
| 161 | Ga0070664_100039991 | 3300005564 | Bacteria | 3953 |
| 162 | Ga0070664_100043980 | 3300005564 | Bacteria | 3770 |
| 163 | Ga0070664_100072197 | 3300005564 | Unclassified | 2959 |
| 164 | Ga0070664_100075230 | 3300005564 | Unclassified | 2900 |
| 165 | Ga0070664_100075483 | 3300005564 | Bacteria | 2895 |
| 166 | Ga0070664_100086287 | 3300005564 | Bacteria | 2712 |
| 167 | Ga0070664_100093466 | 3300005564 | Bacteria | 2606 |
| 168 | Ga0070664_100131438 | 3300005564 | Bacteria | 2199 |
| 169 | Ga0070664_100140560 | 3300005564 | Bacteria | 2126 |
| 170 | Ga0070664_100152617 | 3300005564 | Bacteria | 2040 |
| 171 | Ga0070664_100320560 | 3300005564 | Bacteria | 1404 |
| 172 | Ga0068857_100004492 | 3300005577 | Bacteria | 11788 |
| 173 | Ga0068857_100005326 | 3300005577 | Bacteria | 10956 |
| 174 | Ga0068857_100010794 | 3300005577 | Bacteria | 7951 |
| 175 | Ga0068857_100029201 | 3300005577 | Bacteria | 4866 |
| 176 | Ga0068857_100062029 | 3300005577 | Bacteria | 3323 |
| 177 | Ga0068857_100086713 | 3300005577 | Bacteria | 2800 |
| 178 | Ga0068857_100340268 | 3300005577 | Bacteria | 1388 |
| 179 | Ga0068857_100384934 | 3300005577 | Bacteria | 1303 |
| 180 | Ga0068857_100414415 | 3300005577 | Bacteria | 1255 |
| 181 | Ga0068854_100006413 | 3300005578 | Bacteria | 7484 |
| 182 | Ga0068856_100007749 | 3300005614 | Bacteria | 10486 |
| 183 | Ga0068856_100009813 | 3300005614 | Bacteria | 9301 |
| 184 | Ga0068856_100010791 | 3300005614 | Bacteria | 8871 |
| 185 | Ga0068856_100024279 | 3300005614 | Bacteria | 5900 |
| 186 | Ga0068856_100051848 | 3300005614 | Bacteria | 4045 |
| 187 | Ga0068856_100058783 | 3300005614 | Bacteria | 3798 |
| 188 | Ga0068856_100350139 | 3300005614 | Bacteria | 1496 |
| 189 | Ga0068856_100357858 | 3300005614 | Unclassified | 1478 |
| 190 | Ga0068856_100398003 | 3300005614 | Bacteria | 1397 |
| 191 | Ga0068852_100001772 | 3300005616 | Bacteria | 14694 |
| 192 | Ga0068852_100003669 | 3300005616 | Bacteria | 10760 |
| 193 | Ga0068852_100005559 | 3300005616 | Bacteria | 9040 |
| 194 | Ga0068852_100013328 | 3300005616 | Bacteria | 6289 |
| 195 | Ga0068852_100015239 | 3300005616 | Bacteria | 5953 |
| 196 | Ga0068852_100022959 | 3300005616 | Bacteria | 5012 |
| 197 | Ga0068852_100029559 | 3300005616 | Unclassified | 4504 |
| 198 | Ga0068852_100034912 | 3300005616 | Bacteria | 4188 |
| 199 | Ga0068852_100047679 | 3300005616 | Bacteria | 3656 |
| 200 | Ga0068859_100000024 | 3300005617 | Bacteria | 217931 |
| 201 | Ga0068859_100004205 | 3300005617 | Bacteria | 14695 |
| 202 | Ga0068859_100007001 | 3300005617 | Bacteria | 11451 |
| 203 | Ga0068859_100063511 | 3300005617 | Bacteria | 3723 |
| 204 | Ga0068859_100199116 | 3300005617 | Bacteria | 2087 |
| 205 | Ga0068859_100356435 | 3300005617 | Bacteria | 1558 |
| 206 | Ga0068864_100000612 | 3300005618 | Bacteria | 30148 |
| 207 | Ga0068864_100003351 | 3300005618 | Bacteria | 13249 |
| 208 | Ga0068864_100022983 | 3300005618 | Bacteria | 5232 |
| 209 | Ga0068864_100047147 | 3300005618 | Bacteria | 3700 |
| 210 | Ga0068864_100048041 | 3300005618 | Bacteria | 3668 |
| 211 | Ga0068864_100094852 | 3300005618 | Bacteria | 2638 |
| 212 | Ga0068864_100152003 | 3300005618 | Bacteria | 2098 |
| 213 | Ga0068866_10083142 | 3300005718 | Bacteria | 1724 |
| 214 | Ga0068861_100010534 | 3300005719 | Bacteria | 6419 |
| 215 | Ga0068861_100011213 | 3300005719 | Bacteria | 6222 |
| 216 | Ga0068861_100028581 | 3300005719 | Bacteria | 4070 |
| 217 | Ga0068861_100030470 | 3300005719 | Bacteria | 3954 |
| 218 | Ga0068861_100133478 | 3300005719 | Bacteria | 2018 |
| 219 | Ga0068851_10001287 | 3300005834 | Bacteria | 10943 |
| 220 | Ga0068870_10002733 | 3300005840 | Bacteria | 7406 |
| 221 | Ga0068870_10010778 | 3300005840 | Bacteria | 4212 |
| 222 | Ga0068863_100003886 | 3300005841 | Bacteria | 14774 |
| 223 | Ga0068863_100008322 | 3300005841 | Bacteria | 10132 |
| 224 | Ga0068863_100008613 | 3300005841 | Bacteria | 9970 |
| 225 | Ga0068863_100011859 | 3300005841 | Bacteria | 8424 |
| 226 | Ga0068863_100059400 | 3300005841 | Bacteria | 3618 |
| 227 | Ga0068863_100214412 | 3300005841 | Unclassified | 1854 |
| 228 | Ga0068863_100247802 | 3300005841 | Bacteria | 1720 |
| 229 | Ga0068863_100344533 | 3300005841 | Bacteria | 1450 |
| 230 | Ga0068863_100414847 | 3300005841 | Bacteria | 1318 |
| 231 | Ga0068858_100015236 | 3300005842 | Bacteria | 7232 |
| 232 | Ga0068858_100059006 | 3300005842 | Bacteria | 3546 |
| 233 | Ga0068858_100133917 | 3300005842 | Bacteria | 2324 |
| 234 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 235 | Ga0068860_100001226 | 3300005843 | Bacteria | 27951 |
| 236 | Ga0068860_100002264 | 3300005843 | Bacteria | 20238 |
| 237 | Ga0068860_100002819 | 3300005843 | Bacteria | 18071 |
| 238 | Ga0068860_100009265 | 3300005843 | Bacteria | 9789 |
| 239 | Ga0068860_100056523 | 3300005843 | Bacteria | 3730 |
| 240 | Ga0068860_100062123 | 3300005843 | Bacteria | 3550 |
| 241 | Ga0068860_100082144 | 3300005843 | Bacteria | 3065 |
| 242 | Ga0068860_100102143 | 3300005843 | Bacteria | 2736 |
| 243 | Ga0068860_100212626 | 3300005843 | Bacteria | 1876 |
| 244 | Ga0068860_100260520 | 3300005843 | Bacteria | 1690 |
| 245 | Ga0068862_100004028 | 3300005844 | Bacteria | 12458 |
| 246 | Ga0068862_100017129 | 3300005844 | Bacteria | 6029 |
| 247 | Ga0068862_100152263 | 3300005844 | Bacteria | 2059 |
| 248 | Ga0081540_1004002 | 3300005983 | Bacteria | 11419 |
| 249 | Ga0081539_10001463 | 3300005985 | Bacteria | 40106 |
| 250 | Ga0081539_10033716 | 3300005985 | Bacteria | 3112 |
| 251 | Ga0070715_10012500 | 3300006163 | Bacteria | 3093 |
| 252 | Ga0075366_10015837 | 3300006195 | Bacteria | 4328 |
| 253 | Ga0075366_10084475 | 3300006195 | Bacteria | 1898 |
| 254 | Ga0075366_10093880 | 3300006195 | Bacteria | 1798 |
| 255 | Ga0075366_10127444 | 3300006195 | Bacteria | 1535 |
| 256 | Ga0097621_100000839 | 3300006237 | Bacteria | 21631 |
| 257 | Ga0097621_100002790 | 3300006237 | Bacteria | 11958 |
| 258 | Ga0097621_100009053 | 3300006237 | Bacteria | 7214 |
| 259 | Ga0097621_100023249 | 3300006237 | Bacteria | 4822 |
| 260 | Ga0097621_100096389 | 3300006237 | Bacteria | 2482 |
| 261 | Ga0097621_100137266 | 3300006237 | Bacteria | 2087 |
| 262 | Ga0068871_100001731 | 3300006358 | Bacteria | 14701 |
| 263 | Ga0068871_100003521 | 3300006358 | Bacteria | 10774 |
| 264 | Ga0068871_100010126 | 3300006358 | Bacteria | 6862 |
| 265 | Ga0068871_100011590 | 3300006358 | Bacteria | 6471 |
| 266 | Ga0068871_100103406 | 3300006358 | Bacteria | 2388 |
| 267 | Ga0068871_100170953 | 3300006358 | Bacteria | 1863 |
| 268 | Ga0068871_100228817 | 3300006358 | Bacteria | 1613 |
| 269 | Ga0075428_100029256 | 3300006844 | Bacteria | 6096 |
| 270 | Ga0075431_100021549 | 3300006847 | Bacteria | 6591 |
| 271 | Ga0075431_100026223 | 3300006847 | Bacteria | 5977 |
| 272 | Ga0075431_100033023 | 3300006847 | Bacteria | 5334 |
| 273 | Ga0075429_100000407 | 3300006880 | Bacteria | 31868 |
| 274 | Ga0068865_100002395 | 3300006881 | Bacteria | 11060 |
| 275 | Ga0068865_100012779 | 3300006881 | Bacteria | 5292 |
| 276 | Ga0097620_100000024 | 3300006931 | Bacteria | 217931 |
| 277 | Ga0097620_100001293 | 3300006931 | Bacteria | 25566 |
| 278 | Ga0097620_100004205 | 3300006931 | Bacteria | 14695 |
| 279 | Ga0097620_100007001 | 3300006931 | Bacteria | 11451 |
| 280 | Ga0097620_100063503 | 3300006931 | Bacteria | 3723 |
| 281 | Ga0097620_100199121 | 3300006931 | Bacteria | 2087 |
| 282 | Ga0097620_100356396 | 3300006931 | Bacteria | 1558 |
| 283 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 284 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 285 | Ga0105240_10001624 | 3300009093 | Bacteria | 38134 |
| 286 | Ga0105240_10002363 | 3300009093 | Bacteria | 30416 |
| 287 | Ga0105240_10002407 | 3300009093 | Bacteria | 30067 |
| 288 | Ga0105240_10006526 | 3300009093 | Bacteria | 17130 |
| 289 | Ga0105240_10007767 | 3300009093 | Bacteria | 15513 |
| 290 | Ga0105240_10008691 | 3300009093 | Bacteria | 14490 |
| 291 | Ga0105240_10016355 | 3300009093 | Bacteria | 10045 |
| 292 | Ga0105240_10025827 | 3300009093 | Bacteria | 7713 |
| 293 | Ga0105240_10035129 | 3300009093 | Bacteria | 6463 |
| 294 | Ga0105240_10035580 | 3300009093 | Bacteria | 6416 |
| 295 | Ga0105240_10085340 | 3300009093 | Bacteria | 3868 |
| 296 | Ga0105240_10097933 | 3300009093 | Bacteria | 3573 |
| 297 | Ga0105240_10109150 | 3300009093 | Bacteria | 3352 |
| 298 | Ga0111539_10000458 | 3300009094 | Bacteria | 51231 |
| 299 | Ga0111539_10025327 | 3300009094 | Bacteria | 7273 |
| 300 | Ga0111539_10198461 | 3300009094 | Bacteria | 2340 |
| 301 | Ga0111539_10222463 | 3300009094 | Bacteria | 2198 |
| 302 | Ga0105245_10028055 | 3300009098 | Bacteria | 4962 |
| 303 | Ga0105247_10001556 | 3300009101 | Bacteria | 16352 |
| 304 | Ga0105247_10002650 | 3300009101 | Bacteria | 12054 |
| 305 | Ga0105247_10011428 | 3300009101 | Bacteria | 5354 |
| 306 | Ga0114129_10002233 | 3300009147 | Bacteria | 26725 |
| 307 | Ga0114129_10078244 | 3300009147 | Bacteria | 4600 |
| 308 | Ga0105243_10180362 | 3300009148 | Bacteria | 1836 |
| 309 | Ga0105241_10000056 | 3300009174 | Bacteria | 84758 |
| 310 | Ga0105241_10000775 | 3300009174 | Bacteria | 24313 |
| 311 | Ga0105241_10002612 | 3300009174 | Bacteria | 13500 |
| 312 | Ga0105241_10007787 | 3300009174 | Bacteria | 7877 |
| 313 | Ga0105241_10087729 | 3300009174 | Bacteria | 2449 |
| 314 | Ga0105242_10004393 | 3300009176 | Bacteria | 10967 |
| 315 | Ga0105242_10006918 | 3300009176 | Bacteria | 8751 |
| 316 | Ga0105242_10007249 | 3300009176 | Bacteria | 8550 |
| 317 | Ga0105242_10017245 | 3300009176 | Bacteria | 5623 |
| 318 | Ga0105242_10032510 | 3300009176 | Bacteria | 4172 |
| 319 | Ga0105242_10046277 | 3300009176 | Bacteria | 3529 |
| 320 | Ga0105248_10245490 | 3300009177 | Bacteria | 2015 |
| 321 | Ga0105237_10000561 | 3300009545 | Bacteria | 51951 |
| 322 | Ga0105237_10000696 | 3300009545 | Bacteria | 46514 |
| 323 | Ga0105237_10000855 | 3300009545 | Bacteria | 41395 |
| 324 | Ga0105237_10003378 | 3300009545 | Bacteria | 18981 |
| 325 | Ga0105237_10004378 | 3300009545 | Bacteria | 16371 |
| 326 | Ga0105237_10007863 | 3300009545 | Bacteria | 11623 |
| 327 | Ga0105237_10025728 | 3300009545 | Bacteria | 6017 |
| 328 | Ga0105237_10026296 | 3300009545 | Bacteria | 5947 |
| 329 | Ga0105237_10033236 | 3300009545 | Bacteria | 5225 |
| 330 | Ga0105237_10272365 | 3300009545 | Bacteria | 1696 |
| 331 | Ga0105237_10337132 | 3300009545 | Bacteria | 1512 |
| 332 | Ga0105238_10001830 | 3300009551 | Bacteria | 21319 |
| 333 | Ga0105238_10180978 | 3300009551 | Bacteria | 2085 |
| 334 | Ga0105249_10003210 | 3300009553 | Bacteria | 14149 |
| 335 | Ga0105249_10005957 | 3300009553 | Bacteria | 10564 |
