F487601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 454 | 1980 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100929593|Ga0070714_1009295931 |
| Length | 216 |
| Sequence | MSDLTSDPLSDTTAYSSDVGFTPTVKAIQSRKGSREAYARMEEKGGWRTGIDNDLAAFIGEQTSFFLATASAAGQPYIQHRGGPAGFLKVLDNTTLAFADFSGNRQFITQGNLSENPKAYIFLLDYVHRRRVKIWGEAKVIEDDPALVAALMPRGYKARPEQAIVFKVAAWDTNCPQHIPQKLDVADVAAVINARDQRIAELEAELAELKKHLTAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 80 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 411 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 412 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 417 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 421 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 422 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 430 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 431 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 432 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 433 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 434 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 437 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 439 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 444 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 445 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 447 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 448 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 449 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 450 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 452 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 454 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.57 |
| Nodule | 1.21 |
| Rhizoplane | 5.56 |
| Rhizosphere | 68.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100929593 | 3300005435 | Bacteria | 845 |
| 2 | JGI25406J46586_10000233 | 3300003203 | Bacteria | 24719 |
| 3 | JGI25406J46586_10006333 | 3300003203 | Bacteria | 5460 |
| 4 | JGI25153J46596_10006692 | 3300003215 | Bacteria | 5794 |
| 5 | JGI25153J46596_10040042 | 3300003215 | Bacteria | 1458 |
| 6 | rootH2_10011831 | 3300003320 | Bacteria | 2405 |
| 7 | JGI25404J52841_10020882 | 3300003659 | Bacteria | 1418 |
| 8 | JGI25404J52841_10067893 | 3300003659 | Bacteria | 746 |
| 9 | Ga0055526_1028100 | 3300003771 | Bacteria | 1712 |
| 10 | Ga0055531_10005040 | 3300003794 | Bacteria | 7829 |
| 11 | Ga0055531_10083370 | 3300003794 | Bacteria | 697 |
| 12 | Ga0070658_10525619 | 3300005327 | Bacteria | 1023 |
| 13 | Ga0070670_100182004 | 3300005331 | Bacteria | 1825 |
| 14 | Ga0068869_100030464 | 3300005334 | Bacteria | 3787 |
| 15 | Ga0068869_100087498 | 3300005334 | Bacteria | 2337 |
| 16 | Ga0068869_100160324 | 3300005334 | Bacteria | 1751 |
| 17 | Ga0068869_100382431 | 3300005334 | Bacteria | 1154 |
| 18 | Ga0070666_10273787 | 3300005335 | Bacteria | 1199 |
| 19 | Ga0070680_100013830 | 3300005336 | Bacteria | 6296 |
| 20 | Ga0070680_100196494 | 3300005336 | Bacteria | 1701 |
| 21 | Ga0070682_100027255 | 3300005337 | Bacteria | 3428 |
| 22 | Ga0070682_100194300 | 3300005337 | Bacteria | 1427 |
| 23 | Ga0068868_100050101 | 3300005338 | Bacteria | 3278 |
| 24 | Ga0068868_100338502 | 3300005338 | Bacteria | 1286 |
| 25 | Ga0068868_100444242 | 3300005338 | Bacteria | 1127 |
| 26 | Ga0068868_100560625 | 3300005338 | Bacteria | 1008 |
| 27 | Ga0070660_100003692 | 3300005339 | Bacteria | 10562 |
| 28 | Ga0070660_100129050 | 3300005339 | Bacteria | 2022 |
| 29 | Ga0070660_100333322 | 3300005339 | Bacteria | 1248 |
| 30 | Ga0070689_100099415 | 3300005340 | Bacteria | 2302 |
| 31 | Ga0070687_100361678 | 3300005343 | Bacteria | 940 |
| 32 | Ga0070661_100055967 | 3300005344 | Bacteria | 2888 |
| 33 | Ga0070661_100278907 | 3300005344 | Bacteria | 1296 |
| 34 | Ga0070661_100461411 | 3300005344 | Bacteria | 1012 |
| 35 | Ga0070668_100024341 | 3300005347 | Bacteria | 4586 |
| 36 | Ga0070668_100059725 | 3300005347 | Bacteria | 2951 |
| 37 | Ga0070668_100091702 | 3300005347 | Bacteria | 2396 |
| 38 | Ga0070668_100127388 | 3300005347 | Bacteria | 2040 |
| 39 | Ga0070669_100351449 | 3300005353 | Bacteria | 1197 |
| 40 | Ga0070669_100433510 | 3300005353 | Bacteria | 1081 |
| 41 | Ga0070675_100419897 | 3300005354 | Bacteria | 1196 |
| 42 | Ga0070675_100848847 | 3300005354 | Bacteria | 836 |
| 43 | Ga0070674_100231814 | 3300005356 | Bacteria | 1441 |
| 44 | Ga0070674_100373942 | 3300005356 | Bacteria | 1157 |
| 45 | Ga0070673_100103078 | 3300005364 | Bacteria | 2353 |
| 46 | Ga0070688_100472045 | 3300005365 | Bacteria | 942 |
| 47 | Ga0070659_100077774 | 3300005366 | Bacteria | 2646 |
| 48 | Ga0070659_100189719 | 3300005366 | Bacteria | 1689 |
| 49 | Ga0070709_10036585 | 3300005434 | Bacteria | 2992 |
| 50 | Ga0070714_100015842 | 3300005435 | Bacteria | 6077 |
| 51 | Ga0070714_100067089 | 3300005435 | Bacteria | 3093 |
| 52 | Ga0070713_100269513 | 3300005436 | Bacteria | 1559 |
| 53 | Ga0070713_100680283 | 3300005436 | Bacteria | 981 |
| 54 | Ga0070701_10199112 | 3300005438 | Bacteria | 1183 |
| 55 | Ga0070711_100001130 | 3300005439 | Bacteria | 14272 |
| 56 | Ga0070705_100707547 | 3300005440 | Bacteria | 792 |
| 57 | Ga0070694_100163094 | 3300005444 | Bacteria | 1637 |
| 58 | Ga0070694_100490103 | 3300005444 | Bacteria | 976 |
| 59 | Ga0070708_100105209 | 3300005445 | Bacteria | 2589 |
| 60 | Ga0070663_100032985 | 3300005455 | Bacteria | 3574 |
| 61 | Ga0070663_100057207 | 3300005455 | Bacteria | 2797 |
| 62 | Ga0070663_100292428 | 3300005455 | Bacteria | 1301 |
| 63 | Ga0070663_100411763 | 3300005455 | Bacteria | 1107 |
| 64 | Ga0070663_100417055 | 3300005455 | Bacteria | 1100 |
| 65 | Ga0070663_100541761 | 3300005455 | Bacteria | 972 |
| 66 | Ga0070678_100034642 | 3300005456 | Bacteria | 3518 |
| 67 | Ga0070678_100999680 | 3300005456 | Bacteria | 769 |
| 68 | Ga0070662_100091189 | 3300005457 | Bacteria | 2288 |
| 69 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 70 | Ga0070681_10007888 | 3300005458 | Bacteria | 10418 |
| 71 | Ga0070685_10055262 | 3300005466 | Bacteria | 2306 |
| 72 | Ga0070685_10079531 | 3300005466 | Bacteria | 1962 |
| 73 | Ga0070685_10209492 | 3300005466 | Bacteria | 1271 |
| 74 | Ga0070698_100400542 | 3300005471 | Bacteria | 1306 |
| 75 | Ga0070698_100465666 | 3300005471 | Bacteria | 1200 |
| 76 | Ga0070699_100796420 | 3300005518 | Bacteria | 865 |
| 77 | Ga0070679_100018490 | 3300005530 | Bacteria | 6764 |
| 78 | Ga0070679_100074252 | 3300005530 | Bacteria | 3391 |
| 79 | Ga0070679_100084060 | 3300005530 | Bacteria | 3171 |
| 80 | Ga0070679_100229905 | 3300005530 | Bacteria | 1814 |
| 81 | Ga0070697_100054323 | 3300005536 | Bacteria | 3256 |
| 82 | Ga0068853_100009612 | 3300005539 | Bacteria | 7791 |
| 83 | Ga0068853_100422126 | 3300005539 | Bacteria | 1251 |
| 84 | Ga0068853_100925826 | 3300005539 | Bacteria | 838 |
| 85 | Ga0070686_100726033 | 3300005544 | Bacteria | 794 |
| 86 | Ga0070693_100056138 | 3300005547 | Bacteria | 2272 |
| 87 | Ga0070693_100210058 | 3300005547 | Bacteria | 1269 |
| 88 | Ga0070693_100606723 | 3300005547 | Bacteria | 791 |
| 89 | Ga0070665_100038699 | 3300005548 | Bacteria | 4794 |
| 90 | Ga0070665_100060150 | 3300005548 | Bacteria | 3808 |
| 91 | Ga0070665_100233037 | 3300005548 | Bacteria | 1841 |
| 92 | Ga0070665_100355551 | 3300005548 | Bacteria | 1470 |