| 336 | Ga0105249_10007197 | 3300009553 | Bacteria | 9716 |
| 337 | Ga0105249_10016437 | 3300009553 | Bacteria | 6565 |
| 338 | Ga0105249_10018824 | 3300009553 | Bacteria | 6155 |
| 339 | Ga0105249_10056836 | 3300009553 | Bacteria | 3583 |
| 340 | Ga0105249_10092486 | 3300009553 | Bacteria | 2832 |
| 341 | Ga0105249_10152492 | 3300009553 | Bacteria | 2226 |
| 342 | Ga0105249_10168993 | 3300009553 | Unclassified | 2119 |
| 343 | Ga0105249_10251423 | 3300009553 | Bacteria | 1752 |
| 344 | Ga0105239_10000580 | 3300010375 | Bacteria | 52245 |
| 345 | Ga0105239_10001802 | 3300010375 | Bacteria | 28139 |
| 346 | Ga0105239_10002300 | 3300010375 | Bacteria | 24396 |
| 347 | Ga0105239_10007101 | 3300010375 | Bacteria | 12888 |
| 348 | Ga0105239_10017205 | 3300010375 | Bacteria | 7992 |
| 349 | Ga0105239_10028924 | 3300010375 | Bacteria | 6091 |
| 350 | Ga0105239_10041537 | 3300010375 | Bacteria | 5040 |
| 351 | Ga0105239_10325139 | 3300010375 | Bacteria | 1735 |
| 352 | Ga0105239_10337602 | 3300010375 | Bacteria | 1700 |
| 353 | Ga0105239_10488142 | 3300010375 | Bacteria | 1400 |
| 354 | Ga0105246_10021094 | 3300011119 | Bacteria | 4188 |
| 355 | Ga0105246_10034709 | 3300011119 | Bacteria | 3364 |
| 356 | Ga0157373_10002019 | 3300013100 | Bacteria | 15390 |
| 357 | Ga0157373_10002576 | 3300013100 | Bacteria | 13778 |
| 358 | Ga0157373_10009023 | 3300013100 | Bacteria | 7378 |
| 359 | Ga0157373_10012873 | 3300013100 | Bacteria | 6144 |
| 360 | Ga0157373_10026659 | 3300013100 | Bacteria | 4172 |
| 361 | Ga0157373_10108863 | 3300013100 | Bacteria | 1948 |
| 362 | Ga0157373_10160577 | 3300013100 | Bacteria | 1581 |
| 363 | Ga0157371_10000141 | 3300013102 | Bacteria | 104396 |
| 364 | Ga0157371_10001044 | 3300013102 | Bacteria | 30377 |
| 365 | Ga0157371_10001795 | 3300013102 | Bacteria | 21712 |
| 366 | Ga0157371_10002241 | 3300013102 | Bacteria | 18672 |
| 367 | Ga0157371_10002756 | 3300013102 | Bacteria | 16506 |
| 368 | Ga0157371_10002926 | 3300013102 | Bacteria | 15940 |
| 369 | Ga0157371_10003663 | 3300013102 | Bacteria | 13826 |
| 370 | Ga0157371_10005857 | 3300013102 | Bacteria | 10274 |
| 371 | Ga0157371_10009991 | 3300013102 | Bacteria | 7427 |
| 372 | Ga0157371_10011660 | 3300013102 | Bacteria | 6755 |
| 373 | Ga0157371_10020366 | 3300013102 | Bacteria | 4881 |
| 374 | Ga0157371_10022928 | 3300013102 | Bacteria | 4566 |
| 375 | Ga0157371_10048549 | 3300013102 | Bacteria | 3017 |
| 376 | Ga0157371_10051420 | 3300013102 | Bacteria | 2928 |
| 377 | Ga0157371_10090612 | 3300013102 | Bacteria | 2166 |
| 378 | Ga0157371_10135277 | 3300013102 | Bacteria | 1755 |
| 379 | Ga0157370_10000491 | 3300013104 | Bacteria | 49237 |
| 380 | Ga0157370_10000945 | 3300013104 | Bacteria | 36860 |
| 381 | Ga0157370_10001381 | 3300013104 | Bacteria | 30032 |
| 382 | Ga0157370_10006901 | 3300013104 | Bacteria | 12425 |
| 383 | Ga0157370_10008209 | 3300013104 | Bacteria | 11283 |
| 384 | Ga0157370_10020969 | 3300013104 | Bacteria | 6517 |
| 385 | Ga0157370_10185900 | 3300013104 | Bacteria | 1929 |
| 386 | Ga0157369_10058643 | 3300013105 | Bacteria | 4152 |
| 387 | Ga0157369_10074602 | 3300013105 | Bacteria | 3638 |
| 388 | Ga0157369_10105419 | 3300013105 | Bacteria | 3001 |
| 389 | Ga0157369_10139186 | 3300013105 | Bacteria | 2569 |
| 390 | Ga0157369_10222353 | 3300013105 | Bacteria | 1976 |
| 391 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 392 | Ga0157374_10000640 | 3300013296 | Bacteria | 30838 |
| 393 | Ga0157374_10001051 | 3300013296 | Bacteria | 23998 |
| 394 | Ga0157374_10002178 | 3300013296 | Bacteria | 16512 |
| 395 | Ga0157374_10006069 | 3300013296 | Bacteria | 10225 |
| 396 | Ga0157374_10054213 | 3300013296 | Bacteria | 3740 |
| 397 | Ga0157374_10100148 | 3300013296 | Bacteria | 2777 |
| 398 | Ga0157374_10155812 | 3300013296 | Bacteria | 2223 |
| 399 | Ga0157378_10004366 | 3300013297 | Bacteria | 12446 |
| 400 | Ga0157378_10012093 | 3300013297 | Bacteria | 7560 |
| 401 | Ga0157378_10097757 | 3300013297 | Bacteria | 2676 |
| 402 | Ga0157378_10123781 | 3300013297 | Bacteria | 2386 |
| 403 | Ga0157378_10207710 | 3300013297 | Bacteria | 1855 |
| 404 | Ga0157378_10256235 | 3300013297 | Bacteria | 1677 |
| 405 | Ga0157378_10342042 | 3300013297 | Bacteria | 1459 |
| 406 | Ga0163162_10000068 | 3300013306 | Bacteria | 97068 |
| 407 | Ga0163162_10000096 | 3300013306 | Bacteria | 80090 |
| 408 | Ga0163162_10000142 | 3300013306 | Bacteria | 65555 |
| 409 | Ga0163162_10000153 | 3300013306 | Bacteria | 63805 |
| 410 | Ga0163162_10001124 | 3300013306 | Bacteria | 24905 |
| 411 | Ga0163162_10002730 | 3300013306 | Bacteria | 16751 |
| 412 | Ga0163162_10003086 | 3300013306 | Bacteria | 15916 |
| 413 | Ga0163162_10005777 | 3300013306 | Bacteria | 11970 |
| 414 | Ga0163162_10007257 | 3300013306 | Bacteria | 10761 |
| 415 | Ga0163162_10031816 | 3300013306 | Bacteria | 5235 |
| 416 | Ga0163162_10087312 | 3300013306 | Bacteria | 3197 |
| 417 | Ga0163162_10166860 | 3300013306 | Bacteria | 2326 |
| 418 | Ga0163162_10195547 | 3300013306 | Bacteria | 2151 |
| 419 | Ga0163162_10284239 | 3300013306 | Bacteria | 1786 |
| 420 | Ga0163162_10449998 | 3300013306 | Bacteria | 1420 |
| 421 | Ga0157372_10000171 | 3300013307 | Bacteria | 71956 |
| 422 | Ga0157372_10000418 | 3300013307 | Bacteria | 46635 |
| 423 | Ga0157372_10000463 | 3300013307 | Bacteria | 44664 |
| 424 | Ga0157372_10002554 | 3300013307 | Bacteria | 19731 |
| 425 | Ga0157372_10004995 | 3300013307 | Bacteria | 14094 |
| 426 | Ga0157372_10016951 | 3300013307 | Bacteria | 7821 |
| 427 | Ga0157372_10017801 | 3300013307 | Bacteria | 7630 |
| 428 | Ga0157372_10028942 | 3300013307 | Bacteria | 6045 |
| 429 | Ga0157372_10049248 | 3300013307 | Bacteria | 4684 |
| 430 | Ga0157372_10120764 | 3300013307 | Bacteria | 3009 |
| 431 | Ga0157372_10134672 | 3300013307 | Bacteria | 2844 |
| 432 | Ga0157372_10211920 | 3300013307 | Bacteria | 2245 |
| 433 | Ga0157372_10423955 | 3300013307 | Bacteria | 1550 |
| 434 | Ga0157372_10458358 | 3300013307 | Bacteria | 1486 |
| 435 | Ga0157375_10000622 | 3300013308 | Bacteria | 31461 |
| 436 | Ga0157375_10004424 | 3300013308 | Bacteria | 12203 |
| 437 | Ga0157375_10008218 | 3300013308 | Bacteria | 9133 |
| 438 | Ga0157375_10013976 | 3300013308 | Bacteria | 7158 |
| 439 | Ga0157375_10191331 | 3300013308 | Bacteria | 2201 |
| 440 | Ga0157375_10355022 | 3300013308 | Bacteria | 1632 |
| 441 | Ga0157375_10365016 | 3300013308 | Bacteria | 1610 |
| 442 | Ga0157375_10544362 | 3300013308 | Bacteria | 1323 |
| 443 | Ga0157375_10625817 | 3300013308 | Bacteria | 1234 |
| 444 | Ga0163163_10000251 | 3300014325 | Bacteria | 54526 |
| 445 | Ga0163163_10000325 | 3300014325 | Bacteria | 46201 |
| 446 | Ga0163163_10004966 | 3300014325 | Bacteria | 11451 |
| 447 | Ga0163163_10008774 | 3300014325 | Bacteria | 8998 |
| 448 | Ga0163163_10067344 | 3300014325 | Bacteria | 3560 |
| 449 | Ga0163163_10070351 | 3300014325 | Bacteria | 3485 |
| 450 | Ga0157380_10002400 | 3300014326 | Bacteria | 12600 |
| 451 | Ga0157380_10006245 | 3300014326 | Bacteria | 8369 |
| 452 | Ga0157380_10040531 | 3300014326 | Bacteria | 3628 |
| 453 | Ga0157380_10143712 | 3300014326 | Bacteria | 2053 |
| 454 | Ga0157377_10002011 | 3300014745 | Bacteria | 8909 |
| 455 | Ga0157377_10024184 | 3300014745 | Bacteria | 3227 |
| 456 | Ga0157377_10028966 | 3300014745 | Bacteria | 2986 |
| 457 | Ga0157377_10030337 | 3300014745 | Bacteria | 2928 |
| 458 | Ga0157379_10000128 | 3300014968 | Bacteria | 53403 |
| 459 | Ga0157379_10092058 | 3300014968 | Bacteria | 2720 |
| 460 | Ga0157379_10095514 | 3300014968 | Bacteria | 2667 |
| 461 | Ga0157376_10000334 | 3300014969 | Bacteria | 31383 |
| 462 | Ga0157376_10000931 | 3300014969 | Bacteria | 19001 |
| 463 | Ga0157376_10016786 | 3300014969 | Bacteria | 5569 |
| 464 | Ga0163161_10010439 | 3300017792 | Bacteria | 6430 |
| 465 | Ga0163161_10022116 | 3300017792 | Bacteria | 4476 |
| 466 | Ga0213876_10014951 | 3300021384 | Bacteria | 4114 |
| 467 | Ga0209436_100698 | 3300025208 | Bacteria | 14098 |
| 468 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 469 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 470 | Ga0209646_1001408 | 3300025246 | Bacteria | 6530 |
| 471 | Ga0209026_1000136 | 3300025250 | Bacteria | 116507 |
| 472 | Ga0209026_1001610 | 3300025250 | Bacteria | 9667 |
| 473 | Ga0209148_1000251 | 3300025254 | Bacteria | 85638 |
| 474 | Ga0209673_1000203 | 3300025273 | Bacteria | 119623 |
| 475 | Ga0209130_1004265 | 3300025284 | Bacteria | 5534 |
| 476 | Ga0209758_1001443 | 3300025297 | Bacteria | 28004 |
| 477 | Ga0209050_1000276 | 3300025298 | Bacteria | 109997 |
| 478 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 479 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 480 | Ga0207426_1000957 | 3300025302 | Bacteria | 28456 |
| 481 | Ga0207426_1005363 | 3300025302 | Bacteria | 5884 |
| 482 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 483 | Ga0207656_10001599 | 3300025321 | Bacteria | 7532 |
| 484 | Ga0207642_10026816 | 3300025899 | Bacteria | 2350 |
| 485 | Ga0207710_10004858 | 3300025900 | Bacteria | 5827 |
| 486 | Ga0207710_10012930 | 3300025900 | Bacteria | 3515 |
| 487 | Ga0207688_10028053 | 3300025901 | Bacteria | 3098 |
| 488 | Ga0207680_10006273 | 3300025903 | Bacteria | 5736 |
| 489 | Ga0207680_10040785 | 3300025903 | Bacteria | 2704 |
| 490 | Ga0207647_10000062 | 3300025904 | Bacteria | 83809 |
| 491 | Ga0207647_10000263 | 3300025904 | Bacteria | 43120 |
| 492 | Ga0207647_10000360 | 3300025904 | Bacteria | 37076 |
| 493 | Ga0207647_10002291 | 3300025904 | Bacteria | 14577 |
| 494 | Ga0207647_10077507 | 3300025904 | Bacteria | 1997 |
| 495 | Ga0207645_10000385 | 3300025907 | Bacteria | 36499 |
| 496 | Ga0207645_10005692 | 3300025907 | Bacteria | 9002 |
| 497 | Ga0207645_10056613 | 3300025907 | Bacteria | 2503 |
| 498 | Ga0207645_10072411 | 3300025907 | Bacteria | 2206 |
| 499 | Ga0207645_10075083 | 3300025907 | Unclassified | 2164 |
| 500 | Ga0207643_10004478 | 3300025908 | Bacteria | 7510 |
| 501 | Ga0207643_10004874 | 3300025908 | Bacteria | 7186 |
| 502 | Ga0207705_10002223 | 3300025909 | Bacteria | 14980 |
| 503 | Ga0207705_10010869 | 3300025909 | Bacteria | 6609 |
| 504 | Ga0207705_10029388 | 3300025909 | Bacteria | 3918 |
| 505 | Ga0207654_10000315 | 3300025911 | Bacteria | 29061 |
| 506 | Ga0207654_10000365 | 3300025911 | Bacteria | 26713 |
| 507 | Ga0207654_10004131 | 3300025911 | Bacteria | 7320 |
| 508 | Ga0207707_10000026 | 3300025912 | Bacteria | 175026 |
| 509 | Ga0207707_10000067 | 3300025912 | Bacteria | 105764 |
| 510 | Ga0207707_10268855 | 3300025912 | Bacteria | 1478 |
| 511 | Ga0207707_10268968 | 3300025912 | Bacteria | 1477 |