| 93 | Ga0070665_100373554 | 3300005548 | Bacteria | 1433 |
| 94 | Ga0070665_100386166 | 3300005548 | Bacteria | 1408 |
| 95 | Ga0070665_100489586 | 3300005548 | Bacteria | 1241 |
| 96 | Ga0070665_100519222 | 3300005548 | Bacteria | 1203 |
| 97 | Ga0068855_100027307 | 3300005563 | Bacteria | 6830 |
| 98 | Ga0068855_100160273 | 3300005563 | Bacteria | 2554 |
| 99 | Ga0068855_100215023 | 3300005563 | Bacteria | 2158 |
| 100 | Ga0068855_100249115 | 3300005563 | Bacteria | 1982 |
| 101 | Ga0068855_100485141 | 3300005563 | Bacteria | 1345 |
| 102 | Ga0068857_100013087 | 3300005577 | Bacteria | 7230 |
| 103 | Ga0068857_100280101 | 3300005577 | Bacteria | 1534 |
| 104 | Ga0068854_100090808 | 3300005578 | Bacteria | 2272 |
| 105 | Ga0068856_100342777 | 3300005614 | Bacteria | 1513 |
| 106 | Ga0068852_100103072 | 3300005616 | Bacteria | 2580 |
| 107 | Ga0068852_100105170 | 3300005616 | Bacteria | 2556 |
| 108 | Ga0068852_100497397 | 3300005616 | Bacteria | 1213 |
| 109 | Ga0068859_100053072 | 3300005617 | Bacteria | 4076 |
| 110 | Ga0068859_100146181 | 3300005617 | Bacteria | 2439 |
| 111 | Ga0068859_101318636 | 3300005617 | Bacteria | 796 |
| 112 | Ga0068864_100124538 | 3300005618 | Bacteria | 2308 |
| 113 | Ga0068864_100846275 | 3300005618 | Bacteria | 901 |
| 114 | Ga0068866_10152765 | 3300005718 | Bacteria | 1338 |
| 115 | Ga0068861_100040899 | 3300005719 | Bacteria | 3469 |
| 116 | Ga0068861_100122230 | 3300005719 | Bacteria | 2102 |
| 117 | Ga0068870_10218316 | 3300005840 | Bacteria | 1166 |
| 118 | Ga0068863_100550995 | 3300005841 | Bacteria | 1139 |
| 119 | Ga0068858_100551252 | 3300005842 | Bacteria | 1116 |
| 120 | Ga0068858_100642741 | 3300005842 | Bacteria | 1031 |
| 121 | Ga0068858_100694274 | 3300005842 | Bacteria | 990 |
| 122 | Ga0068858_101057945 | 3300005842 | Bacteria | 796 |
| 123 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 124 | Ga0068862_100221922 | 3300005844 | Bacteria | 1712 |
| 125 | Ga0068862_101092449 | 3300005844 | Bacteria | 792 |
| 126 | Ga0081455_10005731 | 3300005937 | Bacteria | 13539 |
| 127 | Ga0081455_10029773 | 3300005937 | Bacteria | 4973 |
| 128 | Ga0081455_10099630 | 3300005937 | Bacteria | 2337 |
| 129 | Ga0081455_10109419 | 3300005937 | Bacteria | 2199 |
| 130 | Ga0081540_1007566 | 3300005983 | Bacteria | 7722 |
| 131 | Ga0081540_1008557 | 3300005983 | Bacteria | 7138 |
| 132 | Ga0081540_1011157 | 3300005983 | Bacteria | 6030 |
| 133 | Ga0081540_1012286 | 3300005983 | Bacteria | 5653 |
| 134 | Ga0081540_1015476 | 3300005983 | Bacteria | 4830 |
| 135 | Ga0081540_1016697 | 3300005983 | Bacteria | 4578 |
| 136 | Ga0081540_1018292 | 3300005983 | Bacteria | 4305 |
| 137 | Ga0081540_1035420 | 3300005983 | Bacteria | 2677 |
| 138 | Ga0081540_1044694 | 3300005983 | Bacteria | 2258 |
| 139 | Ga0081540_1059902 | 3300005983 | Bacteria | 1825 |
| 140 | Ga0081540_1071540 | 3300005983 | Bacteria | 1602 |
| 141 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 142 | Ga0081539_10002599 | 3300005985 | Bacteria | 24763 |
| 143 | Ga0081539_10106751 | 3300005985 | Bacteria | 1417 |
| 144 | Ga0070717_10034976 | 3300006028 | Bacteria | 4063 |
| 145 | Ga0070717_10315909 | 3300006028 | Bacteria | 1391 |
| 146 | Ga0070717_10339131 | 3300006028 | Bacteria | 1342 |
| 147 | Ga0075365_10068327 | 3300006038 | Bacteria | 2387 |
| 148 | Ga0075365_10093827 | 3300006038 | Bacteria | 2048 |
| 149 | Ga0075365_10115880 | 3300006038 | Bacteria | 1845 |
| 150 | Ga0075365_10401340 | 3300006038 | Bacteria | 967 |
| 151 | Ga0075365_10766777 | 3300006038 | Bacteria | 681 |
| 152 | Ga0075368_10002578 | 3300006042 | Bacteria | 5945 |
| 153 | Ga0075368_10040110 | 3300006042 | Bacteria | 1838 |
| 154 | Ga0075368_10044493 | 3300006042 | Bacteria | 1752 |
| 155 | Ga0075363_100003641 | 3300006048 | Bacteria | 6610 |
| 156 | Ga0075363_100012959 | 3300006048 | Bacteria | 4027 |
| 157 | Ga0075363_100091186 | 3300006048 | Bacteria | 1677 |
| 158 | Ga0075363_100128984 | 3300006048 | Bacteria | 1417 |
| 159 | Ga0075363_100245248 | 3300006048 | Bacteria | 1031 |
| 160 | Ga0075364_10012640 | 3300006051 | Bacteria | 5171 |
| 161 | Ga0075364_10076141 | 3300006051 | Bacteria | 2214 |
| 162 | Ga0075364_10084435 | 3300006051 | Bacteria | 2103 |
| 163 | Ga0075364_10383488 | 3300006051 | Bacteria | 959 |
| 164 | Ga0075364_10406694 | 3300006051 | Bacteria | 929 |
| 165 | Ga0070716_100156175 | 3300006173 | Bacteria | 1473 |
| 166 | Ga0075367_10008296 | 3300006178 | Bacteria | 5379 |
| 167 | Ga0075367_10160099 | 3300006178 | Bacteria | 1399 |
| 168 | Ga0075367_10167738 | 3300006178 | Bacteria | 1367 |
| 169 | Ga0075367_10267582 | 3300006178 | Bacteria | 1073 |
| 170 | Ga0075369_10031533 | 3300006186 | Bacteria | 2238 |
| 171 | Ga0075369_10039347 | 3300006186 | Bacteria | 2019 |
| 172 | Ga0075369_10080100 | 3300006186 | Bacteria | 1447 |
| 173 | Ga0075369_10139008 | 3300006186 | Bacteria | 1107 |
| 174 | Ga0075366_10068130 | 3300006195 | Bacteria | 2118 |
| 175 | Ga0075366_10112181 | 3300006195 | Bacteria | 1641 |
| 176 | Ga0097621_100748026 | 3300006237 | Bacteria | 903 |
| 177 | Ga0075370_10010672 | 3300006353 | Bacteria | 4812 |
| 178 | Ga0075370_10264863 | 3300006353 | Bacteria | 1020 |
| 179 | Ga0068871_100573485 | 3300006358 | Bacteria | 1024 |
| 180 | Ga0075434_100023401 | 3300006871 | Bacteria | 6020 |
| 181 | Ga0075434_100200870 | 3300006871 | Bacteria | 2013 |
| 182 | Ga0075434_100310997 | 3300006871 | Bacteria | 1596 |
| 183 | Ga0075434_100400957 | 3300006871 | Bacteria | 1393 |
| 184 | Ga0068865_100598496 | 3300006881 | Bacteria | 931 |
| 185 | Ga0075436_100773008 | 3300006914 | Bacteria | 714 |
| 186 | Ga0097620_100053073 | 3300006931 | Bacteria | 4076 |
| 187 | Ga0097620_100146183 | 3300006931 | Bacteria | 2439 |
| 188 | Ga0097620_101318534 | 3300006931 | Bacteria | 796 |
| 189 | Ga0099824_1018691 | 3300006942 | Bacteria | 5613 |
| 190 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 191 | Ga0099822_1077802 | 3300006943 | Bacteria | 845 |
| 192 | Ga0075435_100087942 | 3300007076 | Bacteria | 2560 |
| 193 | Ga0099794_10026556 | 3300007265 | Bacteria | 2678 |
| 194 | Ga0099794_10035471 | 3300007265 | Bacteria | 2354 |
| 195 | Ga0099794_10216336 | 3300007265 | Bacteria | 983 |
| 196 | Ga0099795_10027564 | 3300007788 | Bacteria | 1923 |
| 197 | Ga0099795_10037370 | 3300007788 | Bacteria | 1708 |
| 198 | Ga0105240_10002295 | 3300009093 | Bacteria | 30967 |
| 199 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 200 | Ga0105240_10303050 | 3300009093 | Bacteria | 1827 |
| 201 | Ga0111539_10490578 | 3300009094 | Bacteria | 1431 |
| 202 | Ga0111539_11329697 | 3300009094 | Bacteria | 834 |
| 203 | Ga0105245_10406274 | 3300009098 | Bacteria | 1362 |
| 204 | Ga0105247_10035521 | 3300009101 | Bacteria | 3038 |
| 205 | Ga0105247_10121903 | 3300009101 | Bacteria | 1690 |
| 206 | Ga0105243_10036778 | 3300009148 | Bacteria | 3802 |
| 207 | Ga0105243_10208884 | 3300009148 | Bacteria | 1718 |
| 208 | Ga0105241_10072901 | 3300009174 | Bacteria | 2670 |
| 209 | Ga0105241_10075194 | 3300009174 | Bacteria | 2632 |
| 210 | Ga0105241_10479912 | 3300009174 | Bacteria | 1105 |
| 211 | Ga0105242_10266630 | 3300009176 | Bacteria | 1549 |
| 212 | Ga0105248_10231301 | 3300009177 | Bacteria | 2081 |
| 213 | Ga0105237_10002301 | 3300009545 | Bacteria | 23744 |
| 214 | Ga0105237_10066311 | 3300009545 | Bacteria | 3605 |
| 215 | Ga0105237_10314760 | 3300009545 | Bacteria | 1568 |
| 216 | Ga0105238_10006268 | 3300009551 | Bacteria | 11820 |
| 217 | Ga0105238_10022426 | 3300009551 | Bacteria | 6435 |
| 218 | Ga0105238_10461190 | 3300009551 | Bacteria | 1268 |
| 219 | Ga0105249_10333593 | 3300009553 | Bacteria | 1531 |
| 220 | Ga0105249_10493636 | 3300009553 | Bacteria | 1268 |
| 221 | Ga0105249_10545568 | 3300009553 | Bacteria | 1209 |
| 222 | Ga0099796_10092218 | 3300010159 | Bacteria | 1128 |
| 223 | Ga0105239_10017503 | 3300010375 | Bacteria | 7926 |
| 224 | Ga0105239_10035625 | 3300010375 | Bacteria | 5465 |
| 225 | Ga0105239_10066921 | 3300010375 | Bacteria | 3946 |
| 226 | Ga0105239_10189208 | 3300010375 | Bacteria | 2304 |
| 227 | Ga0105239_10191172 | 3300010375 | Bacteria | 2291 |
| 228 | Ga0105239_10605283 | 3300010375 | Bacteria | 1250 |
| 229 | Ga0105239_10650584 | 3300010375 | Bacteria | 1204 |
| 230 | Ga0105239_10694815 | 3300010375 | Bacteria | 1163 |
| 231 | Ga0105239_10831580 | 3300010375 | Bacteria | 1058 |
| 232 | Ga0105239_10850948 | 3300010375 | Bacteria | 1046 |
| 233 | Ga0105246_10035946 | 3300011119 | Bacteria | 3315 |
| 234 | Ga0105246_10095428 | 3300011119 | Bacteria | 2153 |
| 235 | Ga0105246_10264649 | 3300011119 | Bacteria | 1371 |
| 236 | Ga0157371_10031405 | 3300013102 | Bacteria | 3826 |
| 237 | Ga0157370_10075424 | 3300013104 | Bacteria | 3179 |
| 238 | Ga0157370_10492533 | 3300013104 | Bacteria | 1126 |
| 239 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 240 | Ga0157374_10131548 | 3300013296 | Bacteria | 2422 |
| 241 | Ga0157378_10008170 | 3300013297 | Bacteria | 9132 |
| 242 | Ga0163162_10026136 | 3300013306 | Bacteria | 5769 |
| 243 | Ga0163162_10127713 | 3300013306 | Bacteria | 2650 |
| 244 | Ga0163162_10232436 | 3300013306 | Bacteria | 1974 |
| 245 | Ga0163162_10485689 | 3300013306 | Bacteria | 1366 |
| 246 | Ga0163162_10834378 | 3300013306 | Bacteria | 1038 |
| 247 | Ga0157372_10075935 | 3300013307 | Bacteria | 3793 |
| 248 | Ga0157372_11545435 | 3300013307 | Bacteria | 764 |
| 249 | Ga0157375_10537241 | 3300013308 | Bacteria | 1332 |
| 250 | Ga0163163_10007500 | 3300014325 | Bacteria | 9629 |
| 251 | Ga0163163_10092490 | 3300014325 | Bacteria | 3040 |
| 252 | Ga0163163_10490891 | 3300014325 | Bacteria | 1289 |
| 253 | Ga0157380_10047597 | 3300014326 | Bacteria | 3374 |
| 254 | Ga0157379_10060314 | 3300014968 | Bacteria | 3391 |
| 255 | Ga0157379_10219909 | 3300014968 | Bacteria | 1721 |
| 256 | Ga0157379_11094465 | 3300014968 | Bacteria | 763 |
| 257 | Ga0157376_10127798 | 3300014969 | Bacteria | 2263 |
| 258 | Ga0206356_10672806 | 3300020070 | Bacteria | 1282 |
| 259 | Ga0209563_102736 | 3300025230 | Bacteria | 3871 |
| 260 | Ga0209563_119376 | 3300025230 | Bacteria | 781 |
| 261 | Ga0207425_1019877 | 3300025245 | Bacteria | 1442 |
| 262 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 263 | Ga0209233_1002344 | 3300025261 | Bacteria | 7057 |
| 264 | Ga0209233_1018924 | 3300025261 | Bacteria | 1840 |
| 265 | Ga0209233_1050685 | 3300025261 | Bacteria | 846 |
| 266 | Ga0209455_1002785 | 3300025272 | Bacteria | 6531 |
| 267 | Ga0209564_1021745 | 3300025295 | Bacteria | 2294 |
| 268 | Ga0209564_1022449 | 3300025295 | Bacteria | 2230 |
| 269 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 270 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 271 | Ga0209758_1001094 | 3300025297 | Bacteria | 35071 |
| 272 | Ga0209758_1001864 | 3300025297 | Bacteria | 23116 |
| 273 | Ga0209758_1031488 | 3300025297 | Bacteria | 2174 |
| 274 | Ga0209758_1048288 | 3300025297 | Bacteria | 1514 |
| 275 | Ga0209256_1004771 | 3300025299 | Bacteria | 8264 |
| 276 | Ga0207426_1003610 | 3300025302 | Bacteria | 8206 |
| 277 | Ga0209257_1001688 | 3300025304 | Bacteria | 24840 |
| 278 | Ga0209257_1035198 | 3300025304 | Bacteria | 1552 |
| 279 | Ga0207656_10018079 | 3300025321 | Bacteria | 2769 |
| 280 | Ga0207710_10028664 | 3300025900 | Bacteria | 2418 |
| 281 | Ga0207710_10288533 | 3300025900 | Bacteria | 827 |
| 282 | Ga0207688_10054745 | 3300025901 | Bacteria | 2238 |
| 283 | Ga0207688_10092165 | 3300025901 | Bacteria | 1741 |
| 284 | Ga0207680_10568610 | 3300025903 | Bacteria | 810 |
| 285 | Ga0207647_10009749 | 3300025904 | Bacteria | 6815 |
| 286 | Ga0207647_10307119 | 3300025904 | Bacteria | 903 |
| 287 | Ga0207699_10144934 | 3300025906 | Bacteria | 1565 |
| 288 | Ga0207645_10063010 | 3300025907 | Bacteria | 2369 |
| 289 | Ga0207645_10170646 | 3300025907 | Bacteria | 1426 |
| 290 | Ga0207645_10374619 | 3300025907 | Bacteria | 955 |
| 291 | Ga0207643_10189637 | 3300025908 | Bacteria | 1247 |
| 292 | Ga0207705_10238678 | 3300025909 | Bacteria | 1384 |
| 293 | Ga0207684_10618921 | 3300025910 | Bacteria | 924 |
| 294 | Ga0207654_10011023 | 3300025911 | Bacteria | 4600 |
| 295 | Ga0207654_10028697 | 3300025911 | Bacteria | 3036 |
| 296 | Ga0207654_10045094 | 3300025911 | Bacteria | 2508 |
| 297 | Ga0207654_10523149 | 3300025911 | Bacteria | 840 |
| 298 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 299 | Ga0207707_10014431 | 3300025912 | Bacteria | 6882 |
| 300 | Ga0207707_10032951 | 3300025912 | Bacteria | 4536 |
| 301 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 302 | Ga0207695_10093922 | 3300025913 | Bacteria | 3008 |
| 303 | Ga0207695_10179409 | 3300025913 | Bacteria | 2039 |
| 304 | Ga0207695_10895162 | 3300025913 | Bacteria | 767 |
| 305 | Ga0207671_10001109 | 3300025914 | Bacteria | 32478 |
| 306 | Ga0207671_10130576 | 3300025914 | Bacteria | 1928 |
| 307 | Ga0207671_10538603 | 3300025914 | Bacteria | 931 |
| 308 | Ga0207693_10059333 | 3300025915 | Bacteria | 2997 |
| 309 | Ga0207693_10184703 | 3300025915 | Bacteria | 1641 |
| 310 | Ga0207693_10450114 | 3300025915 | Bacteria | 1006 |
| 311 | Ga0207663_10021983 | 3300025916 | Bacteria | 3639 |
| 312 | Ga0207660_10007904 | 3300025917 | Bacteria | 6882 |
| 313 | Ga0207660_10079595 | 3300025917 | Bacteria | 2404 |
| 314 | Ga0207660_10279084 | 3300025917 | Bacteria | 1325 |
| 315 | Ga0207657_10005482 | 3300025919 | Bacteria | 13248 |
| 316 | Ga0207657_10074276 | 3300025919 | Bacteria | 2871 |
| 317 | Ga0207657_10251739 | 3300025919 | Bacteria | 1408 |
| 318 | Ga0207657_10436016 | 3300025919 | Bacteria | 1029 |
| 319 | Ga0207652_10024703 | 3300025921 | Bacteria | 4987 |
| 320 | Ga0207652_10027515 | 3300025921 | Bacteria | 4738 |
| 321 | Ga0207652_10045150 | 3300025921 | Bacteria | 3755 |
| 322 | Ga0207681_10330550 | 3300025923 | Bacteria | 1215 |
| 323 | Ga0207694_10110472 | 3300025924 | Bacteria | 2187 |
| 324 | Ga0207650_10179960 | 3300025925 | Bacteria | 1684 |
| 325 | Ga0207659_10221682 | 3300025926 | Bacteria | 1521 |
| 326 | Ga0207687_10085748 | 3300025927 | Bacteria | 2285 |
| 327 | Ga0207687_10298816 | 3300025927 | Bacteria | 1296 |
| 328 | Ga0207700_10206963 | 3300025928 | Bacteria | 1656 |
| 329 | Ga0207700_10272732 | 3300025928 | Bacteria | 1452 |
| 330 | Ga0207664_10243512 | 3300025929 | Bacteria | 1567 |
| 331 | Ga0207664_10282814 | 3300025929 | Bacteria | 1456 |
| 332 | Ga0207664_10462245 | 3300025929 | Bacteria | 1133 |
| 333 | Ga0207664_10542191 | 3300025929 | Bacteria | 1043 |
| 334 | Ga0207664_10609971 | 3300025929 | Bacteria | 980 |
| 335 | Ga0207644_10216876 | 3300025931 | Bacteria | 1515 |
| 336 | Ga0207644_10492535 | 3300025931 | Bacteria | 1010 |