| 512 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 513 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 514 | Ga0207695_10001064 | 3300025913 | Bacteria | 48020 |
| 515 | Ga0207695_10002158 | 3300025913 | Bacteria | 29777 |
| 516 | Ga0207695_10004051 | 3300025913 | Bacteria | 20148 |
| 517 | Ga0207695_10005987 | 3300025913 | Bacteria | 15904 |
| 518 | Ga0207695_10006146 | 3300025913 | Bacteria | 15657 |
| 519 | Ga0207695_10006647 | 3300025913 | Bacteria | 14920 |
| 520 | Ga0207695_10012275 | 3300025913 | Bacteria | 10290 |
| 521 | Ga0207695_10019778 | 3300025913 | Bacteria | 7739 |
| 522 | Ga0207695_10033373 | 3300025913 | Bacteria | 5615 |
| 523 | Ga0207695_10035311 | 3300025913 | Bacteria | 5424 |
| 524 | Ga0207695_10047536 | 3300025913 | Bacteria | 4540 |
| 525 | Ga0207695_10080104 | 3300025913 | Bacteria | 3308 |
| 526 | Ga0207695_10157607 | 3300025913 | Bacteria | 2204 |
| 527 | Ga0207671_10000150 | 3300025914 | Bacteria | 107685 |
| 528 | Ga0207671_10004672 | 3300025914 | Bacteria | 12957 |
| 529 | Ga0207671_10004755 | 3300025914 | Bacteria | 12819 |
| 530 | Ga0207671_10005720 | 3300025914 | Bacteria | 11340 |
| 531 | Ga0207671_10006030 | 3300025914 | Bacteria | 10943 |
| 532 | Ga0207671_10010089 | 3300025914 | Bacteria | 7830 |
| 533 | Ga0207671_10015577 | 3300025914 | Bacteria | 5947 |
| 534 | Ga0207660_10031021 | 3300025917 | Bacteria | 3677 |
| 535 | Ga0207660_10046543 | 3300025917 | Bacteria | 3061 |
| 536 | Ga0207662_10018352 | 3300025918 | Bacteria | 3968 |
| 537 | Ga0207662_10156221 | 3300025918 | Bacteria | 1454 |
| 538 | Ga0207657_10011455 | 3300025919 | Bacteria | 8805 |
| 539 | Ga0207657_10070124 | 3300025919 | Bacteria | 2971 |
| 540 | Ga0207657_10072673 | 3300025919 | Bacteria | 2909 |
| 541 | Ga0207657_10106859 | 3300025919 | Bacteria | 2315 |
| 542 | Ga0207657_10185584 | 3300025919 | Bacteria | 1680 |
| 543 | Ga0207657_10252414 | 3300025919 | Bacteria | 1406 |
| 544 | Ga0207649_10001633 | 3300025920 | Bacteria | 13025 |
| 545 | Ga0207649_10037021 | 3300025920 | Bacteria | 2944 |
| 546 | Ga0207649_10040436 | 3300025920 | Bacteria | 2834 |
| 547 | Ga0207652_10000035 | 3300025921 | Bacteria | 138263 |
| 548 | Ga0207652_10000109 | 3300025921 | Bacteria | 89337 |
| 549 | Ga0207652_10000159 | 3300025921 | Bacteria | 73101 |
| 550 | Ga0207652_10051010 | 3300025921 | Bacteria | 3546 |
| 551 | Ga0207652_10084317 | 3300025921 | Bacteria | 2784 |
| 552 | Ga0207652_10125359 | 3300025921 | Bacteria | 2287 |
| 553 | Ga0207646_10096044 | 3300025922 | Bacteria | 2655 |
| 554 | Ga0207681_10011482 | 3300025923 | Bacteria | 5442 |
| 555 | Ga0207681_10120995 | 3300025923 | Bacteria | 1920 |
| 556 | Ga0207694_10005172 | 3300025924 | Bacteria | 10074 |
| 557 | Ga0207694_10041995 | 3300025924 | Bacteria | 3526 |
| 558 | Ga0207694_10144105 | 3300025924 | Bacteria | 1917 |
| 559 | Ga0207650_10005285 | 3300025925 | Bacteria | 8807 |
| 560 | Ga0207650_10010553 | 3300025925 | Bacteria | 6341 |
| 561 | Ga0207650_10013216 | 3300025925 | Bacteria | 5712 |
| 562 | Ga0207650_10079707 | 3300025925 | Bacteria | 2481 |
| 563 | Ga0207650_10119410 | 3300025925 | Bacteria | 2050 |
| 564 | Ga0207650_10229102 | 3300025925 | Bacteria | 1498 |
| 565 | Ga0207659_10009731 | 3300025926 | Bacteria | 6012 |
| 566 | Ga0207659_10029611 | 3300025926 | Bacteria | 3734 |
| 567 | Ga0207659_10056732 | 3300025926 | Bacteria | 2806 |
| 568 | Ga0207659_10238010 | 3300025926 | Bacteria | 1471 |
| 569 | Ga0207687_10188207 | 3300025927 | Bacteria | 1604 |
| 570 | Ga0207664_10080245 | 3300025929 | Bacteria | 2651 |
| 571 | Ga0207644_10070017 | 3300025931 | Bacteria | 2563 |
| 572 | Ga0207644_10076097 | 3300025931 | Bacteria | 2468 |
| 573 | Ga0207690_10006760 | 3300025932 | Bacteria | 6796 |
| 574 | Ga0207690_10048675 | 3300025932 | Bacteria | 2821 |
| 575 | Ga0207690_10068499 | 3300025932 | Bacteria | 2438 |
| 576 | Ga0207690_10232491 | 3300025932 | Bacteria | 1416 |
| 577 | Ga0207706_10004297 | 3300025933 | Bacteria | 13389 |
| 578 | Ga0207706_10016258 | 3300025933 | Bacteria | 6721 |
| 579 | Ga0207706_10023961 | 3300025933 | Bacteria | 5476 |
| 580 | Ga0207706_10026986 | 3300025933 | Bacteria | 5138 |
| 581 | Ga0207706_10039659 | 3300025933 | Bacteria | 4175 |
| 582 | Ga0207686_10000566 | 3300025934 | Bacteria | 23556 |
| 583 | Ga0207686_10047991 | 3300025934 | Bacteria | 2643 |
| 584 | Ga0207686_10109150 | 3300025934 | Bacteria | 1863 |
| 585 | Ga0207670_10030852 | 3300025936 | Bacteria | 3427 |
| 586 | Ga0207669_10011448 | 3300025937 | Bacteria | 4317 |
| 587 | Ga0207691_10001341 | 3300025940 | Bacteria | 24555 |
| 588 | Ga0207691_10008451 | 3300025940 | Bacteria | 9886 |
| 589 | Ga0207691_10029587 | 3300025940 | Bacteria | 5123 |
| 590 | Ga0207691_10053222 | 3300025940 | Bacteria | 3696 |
| 591 | Ga0207691_10090792 | 3300025940 | Bacteria | 2738 |
| 592 | Ga0207691_10182070 | 3300025940 | Bacteria | 1836 |
| 593 | Ga0207691_10236301 | 3300025940 | Bacteria | 1581 |
| 594 | Ga0207691_10249410 | 3300025940 | Bacteria | 1533 |
| 595 | Ga0207689_10003540 | 3300025942 | Bacteria | 14277 |
| 596 | Ga0207689_10003722 | 3300025942 | Bacteria | 13900 |
| 597 | Ga0207689_10005343 | 3300025942 | Bacteria | 11506 |
| 598 | Ga0207689_10008125 | 3300025942 | Bacteria | 9153 |
| 599 | Ga0207689_10013922 | 3300025942 | Bacteria | 6851 |
| 600 | Ga0207689_10026642 | 3300025942 | Bacteria | 4842 |
| 601 | Ga0207689_10036891 | 3300025942 | Bacteria | 4057 |
| 602 | Ga0207689_10059527 | 3300025942 | Bacteria | 3141 |
| 603 | Ga0207689_10092768 | 3300025942 | Bacteria | 2481 |
| 604 | Ga0207689_10095987 | 3300025942 | Bacteria | 2435 |
| 605 | Ga0207661_10036242 | 3300025944 | Bacteria | 3849 |
| 606 | Ga0207661_10076377 | 3300025944 | Bacteria | 2751 |
| 607 | Ga0207661_10088987 | 3300025944 | Bacteria | 2568 |
| 608 | Ga0207661_10111644 | 3300025944 | Bacteria | 2313 |
| 609 | Ga0207661_10122930 | 3300025944 | Bacteria | 2212 |
| 610 | Ga0207679_10000308 | 3300025945 | Bacteria | 36802 |
| 611 | Ga0207679_10009684 | 3300025945 | Bacteria | 6177 |
| 612 | Ga0207679_10015474 | 3300025945 | Bacteria | 5042 |
| 613 | Ga0207679_10019657 | 3300025945 | Bacteria | 4543 |
| 614 | Ga0207679_10024979 | 3300025945 | Bacteria | 4103 |
| 615 | Ga0207679_10156200 | 3300025945 | Bacteria | 1863 |
| 616 | Ga0207679_10211496 | 3300025945 | Bacteria | 1626 |
| 617 | Ga0207667_10000584 | 3300025949 | Bacteria | 47412 |
| 618 | Ga0207667_10001565 | 3300025949 | Bacteria | 28824 |
| 619 | Ga0207667_10016433 | 3300025949 | Bacteria | 8363 |
| 620 | Ga0207667_10032055 | 3300025949 | Bacteria | 5666 |
| 621 | Ga0207667_10057085 | 3300025949 | Bacteria | 4099 |
| 622 | Ga0207667_10108221 | 3300025949 | Bacteria | 2868 |
| 623 | Ga0207667_10144103 | 3300025949 | Bacteria | 2453 |
| 624 | Ga0207667_10174362 | 3300025949 | Bacteria | 2210 |
| 625 | Ga0207667_10492682 | 3300025949 | Bacteria | 1243 |
| 626 | Ga0207651_10105025 | 3300025960 | Bacteria | 2106 |
| 627 | Ga0207712_10005799 | 3300025961 | Bacteria | 7782 |
| 628 | Ga0207712_10010483 | 3300025961 | Bacteria | 5883 |
| 629 | Ga0207712_10016326 | 3300025961 | Bacteria | 4805 |
| 630 | Ga0207712_10072396 | 3300025961 | Bacteria | 2482 |
| 631 | Ga0207712_10177381 | 3300025961 | Bacteria | 1671 |
| 632 | Ga0207668_10001365 | 3300025972 | Bacteria | 14421 |
| 633 | Ga0207668_10037363 | 3300025972 | Bacteria | 3249 |
| 634 | Ga0207640_10004728 | 3300025981 | Bacteria | 7396 |
| 635 | Ga0207658_10037300 | 3300025986 | Bacteria | 3491 |
| 636 | Ga0207658_10047918 | 3300025986 | Bacteria | 3130 |
| 637 | Ga0207658_10059916 | 3300025986 | Bacteria | 2838 |
| 638 | Ga0207677_10008694 | 3300026023 | Bacteria | 5686 |
| 639 | Ga0207677_10022096 | 3300026023 | Bacteria | 3903 |
| 640 | Ga0207677_10071606 | 3300026023 | Bacteria | 2447 |
| 641 | Ga0207677_10108113 | 3300026023 | Bacteria | 2064 |
| 642 | Ga0207677_10129013 | 3300026023 | Bacteria | 1916 |
| 643 | Ga0207703_10006574 | 3300026035 | Bacteria | 9274 |
| 644 | Ga0207703_10055443 | 3300026035 | Bacteria | 3225 |
| 645 | Ga0207703_10056598 | 3300026035 | Bacteria | 3194 |
| 646 | Ga0207639_10007804 | 3300026041 | Bacteria | 7307 |
| 647 | Ga0207639_10009497 | 3300026041 | Bacteria | 6715 |
| 648 | Ga0207639_10012342 | 3300026041 | Bacteria | 5949 |
| 649 | Ga0207639_10012619 | 3300026041 | Bacteria | 5888 |
| 650 | Ga0207639_10020809 | 3300026041 | Unclassified | 4703 |
| 651 | Ga0207639_10041440 | 3300026041 | Bacteria | 3445 |
| 652 | Ga0207639_10097583 | 3300026041 | Bacteria | 2367 |
| 653 | Ga0207639_10370567 | 3300026041 | Bacteria | 1284 |
| 654 | Ga0207678_10017432 | 3300026067 | Bacteria | 6308 |
| 655 | Ga0207708_10128290 | 3300026075 | Bacteria | 1981 |
| 656 | Ga0207702_10014081 | 3300026078 | Bacteria | 6641 |
| 657 | Ga0207702_10014288 | 3300026078 | Bacteria | 6592 |
| 658 | Ga0207702_10155047 | 3300026078 | Bacteria | 2087 |
| 659 | Ga0207702_10174505 | 3300026078 | Bacteria | 1974 |
| 660 | Ga0207702_10248525 | 3300026078 | Bacteria | 1669 |
| 661 | Ga0207702_10288614 | 3300026078 | Bacteria | 1554 |
| 662 | Ga0207702_10314050 | 3300026078 | Bacteria | 1491 |
| 663 | Ga0207702_10355433 | 3300026078 | Bacteria | 1403 |
| 664 | Ga0207702_10374910 | 3300026078 | Bacteria | 1367 |
| 665 | Ga0207641_10000087 | 3300026088 | Bacteria | 132202 |
| 666 | Ga0207641_10002639 | 3300026088 | Bacteria | 16405 |
| 667 | Ga0207641_10005383 | 3300026088 | Bacteria | 10933 |
| 668 | Ga0207641_10034916 | 3300026088 | Bacteria | 4185 |
| 669 | Ga0207641_10079644 | 3300026088 | Bacteria | 2840 |
| 670 | Ga0207641_10197516 | 3300026088 | Unclassified | 1853 |
| 671 | Ga0207648_10001213 | 3300026089 | Bacteria | 28877 |
| 672 | Ga0207648_10002051 | 3300026089 | Bacteria | 21945 |
| 673 | Ga0207648_10004056 | 3300026089 | Bacteria | 15196 |
| 674 | Ga0207648_10006875 | 3300026089 | Bacteria | 11280 |
| 675 | Ga0207648_10009532 | 3300026089 | Bacteria | 9290 |
| 676 | Ga0207648_10021761 | 3300026089 | Bacteria | 5761 |
| 677 | Ga0207648_10046913 | 3300026089 | Bacteria | 3787 |
| 678 | Ga0207648_10047097 | 3300026089 | Bacteria | 3780 |
| 679 | Ga0207648_10058790 | 3300026089 | Bacteria | 3352 |
| 680 | Ga0207648_10267170 | 3300026089 | Bacteria | 1527 |
| 681 | Ga0207676_10002549 | 3300026095 | Bacteria | 13001 |
| 682 | Ga0207676_10002910 | 3300026095 | Bacteria | 12207 |
| 683 | Ga0207676_10008058 | 3300026095 | Bacteria | 7490 |
| 684 | Ga0207676_10200382 | 3300026095 | Unclassified | 1763 |
| 685 | Ga0207676_10208874 | 3300026095 | Unclassified | 1731 |
| 686 | Ga0207676_10279805 | 3300026095 | Bacteria | 1514 |
| 687 | Ga0207674_10000453 | 3300026116 | Bacteria | 53589 |
| 688 | Ga0207674_10006730 | 3300026116 | Bacteria | 13496 |