| 337 | Ga0207690_10250658 | 3300025932 | Bacteria | 1367 |
| 338 | Ga0207706_10107908 | 3300025933 | Bacteria | 2450 |
| 339 | Ga0207706_10314047 | 3300025933 | Bacteria | 1364 |
| 340 | Ga0207706_10470633 | 3300025933 | Bacteria | 1086 |
| 341 | Ga0207686_10237709 | 3300025934 | Bacteria | 1324 |
| 342 | Ga0207686_10238933 | 3300025934 | Bacteria | 1321 |
| 343 | Ga0207709_10010853 | 3300025935 | Bacteria | 5018 |
| 344 | Ga0207709_10615410 | 3300025935 | Bacteria | 861 |
| 345 | Ga0207670_10053964 | 3300025936 | Bacteria | 2710 |
| 346 | Ga0207670_10230196 | 3300025936 | Bacteria | 1423 |
| 347 | Ga0207669_10168381 | 3300025937 | Bacteria | 1556 |
| 348 | Ga0207665_10501756 | 3300025939 | Bacteria | 937 |
| 349 | Ga0207691_10259003 | 3300025940 | Bacteria | 1500 |
| 350 | Ga0207691_10330741 | 3300025940 | Bacteria | 1306 |
| 351 | Ga0207711_10112183 | 3300025941 | Bacteria | 2426 |
| 352 | Ga0207711_10120999 | 3300025941 | Bacteria | 2337 |
| 353 | Ga0207689_10052561 | 3300025942 | Bacteria | 3357 |
| 354 | Ga0207689_10059101 | 3300025942 | Bacteria | 3154 |
| 355 | Ga0207689_10371601 | 3300025942 | Bacteria | 1190 |
| 356 | Ga0207661_10068018 | 3300025944 | Bacteria | 2899 |
| 357 | Ga0207667_10020014 | 3300025949 | Bacteria | 7455 |
| 358 | Ga0207667_10020505 | 3300025949 | Bacteria | 7348 |
| 359 | Ga0207667_10154463 | 3300025949 | Bacteria | 2362 |
| 360 | Ga0207667_10222922 | 3300025949 | Bacteria | 1932 |
| 361 | Ga0207667_10779988 | 3300025949 | Bacteria | 954 |
| 362 | Ga0207667_11119903 | 3300025949 | Bacteria | 770 |
| 363 | Ga0207651_10572263 | 3300025960 | Bacteria | 985 |
| 364 | Ga0207712_10039860 | 3300025961 | Bacteria | 3221 |
| 365 | Ga0207712_10203648 | 3300025961 | Bacteria | 1571 |
| 366 | Ga0207712_10770662 | 3300025961 | Bacteria | 844 |
| 367 | Ga0207668_10061758 | 3300025972 | Bacteria | 2636 |
| 368 | Ga0207668_10213756 | 3300025972 | Bacteria | 1544 |
| 369 | Ga0207668_10674564 | 3300025972 | Bacteria | 906 |
| 370 | Ga0207640_10342888 | 3300025981 | Bacteria | 1197 |
| 371 | Ga0207658_10869302 | 3300025986 | Bacteria | 820 |
| 372 | Ga0207677_10099933 | 3300026023 | Bacteria | 2132 |
| 373 | Ga0207703_10045007 | 3300026035 | Bacteria | 3549 |
| 374 | Ga0207703_10429822 | 3300026035 | Bacteria | 1230 |
| 375 | Ga0207703_10539958 | 3300026035 | Bacteria | 1098 |
| 376 | Ga0207703_10593231 | 3300026035 | Bacteria | 1047 |
| 377 | Ga0207703_11263153 | 3300026035 | Bacteria | 710 |
| 378 | Ga0207639_10076603 | 3300026041 | Bacteria | 2634 |
| 379 | Ga0207639_10087416 | 3300026041 | Bacteria | 2485 |
| 380 | Ga0207678_10030059 | 3300026067 | Bacteria | 4743 |
| 381 | Ga0207678_10049937 | 3300026067 | Bacteria | 3615 |
| 382 | Ga0207678_10067196 | 3300026067 | Bacteria | 3077 |
| 383 | Ga0207678_10069172 | 3300026067 | Bacteria | 3027 |
| 384 | Ga0207678_10077044 | 3300026067 | Bacteria | 2856 |
| 385 | Ga0207678_10100244 | 3300026067 | Bacteria | 2474 |
| 386 | Ga0207678_10334279 | 3300026067 | Bacteria | 1304 |
| 387 | Ga0207702_10180166 | 3300026078 | Bacteria | 1945 |
| 388 | Ga0207641_10415901 | 3300026088 | Bacteria | 1294 |
| 389 | Ga0207648_10069067 | 3300026089 | Bacteria | 3079 |
| 390 | Ga0207648_10079125 | 3300026089 | Bacteria | 2868 |
| 391 | Ga0207676_10102795 | 3300026095 | Bacteria | 2373 |
| 392 | Ga0207676_10765225 | 3300026095 | Bacteria | 940 |
| 393 | Ga0207674_10018135 | 3300026116 | Bacteria | 7658 |
| 394 | Ga0207674_10180637 | 3300026116 | Bacteria | 2061 |
| 395 | Ga0207674_10482581 | 3300026116 | Bacteria | 1198 |
| 396 | Ga0207675_100043034 | 3300026118 | Bacteria | 4217 |
| 397 | Ga0207675_100099220 | 3300026118 | Bacteria | 2743 |
| 398 | Ga0207675_100171194 | 3300026118 | Bacteria | 2076 |
| 399 | Ga0207675_100377654 | 3300026118 | Bacteria | 1393 |
| 400 | Ga0207683_10370569 | 3300026121 | Bacteria | 1316 |
| 401 | Ga0207698_10230995 | 3300026142 | Bacteria | 1679 |
| 402 | Ga0207698_10917746 | 3300026142 | Bacteria | 883 |
| 403 | Ga0207698_10975898 | 3300026142 | Bacteria | 857 |
| 404 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 405 | Ga0209389_1000069 | 3300027296 | Bacteria | 98063 |
| 406 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 407 | Ga0209589_1000077 | 3300027357 | Bacteria | 98063 |
| 408 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 409 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 410 | Ga0209489_100020 | 3300027361 | Bacteria | 207541 |
| 411 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 412 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 413 | Ga0209179_1000903 | 3300027512 | Bacteria | 3335 |
| 414 | Ga0209179_1006292 | 3300027512 | Bacteria | 1907 |
| 415 | Ga0209588_1040830 | 3300027671 | Bacteria | 1497 |
| 416 | Ga0207428_10103834 | 3300027907 | Bacteria | 2194 |
| 417 | Ga0268266_10046869 | 3300028379 | Bacteria | 3700 |
| 418 | Ga0268266_10047304 | 3300028379 | Bacteria | 3685 |
| 419 | Ga0268266_10053850 | 3300028379 | Bacteria | 3457 |
| 420 | Ga0268266_10091993 | 3300028379 | Bacteria | 2661 |
| 421 | Ga0268266_10115674 | 3300028379 | Bacteria | 2381 |
| 422 | Ga0268266_10318321 | 3300028379 | Bacteria | 1455 |
| 423 | Ga0268266_10834863 | 3300028379 | Bacteria | 890 |
| 424 | Ga0268265_10060372 | 3300028380 | Bacteria | 2905 |
| 425 | Ga0268265_10182909 | 3300028380 | Bacteria | 1802 |
| 426 | Ga0268265_10355274 | 3300028380 | Bacteria | 1339 |
| 427 | Ga0268265_10575258 | 3300028380 | Bacteria | 1073 |
| 428 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 429 | Ga0265337_1011271 | 3300028556 | Bacteria | 3089 |
| 430 | Ga0265326_10006827 | 3300028558 | Bacteria | 3524 |
| 431 | Ga0265319_1024285 | 3300028563 | Bacteria | 2184 |
| 432 | Ga0265334_10020212 | 3300028573 | Bacteria | 2729 |
| 433 | Ga0265322_10013237 | 3300028654 | Bacteria | 2388 |
| 434 | Ga0265336_10000850 | 3300028666 | Bacteria | 15908 |
| 435 | Ga0307517_10010277 | 3300028786 | Bacteria | 13120 |
| 436 | Ga0307515_10045648 | 3300028794 | Bacteria | 6723 |
| 437 | Ga0307515_10121325 | 3300028794 | Bacteria | 2958 |
| 438 | Ga0307515_10381058 | 3300028794 | Bacteria | 1043 |
| 439 | Ga0265338_10000417 | 3300028800 | Bacteria | 76249 |
| 440 | Ga0265324_10003779 | 3300029957 | Bacteria | 7073 |
| 441 | Ga0307511_10034380 | 3300030521 | Bacteria | 4450 |
| 442 | Ga0307511_10194222 | 3300030521 | Bacteria | 1067 |
| 443 | Ga0265330_10012848 | 3300031235 | Bacteria | 3909 |
| 444 | Ga0265330_10050026 | 3300031235 | Bacteria | 1834 |
| 445 | Ga0265340_10055091 | 3300031247 | Bacteria | 1916 |
| 446 | Ga0265339_10016661 | 3300031249 | Bacteria | 4373 |
| 447 | Ga0265316_10301072 | 3300031344 | Bacteria | 1168 |
| 448 | Ga0307509_10009216 | 3300031507 | Bacteria | 12388 |
| 449 | Ga0265313_10052803 | 3300031595 | Bacteria | 1938 |
| 450 | Ga0307508_10000715 | 3300031616 | Bacteria | 39415 |
| 451 | Ga0307508_10033881 | 3300031616 | Bacteria | 4605 |
| 452 | Ga0307508_10185701 | 3300031616 | Bacteria | 1681 |
| 453 | Ga0265342_10003269 | 3300031712 | Bacteria | 13437 |
| 454 | Ga0265342_10085372 | 3300031712 | Bacteria | 1817 |
| 455 | Ga0265342_10105122 | 3300031712 | Bacteria | 1604 |
| 456 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 457 | Ga0307516_10009786 | 3300031730 | Bacteria | 10635 |
| 458 | Ga0307516_10068945 | 3300031730 | Bacteria | 3403 |
| 459 | Ga0307405_10105611 | 3300031731 | Bacteria | 1898 |
| 460 | Ga0307410_10555398 | 3300031852 | Bacteria | 952 |
| 461 | Ga0307412_10349068 | 3300031911 | Bacteria | 1187 |
| 462 | Ga0307409_100220742 | 3300031995 | Bacteria | 1711 |
| 463 | Ga0307409_100410238 | 3300031995 | Bacteria | 1296 |
| 464 | Ga0307416_100151303 | 3300032002 | Bacteria | 2129 |
| 465 | Ga0307416_101099872 | 3300032002 | Bacteria | 899 |
| 466 | Ga0307415_100025456 | 3300032126 | Bacteria | 3714 |
| 467 | Ga0307415_100521848 | 3300032126 | Bacteria | 1043 |
| 468 | Ga0307415_100618633 | 3300032126 | Bacteria | 966 |
| 469 | Ga0307507_10045602 | 3300033179 | Bacteria | 4310 |
| 470 | Ga0307510_10010708 | 3300033180 | Bacteria | 10903 |
| 471 | Ga0307510_10018266 | 3300033180 | Bacteria | 8254 |
| 472 | Ga0307510_10075614 | 3300033180 | Bacteria | 3319 |
| 473 | Ga0307510_10195727 | 3300033180 | Bacteria | 1563 |
| 474 | Ga0307510_10435309 | 3300033180 | Bacteria | 753 |
| 475 | Ga0373926_0023243 | 3300035083 | Bacteria | 2153 |
| 476 | Ga0373923_0008743 | 3300035111 | Bacteria | 3629 |
| 477 | Ga0373923_0130314 | 3300035111 | Bacteria | 1130 |
| 478 | Ga0373936_0092173 | 3300035113 | Bacteria | 1271 |
| 479 | Ga0373936_0111064 | 3300035113 | Bacteria | 1164 |
| 480 | Ga0373939_0066133 | 3300035114 | Bacteria | 1165 |
| 481 | Ga0373945_0004291 | 3300035116 | Bacteria | 4526 |
| 482 | Ga0373954_0075857 | 3300035118 | Bacteria | 1602 |
| 483 | Ga0373957_0019213 | 3300035120 | Bacteria | 2402 |
| 484 | Ga0373943_0073105 | 3300035170 | Bacteria | 1741 |
| 485 | Ga0373931_0105518 | 3300035691 | Bacteria | 1591 |
| 486 | Ga0373935_0001812 | 3300035692 | Bacteria | 11998 |
| 487 | Ga0373935_0005959 | 3300035692 | Bacteria | 7231 |
| 488 | Ga0373935_0061189 | 3300035692 | Bacteria | 2410 |
| 489 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 490 | Ga0373927_0005646 | 3300035695 | Bacteria | 8601 |
| 491 | Ga0373927_0014399 | 3300035695 | Bacteria | 5236 |
| 492 | Ga0373947_0003829 | 3300035725 | Bacteria | 8862 |
| 493 | Ga0373947_0176820 | 3300035725 | Bacteria | 1387 |
| 494 | Ga0373937_0021625 | 3300036401 | Bacteria | 5773 |
| 495 | Ga0373937_0105868 | 3300036401 | Bacteria | 2614 |
| 496 | Ga0373925_0008084 | 3300037068 | Bacteria | 7662 |
| 497 | Ga0373925_0034633 | 3300037068 | Bacteria | 3722 |
| 498 | Ga0373925_0113338 | 3300037068 | Bacteria | 2097 |
| 499 | Ga0373925_0277941 | 3300037068 | Bacteria | 1348 |
| 500 | Ga0373925_0430530 | 3300037068 | Bacteria | 1079 |
| 501 | Ga0373925_0823081 | 3300037068 | Bacteria | 765 |
| 502 | Ga0395900_0280928 | 3300037418 | Bacteria | 1657 |
| 503 | Ga0395898_0005085 | 3300037466 | Bacteria | 14256 |
| 504 | Ga0395898_0058714 | 3300037466 | Bacteria | 3745 |
| 505 | Ga0395898_0270797 | 3300037466 | Bacteria | 1620 |
| 506 | Ga0395905_0136017 | 3300037471 | Bacteria | 2312 |
| 507 | Ga0436364_1520197 | 3300037853 | Bacteria | 2904 |
| 508 | Ga0395901_0017340 | 3300038443 | Bacteria | 7351 |
| 509 | Ga0395901_0293685 | 3300038443 | Bacteria | 1686 |
| 510 | Ga0395901_0441797 | 3300038443 | Bacteria | 1331 |
| 511 | Ga0395901_0943648 | 3300038443 | Bacteria | 842 |
| 512 | Ga0436365_0190765 | 3300039437 | Bacteria | 785 |
| 513 | Ga0436365_1328606 | 3300039437 | Bacteria | 2770 |
| 514 | Ga0436365_1363457 | 3300039437 | Bacteria | 860 |
| 515 | Ga0436360_0868220 | 3300039438 | Bacteria | 1886 |
| 516 | Ga0439465_0038800 | 3300041413 | Bacteria | 1535 |
| 517 | Ga0439465_0070317 | 3300041413 | Bacteria | 1172 |
| 518 | Ga0451789_0385457 | 3300041443 | Bacteria | 731 |
| 519 | Ga0451807_0327781 | 3300041486 | Bacteria | 779 |
| 520 | Ga0451849_0176703 | 3300041505 | Bacteria | 737 |
| 521 | Ga0466969_0146013 | 3300044656 | Bacteria | 1091 |
| 522 | Ga0466972_0123383 | 3300044658 | Bacteria | 1221 |
| 523 | Ga0466972_0125330 | 3300044658 | Bacteria | 1210 |
| 524 | Ga0466965_0045854 | 3300044683 | Bacteria | 2163 |
| 525 | Ga0466966_0000411 | 3300044684 | Bacteria | 27522 |
| 526 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 527 | Ga0466964_0132154 | 3300044706 | Bacteria | 1138 |
| 528 | Ga0466964_0154099 | 3300044706 | Bacteria | 1068 |
| 529 | Ga0466968_0031952 | 3300044735 | Bacteria | 2187 |
| 530 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 531 | Ga0466959_0068203 | 3300045049 | Bacteria | 2578 |
| 532 | Ga0495617_026277 | 3300046452 | Bacteria | 1960 |
| 533 | Ga0495592_0046764 | 3300046454 | Bacteria | 3225 |
| 534 | Ga0495592_0091211 | 3300046454 | Bacteria | 2185 |
| 535 | Ga0495603_0000029 | 3300046455 | Bacteria | 60872 |
| 536 | Ga0495603_0004729 | 3300046455 | Bacteria | 8133 |
| 537 | Ga0495603_0060500 | 3300046455 | Bacteria | 2238 |
| 538 | Ga0495590_0053297 | 3300046457 | Bacteria | 1412 |
| 539 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 540 | Ga0495629_0006648 | 3300046459 | Bacteria | 8555 |
| 541 | Ga0495629_0395369 | 3300046459 | Bacteria | 940 |
| 542 | Ga0495638_0023790 | 3300046460 | Bacteria | 4001 |
| 543 | Ga0495641_0004254 | 3300046461 | Bacteria | 10233 |
| 544 | Ga0495641_0087336 | 3300046461 | Bacteria | 1395 |
| 545 | Ga0495651_0004449 | 3300046462 | Bacteria | 10735 |
| 546 | Ga0495651_0074068 | 3300046462 | Bacteria | 2584 |
| 547 | Ga0495651_0074964 | 3300046462 | Bacteria | 2566 |
| 548 | Ga0495651_0269635 | 3300046462 | Bacteria | 1154 |
| 549 | Ga0495653_0160665 | 3300046463 | Bacteria | 1560 |
| 550 | Ga0495653_0448239 | 3300046463 | Bacteria | 812 |
| 551 | Ga0495653_0522029 | 3300046463 | Bacteria | 738 |
| 552 | Ga0495650_0134364 | 3300046471 | Bacteria | 900 |
| 553 | Ga0495580_0000321 | 3300046472 | Bacteria | 39093 |
| 554 | Ga0495580_0077289 | 3300046472 | Bacteria | 2322 |
| 555 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 556 | Ga0495605_0084523 | 3300046474 | Bacteria | 1480 |
| 557 | Ga0495605_0143523 | 3300046474 | Bacteria | 1069 |
| 558 | Ga0495605_0244164 | 3300046474 | Bacteria | 770 |
| 559 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 560 | Ga0495662_0000068 | 3300046476 | Bacteria | 36559 |
| 561 | Ga0495664_0002214 | 3300046477 | Bacteria | 10401 |
| 562 | Ga0495664_0041194 | 3300046477 | Bacteria | 2732 |
| 563 | Ga0495584_0106586 | 3300046491 | Bacteria | 1417 |
| 564 | Ga0495585_0061660 | 3300046492 | Bacteria | 2061 |
| 565 | Ga0495585_0125472 | 3300046492 | Bacteria | 1355 |
| 566 | Ga0495594_0000170 | 3300046499 | Bacteria | 31295 |
| 567 | Ga0495594_0086680 | 3300046499 | Bacteria | 1752 |
| 568 | Ga0495607_0070149 | 3300046501 | Bacteria | 1959 |
| 569 | Ga0495607_0161192 | 3300046501 | Bacteria | 1140 |
| 570 | Ga0495607_0259189 | 3300046501 | Bacteria | 833 |
| 571 | Ga0495583_0111949 | 3300046506 | Bacteria | 1156 |
| 572 | Ga0495583_0187388 | 3300046506 | Bacteria | 845 |
| 573 | Ga0495606_0025242 | 3300046507 | Bacteria | 4260 |
| 574 | Ga0495606_0298667 | 3300046507 | Bacteria | 873 |
| 575 | Ga0495608_0009906 | 3300046511 | Bacteria | 6653 |
| 576 | Ga0495608_0073325 | 3300046511 | Bacteria | 2232 |
| 577 | Ga0495610_0017507 | 3300046512 | Bacteria | 4083 |
| 578 | Ga0495616_0100955 | 3300046513 | Bacteria | 1353 |
| 579 | Ga0495618_0060568 | 3300046514 | Bacteria | 2400 |
| 580 | Ga0495618_0107227 | 3300046514 | Bacteria | 1789 |
| 581 | Ga0495618_0115478 | 3300046514 | Bacteria | 1719 |