| 689 | Ga0207674_10015913 | 3300026116 | Bacteria | 8243 |
| 690 | Ga0207674_10026859 | 3300026116 | Bacteria | 6106 |
| 691 | Ga0207674_10045565 | 3300026116 | Bacteria | 4510 |
| 692 | Ga0207674_10063048 | 3300026116 | Bacteria | 3742 |
| 693 | Ga0207674_10065873 | 3300026116 | Bacteria | 3651 |
| 694 | Ga0207674_10080941 | 3300026116 | Bacteria | 3250 |
| 695 | Ga0207674_10142241 | 3300026116 | Bacteria | 2358 |
| 696 | Ga0207674_10320485 | 3300026116 | Bacteria | 1499 |
| 697 | Ga0207675_100000332 | 3300026118 | Bacteria | 45114 |
| 698 | Ga0207675_100002551 | 3300026118 | Bacteria | 18029 |
| 699 | Ga0207675_100011114 | 3300026118 | Bacteria | 8435 |
| 700 | Ga0207675_100039339 | 3300026118 | Bacteria | 4414 |
| 701 | Ga0207675_100055364 | 3300026118 | Bacteria | 3700 |
| 702 | Ga0207675_100108094 | 3300026118 | Bacteria | 2623 |
| 703 | Ga0207675_100194709 | 3300026118 | Bacteria | 1945 |
| 704 | Ga0207675_100213824 | 3300026118 | Bacteria | 1855 |
| 705 | Ga0207683_10059216 | 3300026121 | Bacteria | 3365 |
| 706 | Ga0207683_10105170 | 3300026121 | Bacteria | 2523 |
| 707 | Ga0207698_10005290 | 3300026142 | Bacteria | 7947 |
| 708 | Ga0207698_10012914 | 3300026142 | Bacteria | 5489 |
| 709 | Ga0207698_10045406 | 3300026142 | Bacteria | 3310 |
| 710 | Ga0207698_10063801 | 3300026142 | Bacteria | 2885 |
| 711 | Ga0207698_10124696 | 3300026142 | Bacteria | 2188 |
| 712 | Ga0207698_10174105 | 3300026142 | Bacteria | 1898 |
| 713 | Ga0207698_10190928 | 3300026142 | Bacteria | 1824 |
| 714 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 715 | Ga0268266_10000095 | 3300028379 | Bacteria | 186169 |
| 716 | Ga0268266_10016984 | 3300028379 | Bacteria | 6217 |
| 717 | Ga0268266_10104939 | 3300028379 | Bacteria | 2496 |
| 718 | Ga0268266_10290952 | 3300028379 | Unclassified | 1521 |
| 719 | Ga0268265_10006905 | 3300028380 | Bacteria | 7679 |
| 720 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 721 | Ga0268264_10001032 | 3300028381 | Bacteria | 27988 |
| 722 | Ga0268264_10002113 | 3300028381 | Bacteria | 17708 |
| 723 | Ga0268264_10002801 | 3300028381 | Bacteria | 15241 |
| 724 | Ga0268264_10011575 | 3300028381 | Bacteria | 7283 |
| 725 | Ga0268264_10011841 | 3300028381 | Bacteria | 7188 |
| 726 | Ga0268264_10029344 | 3300028381 | Bacteria | 4504 |
| 727 | Ga0268264_10050523 | 3300028381 | Bacteria | 3463 |
| 728 | Ga0268264_10086830 | 3300028381 | Bacteria | 2689 |
| 729 | Ga0268264_10186651 | 3300028381 | Bacteria | 1887 |
| 730 | Ga0268264_10202803 | 3300028381 | Bacteria | 1815 |
| 731 | Ga0307517_10000268 | 3300028786 | Bacteria | 89531 |
| 732 | Ga0307517_10015457 | 3300028786 | Bacteria | 10144 |
| 733 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 734 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 735 | Ga0265338_10011713 | 3300028800 | Bacteria | 10096 |
| 736 | Ga0265324_10012561 | 3300029957 | Bacteria | 3190 |
| 737 | Ga0307511_10001580 | 3300030521 | Bacteria | 24156 |
| 738 | Ga0265340_10105025 | 3300031247 | Bacteria | 1310 |
| 739 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 740 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 741 | Ga0265327_10000288 | 3300031251 | Bacteria | 99230 |
| 742 | Ga0265327_10000611 | 3300031251 | Bacteria | 59062 |
| 743 | Ga0265327_10009552 | 3300031251 | Bacteria | 6979 |
| 744 | Ga0265327_10014326 | 3300031251 | Bacteria | 5194 |
| 745 | Ga0307513_10062496 | 3300031456 | Bacteria | 3935 |
| 746 | Ga0307513_10271885 | 3300031456 | Bacteria | 1477 |
| 747 | Ga0307509_10021201 | 3300031507 | Bacteria | 7351 |
| 748 | Ga0307509_10190597 | 3300031507 | Bacteria | 1902 |
| 749 | Ga0307508_10004676 | 3300031616 | Bacteria | 13275 |
| 750 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 751 | Ga0307405_10042290 | 3300031731 | Bacteria | 2773 |
| 752 | Ga0307412_10185700 | 3300031911 | Bacteria | 1568 |
| 753 | Ga0307414_10195015 | 3300032004 | Bacteria | 1642 |
| 754 | Ga0307415_100118656 | 3300032126 | Bacteria | 1979 |
| 755 | Ga0307415_100317907 | 3300032126 | Bacteria | 1297 |
| 756 | Ga0307507_10005801 | 3300033179 | Bacteria | 19805 |
| 757 | Ga0307510_10001684 | 3300033180 | Bacteria | 24528 |
| 758 | Ga0307510_10003047 | 3300033180 | Bacteria | 19348 |
| 759 | Ga0373924_0019236 | 3300035410 | Bacteria | 2644 |
| 760 | Ga0373937_0047113 | 3300036401 | Bacteria | 3944 |
| 761 | Ga0373937_0055517 | 3300036401 | Bacteria | 3636 |
| 762 | Ga0373937_0079369 | 3300036401 | Bacteria | 3033 |
| 763 | Ga0373925_0091151 | 3300037068 | Bacteria | 2331 |
| 764 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 765 | Ga0395899_0000397 | 3300037312 | Bacteria | 51693 |
| 766 | Ga0395899_0000913 | 3300037312 | Bacteria | 27769 |
| 767 | Ga0395899_0004264 | 3300037312 | Bacteria | 11186 |
| 768 | Ga0395899_0067073 | 3300037312 | Bacteria | 2633 |
| 769 | Ga0395900_0000694 | 3300037418 | Bacteria | 44919 |
| 770 | Ga0395900_0002533 | 3300037418 | Bacteria | 20016 |
| 771 | Ga0395900_0010833 | 3300037418 | Bacteria | 9327 |
| 772 | Ga0395900_0063082 | 3300037418 | Bacteria | 3809 |
| 773 | Ga0395900_0085452 | 3300037418 | Bacteria | 3242 |
| 774 | Ga0395900_0094164 | 3300037418 | Bacteria | 3077 |
| 775 | Ga0395900_0222594 | 3300037418 | Bacteria | 1901 |
| 776 | Ga0395898_0000730 | 3300037466 | Bacteria | 57720 |
| 777 | Ga0395898_0018086 | 3300037466 | Bacteria | 7191 |
| 778 | Ga0395898_0043445 | 3300037466 | Bacteria | 4428 |
| 779 | Ga0395898_0068114 | 3300037466 | Bacteria | 3445 |
| 780 | Ga0395898_0100734 | 3300037466 | Bacteria | 2774 |
| 781 | Ga0395898_0168332 | 3300037466 | Bacteria | 2095 |
| 782 | Ga0395905_0000433 | 3300037471 | Bacteria | 58492 |
| 783 | Ga0395905_0000841 | 3300037471 | Bacteria | 40055 |
| 784 | Ga0395905_0001879 | 3300037471 | Bacteria | 24200 |
| 785 | Ga0395905_0005773 | 3300037471 | Bacteria | 12580 |
| 786 | Ga0395905_0010062 | 3300037471 | Bacteria | 9219 |
| 787 | Ga0395905_0109888 | 3300037471 | Bacteria | 2589 |
| 788 | Ga0395901_0000890 | 3300038443 | Bacteria | 32857 |
| 789 | Ga0395901_0001768 | 3300038443 | Bacteria | 22294 |
| 790 | Ga0395901_0004575 | 3300038443 | Bacteria | 13970 |
| 791 | Ga0395901_0005110 | 3300038443 | Bacteria | 13252 |
| 792 | Ga0395901_0006685 | 3300038443 | Bacteria | 11656 |
| 793 | Ga0395901_0032477 | 3300038443 | Bacteria | 5386 |
| 794 | Ga0395901_0109654 | 3300038443 | Bacteria | 2898 |
| 795 | Ga0395901_0180400 | 3300038443 | Bacteria | 2215 |
| 796 | Ga0436365_1179806 | 3300039437 | Bacteria | 16474 |
| 797 | Ga0436365_1257453 | 3300039437 | Bacteria | 10879 |
| 798 | Ga0439436_0016460 | 3300041404 | Bacteria | 2218 |
| 799 | Ga0439466_0048308 | 3300041411 | Bacteria | 1400 |
| 800 | Ga0439465_0013406 | 3300041413 | Bacteria | 2557 |
| 801 | Ga0451833_1091744 | 3300041491 | Bacteria | 1247 |
| 802 | Ga0439431_0002082 | 3300041997 | Bacteria | 4418 |
| 803 | Ga0439442_011767 | 3300042002 | Bacteria | 1784 |
| 804 | Ga0439448_0029975 | 3300042005 | Bacteria | 1724 |
| 805 | Ga0439449_0002212 | 3300042007 | Bacteria | 7656 |
| 806 | Ga0439462_0023317 | 3300042015 | Bacteria | 1622 |
| 807 | Ga0450894_005744 | 3300042131 | Bacteria | 1606 |
| 808 | Ga0451577_0004269 | 3300042876 | Bacteria | 15196 |
| 809 | Ga0451577_0268123 | 3300042876 | Bacteria | 1546 |
| 810 | Ga0466969_0000453 | 3300044656 | Bacteria | 22543 |
| 811 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 812 | Ga0466972_0000080 | 3300044658 | Bacteria | 89226 |
| 813 | Ga0466972_0014885 | 3300044658 | Bacteria | 3892 |
| 814 | Ga0466972_0032487 | 3300044658 | Bacteria | 2562 |
| 815 | Ga0466965_0004123 | 3300044683 | Bacteria | 6459 |
| 816 | Ga0466965_0009905 | 3300044683 | Bacteria | 4433 |
| 817 | Ga0466966_0000096 | 3300044684 | Bacteria | 54307 |
| 818 | Ga0466961_0044701 | 3300044693 | Bacteria | 2834 |
| 819 | Ga0453684_0085716 | 3300044712 | Bacteria | 3912 |
| 820 | Ga0466970_0005412 | 3300044765 | Bacteria | 6334 |
| 821 | Ga0466970_0099052 | 3300044765 | Bacteria | 1587 |
| 822 | Ga0466957_0231245 | 3300044842 | Bacteria | 1224 |
| 823 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 824 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 825 | Ga0451576_0287520 | 3300045051 | Bacteria | 1719 |
| 826 | Ga0451576_0357177 | 3300045051 | Bacteria | 1530 |
| 827 | Ga0466967_0155783 | 3300045976 | Bacteria | 2140 |
| 828 | Ga0495627_008066 | 3300046453 | Bacteria | 3970 |
| 829 | Ga0495639_0045153 | 3300046475 | Bacteria | 1993 |
| 830 | Ga0495662_0071054 | 3300046476 | Bacteria | 1687 |
| 831 | Ga0495606_0005929 | 3300046507 | Bacteria | 11479 |
| 832 | Ga0495628_0012069 | 3300046516 | Bacteria | 7285 |
| 833 | Ga0495630_0009376 | 3300046517 | Bacteria | 7037 |
| 834 | Ga0495631_0005844 | 3300046518 | Bacteria | 6413 |
| 835 | Ga0495644_0010812 | 3300046523 | Bacteria | 3516 |
| 836 | Ga0495648_0005283 | 3300046524 | Bacteria | 10785 |
| 837 | Ga0495598_0026105 | 3300046537 | Bacteria | 1599 |
| 838 | Ga0495633_0000116 | 3300046558 | Bacteria | 108667 |
| 839 | Ga0495667_0055403 | 3300046559 | Bacteria | 2608 |
| 840 | Ga0495668_0000384 | 3300046616 | Bacteria | 58265 |
| 841 | Ga0495668_0001762 | 3300046616 | Bacteria | 19803 |
| 842 | Ga0495668_0059065 | 3300046616 | Bacteria | 2116 |
| 843 | Ga0495634_0071236 | 3300046642 | Bacteria | 2289 |
| 844 | Ga0495611_0000677 | 3300046648 | Bacteria | 19441 |
| 845 | Ga0495625_0003718 | 3300046660 | Bacteria | 14874 |
| 846 | Ga0495625_0118486 | 3300046660 | Bacteria | 1804 |
| 847 | Ga0495647_0036192 | 3300046681 | Bacteria | 1857 |
| 848 | Ga0495658_0042678 | 3300046683 | Bacteria | 2533 |
| 849 | Ga0495624_0181122 | 3300046690 | Bacteria | 1284 |
| 850 | Ga0495649_0034475 | 3300046694 | Bacteria | 2785 |
| 851 | Ga0495636_0000202 | 3300047318 | Bacteria | 23274 |
| 852 | Ga0495674_0054754 | 3300047319 | Bacteria | 3502 |
| 853 | Ga0495672_0005120 | 3300047320 | Bacteria | 10461 |
| 854 | Ga0495672_0009074 | 3300047320 | Bacteria | 7252 |
| 855 | Ga0495672_0036015 | 3300047320 | Bacteria | 3042 |
| 856 | Ga0495683_0011665 | 3300047323 | Bacteria | 4624 |
| 857 | Ga0495687_008223 | 3300047443 | Bacteria | 6007 |
| 858 | Ga0495684_0048755 | 3300047471 | Bacteria | 3238 |
| 859 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 860 | Ga0495686_0000230 | 3300047472 | Bacteria | 102747 |
| 861 | Ga0495686_0039265 | 3300047472 | Bacteria | 3024 |
| 862 | Ga0495686_0044934 | 3300047472 | Bacteria | 2796 |
| 863 | Ga0495686_0046204 | 3300047472 | Bacteria | 2754 |
| 864 | Ga0496104_0433106 | 3300048907 | Bacteria | 1227 |
| 865 | Ga0496109_0055530 | 3300048912 | Bacteria | 3613 |
| 866 | Ga0496114_0000579 | 3300048917 | Bacteria | 27076 |
| 867 | Ga0496115_0090562 | 3300048918 | Bacteria | 2498 |