| 582 | Ga0495620_0028647 | 3300046515 | Bacteria | 2587 |
| 583 | Ga0495628_0031335 | 3300046516 | Bacteria | 4302 |
| 584 | Ga0495628_0051848 | 3300046516 | Bacteria | 3242 |
| 585 | Ga0495628_0079160 | 3300046516 | Bacteria | 2555 |
| 586 | Ga0495631_0136597 | 3300046518 | Bacteria | 1053 |
| 587 | Ga0495631_0159190 | 3300046518 | Bacteria | 969 |
| 588 | Ga0495643_0118196 | 3300046522 | Bacteria | 1341 |
| 589 | Ga0495648_0002829 | 3300046524 | Bacteria | 15615 |
| 590 | Ga0495648_0012566 | 3300046524 | Bacteria | 6304 |
| 591 | Ga0495648_0087717 | 3300046524 | Bacteria | 1751 |
| 592 | Ga0495648_0097974 | 3300046524 | Bacteria | 1625 |
| 593 | Ga0495666_0003580 | 3300046526 | Bacteria | 7855 |
| 594 | Ga0495652_0005458 | 3300046529 | Bacteria | 11981 |
| 595 | Ga0495652_0005882 | 3300046529 | Bacteria | 11474 |
| 596 | Ga0495652_0142977 | 3300046529 | Bacteria | 1879 |
| 597 | Ga0495654_0134236 | 3300046530 | Bacteria | 1108 |
| 598 | Ga0495665_0000158 | 3300046531 | Bacteria | 33789 |
| 599 | Ga0495665_0067607 | 3300046531 | Bacteria | 1885 |
| 600 | Ga0495640_0015043 | 3300046533 | Bacteria | 5830 |
| 601 | Ga0495640_0028879 | 3300046533 | Bacteria | 3988 |
| 602 | Ga0495640_0050475 | 3300046533 | Bacteria | 2865 |
| 603 | Ga0495640_0220330 | 3300046533 | Bacteria | 1197 |
| 604 | Ga0495587_0008038 | 3300046536 | Bacteria | 6810 |
| 605 | Ga0495587_0157027 | 3300046536 | Bacteria | 1295 |
| 606 | Ga0495598_0017810 | 3300046537 | Bacteria | 1837 |
| 607 | Ga0495597_0223582 | 3300046542 | Bacteria | 747 |
| 608 | Ga0495645_0010468 | 3300046543 | Bacteria | 6503 |
| 609 | Ga0495622_0018938 | 3300046557 | Bacteria | 3208 |
| 610 | Ga0495622_0052375 | 3300046557 | Bacteria | 1893 |
| 611 | Ga0495622_0072868 | 3300046557 | Bacteria | 1585 |
| 612 | Ga0495667_0005992 | 3300046559 | Bacteria | 8219 |
| 613 | Ga0495667_0008458 | 3300046559 | Bacteria | 6985 |
| 614 | Ga0495667_0329276 | 3300046559 | Bacteria | 966 |
| 615 | Ga0495656_0058931 | 3300046615 | Bacteria | 1668 |
| 616 | Ga0495656_0063515 | 3300046615 | Bacteria | 1618 |
| 617 | Ga0495668_0044558 | 3300046616 | Bacteria | 2465 |
| 618 | Ga0495668_0060956 | 3300046616 | Bacteria | 2081 |
| 619 | Ga0495668_0153014 | 3300046616 | Bacteria | 1263 |
| 620 | Ga0495668_0224752 | 3300046616 | Bacteria | 1028 |
| 621 | Ga0495668_0425504 | 3300046616 | Bacteria | 730 |
| 622 | Ga0495668_0481706 | 3300046616 | Bacteria | 683 |
| 623 | Ga0495634_0000354 | 3300046642 | Bacteria | 44714 |
| 624 | Ga0495634_0044463 | 3300046642 | Bacteria | 3006 |
| 625 | Ga0495625_0108166 | 3300046660 | Bacteria | 1902 |
| 626 | Ga0495625_0206080 | 3300046660 | Bacteria | 1295 |
| 627 | Ga0495625_0235636 | 3300046660 | Bacteria | 1194 |
| 628 | Ga0495625_0407981 | 3300046660 | Bacteria | 847 |
| 629 | Ga0495635_0000179 | 3300046663 | Bacteria | 40014 |
| 630 | Ga0495635_0029811 | 3300046663 | Bacteria | 3794 |
| 631 | Ga0495635_0039091 | 3300046663 | Bacteria | 3284 |
| 632 | Ga0495659_0034268 | 3300046664 | Bacteria | 1785 |
| 633 | Ga0495661_0012280 | 3300046665 | Bacteria | 5785 |
| 634 | Ga0495588_0001137 | 3300046674 | Bacteria | 11460 |
| 635 | Ga0495588_0030267 | 3300046674 | Bacteria | 2720 |
| 636 | Ga0495588_0174778 | 3300046674 | Bacteria | 1135 |
| 637 | Ga0495657_0002384 | 3300046675 | Bacteria | 15809 |
| 638 | Ga0495599_0049233 | 3300046678 | Bacteria | 2641 |
| 639 | Ga0495623_0013961 | 3300046679 | Bacteria | 5205 |
| 640 | Ga0495623_0197544 | 3300046679 | Bacteria | 1158 |
| 641 | Ga0495623_0202305 | 3300046679 | Bacteria | 1141 |
| 642 | Ga0495623_0294893 | 3300046679 | Bacteria | 898 |
| 643 | Ga0495623_0338856 | 3300046679 | Bacteria | 822 |
| 644 | Ga0495646_0103280 | 3300046680 | Bacteria | 1631 |
| 645 | Ga0495646_0390608 | 3300046680 | Bacteria | 724 |
| 646 | Ga0495647_0000068 | 3300046681 | Bacteria | 25521 |
| 647 | Ga0495658_0000428 | 3300046683 | Bacteria | 23516 |
| 648 | Ga0495669_0012020 | 3300046684 | Bacteria | 3682 |
| 649 | Ga0495669_0149446 | 3300046684 | Bacteria | 1105 |
| 650 | Ga0495613_0015638 | 3300046689 | Bacteria | 5647 |
| 651 | Ga0495613_0056042 | 3300046689 | Bacteria | 2895 |
| 652 | Ga0495613_0184516 | 3300046689 | Bacteria | 1476 |
| 653 | Ga0495624_0010213 | 3300046690 | Bacteria | 6471 |
| 654 | Ga0495624_0132283 | 3300046690 | Bacteria | 1529 |
| 655 | Ga0495624_0314973 | 3300046690 | Bacteria | 943 |
| 656 | Ga0495624_0418542 | 3300046690 | Bacteria | 804 |
| 657 | Ga0495670_0012601 | 3300046691 | Bacteria | 4158 |
| 658 | Ga0495671_0025533 | 3300046692 | Bacteria | 3070 |
| 659 | Ga0495671_0069985 | 3300046692 | Bacteria | 1724 |
| 660 | Ga0495671_0143422 | 3300046692 | Bacteria | 1164 |
| 661 | Ga0495649_0037274 | 3300046694 | Bacteria | 2669 |
| 662 | Ga0495649_0107005 | 3300046694 | Bacteria | 1484 |
| 663 | Ga0495589_0228599 | 3300046794 | Bacteria | 873 |
| 664 | Ga0495600_0021305 | 3300046809 | Bacteria | 4149 |
| 665 | Ga0495600_0047916 | 3300046809 | Bacteria | 2788 |
| 666 | Ga0495660_0022925 | 3300046810 | Bacteria | 3563 |
| 667 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 668 | Ga0495581_0013854 | 3300047315 | Bacteria | 4674 |
| 669 | Ga0495581_0047767 | 3300047315 | Bacteria | 2473 |
| 670 | Ga0495604_0002741 | 3300047317 | Bacteria | 14128 |
| 671 | Ga0495604_0145613 | 3300047317 | Bacteria | 1688 |
| 672 | Ga0495604_0175414 | 3300047317 | Bacteria | 1503 |
| 673 | Ga0495604_0280002 | 3300047317 | Bacteria | 1127 |
| 674 | Ga0495636_0029585 | 3300047318 | Bacteria | 2236 |
| 675 | Ga0495674_0000415 | 3300047319 | Bacteria | 38235 |
| 676 | Ga0495674_0018174 | 3300047319 | Bacteria | 6545 |
| 677 | Ga0495674_0163154 | 3300047319 | Bacteria | 1863 |
| 678 | Ga0495674_0241600 | 3300047319 | Bacteria | 1488 |
| 679 | Ga0495676_0050060 | 3300047321 | Bacteria | 3353 |
| 680 | Ga0495676_0054205 | 3300047321 | Bacteria | 3189 |
| 681 | Ga0495680_0001876 | 3300047322 | Bacteria | 22116 |
| 682 | Ga0495680_0095170 | 3300047322 | Bacteria | 2227 |
| 683 | Ga0495683_0128554 | 3300047323 | Bacteria | 1197 |
| 684 | Ga0495683_0133044 | 3300047323 | Bacteria | 1171 |
| 685 | Ga0495683_0197211 | 3300047323 | Bacteria | 910 |
| 686 | Ga0495675_0007387 | 3300047444 | Bacteria | 6766 |
| 687 | Ga0495675_0047111 | 3300047444 | Bacteria | 2743 |
| 688 | Ga0495677_0032399 | 3300047445 | Bacteria | 1904 |
| 689 | Ga0495673_0006914 | 3300047469 | Bacteria | 6607 |
| 690 | Ga0495673_0064011 | 3300047469 | Bacteria | 1566 |
| 691 | Ga0495673_0174179 | 3300047469 | Bacteria | 818 |
| 692 | Ga0495684_0021327 | 3300047471 | Bacteria | 4988 |
| 693 | Ga0495686_0116808 | 3300047472 | Bacteria | 1594 |
| 694 | Ga0495686_0203948 | 3300047472 | Bacteria | 1133 |
| 695 | Ga0495686_0208156 | 3300047472 | Bacteria | 1119 |
| 696 | Ga0495686_0258037 | 3300047472 | Bacteria | 977 |
| 697 | Ga0495686_0271448 | 3300047472 | Bacteria | 946 |
| 698 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 699 | Ga0495602_0043056 | 3300048088 | Bacteria | 4108 |
| 700 | Ga0495602_0123078 | 3300048088 | Bacteria | 2083 |
| 701 | Ga0495626_0108988 | 3300048091 | Bacteria | 1201 |
| 702 | Ga0496100_0117445 | 3300048903 | Bacteria | 1857 |
| 703 | Ga0496100_0126267 | 3300048903 | Bacteria | 1796 |
| 704 | Ga0496100_0583701 | 3300048903 | Bacteria | 867 |
| 705 | Ga0496101_0130825 | 3300048904 | Bacteria | 1906 |
| 706 | Ga0496101_0138158 | 3300048904 | Bacteria | 1856 |
| 707 | Ga0496101_0223664 | 3300048904 | Bacteria | 1461 |
| 708 | Ga0496101_0394043 | 3300048904 | Bacteria | 1090 |
| 709 | Ga0496102_0020294 | 3300048905 | Bacteria | 5872 |
| 710 | Ga0496102_0069096 | 3300048905 | Bacteria | 3242 |
| 711 | Ga0496102_0155526 | 3300048905 | Bacteria | 2149 |
| 712 | Ga0496102_0215653 | 3300048905 | Bacteria | 1809 |
| 713 | Ga0496103_0160058 | 3300048906 | Bacteria | 1444 |
| 714 | Ga0496103_0203537 | 3300048906 | Bacteria | 1273 |
| 715 | Ga0496103_0366621 | 3300048906 | Bacteria | 926 |
| 716 | Ga0496104_0009070 | 3300048907 | Bacteria | 8843 |
| 717 | Ga0496104_0018816 | 3300048907 | Bacteria | 6309 |
| 718 | Ga0496104_0299737 | 3300048907 | Bacteria | 1519 |
| 719 | Ga0496105_0036292 | 3300048908 | Bacteria | 4060 |
| 720 | Ga0496105_0201087 | 3300048908 | Bacteria | 1626 |
| 721 | Ga0496106_0013477 | 3300048909 | Bacteria | 6036 |
| 722 | Ga0496106_0186460 | 3300048909 | Bacteria | 1648 |
| 723 | Ga0496106_0321064 | 3300048909 | Bacteria | 1243 |
| 724 | Ga0496106_0365234 | 3300048909 | Bacteria | 1160 |
| 725 | Ga0496106_0611907 | 3300048909 | Bacteria | 872 |
| 726 | Ga0496107_0026324 | 3300048910 | Bacteria | 4122 |
| 727 | Ga0496107_0066674 | 3300048910 | Bacteria | 2610 |
| 728 | Ga0496107_0257753 | 3300048910 | Bacteria | 1298 |
| 729 | Ga0496108_0007465 | 3300048911 | Bacteria | 8863 |
| 730 | Ga0496108_0205236 | 3300048911 | Bacteria | 1710 |
| 731 | Ga0496108_0406946 | 3300048911 | Bacteria | 1188 |
| 732 | Ga0496109_0000609 | 3300048912 | Bacteria | 29900 |
| 733 | Ga0496109_0600231 | 3300048912 | Bacteria | 1037 |
| 734 | Ga0496110_0008924 | 3300048913 | Bacteria | 8082 |
| 735 | Ga0496110_0051009 | 3300048913 | Bacteria | 3635 |
| 736 | Ga0496110_0106590 | 3300048913 | Bacteria | 2515 |
| 737 | Ga0496110_0188518 | 3300048913 | Bacteria | 1873 |
| 738 | Ga0496111_0248764 | 3300048914 | Bacteria | 1320 |
| 739 | Ga0496112_0002437 | 3300048915 | Bacteria | 14996 |
| 740 | Ga0496112_0063507 | 3300048915 | Bacteria | 3643 |
| 741 | Ga0496112_0158624 | 3300048915 | Bacteria | 2229 |
| 742 | Ga0496112_0208189 | 3300048915 | Bacteria | 1913 |
| 743 | Ga0496112_0240664 | 3300048915 | Bacteria | 1762 |
| 744 | Ga0496112_0475644 | 3300048915 | Bacteria | 1186 |
| 745 | Ga0496112_0541120 | 3300048915 | Bacteria | 1099 |
| 746 | Ga0496112_0591305 | 3300048915 | Bacteria | 1042 |
| 747 | Ga0496113_0023429 | 3300048916 | Bacteria | 4377 |
| 748 | Ga0496113_0186428 | 3300048916 | Bacteria | 1646 |
| 749 | Ga0496114_0052300 | 3300048917 | Bacteria | 3403 |
| 750 | Ga0496114_0596401 | 3300048917 | Bacteria | 974 |
| 751 | Ga0496114_1155065 | 3300048917 | Bacteria | 660 |
| 752 | Ga0496115_0042539 | 3300048918 | Bacteria | 3619 |
| 753 | Ga0496115_0148788 | 3300048918 | Bacteria | 1933 |
| 754 | Ga0496115_0172020 | 3300048918 | Bacteria | 1791 |
| 755 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 756 | Ga0496117_0014058 | 3300048920 | Bacteria | 6924 |
| 757 | Ga0496117_0034522 | 3300048920 | Bacteria | 3809 |
| 758 | Ga0496117_0037972 | 3300048920 | Bacteria | 3580 |
| 759 | Ga0496117_0169203 | 3300048920 | Bacteria | 1270 |
| 760 | Ga0496117_0292105 | 3300048920 | Bacteria | 867 |
| 761 | Ga0496117_0330976 | 3300048920 | Bacteria | 794 |
| 762 | Ga0496118_0003027 | 3300048921 | Bacteria | 21693 |
| 763 | Ga0496118_0010242 | 3300048921 | Bacteria | 9306 |
| 764 | Ga0496118_0098113 | 3300048921 | Bacteria | 1991 |
| 765 | Ga0496118_0136894 | 3300048921 | Bacteria | 1561 |
| 766 | Ga0496118_0219477 | 3300048921 | Bacteria | 1108 |
| 767 | Ga0496119_0065293 | 3300048922 | Bacteria | 2156 |
| 768 | Ga0496119_0099673 | 3300048922 | Bacteria | 1633 |
| 769 | Ga0496119_0200392 | 3300048922 | Bacteria | 1033 |
| 770 | Ga0496120_0094039 | 3300048923 | Bacteria | 1596 |
| 771 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 772 | Ga0496121_0002689 | 3300048924 | Bacteria | 26584 |
| 773 | Ga0496121_0009316 | 3300048924 | Bacteria | 11324 |
| 774 | Ga0496121_0023791 | 3300048924 | Bacteria | 5882 |
| 775 | Ga0496121_0047888 | 3300048924 | Bacteria | 3642 |
| 776 | Ga0496121_0049586 | 3300048924 | Bacteria | 3558 |
| 777 | Ga0496121_0107036 | 3300048924 | Bacteria | 2142 |
| 778 | Ga0496121_0111268 | 3300048924 | Bacteria | 2089 |
| 779 | Ga0496121_0189225 | 3300048924 | Bacteria | 1477 |
| 780 | Ga0496121_0216276 | 3300048924 | Bacteria | 1353 |
| 781 | Ga0496122_0081574 | 3300048925 | Bacteria | 2250 |
| 782 | Ga0496122_0307107 | 3300048925 | Bacteria | 852 |
| 783 | Ga0496123_0049608 | 3300048926 | Bacteria | 2812 |
| 784 | Ga0496124_0002957 | 3300048927 | Bacteria | 21339 |
| 785 | Ga0496124_0245021 | 3300048927 | Bacteria | 1330 |
| 786 | Ga0496124_0269286 | 3300048927 | Bacteria | 1248 |
| 787 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 788 | Ga0496125_0076533 | 3300048928 | Bacteria | 2583 |
| 789 | Ga0496125_0094047 | 3300048928 | Bacteria | 2235 |
| 790 | Ga0496125_0099905 | 3300048928 | Bacteria | 2141 |
| 791 | Ga0496125_0135884 | 3300048928 | Bacteria | 1720 |
| 792 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 793 | Ga0496126_0003803 | 3300048929 | Bacteria | 18741 |
| 794 | Ga0496126_0022661 | 3300048929 | Bacteria | 6104 |
| 795 | Ga0496126_0033427 | 3300048929 | Bacteria | 4838 |
| 796 | Ga0496126_0062063 | 3300048929 | Bacteria | 3354 |
| 797 | Ga0496126_0074642 | 3300048929 | Bacteria | 3011 |
| 798 | Ga0496126_0085033 | 3300048929 | Bacteria | 2789 |
| 799 | Ga0496126_0128008 | 3300048929 | Bacteria | 2196 |
| 800 | Ga0496126_0132568 | 3300048929 | Bacteria | 2152 |
| 801 | Ga0496126_0138734 | 3300048929 | Bacteria | 2095 |
| 802 | Ga0496126_0166265 | 3300048929 | Bacteria | 1882 |
| 803 | Ga0496126_0176282 | 3300048929 | Bacteria | 1818 |
| 804 | Ga0496126_0786760 | 3300048929 | Bacteria | 731 |
| 805 | Ga0495682_0139544 | 3300049460 | Bacteria | 866 |
| 806 | Ga0495682_0168838 | 3300049460 | Bacteria | 778 |
| 807 | Ga0501031_0003114 | 3300049568 | Bacteria | 10626 |
| 808 | Ga0501031_0031671 | 3300049568 | Bacteria | 3450 |
| 809 | Ga0501032_0000762 | 3300049569 | Bacteria | 26183 |
| 810 | Ga0501032_0051974 | 3300049569 | Bacteria | 2761 |
| 811 | Ga0501032_0094743 | 3300049569 | Bacteria | 1979 |
| 812 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 813 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 814 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 815 | Ga0501036_0236357 | 3300049572 | Bacteria | 1533 |
| 816 | Ga0501036_0429974 | 3300049572 | Bacteria | 1100 |
| 817 | Ga0501036_0721492 | 3300049572 | Bacteria | 823 |
| 818 | Ga0501037_0000867 | 3300049573 | Bacteria | 22596 |
| 819 | Ga0501037_0506296 | 3300049573 | Bacteria | 819 |
| 820 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 821 | Ga0501038_0132405 | 3300049574 | Bacteria | 2045 |
| 822 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 823 | Ga0501039_0050295 | 3300049575 | Bacteria | 3224 |
| 824 | Ga0501039_0208823 | 3300049575 | Bacteria | 1535 |
| 825 | Ga0501042_0010927 | 3300049578 | Bacteria | 6113 |
| 826 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 827 | Ga0501043_0656988 | 3300049579 | Bacteria | 769 |
| 828 | Ga0501046_0000839 | 3300049580 | Bacteria | 29959 |
| 829 | Ga0501046_0235849 | 3300049580 | Bacteria | 1350 |