| 868 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 869 | Ga0496126_0021648 | 3300048929 | Bacteria | 6276 |
| 870 | Ga0501031_0029437 | 3300049568 | Bacteria | 3582 |
| 871 | Ga0501031_0179716 | 3300049568 | Bacteria | 1382 |
| 872 | Ga0501032_0002148 | 3300049569 | Bacteria | 15521 |
| 873 | Ga0501032_0006800 | 3300049569 | Bacteria | 8391 |
| 874 | Ga0501032_0080286 | 3300049569 | Bacteria | 2171 |
| 875 | Ga0501032_0086641 | 3300049569 | Bacteria | 2081 |
| 876 | Ga0501033_0084832 | 3300049570 | Bacteria | 2321 |
| 877 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 878 | Ga0501034_0000937 | 3300049571 | Bacteria | 42464 |
| 879 | Ga0501034_0004888 | 3300049571 | Bacteria | 14781 |
| 880 | Ga0501034_0005439 | 3300049571 | Bacteria | 13917 |
| 881 | Ga0501034_0022432 | 3300049571 | Bacteria | 6434 |
| 882 | Ga0501034_0101577 | 3300049571 | Bacteria | 2869 |
| 883 | Ga0501034_0186305 | 3300049571 | Bacteria | 2039 |
| 884 | Ga0501036_0007119 | 3300049572 | Bacteria | 9103 |
| 885 | Ga0501036_0007293 | 3300049572 | Bacteria | 9006 |
| 886 | Ga0501037_0000718 | 3300049573 | Bacteria | 25144 |
| 887 | Ga0501037_0054884 | 3300049573 | Bacteria | 2914 |
| 888 | Ga0501037_0072286 | 3300049573 | Bacteria | 2509 |
| 889 | Ga0501038_0007548 | 3300049574 | Bacteria | 10025 |
| 890 | Ga0501038_0096510 | 3300049574 | Bacteria | 2467 |
| 891 | Ga0501039_0010296 | 3300049575 | Bacteria | 7133 |
| 892 | Ga0501039_0075954 | 3300049575 | Bacteria | 2612 |
| 893 | Ga0501039_0298426 | 3300049575 | Bacteria | 1267 |
| 894 | Ga0501043_0002800 | 3300049579 | Bacteria | 14570 |
| 895 | Ga0501043_0004294 | 3300049579 | Bacteria | 11599 |
| 896 | Ga0501043_0042332 | 3300049579 | Bacteria | 3579 |
| 897 | Ga0501043_0111275 | 3300049579 | Bacteria | 2150 |
| 898 | Ga0501046_0028665 | 3300049580 | Bacteria | 4533 |
| 899 | Ga0501047_0006113 | 3300049581 | Bacteria | 11313 |
| 900 | Ga0501047_0014693 | 3300049581 | Bacteria | 7450 |
| 901 | Ga0501047_0023388 | 3300049581 | Bacteria | 5933 |
| 902 | Ga0501047_0093066 | 3300049581 | Bacteria | 2893 |
| 903 | Ga0501047_0169531 | 3300049581 | Bacteria | 2052 |
| 904 | Ga0501047_0235646 | 3300049581 | Bacteria | 1682 |
| 905 | Ga0501067_0010424 | 3300049583 | Bacteria | 5145 |
| 906 | Ga0501067_0016478 | 3300049583 | Bacteria | 4083 |
| 907 | Ga0501069_0012320 | 3300049585 | Bacteria | 4543 |
| 908 | Ga0501070_0003667 | 3300049586 | Bacteria | 13277 |
| 909 | Ga0501073_0022922 | 3300049589 | Bacteria | 4490 |
| 910 | Ga0501074_0003753 | 3300049590 | Bacteria | 10790 |
| 911 | Ga0501074_0205211 | 3300049590 | Bacteria | 1404 |
| 912 | Ga0501076_0246157 | 3300049592 | Bacteria | 1463 |
| 913 | Ga0501198_000255 | 3300049649 | Bacteria | 6727 |
| 914 | Ga0501235_000033 | 3300049669 | Bacteria | 22695 |
| 915 | Ga0501240_003176 | 3300049673 | Bacteria | 1811 |
| 916 | Ga0501243_000132 | 3300049675 | Bacteria | 8341 |
| 917 | Ga0501259_000226 | 3300049688 | Bacteria | 8796 |
| 918 | Ga0501219_000184 | 3300049703 | Bacteria | 11520 |
| 919 | Ga0501225_0005195 | 3300049705 | Bacteria | 3832 |
| 920 | Ga0501234_002126 | 3300049707 | Bacteria | 3134 |
| 921 | Ga0501080_0024066 | 3300049742 | Bacteria | 5644 |
| 922 | Ga0501080_0054575 | 3300049742 | Bacteria | 3720 |
| 923 | Ga0501083_0000193 | 3300049744 | Bacteria | 39210 |
| 924 | Ga0501241_000709 | 3300049758 | Bacteria | 7191 |
| 925 | Ga0501263_001923 | 3300049760 | Bacteria | 2053 |
| 926 | Ga0501035_0000916 | 3300049822 | Bacteria | 31216 |
| 927 | Ga0501035_0006985 | 3300049822 | Bacteria | 10544 |
| 928 | Ga0501035_0016926 | 3300049822 | Bacteria | 6720 |
| 929 | Ga0501035_0047473 | 3300049822 | Bacteria | 3854 |
| 930 | Ga0501035_0285679 | 3300049822 | Bacteria | 1393 |
| 931 | Ga0501044_0005186 | 3300049823 | Bacteria | 14501 |
| 932 | Ga0501044_0007354 | 3300049823 | Bacteria | 12108 |
| 933 | Ga0501044_0007617 | 3300049823 | Bacteria | 11907 |
| 934 | Ga0501044_0037163 | 3300049823 | Bacteria | 5091 |
| 935 | Ga0501044_0239864 | 3300049823 | Bacteria | 1757 |
| 936 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 937 | nmdc:mga0k408_114750_c1 | 3300050493 | Bacteria | 1593 |
| 938 | nmdc:mga0k408_31681_c1 | 3300050493 | Bacteria | 3020 |
| 939 | nmdc:mga0k408_608_c1 | 3300050493 | Bacteria | 9462 |
| 940 | nmdc:mga05p37_9673_c1 | 3300050507 | Bacteria | 11427 |
| 941 | nmdc:mga06r32_120612_c1 | 3300050510 | Bacteria | 2586 |
| 942 | nmdc:mga06r32_66628_c1 | 3300050510 | Bacteria | 3475 |
| 943 | nmdc:mga08y16_18017_c1 | 3300050511 | Bacteria | 7439 |
| 944 | nmdc:mga08y16_46681_c1 | 3300050511 | Bacteria | 4534 |
| 945 | Ga0500635_0003485 | 3300053080 | Bacteria | 3965 |
| 946 | Ga0500578_0000325 | 3300053086 | Bacteria | 58251 |
| 947 | Ga0500644_0000469 | 3300053088 | Bacteria | 17883 |
| 948 | Ga0500646_0009624 | 3300053090 | Bacteria | 2473 |
| 949 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 950 | Ga0500583_0001226 | 3300053092 | Bacteria | 7333 |
| 951 | Ga0500583_0012814 | 3300053092 | Bacteria | 3215 |
| 952 | Ga0500651_0038410 | 3300053093 | Bacteria | 3016 |
| 953 | Ga0500641_0058950 | 3300053096 | Bacteria | 1595 |
| 954 | Ga0500556_0006680 | 3300053104 | Bacteria | 3280 |
| 955 | Ga0500562_000024 | 3300053108 | Bacteria | 105996 |
| 956 | Ga0500562_037603 | 3300053108 | Bacteria | 1285 |
| 957 | Ga0500569_000534 | 3300053109 | Bacteria | 6350 |
| 958 | Ga0500642_0017004 | 3300053130 | Bacteria | 2778 |
| 959 | Ga0500658_0003895 | 3300053134 | Bacteria | 5614 |
| 960 | Ga0500568_0000380 | 3300053139 | Bacteria | 33995 |
| 961 | Ga0500577_0000937 | 3300053142 | Bacteria | 7565 |
| 962 | Ga0500616_0000868 | 3300053153 | Bacteria | 33454 |
| 963 | Ga0500616_0037288 | 3300053153 | Bacteria | 2632 |
| 964 | Ga0500622_0000379 | 3300053156 | Bacteria | 42858 |
| 965 | Ga0500622_0001080 | 3300053156 | Bacteria | 22682 |
| 966 | Ga0500622_0021845 | 3300053156 | Bacteria | 3395 |
| 967 | Ga0500636_0008604 | 3300053177 | Bacteria | 5911 |
| 968 | Ga0500637_0063707 | 3300053178 | Bacteria | 2114 |
| 969 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 970 | Ga0500645_011526 | 3300053730 | Bacteria | 2884 |
| 971 | Ga0500661_009665 | 3300055283 | Bacteria | 1763 |
| 972 | Ga0501082_0136985 | 3300060353 | Bacteria | 2124 |
| 973 | 2738725453 | 2738541278 | Bacteria | 9755573 |
| 974 | 2819574992 | 2818991442 | Bacteria | 8318214 |
| 975 | 2819585928 | 2818991444 | Bacteria | 6968812 |
| 976 | 2819676949 | 2818991460 | Bacteria | 7595395 |
| 977 | 2821141088 | 2821136567 | Bacteria | 8080116 |
| 978 | 2840678775 | 2840677318 | Bacteria | 2664183 |
| 979 | 2881956494 | 2881955468 | Bacteria | 3545609 |
| 980 | 2883069587 | 2883068021 | Bacteria | 6192739 |
| 981 | 2884796789 | 2884791551 | Bacteria | 8511252 |
| 982 | 2896086593 | 2896085136 | Bacteria | 6129793 |
| 983 | 2896113107 | 2896109856 | Bacteria | 7140722 |
| 984 | 2904471589 | 2904467357 | Bacteria | 8057758 |
| 985 | 2914761942 | 2914759650 | Bacteria | 4701441 |
| 986 | 2929159308 | 2929154850 | Bacteria | 6753285 |
| 987 | 2929177696 | 2929177148 | Bacteria | 7883697 |
| 988 | 2929240058 | 2929239360 | Bacteria | 7745570 |
| 989 | 2929921758 | 2929921140 | Bacteria | 8649150 |
| 990 | 2945980043 | 2945977869 | Bacteria | 7777518 |
| 991 | 2946014095 | 2946013367 | Bacteria | 7766675 |
| 992 | 8003154304 | 8003151029 | Bacteria | 8187759 |
| 993 | Ga0075366_10072518 | |||
| 994 | SwRhRL2b_contig_1759593 | |||
| 995 | MRS1b_contig_9249380 | |||
| 996 | JGI24740J21852_10000620 | |||
| 997 | JGI24735J21928_10008821 | |||
| 998 | JGI25162J39368_1000011 | |||
| 999 | JGI25154J39366_1000023 | |||
| 1000 | JGI25157J39369_1003320 | |||
| 1001 | JGI25406J46586_10014065 | |||
| 1002 | JGI25153J46596_10006783 | |||
| 1003 | JGI25153J46596_10006883 | |||
| 1004 | rootH2_10002397 | |||
| 1005 | rootH2_10003850 | |||
| 1006 | rootH2_10004303 | |||
| 1007 | rootH2_10062115 | |||
| 1008 | rootL2_10004867 | |||
| 1009 | rootL2_10130539 | |||
| 1010 | rootL2_10214933 | |||
| 1011 | rootH1_10007286 | |||
| 1012 | rootH1_10018718 | |||
| 1013 | JGI25160J50197_1001213 | |||
| 1014 | JGI25160J50197_1004488 | |||
| 1015 | JGI25160J50197_1012247 | |||
| 1016 | Ga0055526_1012624 | |||
| 1017 | Ga0055528_1000532 | |||
| 1018 | Ga0055530_10000185 | |||
| 1019 | Ga0055531_10000080 | |||
| 1020 | Ga0065165_1000027 | |||
| 1021 | Ga0065704_10070133 | |||
| 1022 | Ga0065704_10071007 | |||
| 1023 | Ga0065712_10000319 | |||
| 1024 | Ga0065712_10008603 | |||
| 1025 | Ga0065707_10091011 | |||
| 1026 | Ga0070658_10001898 | |||
| 1027 | Ga0070658_10007770 | |||
| 1028 | Ga0070676_10001559 | |||
| 1029 | Ga0070676_10028455 | |||
| 1030 | Ga0070676_10063039 | |||
| 1031 | Ga0070683_100008327 | |||
| 1032 | Ga0070683_100013501 | |||
| 1033 | Ga0070683_100015722 | |||
| 1034 | Ga0070683_100084320 | |||
| 1035 | Ga0070683_100099149 | |||
| 1036 | Ga0070690_100070034 | |||
| 1037 | Ga0070670_100015731 | |||
| 1038 | Ga0070670_100015901 | |||
| 1039 | Ga0070670_100076518 | |||
| 1040 | Ga0070670_100237273 | |||
| 1041 | Ga0070677_10012377 | |||
| 1042 | Ga0068869_100004070 | |||
| 1043 | Ga0068869_100045335 | |||
| 1044 | Ga0068869_100083234 | |||
| 1045 | Ga0068869_100094712 | |||
| 1046 | Ga0070666_10001268 | |||
| 1047 | Ga0070666_10003016 | |||
| 1048 | Ga0070666_10017735 | |||
| 1049 | Ga0070666_10022057 | |||
| 1050 | Ga0070680_100016131 | |||
| 1051 | Ga0070680_100196714 | |||
| 1052 | Ga0070682_100000012 | |||
| 1053 | Ga0068868_100011564 | |||
| 1054 | Ga0068868_100017757 | |||
| 1055 | Ga0068868_100054019 | |||
| 1056 | Ga0068868_100094299 | |||
| 1057 | Ga0068868_100100219 | |||
| 1058 | Ga0068868_100167366 | |||
| 1059 | Ga0070660_100099920 | |||
| 1060 | Ga0070660_100201295 | |||
| 1061 | Ga0070660_100218286 | |||
| 1062 | Ga0070660_100237410 | |||
| 1063 | Ga0070691_10000368 | |||
| 1064 | Ga0070691_10036152 | |||
| 1065 | Ga0070661_100002162 | |||
| 1066 | Ga0070661_100023481 | |||
| 1067 | Ga0070661_100025094 | |||
| 1068 | Ga0070661_100072439 | |||
| 1069 | Ga0070668_100000758 | |||
| 1070 | Ga0070668_100021157 | |||
| 1071 | Ga0070668_100067597 | |||
| 1072 | Ga0070669_100007886 | |||
| 1073 | Ga0070669_100019079 | |||
| 1074 | Ga0070669_100034935 | |||
| 1075 | Ga0070669_100094299 | |||
| 1076 | Ga0070669_100217694 | |||
| 1077 | Ga0070675_100003918 | |||
| 1078 | Ga0070675_100024343 | |||
| 1079 | Ga0070675_100033999 | |||
| 1080 | Ga0070675_100219334 | |||
| 1081 | Ga0070671_100027845 | |||
| 1082 | Ga0070671_100041838 | |||
| 1083 | Ga0070674_100022485 | |||
| 1084 | Ga0070674_100033034 | |||
| 1085 | Ga0070674_100037333 | |||
| 1086 | Ga0070673_100000723 | |||
| 1087 | Ga0070673_100018982 | |||
| 1088 | Ga0070673_100019081 | |||
| 1089 | Ga0070673_100068947 | |||
| 1090 | Ga0070659_100018691 | |||
| 1091 | Ga0070659_100039892 | |||
| 1092 | Ga0070659_100051274 | |||
| 1093 | Ga0070659_100052195 | |||
| 1094 | Ga0070659_100083411 | |||
| 1095 | Ga0070659_100128194 | |||
| 1096 | Ga0070667_100000567 | |||
| 1097 | Ga0070667_100197209 | |||
| 1098 | Ga0070701_10021006 | |||
| 1099 | Ga0070678_100065915 | |||
| 1100 | Ga0070678_100123155 | |||
| 1101 | Ga0070662_100000103 | |||
| 1102 | Ga0070662_100006612 | |||
| 1103 | Ga0070662_100008420 | |||
| 1104 | Ga0070662_100171448 | |||
| 1105 | Ga0070681_10120521 | |||
| 1106 | Ga0070681_10331018 | |||
| 1107 | Ga0068867_100002223 | |||
| 1108 | Ga0068867_100010325 | |||
| 1109 | Ga0068867_100011794 | |||
| 1110 | Ga0068867_100016164 | |||
| 1111 | Ga0068867_100042351 | |||
| 1112 | Ga0070707_100173914 | |||
| 1113 | Ga0070698_100003494 | |||
| 1114 | Ga0070698_100003801 | |||
| 1115 | Ga0070698_100010038 | |||
| 1116 | Ga0070679_100047590 | |||
| 1117 | Ga0070684_100005000 | |||
| 1118 | Ga0070684_100007172 | |||
| 1119 | Ga0070684_100014504 | |||
| 1120 | Ga0070684_100028792 | |||
| 1121 | Ga0070684_100038344 | |||
| 1122 | Ga0070684_100055466 | |||
| 1123 | Ga0070684_100159009 | |||
| 1124 | Ga0070684_100168144 | |||
| 1125 | Ga0068853_100004093 | |||
| 1126 | Ga0068853_100007073 | |||
| 1127 | Ga0068853_100011486 | |||
| 1128 | Ga0068853_100013878 | |||
| 1129 | Ga0068853_100017952 | |||
| 1130 | Ga0068853_100018681 | |||
| 1131 | Ga0068853_100019980 | |||
| 1132 | Ga0070672_100000449 | |||
| 1133 | Ga0070672_100011379 | |||
| 1134 | Ga0070672_100057129 | |||
| 1135 | Ga0070672_100074177 | |||
| 1136 | Ga0070686_100042789 | |||
| 1137 | Ga0070693_100003807 | |||
| 1138 | Ga0070693_100144493 | |||
| 1139 | Ga0070665_100000014 | |||
| 1140 | Ga0070665_100000083 | |||
| 1141 | Ga0070665_100023502 | |||
| 1142 | Ga0070665_100042302 | |||
| 1143 | Ga0070665_100114888 | |||
| 1144 | Ga0068855_100000081 | |||
| 1145 | Ga0068855_100001235 | |||
| 1146 | Ga0068855_100013077 | |||
| 1147 | Ga0068855_100016424 | |||
| 1148 | Ga0068855_100023260 | |||
| 1149 | Ga0068855_100060717 | |||
| 1150 | Ga0068855_100204091 | |||
| 1151 | Ga0070664_100001578 | |||
| 1152 | Ga0070664_100013993 | |||
| 1153 | Ga0070664_100039991 | |||
| 1154 | Ga0070664_100043980 | |||
| 1155 | Ga0070664_100072197 | |||
| 1156 | Ga0070664_100075230 | |||
| 1157 | Ga0070664_100075483 | |||
| 1158 | Ga0070664_100086287 | |||
| 1159 | Ga0070664_100093466 | |||
| 1160 | Ga0070664_100131438 | |||
| 1161 | Ga0070664_100140560 | |||
| 1162 | Ga0070664_100152617 | |||
| 1163 | Ga0070664_100320560 | |||
| 1164 | Ga0068857_100004492 | |||
| 1165 | Ga0068857_100005326 | |||
| 1166 | Ga0068857_100010794 | |||
| 1167 | Ga0068857_100029201 | |||
| 1168 | Ga0068857_100062029 | |||
| 1169 | Ga0068857_100086713 | |||
| 1170 | Ga0068857_100340268 | |||
| 1171 | Ga0068857_100384934 | |||
| 1172 | Ga0068857_100414415 | |||
| 1173 | Ga0068854_100006413 | |||
| 1174 | Ga0068856_100007749 | |||
| 1175 | Ga0068856_100009813 | |||
| 1176 | Ga0068856_100010791 | |||
| 1177 | Ga0068856_100024279 | |||
| 1178 | Ga0068856_100051848 | |||
| 1179 | Ga0068856_100058783 | |||
| 1180 | Ga0068856_100350139 | |||
| 1181 | Ga0068856_100357858 | |||
| 1182 | Ga0068856_100398003 | |||
| 1183 | Ga0068852_100001772 | |||
| 1184 | Ga0068852_100003669 | |||
| 1185 | Ga0068852_100005559 | |||
| 1186 | Ga0068852_100013328 | |||
| 1187 | Ga0068852_100015239 | |||
| 1188 | Ga0068852_100022959 | |||
| 1189 | Ga0068852_100029559 | |||
| 1190 | Ga0068852_100034912 | |||
| 1191 | Ga0068852_100047679 | |||
| 1192 | Ga0068859_100000024 | |||
| 1193 | Ga0068859_100004205 | |||
| 1194 | Ga0068859_100007001 | |||
| 1195 | Ga0068859_100063511 | |||
| 1196 | Ga0068859_100199116 | |||
| 1197 | Ga0068859_100356435 | |||
| 1198 | Ga0068864_100000612 | |||
| 1199 | Ga0068864_100003351 | |||
| 1200 | Ga0068864_100022983 | |||
| 1201 | Ga0068864_100047147 | |||
| 1202 | Ga0068864_100048041 | |||
| 1203 | Ga0068864_100094852 | |||
| 1204 | Ga0068864_100152003 | |||
| 1205 | Ga0068866_10083142 | |||
| 1206 | Ga0068861_100010534 | |||
| 1207 | Ga0068861_100011213 | |||
| 1208 | Ga0068861_100028581 | |||
| 1209 | Ga0068861_100030470 | |||
| 1210 | Ga0068861_100133478 | |||
| 1211 | Ga0068851_10001287 | |||
| 1212 | Ga0068870_10002733 | |||
| 1213 | Ga0068870_10010778 | |||
| 1214 | Ga0068863_100003886 | |||
| 1215 | Ga0068863_100008322 | |||
| 1216 | Ga0068863_100008613 | |||
| 1217 | Ga0068863_100011859 | |||
| 1218 | Ga0068863_100059400 | |||
| 1219 | Ga0068863_100214412 | |||
| 1220 | Ga0068863_100247802 | |||
| 1221 | Ga0068863_100344533 | |||
| 1222 | Ga0068863_100414847 | |||
| 1223 | Ga0068858_100015236 | |||
| 1224 | Ga0068858_100059006 | |||
| 1225 | Ga0068858_100133917 | |||
| 1226 | Ga0068860_100000024 | |||
| 1227 | Ga0068860_100001226 | |||
| 1228 | Ga0068860_100002264 | |||
| 1229 | Ga0068860_100002819 | |||
| 1230 | Ga0068860_100009265 | |||
| 1231 | Ga0068860_100056523 | |||
| 1232 | Ga0068860_100062123 | |||
| 1233 | Ga0068860_100082144 | |||
| 1234 | Ga0068860_100102143 | |||
| 1235 | Ga0068860_100212626 | |||
| 1236 | Ga0068860_100260520 | |||
| 1237 | Ga0068862_100004028 | |||
| 1238 | Ga0068862_100017129 | |||
| 1239 | Ga0068862_100152263 | |||
| 1240 | Ga0081540_1004002 | |||
| 1241 | Ga0081539_10001463 | |||
| 1242 | Ga0081539_10033716 | |||
| 1243 | Ga0070715_10012500 | |||
| 1244 | Ga0075366_10015837 | |||
| 1245 | Ga0075366_10084475 | |||
| 1246 | Ga0075366_10093880 | |||
| 1247 | Ga0075366_10127444 | |||
| 1248 | Ga0097621_100000839 | |||
| 1249 | Ga0097621_100002790 | |||
| 1250 | Ga0097621_100009053 | |||
| 1251 | Ga0097621_100023249 | |||
| 1252 | Ga0097621_100096389 | |||
| 1253 | Ga0097621_100137266 | |||
| 1254 | Ga0068871_100001731 | |||
| 1255 | Ga0068871_100003521 | |||
| 1256 | Ga0068871_100010126 | |||
| 1257 | Ga0068871_100011590 | |||
| 1258 | Ga0068871_100103406 | |||
| 1259 | Ga0068871_100170953 | |||
| 1260 | Ga0068871_100228817 | |||
| 1261 | Ga0075428_100029256 | |||
| 1262 | Ga0075431_100021549 | |||
| 1263 | Ga0075431_100026223 | |||
| 1264 | Ga0075431_100033023 | |||
| 1265 | Ga0075429_100000407 | |||
| 1266 | Ga0068865_100002395 | |||
| 1267 | Ga0068865_100012779 | |||
| 1268 | Ga0097620_100000024 | |||
| 1269 | Ga0097620_100001293 | |||
| 1270 | Ga0097620_100004205 | |||
| 1271 | Ga0097620_100007001 | |||
| 1272 | Ga0097620_100063503 | |||
| 1273 | Ga0097620_100199121 | |||
| 1274 | Ga0097620_100356396 | |||
| 1275 | Ga0105240_10000011 | |||
| 1276 | Ga0105240_10000106 | |||
| 1277 | Ga0105240_10001624 | |||
| 1278 | Ga0105240_10002363 | |||
| 1279 | Ga0105240_10002407 | |||
| 1280 | Ga0105240_10006526 | |||
| 1281 | Ga0105240_10007767 | |||
| 1282 | Ga0105240_10008691 | |||
| 1283 | Ga0105240_10016355 | |||
| 1284 | Ga0105240_10025827 | |||
| 1285 | Ga0105240_10035129 | |||
| 1286 | Ga0105240_10035580 | |||
| 1287 | Ga0105240_10085340 | |||
| 1288 | Ga0105240_10097933 | |||
| 1289 | Ga0105240_10109150 | |||
| 1290 | Ga0111539_10000458 | |||
| 1291 | Ga0111539_10025327 | |||
| 1292 | Ga0111539_10198461 | |||
| 1293 | Ga0111539_10222463 | |||
| 1294 | Ga0105245_10028055 | |||
| 1295 | Ga0105247_10001556 | |||
| 1296 | Ga0105247_10002650 | |||
| 1297 | Ga0105247_10011428 | |||
| 1298 | Ga0114129_10002233 | |||
| 1299 | Ga0114129_10078244 | |||
| 1300 | Ga0105243_10180362 | |||
| 1301 | Ga0105241_10000056 | |||
| 1302 | Ga0105241_10000775 | |||
| 1303 | Ga0105241_10002612 | |||
| 1304 | Ga0105241_10007787 | |||
| 1305 | Ga0105241_10087729 | |||
| 1306 | Ga0105242_10004393 | |||
| 1307 | Ga0105242_10006918 | |||
| 1308 | Ga0105242_10007249 | |||
| 1309 | Ga0105242_10017245 | |||
| 1310 | Ga0105242_10032510 | |||
| 1311 | Ga0105242_10046277 | |||
| 1312 | Ga0105248_10245490 | |||
| 1313 | Ga0105237_10000561 | |||
| 1314 | Ga0105237_10000696 | |||
| 1315 | Ga0105237_10000855 | |||
| 1316 | Ga0105237_10003378 | |||
| 1317 | Ga0105237_10004378 | |||
| 1318 | Ga0105237_10007863 | |||
| 1319 | Ga0105237_10025728 | |||
| 1320 | Ga0105237_10026296 | |||
| 1321 | Ga0105237_10033236 | |||
| 1322 | Ga0105237_10272365 | |||
| 1323 | Ga0105237_10337132 | |||
| 1324 | Ga0105238_10001830 | |||
| 1325 | Ga0105238_10180978 | |||
| 1326 | Ga0105249_10003210 | |||
| 1327 | Ga0105249_10005957 | |||
| 1328 | Ga0105249_10007197 | |||
| 1329 | Ga0105249_10016437 | |||
| 1330 | Ga0105249_10018824 | |||
| 1331 | Ga0105249_10056836 | |||
| 1332 | Ga0105249_10092486 | |||
| 1333 | Ga0105249_10152492 | |||
| 1334 | Ga0105249_10168993 | |||
| 1335 | Ga0105249_10251423 | |||
| 1336 | Ga0105239_10000580 | |||
| 1337 | Ga0105239_10001802 | |||
| 1338 | Ga0105239_10002300 | |||
| 1339 | Ga0105239_10007101 | |||
| 1340 | Ga0105239_10017205 | |||
| 1341 | Ga0105239_10028924 | |||
| 1342 | Ga0105239_10041537 | |||
| 1343 | Ga0105239_10325139 | |||
| 1344 | Ga0105239_10337602 | |||
| 1345 | Ga0105239_10488142 | |||
| 1346 | Ga0105246_10021094 | |||
| 1347 | Ga0105246_10034709 | |||
| 1348 | Ga0157373_10002019 | |||
| 1349 | Ga0157373_10002576 | |||
| 1350 | Ga0157373_10009023 | |||
| 1351 | Ga0157373_10012873 | |||
| 1352 | Ga0157373_10026659 | |||
| 1353 | Ga0157373_10108863 | |||
| 1354 | Ga0157373_10160577 | |||
| 1355 | Ga0157371_10000141 | |||
| 1356 | Ga0157371_10001044 | |||
| 1357 | Ga0157371_10001795 | |||
| 1358 | Ga0157371_10002241 | |||
| 1359 | Ga0157371_10002756 | |||
| 1360 | Ga0157371_10002926 | |||
| 1361 | Ga0157371_10003663 | |||
| 1362 | Ga0157371_10005857 | |||
| 1363 | Ga0157371_10009991 | |||
| 1364 | Ga0157371_10011660 | |||
| 1365 | Ga0157371_10020366 | |||
| 1366 | Ga0157371_10022928 | |||
| 1367 | Ga0157371_10048549 | |||
| 1368 | Ga0157371_10051420 | |||
| 1369 | Ga0157371_10090612 | |||
| 1370 | Ga0157371_10135277 | |||
| 1371 | Ga0157370_10000491 | |||
| 1372 | Ga0157370_10000945 | |||
| 1373 | Ga0157370_10001381 | |||
| 1374 | Ga0157370_10006901 | |||
| 1375 | Ga0157370_10008209 | |||
| 1376 | Ga0157370_10020969 | |||
| 1377 | Ga0157370_10185900 | |||
| 1378 | Ga0157369_10058643 | |||
| 1379 | Ga0157369_10074602 | |||
| 1380 | Ga0157369_10105419 | |||
| 1381 | Ga0157369_10139186 | |||
| 1382 | Ga0157369_10222353 | |||
| 1383 | Ga0157374_10000027 | |||
| 1384 | Ga0157374_10000640 | |||
| 1385 | Ga0157374_10001051 | |||
| 1386 | Ga0157374_10002178 | |||
| 1387 | Ga0157374_10006069 | |||
| 1388 | Ga0157374_10054213 | |||
| 1389 | Ga0157374_10100148 | |||
| 1390 | Ga0157374_10155812 | |||
| 1391 | Ga0157378_10004366 | |||
| 1392 | Ga0157378_10012093 | |||
| 1393 | Ga0157378_10097757 | |||
| 1394 | Ga0157378_10123781 | |||
| 1395 | Ga0157378_10207710 | |||
| 1396 | Ga0157378_10256235 | |||
| 1397 | Ga0157378_10342042 | |||
| 1398 | Ga0163162_10000068 | |||
| 1399 | Ga0163162_10000096 | |||
| 1400 | Ga0163162_10000142 | |||
| 1401 | Ga0163162_10000153 | |||
| 1402 | Ga0163162_10001124 | |||
| 1403 | Ga0163162_10002730 | |||
| 1404 | Ga0163162_10003086 | |||
| 1405 | Ga0163162_10005777 | |||
| 1406 | Ga0163162_10007257 | |||
| 1407 | Ga0163162_10031816 | |||
| 1408 | Ga0163162_10087312 | |||
| 1409 | Ga0163162_10166860 | |||
| 1410 | Ga0163162_10195547 | |||
| 1411 | Ga0163162_10284239 | |||
| 1412 | Ga0163162_10449998 | |||
| 1413 | Ga0157372_10000171 | |||
| 1414 | Ga0157372_10000418 | |||
| 1415 | Ga0157372_10000463 | |||
| 1416 | Ga0157372_10002554 | |||
| 1417 | Ga0157372_10004995 | |||
| 1418 | Ga0157372_10016951 | |||
| 1419 | Ga0157372_10017801 | |||
| 1420 | Ga0157372_10028942 | |||
| 1421 | Ga0157372_10049248 | |||
| 1422 | Ga0157372_10120764 | |||
| 1423 | Ga0157372_10134672 | |||
| 1424 | Ga0157372_10211920 | |||
| 1425 | Ga0157372_10423955 | |||
| 1426 | Ga0157372_10458358 | |||
| 1427 | Ga0157375_10000622 | |||
| 1428 | Ga0157375_10004424 | |||
| 1429 | Ga0157375_10008218 | |||
| 1430 | Ga0157375_10013976 | |||
| 1431 | Ga0157375_10191331 | |||
| 1432 | Ga0157375_10355022 | |||
| 1433 | Ga0157375_10365016 | |||
| 1434 | Ga0157375_10544362 | |||
| 1435 | Ga0157375_10625817 | |||
| 1436 | Ga0163163_10000251 | |||
| 1437 | Ga0163163_10000325 | |||
| 1438 | Ga0163163_10004966 | |||
| 1439 | Ga0163163_10008774 | |||
| 1440 | Ga0163163_10067344 | |||
| 1441 | Ga0163163_10070351 | |||
| 1442 | Ga0157380_10002400 | |||
| 1443 | Ga0157380_10006245 | |||
| 1444 | Ga0157380_10040531 | |||
| 1445 | Ga0157380_10143712 | |||
| 1446 | Ga0157377_10002011 | |||
| 1447 | Ga0157377_10024184 | |||
| 1448 | Ga0157377_10028966 | |||
| 1449 | Ga0157377_10030337 | |||
| 1450 | Ga0157379_10000128 | |||
| 1451 | Ga0157379_10092058 | |||
| 1452 | Ga0157379_10095514 | |||
| 1453 | Ga0157376_10000334 | |||
| 1454 | Ga0157376_10000931 | |||
| 1455 | Ga0157376_10016786 | |||
| 1456 | Ga0163161_10010439 | |||
| 1457 | Ga0163161_10022116 | |||
| 1458 | Ga0213876_10014951 | |||
| 1459 | Ga0209436_100698 | |||
| 1460 | Ga0209437_100017 | |||
| 1461 | Ga0209646_1000004 | |||
| 1462 | Ga0209646_1001408 | |||
| 1463 | Ga0209026_1000136 | |||
| 1464 | Ga0209026_1001610 | |||
| 1465 | Ga0209148_1000251 | |||
| 1466 | Ga0209673_1000203 | |||
| 1467 | Ga0209130_1004265 | |||
| 1468 | Ga0209758_1001443 | |||
| 1469 | Ga0209050_1000276 | |||
| 1470 | Ga0207426_1000024 | |||
| 1471 | Ga0207426_1000104 | |||
| 1472 | Ga0207426_1000957 | |||
| 1473 | Ga0207426_1005363 | |||
| 1474 | Ga0209257_1000004 | |||
| 1475 | Ga0207656_10001599 | |||
| 1476 | Ga0207642_10026816 | |||
| 1477 | Ga0207710_10004858 | |||
| 1478 | Ga0207710_10012930 | |||
| 1479 | Ga0207688_10028053 | |||
| 1480 | Ga0207680_10006273 | |||
| 1481 | Ga0207680_10040785 | |||
| 1482 | Ga0207647_10000062 | |||
| 1483 | Ga0207647_10000263 | |||
| 1484 | Ga0207647_10000360 | |||
| 1485 | Ga0207647_10002291 | |||
| 1486 | Ga0207647_10077507 | |||
| 1487 | Ga0207645_10000385 | |||
| 1488 | Ga0207645_10005692 | |||
| 1489 | Ga0207645_10056613 | |||
| 1490 | Ga0207645_10072411 | |||
| 1491 | Ga0207645_10075083 | |||
| 1492 | Ga0207643_10004478 | |||
| 1493 | Ga0207643_10004874 | |||
| 1494 | Ga0207705_10002223 | |||
| 1495 | Ga0207705_10010869 | |||
| 1496 | Ga0207705_10029388 | |||
| 1497 | Ga0207654_10000315 | |||
| 1498 | Ga0207654_10000365 | |||
| 1499 | Ga0207654_10004131 | |||
| 1500 | Ga0207707_10000026 | |||
| 1501 | Ga0207707_10000067 | |||
| 1502 | Ga0207707_10268855 | |||
| 1503 | Ga0207707_10268968 | |||
| 1504 | Ga0207695_10000010 | |||
| 1505 | Ga0207695_10000087 | |||
| 1506 | Ga0207695_10001064 | |||
| 1507 | Ga0207695_10002158 | |||
| 1508 | Ga0207695_10004051 | |||
| 1509 | Ga0207695_10005987 | |||
| 1510 | Ga0207695_10006146 | |||
| 1511 | Ga0207695_10006647 | |||
| 1512 | Ga0207695_10012275 | |||
| 1513 | Ga0207695_10019778 | |||
| 1514 | Ga0207695_10033373 | |||
| 1515 | Ga0207695_10035311 | |||
| 1516 | Ga0207695_10047536 | |||
| 1517 | Ga0207695_10080104 | |||
| 1518 | Ga0207695_10157607 | |||
| 1519 | Ga0207671_10000150 | |||
| 1520 | Ga0207671_10004672 | |||
| 1521 | Ga0207671_10004755 | |||
| 1522 | Ga0207671_10005720 | |||
| 1523 | Ga0207671_10006030 | |||
| 1524 | Ga0207671_10010089 | |||
| 1525 | Ga0207671_10015577 | |||
| 1526 | Ga0207660_10031021 | |||
| 1527 | Ga0207660_10046543 | |||
| 1528 | Ga0207662_10018352 | |||
| 1529 | Ga0207662_10156221 | |||
| 1530 | Ga0207657_10011455 | |||
| 1531 | Ga0207657_10070124 | |||
| 1532 | Ga0207657_10072673 | |||
| 1533 | Ga0207657_10106859 | |||
| 1534 | Ga0207657_10185584 | |||
| 1535 | Ga0207657_10252414 | |||
| 1536 | Ga0207649_10001633 | |||
| 1537 | Ga0207649_10037021 | |||
| 1538 | Ga0207649_10040436 | |||
| 1539 | Ga0207652_10000035 | |||
| 1540 | Ga0207652_10000109 | |||
| 1541 | Ga0207652_10000159 | |||
| 1542 | Ga0207652_10051010 | |||
| 1543 | Ga0207652_10084317 | |||
| 1544 | Ga0207652_10125359 | |||
| 1545 | Ga0207646_10096044 | |||
| 1546 | Ga0207681_10011482 | |||
| 1547 | Ga0207681_10120995 | |||
| 1548 | Ga0207694_10005172 | |||
| 1549 | Ga0207694_10041995 | |||
| 1550 | Ga0207694_10144105 | |||
| 1551 | Ga0207650_10005285 | |||
| 1552 | Ga0207650_10010553 | |||
| 1553 | Ga0207650_10013216 | |||
| 1554 | Ga0207650_10079707 | |||
| 1555 | Ga0207650_10119410 | |||
| 1556 | Ga0207650_10229102 | |||
| 1557 | Ga0207659_10009731 | |||
| 1558 | Ga0207659_10029611 | |||
| 1559 | Ga0207659_10056732 | |||
| 1560 | Ga0207659_10238010 | |||
| 1561 | Ga0207687_10188207 | |||
| 1562 | Ga0207664_10080245 | |||
| 1563 | Ga0207644_10070017 | |||
| 1564 | Ga0207644_10076097 | |||
| 1565 | Ga0207690_10006760 | |||
| 1566 | Ga0207690_10048675 | |||
| 1567 | Ga0207690_10068499 | |||
| 1568 | Ga0207690_10232491 | |||
| 1569 | Ga0207706_10004297 | |||
| 1570 | Ga0207706_10016258 | |||
| 1571 | Ga0207706_10023961 | |||
| 1572 | Ga0207706_10026986 | |||
| 1573 | Ga0207706_10039659 | |||
| 1574 | Ga0207686_10000566 | |||
| 1575 | Ga0207686_10047991 | |||
| 1576 | Ga0207686_10109150 | |||
| 1577 | Ga0207670_10030852 | |||
| 1578 | Ga0207669_10011448 | |||
| 1579 | Ga0207691_10001341 | |||
| 1580 | Ga0207691_10008451 | |||
| 1581 | Ga0207691_10029587 | |||
| 1582 | Ga0207691_10053222 | |||
| 1583 | Ga0207691_10090792 | |||
| 1584 | Ga0207691_10182070 | |||
| 1585 | Ga0207691_10236301 | |||
| 1586 | Ga0207691_10249410 | |||
| 1587 | Ga0207689_10003540 | |||
| 1588 | Ga0207689_10003722 | |||
| 1589 | Ga0207689_10005343 | |||
| 1590 | Ga0207689_10008125 | |||
| 1591 | Ga0207689_10013922 | |||
| 1592 | Ga0207689_10026642 | |||
| 1593 | Ga0207689_10036891 | |||
| 1594 | Ga0207689_10059527 | |||
| 1595 | Ga0207689_10092768 | |||
| 1596 | Ga0207689_10095987 | |||
| 1597 | Ga0207661_10036242 | |||
| 1598 | Ga0207661_10076377 | |||
| 1599 | Ga0207661_10088987 | |||
| 1600 | Ga0207661_10111644 | |||
| 1601 | Ga0207661_10122930 | |||
| 1602 | Ga0207679_10000308 | |||
| 1603 | Ga0207679_10009684 | |||
| 1604 | Ga0207679_10015474 | |||
| 1605 | Ga0207679_10019657 | |||
| 1606 | Ga0207679_10024979 | |||
| 1607 | Ga0207679_10156200 | |||
| 1608 | Ga0207679_10211496 | |||
| 1609 | Ga0207667_10000584 | |||
| 1610 | Ga0207667_10001565 | |||
| 1611 | Ga0207667_10016433 | |||
| 1612 | Ga0207667_10032055 | |||
| 1613 | Ga0207667_10057085 | |||
| 1614 | Ga0207667_10108221 | |||
| 1615 | Ga0207667_10144103 | |||
| 1616 | Ga0207667_10174362 | |||
| 1617 | Ga0207667_10492682 | |||
| 1618 | Ga0207651_10105025 | |||
| 1619 | Ga0207712_10005799 | |||
| 1620 | Ga0207712_10010483 | |||
| 1621 | Ga0207712_10016326 | |||
| 1622 | Ga0207712_10072396 | |||
| 1623 | Ga0207712_10177381 | |||
| 1624 | Ga0207668_10001365 | |||
| 1625 | Ga0207668_10037363 | |||
| 1626 | Ga0207640_10004728 | |||
| 1627 | Ga0207658_10037300 | |||
| 1628 | Ga0207658_10047918 | |||
| 1629 | Ga0207658_10059916 | |||
| 1630 | Ga0207677_10008694 | |||
| 1631 | Ga0207677_10022096 | |||
| 1632 | Ga0207677_10071606 | |||
| 1633 | Ga0207677_10108113 | |||
| 1634 | Ga0207677_10129013 | |||
| 1635 | Ga0207703_10006574 | |||
| 1636 | Ga0207703_10055443 | |||
| 1637 | Ga0207703_10056598 | |||
| 1638 | Ga0207639_10007804 | |||
| 1639 | Ga0207639_10009497 | |||
| 1640 | Ga0207639_10012342 | |||
| 1641 | Ga0207639_10012619 | |||
| 1642 | Ga0207639_10020809 | |||
| 1643 | Ga0207639_10041440 | |||
| 1644 | Ga0207639_10097583 | |||
| 1645 | Ga0207639_10370567 | |||
| 1646 | Ga0207678_10017432 | |||
| 1647 | Ga0207708_10128290 | |||
| 1648 | Ga0207702_10014081 | |||
| 1649 | Ga0207702_10014288 | |||
| 1650 | Ga0207702_10155047 | |||
| 1651 | Ga0207702_10174505 | |||
| 1652 | Ga0207702_10248525 | |||
| 1653 | Ga0207702_10288614 | |||
| 1654 | Ga0207702_10314050 | |||
| 1655 | Ga0207702_10355433 | |||
| 1656 | Ga0207702_10374910 | |||
| 1657 | Ga0207641_10000087 | |||
| 1658 | Ga0207641_10002639 | |||
| 1659 | Ga0207641_10005383 | |||
| 1660 | Ga0207641_10034916 | |||
| 1661 | Ga0207641_10079644 | |||
| 1662 | Ga0207641_10197516 | |||
| 1663 | Ga0207648_10001213 | |||
| 1664 | Ga0207648_10002051 | |||
| 1665 | Ga0207648_10004056 | |||
| 1666 | Ga0207648_10006875 | |||
| 1667 | Ga0207648_10009532 | |||
| 1668 | Ga0207648_10021761 | |||
| 1669 | Ga0207648_10046913 | |||
| 1670 | Ga0207648_10047097 | |||
| 1671 | Ga0207648_10058790 | |||
| 1672 | Ga0207648_10267170 | |||
| 1673 | Ga0207676_10002549 | |||
| 1674 | Ga0207676_10002910 | |||
| 1675 | Ga0207676_10008058 | |||
| 1676 | Ga0207676_10200382 | |||
| 1677 | Ga0207676_10208874 | |||
| 1678 | Ga0207676_10279805 | |||
| 1679 | Ga0207674_10000453 | |||
| 1680 | Ga0207674_10006730 | |||
| 1681 | Ga0207674_10015913 | |||
| 1682 | Ga0207674_10026859 | |||
| 1683 | Ga0207674_10045565 | |||
| 1684 | Ga0207674_10063048 | |||
| 1685 | Ga0207674_10065873 | |||
| 1686 | Ga0207674_10080941 | |||
| 1687 | Ga0207674_10142241 | |||
| 1688 | Ga0207674_10320485 | |||
| 1689 | Ga0207675_100000332 | |||
| 1690 | Ga0207675_100002551 | |||
| 1691 | Ga0207675_100011114 | |||
| 1692 | Ga0207675_100039339 | |||
| 1693 | Ga0207675_100055364 | |||
| 1694 | Ga0207675_100108094 | |||
| 1695 | Ga0207675_100194709 | |||
| 1696 | Ga0207675_100213824 | |||
| 1697 | Ga0207683_10059216 | |||
| 1698 | Ga0207683_10105170 | |||
| 1699 | Ga0207698_10005290 | |||
| 1700 | Ga0207698_10012914 | |||
| 1701 | Ga0207698_10045406 | |||
| 1702 | Ga0207698_10063801 | |||
| 1703 | Ga0207698_10124696 | |||
| 1704 | Ga0207698_10174105 | |||
| 1705 | Ga0207698_10190928 | |||
| 1706 | Ga0268266_10000048 | |||
| 1707 | Ga0268266_10000095 | |||
| 1708 | Ga0268266_10016984 | |||
| 1709 | Ga0268266_10104939 | |||
| 1710 | Ga0268266_10290952 | |||
| 1711 | Ga0268265_10006905 | |||
| 1712 | Ga0268264_10000028 | |||
| 1713 | Ga0268264_10001032 | |||
| 1714 | Ga0268264_10002113 | |||
| 1715 | Ga0268264_10002801 | |||
| 1716 | Ga0268264_10011575 | |||
| 1717 | Ga0268264_10011841 | |||
| 1718 | Ga0268264_10029344 | |||
| 1719 | Ga0268264_10050523 | |||
| 1720 | Ga0268264_10086830 | |||
| 1721 | Ga0268264_10186651 | |||
| 1722 | Ga0268264_10202803 | |||
| 1723 | Ga0307517_10000268 | |||
| 1724 | Ga0307517_10015457 | |||
| 1725 | Ga0307515_10000001 | |||
| 1726 | Ga0307515_10000059 | |||
| 1727 | Ga0265338_10011713 | |||
| 1728 | Ga0265324_10012561 | |||
| 1729 | Ga0307511_10001580 | |||
| 1730 | Ga0265340_10105025 | |||
| 1731 | Ga0265327_10000006 | |||
| 1732 | Ga0265327_10000024 | |||
| 1733 | Ga0265327_10000288 | |||
| 1734 | Ga0265327_10000611 | |||
| 1735 | Ga0265327_10009552 | |||
| 1736 | Ga0265327_10014326 | |||
| 1737 | Ga0307513_10062496 | |||
| 1738 | Ga0307513_10271885 | |||
| 1739 | Ga0307509_10021201 | |||
| 1740 | Ga0307509_10190597 | |||
| 1741 | Ga0307508_10004676 | |||
| 1742 | Ga0307516_10000159 | |||
| 1743 | Ga0307405_10042290 | |||
| 1744 | Ga0307412_10185700 | |||
| 1745 | Ga0307414_10195015 | |||
| 1746 | Ga0307415_100118656 | |||
| 1747 | Ga0307415_100317907 | |||
| 1748 | Ga0307507_10005801 | |||
| 1749 | Ga0307510_10001684 | |||
| 1750 | Ga0307510_10003047 | |||
| 1751 | Ga0373924_0019236 | |||
| 1752 | Ga0373937_0047113 | |||
| 1753 | Ga0373937_0055517 | |||
| 1754 | Ga0373937_0079369 | |||
| 1755 | Ga0373925_0091151 | |||
| 1756 | Ga0395899_0000002 | |||
| 1757 | Ga0395899_0000397 | |||
| 1758 | Ga0395899_0000913 | |||
| 1759 | Ga0395899_0004264 | |||
| 1760 | Ga0395899_0067073 | |||
| 1761 | Ga0395900_0000694 | |||
| 1762 | Ga0395900_0002533 | |||
| 1763 | Ga0395900_0010833 | |||
| 1764 | Ga0395900_0063082 | |||
| 1765 | Ga0395900_0085452 | |||
| 1766 | Ga0395900_0094164 | |||
| 1767 | Ga0395900_0222594 | |||
| 1768 | Ga0395898_0000730 | |||
| 1769 | Ga0395898_0018086 | |||
| 1770 | Ga0395898_0043445 | |||
| 1771 | Ga0395898_0068114 | |||
| 1772 | Ga0395898_0100734 | |||
| 1773 | Ga0395898_0168332 | |||
| 1774 | Ga0395905_0000433 | |||
| 1775 | Ga0395905_0000841 | |||
| 1776 | Ga0395905_0001879 | |||
| 1777 | Ga0395905_0005773 | |||
| 1778 | Ga0395905_0010062 | |||
| 1779 | Ga0395905_0109888 | |||
| 1780 | Ga0395901_0000890 | |||
| 1781 | Ga0395901_0001768 | |||
| 1782 | Ga0395901_0004575 | |||
| 1783 | Ga0395901_0005110 | |||
| 1784 | Ga0395901_0006685 | |||
| 1785 | Ga0395901_0032477 | |||
| 1786 | Ga0395901_0109654 | |||
| 1787 | Ga0395901_0180400 | |||
| 1788 | Ga0436365_1179806 | |||
| 1789 | Ga0436365_1257453 | |||
| 1790 | Ga0439436_0016460 | |||
| 1791 | Ga0439466_0048308 | |||
| 1792 | Ga0439465_0013406 | |||
| 1793 | Ga0451833_1091744 | |||
| 1794 | Ga0439431_0002082 | |||
| 1795 | Ga0439442_011767 | |||
| 1796 | Ga0439448_0029975 | |||
| 1797 | Ga0439449_0002212 | |||
| 1798 | Ga0439462_0023317 | |||
| 1799 | Ga0450894_005744 | |||
| 1800 | Ga0451577_0004269 | |||
| 1801 | Ga0451577_0268123 | |||
| 1802 | Ga0466969_0000453 | |||
| 1803 | Ga0466972_0000001 | |||
| 1804 | Ga0466972_0000080 | |||
| 1805 | Ga0466972_0014885 | |||
| 1806 | Ga0466972_0032487 | |||
| 1807 | Ga0466965_0004123 | |||
| 1808 | Ga0466965_0009905 | |||
| 1809 | Ga0466966_0000096 | |||
| 1810 | Ga0466961_0044701 | |||
| 1811 | Ga0453684_0085716 | |||
| 1812 | Ga0466970_0005412 | |||
| 1813 | Ga0466970_0099052 | |||
| 1814 | Ga0466957_0231245 | |||
| 1815 | Ga0466959_0000014 | |||
| 1816 | Ga0451576_0000003 | |||
| 1817 | Ga0451576_0287520 | |||
| 1818 | Ga0451576_0357177 | |||
| 1819 | Ga0466967_0155783 | |||
| 1820 | Ga0495627_008066 | |||
| 1821 | Ga0495639_0045153 | |||
| 1822 | Ga0495662_0071054 | |||
| 1823 | Ga0495606_0005929 | |||
| 1824 | Ga0495628_0012069 | |||
| 1825 | Ga0495630_0009376 | |||
| 1826 | Ga0495631_0005844 | |||
| 1827 | Ga0495644_0010812 | |||
| 1828 | Ga0495648_0005283 | |||
| 1829 | Ga0495598_0026105 | |||
| 1830 | Ga0495633_0000116 | |||
| 1831 | Ga0495667_0055403 | |||
| 1832 | Ga0495668_0000384 | |||
| 1833 | Ga0495668_0001762 | |||
| 1834 | Ga0495668_0059065 | |||
| 1835 | Ga0495634_0071236 | |||
| 1836 | Ga0495611_0000677 | |||
| 1837 | Ga0495625_0003718 | |||
| 1838 | Ga0495625_0118486 | |||
| 1839 | Ga0495647_0036192 | |||
| 1840 | Ga0495658_0042678 | |||
| 1841 | Ga0495624_0181122 | |||
| 1842 | Ga0495649_0034475 | |||
| 1843 | Ga0495636_0000202 | |||
| 1844 | Ga0495674_0054754 | |||
| 1845 | Ga0495672_0005120 | |||
| 1846 | Ga0495672_0009074 | |||
| 1847 | Ga0495672_0036015 | |||
| 1848 | Ga0495683_0011665 | |||
| 1849 | Ga0495687_008223 | |||
| 1850 | Ga0495684_0048755 | |||
| 1851 | Ga0495686_0000005 | |||
| 1852 | Ga0495686_0000230 | |||
| 1853 | Ga0495686_0039265 | |||
| 1854 | Ga0495686_0044934 | |||
| 1855 | Ga0495686_0046204 | |||
| 1856 | Ga0496104_0433106 | |||
| 1857 | Ga0496109_0055530 | |||
| 1858 | Ga0496114_0000579 | |||
| 1859 | Ga0496115_0090562 | |||
| 1860 | Ga0496121_0000081 | |||
| 1861 | Ga0496126_0021648 | |||
| 1862 | Ga0501031_0029437 | |||
| 1863 | Ga0501031_0179716 | |||
| 1864 | Ga0501032_0002148 | |||
| 1865 | Ga0501032_0006800 | |||
| 1866 | Ga0501032_0080286 | |||
| 1867 | Ga0501032_0086641 | |||
| 1868 | Ga0501033_0084832 | |||
| 1869 | Ga0501034_0000004 | |||
| 1870 | Ga0501034_0000937 | |||
| 1871 | Ga0501034_0004888 | |||
| 1872 | Ga0501034_0005439 | |||
| 1873 | Ga0501034_0022432 | |||
| 1874 | Ga0501034_0101577 | |||
| 1875 | Ga0501034_0186305 | |||
| 1876 | Ga0501036_0007119 | |||
| 1877 | Ga0501036_0007293 | |||
| 1878 | Ga0501037_0000718 | |||
| 1879 | Ga0501037_0054884 | |||
| 1880 | Ga0501037_0072286 | |||
| 1881 | Ga0501038_0007548 | |||
| 1882 | Ga0501038_0096510 | |||
| 1883 | Ga0501039_0010296 | |||
| 1884 | Ga0501039_0075954 | |||
| 1885 | Ga0501039_0298426 | |||
| 1886 | Ga0501043_0002800 | |||
| 1887 | Ga0501043_0004294 | |||
| 1888 | Ga0501043_0042332 | |||
| 1889 | Ga0501043_0111275 | |||
| 1890 | Ga0501046_0028665 | |||
| 1891 | Ga0501047_0006113 | |||
| 1892 | Ga0501047_0014693 | |||
| 1893 | Ga0501047_0023388 | |||
| 1894 | Ga0501047_0093066 | |||
| 1895 | Ga0501047_0169531 | |||
| 1896 | Ga0501047_0235646 | |||
| 1897 | Ga0501067_0010424 | |||
| 1898 | Ga0501067_0016478 | |||
| 1899 | Ga0501069_0012320 | |||
| 1900 | Ga0501070_0003667 | |||
| 1901 | Ga0501073_0022922 | |||
| 1902 | Ga0501074_0003753 | |||
| 1903 | Ga0501074_0205211 | |||
| 1904 | Ga0501076_0246157 | |||
| 1905 | Ga0501198_000255 | |||
| 1906 | Ga0501235_000033 | |||
| 1907 | Ga0501240_003176 | |||
| 1908 | Ga0501243_000132 | |||
| 1909 | Ga0501259_000226 | |||
| 1910 | Ga0501219_000184 | |||
| 1911 | Ga0501225_0005195 | |||
| 1912 | Ga0501234_002126 | |||
| 1913 | Ga0501080_0024066 | |||
| 1914 | Ga0501080_0054575 | |||
| 1915 | Ga0501083_0000193 | |||
| 1916 | Ga0501241_000709 | |||
| 1917 | Ga0501263_001923 | |||
| 1918 | Ga0501035_0000916 | |||
| 1919 | Ga0501035_0006985 | |||
| 1920 | Ga0501035_0016926 | |||
| 1921 | Ga0501035_0047473 | |||
| 1922 | Ga0501035_0285679 | |||
| 1923 | Ga0501044_0005186 | |||
| 1924 | Ga0501044_0007354 | |||
| 1925 | Ga0501044_0007617 | |||
| 1926 | Ga0501044_0037163 | |||
| 1927 | Ga0501044_0239864 | |||
| 1928 | Ga0501284_00002 | |||
| 1929 | nmdc:mga0k408_114750_c1 | |||
| 1930 | nmdc:mga0k408_31681_c1 | |||
| 1931 | nmdc:mga0k408_608_c1 | |||
| 1932 | nmdc:mga05p37_9673_c1 | |||
| 1933 | nmdc:mga06r32_120612_c1 | |||
| 1934 | nmdc:mga06r32_66628_c1 | |||
| 1935 | nmdc:mga08y16_18017_c1 | |||
| 1936 | nmdc:mga08y16_46681_c1 | |||
| 1937 | Ga0500635_0003485 | |||
| 1938 | Ga0500578_0000325 | |||
| 1939 | Ga0500644_0000469 | |||
| 1940 | Ga0500646_0009624 | |||
| 1941 | Ga0500583_0000001 | |||
| 1942 | Ga0500583_0001226 | |||
| 1943 | Ga0500583_0012814 | |||
| 1944 | Ga0500651_0038410 | |||
| 1945 | Ga0500641_0058950 | |||
| 1946 | Ga0500556_0006680 | |||
| 1947 | Ga0500562_000024 | |||
| 1948 | Ga0500562_037603 | |||
| 1949 | Ga0500569_000534 | |||
| 1950 | Ga0500642_0017004 | |||
| 1951 | Ga0500658_0003895 | |||
| 1952 | Ga0500568_0000380 | |||
| 1953 | Ga0500577_0000937 | |||
| 1954 | Ga0500616_0000868 | |||
| 1955 | Ga0500616_0037288 | |||
| 1956 | Ga0500622_0000379 | |||
| 1957 | Ga0500622_0001080 | |||
| 1958 | Ga0500622_0021845 | |||
| 1959 | Ga0500636_0008604 | |||
| 1960 | Ga0500637_0063707 | |||
| 1961 | Ga0500611_000003 | |||
| 1962 | Ga0500645_011526 | |||
| 1963 | Ga0500661_009665 | |||
| 1964 | Ga0501082_0136985 | |||
| 1965 | 2738725453 | |||
| 1966 | 2819574992 | |||
| 1967 | 2819585928 | |||
| 1968 | 2819676949 | |||
| 1969 | 2821141088 | |||
| 1970 | 2840678775 | |||
| 1971 | 2881956494 | |||
| 1972 | 2883069587 | |||
| 1973 | 2884796789 | |||
| 1974 | 2896086593 | |||
| 1975 | 2896113107 | |||
| 1976 | 2904471589 | |||
| 1977 | 2914761942 | |||
| 1978 | 2929159308 | |||
| 1979 | 2929177696 | |||
| 1980 | 2929240058 | |||
| 1981 | 2929921758 | |||
| 1982 | 2945980043 | |||
| 1983 | 2946014095 | |||
| 1984 | 8003154304 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xi9-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine | 0.916 | 9 | 363 |
| 6xi9-assembly2.cif.gz_B | x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine | 0.9144 | 9 | 363 |
| 6xig-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus | 0.9136 | 9 | 363 |
| 6xig-assembly1.cif.gz_B | x-ray crystal structure of mqne from pedobacter heparinus | 0.9121 | 9 | 360 |
| 6xi9-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine | 0.8384 | 9 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58826_3_356_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9304 | 11 | 359 | 3.20.20.70 |
| af_P9WP77_498_849_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.925 | 7 | 355 | 3.20.20.70 |
| af_Q58826_3_356_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9152 | 11 | 359 | 3.20.20.70 |
| af_P9WP77_498_849_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9149 | 7 | 355 | 3.20.20.70 |
| af_Q57888_1_320_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8185 | 15 | 347 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6DZG3-F1-model_v4 | Radical SAM protein | 0.9918 | 1 | 249 |
GO:0044689
GO:0046872 GO:0051539 |
| AF-A0A4Q6AUM4-F1-model_v4 | CofH family radical SAM protein | 0.9898 | 1 | 328 |
GO:0016765
GO:0044689 GO:0046872 GO:0051539 |
| AF-A0A3D4TCV1-F1-model_v4 | Dehypoxanthine futalosine cyclase | 0.9881 | 48 | 374 |
GO:0016765
GO:0044689 GO:0046872 GO:0051539 |
| AF-A0A4V1UDW8-F1-model_v4 | CofH family radical SAM protein | 0.9877 | 50 | 374 |
GO:0016765
GO:0044689 GO:0046872 GO:0051539 |
| AF-A0A0R2S706-F1-model_v4 | Dehypoxanthine futalosine cyclase | 0.9872 | 1 | 374 |
GO:0009234
GO:0016765 GO:0044689 GO:0046872 GO:0051539 |