| 830 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 831 | Ga0501047_0041364 | 3300049581 | Bacteria | 4454 |
| 832 | Ga0501047_0313117 | 3300049581 | Bacteria | 1410 |
| 833 | Ga0501048_0001309 | 3300049582 | Bacteria | 18872 |
| 834 | Ga0501048_0127719 | 3300049582 | Bacteria | 1798 |
| 835 | Ga0501067_0000457 | 3300049583 | Bacteria | 22383 |
| 836 | Ga0501067_0013941 | 3300049583 | Bacteria | 4452 |
| 837 | Ga0501067_0395309 | 3300049583 | Bacteria | 771 |
| 838 | Ga0501068_0000839 | 3300049584 | Bacteria | 15999 |
| 839 | Ga0501068_0136215 | 3300049584 | Bacteria | 1538 |
| 840 | Ga0501069_0008491 | 3300049585 | Bacteria | 5401 |
| 841 | Ga0501070_0000971 | 3300049586 | Bacteria | 25732 |
| 842 | Ga0501071_0088114 | 3300049587 | Bacteria | 2277 |
| 843 | Ga0501071_0134855 | 3300049587 | Bacteria | 1836 |
| 844 | Ga0501072_0003301 | 3300049588 | Bacteria | 12139 |
| 845 | Ga0501072_0422464 | 3300049588 | Bacteria | 1056 |
| 846 | Ga0501072_0434625 | 3300049588 | Bacteria | 1040 |
| 847 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 848 | Ga0501073_0074644 | 3300049589 | Bacteria | 2361 |
| 849 | Ga0501074_0037310 | 3300049590 | Bacteria | 3523 |
| 850 | Ga0501076_0383952 | 3300049592 | Bacteria | 1154 |
| 851 | Ga0501076_0514584 | 3300049592 | Bacteria | 987 |
| 852 | Ga0501077_0175557 | 3300049593 | Bacteria | 1361 |
| 853 | Ga0501079_0002302 | 3300049741 | Bacteria | 13814 |
| 854 | Ga0501080_0006603 | 3300049742 | Bacteria | 10426 |
| 855 | Ga0501080_1011448 | 3300049742 | Bacteria | 721 |
| 856 | Ga0501083_0001812 | 3300049744 | Bacteria | 14636 |
| 857 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 858 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 859 | Ga0501044_0021563 | 3300049823 | Bacteria | 6869 |
| 860 | Ga0501044_0467028 | 3300049823 | Bacteria | 1166 |
| 861 | Ga0501045_0002539 | 3300049824 | Bacteria | 12434 |
| 862 | Ga0501045_0115652 | 3300049824 | Bacteria | 1990 |
| 863 | nmdc:mga03n38_20242_c1 | 3300050490 | Bacteria | 2658 |
| 864 | nmdc:mga03n38_225627_c1 | 3300050490 | Bacteria | 980 |
| 865 | nmdc:mga03n38_336891_c1 | 3300050490 | Bacteria | 818 |
| 866 | nmdc:mga00v17_266897_c1 | 3300050491 | Bacteria | 1111 |
| 867 | nmdc:mga00v17_31303_c1 | 3300050491 | Bacteria | 3137 |
| 868 | nmdc:mga0yw44_183313_c1 | 3300050492 | Bacteria | 1379 |
| 869 | nmdc:mga0yw44_203975_c1 | 3300050492 | Bacteria | 1307 |
| 870 | nmdc:mga0yw44_370018_c1 | 3300050492 | Bacteria | 967 |
| 871 | nmdc:mga0yw44_38229_c1 | 3300050492 | Bacteria | 2838 |
| 872 | nmdc:mga0yw44_38444_c1 | 3300050492 | Bacteria | 2832 |
| 873 | nmdc:mga0k408_135340_c1 | 3300050493 | Bacteria | 1464 |
| 874 | nmdc:mga0k408_34806_c1 | 3300050493 | Bacteria | 2885 |
| 875 | nmdc:mga06z11_27972_c1 | 3300050494 | Bacteria | 2700 |
| 876 | nmdc:mga06z11_41041_c1 | 3300050494 | Bacteria | 2313 |
| 877 | nmdc:mga06z11_61431_c1 | 3300050494 | Bacteria | 1960 |
| 878 | nmdc:mga06z11_72222_c1 | 3300050494 | Bacteria | 1829 |
| 879 | nmdc:mga06z11_84378_c1 | 3300050494 | Bacteria | 1712 |
| 880 | nmdc:mga04h51_80619_c1 | 3300050495 | Bacteria | 1154 |
| 881 | nmdc:mga07m45_142421_c1 | 3300050496 | Bacteria | 1388 |
| 882 | nmdc:mga07m45_147292_c1 | 3300050496 | Bacteria | 1365 |
| 883 | nmdc:mga05p37_811294_c1 | 3300050507 | Bacteria | 1022 |
| 884 | nmdc:mga08y16_40533_c1 | 3300050511 | Bacteria | 4881 |
| 885 | nmdc:mga0n895_15181_c1 | 3300050512 | Bacteria | 7018 |
| 886 | nmdc:mga0n895_161206_c1 | 3300050512 | Bacteria | 2274 |
| 887 | nmdc:mga0n895_247010_c1 | 3300050512 | Bacteria | 1811 |
| 888 | nmdc:mga0rr50_88622_c1 | 3300050513 | Bacteria | 2404 |
| 889 | nmdc:mga08x19_275118_c1 | 3300050514 | Bacteria | 1166 |
| 890 | nmdc:mga0sz30_1774_c1 | 3300050516 | Bacteria | 7659 |
| 891 | nmdc:mga0sz30_32158_c1 | 3300050516 | Bacteria | 2175 |
| 892 | nmdc:mga0sz30_73654_c1 | 3300050516 | Bacteria | 1472 |
| 893 | Ga0495601_0029491 | 3300053077 | Bacteria | 3403 |
| 894 | Ga0495601_0221445 | 3300053077 | Bacteria | 1236 |
| 895 | Ga0500635_0140244 | 3300053080 | Bacteria | 917 |
| 896 | Ga0495595_0034044 | 3300053084 | Bacteria | 2303 |
| 897 | Ga0495619_0149002 | 3300053085 | Bacteria | 1613 |
| 898 | Ga0495619_0283258 | 3300053085 | Bacteria | 1148 |
| 899 | Ga0500578_0040493 | 3300053086 | Bacteria | 2994 |
| 900 | Ga0500578_0308065 | 3300053086 | Bacteria | 937 |
| 901 | Ga0500578_0413856 | 3300053086 | Bacteria | 774 |
| 902 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 903 | Ga0500643_012220 | 3300053087 | Bacteria | 3083 |
| 904 | Ga0500581_167153 | 3300053089 | Bacteria | 1014 |
| 905 | Ga0500647_0003150 | 3300053091 | Bacteria | 6361 |
| 906 | Ga0500583_0114375 | 3300053092 | Bacteria | 1331 |
| 907 | Ga0500651_0016774 | 3300053093 | Bacteria | 4508 |
| 908 | Ga0500651_0080962 | 3300053093 | Bacteria | 2011 |
| 909 | Ga0500651_0167795 | 3300053093 | Bacteria | 1310 |
| 910 | Ga0500566_0000126 | 3300053094 | Bacteria | 39286 |
| 911 | Ga0500566_0001615 | 3300053094 | Bacteria | 13269 |
| 912 | Ga0500566_0002605 | 3300053094 | Bacteria | 10733 |
| 913 | Ga0500566_0032785 | 3300053094 | Bacteria | 3029 |
| 914 | Ga0500640_003090 | 3300053095 | Bacteria | 5700 |
| 915 | Ga0500641_0005231 | 3300053096 | Bacteria | 4598 |
| 916 | Ga0500641_0005276 | 3300053096 | Bacteria | 4576 |
| 917 | Ga0500648_072568 | 3300053097 | Bacteria | 1945 |
| 918 | Ga0500650_0002007 | 3300053098 | Bacteria | 6500 |
| 919 | Ga0500556_0137217 | 3300053104 | Bacteria | 961 |
| 920 | Ga0500556_0207441 | 3300053104 | Bacteria | 774 |
| 921 | Ga0500557_119428 | 3300053105 | Bacteria | 875 |
| 922 | Ga0500562_040306 | 3300053108 | Bacteria | 1241 |
| 923 | Ga0500562_044557 | 3300053108 | Bacteria | 1181 |
| 924 | Ga0500569_010177 | 3300053109 | Bacteria | 2206 |
| 925 | Ga0500569_017337 | 3300053109 | Bacteria | 1840 |
| 926 | Ga0500572_000152 | 3300053111 | Bacteria | 24027 |
| 927 | Ga0500572_003010 | 3300053111 | Bacteria | 3933 |
| 928 | Ga0500594_0008171 | 3300053118 | Bacteria | 2380 |
| 929 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 930 | Ga0500595_000497 | 3300053119 | Bacteria | 23997 |
| 931 | Ga0500595_010458 | 3300053119 | Bacteria | 3687 |
| 932 | Ga0500595_030978 | 3300053119 | Bacteria | 1797 |
| 933 | Ga0500607_146783 | 3300053121 | Bacteria | 1100 |
| 934 | Ga0500614_001649 | 3300053123 | Bacteria | 5240 |
| 935 | Ga0500618_013821 | 3300053125 | Bacteria | 2077 |
| 936 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 937 | Ga0500642_0005741 | 3300053130 | Bacteria | 4033 |
| 938 | Ga0500642_0123977 | 3300053130 | Bacteria | 1209 |
| 939 | Ga0500652_010728 | 3300053131 | Bacteria | 3151 |
| 940 | Ga0500652_188156 | 3300053131 | Bacteria | 843 |
| 941 | Ga0500658_0024606 | 3300053134 | Bacteria | 2308 |
| 942 | Ga0500658_0153129 | 3300053134 | Bacteria | 1040 |
| 943 | Ga0500559_0000230 | 3300053136 | Bacteria | 44504 |
| 944 | Ga0500559_0001714 | 3300053136 | Bacteria | 12043 |
| 945 | Ga0500559_0052763 | 3300053136 | Bacteria | 1798 |
| 946 | Ga0500559_0074726 | 3300053136 | Bacteria | 1532 |
| 947 | Ga0500564_052876 | 3300053138 | Bacteria | 1855 |
| 948 | Ga0500568_0000536 | 3300053139 | Bacteria | 27978 |
| 949 | Ga0500568_0007618 | 3300053139 | Bacteria | 5292 |
| 950 | Ga0500568_0028888 | 3300053139 | Bacteria | 2308 |
| 951 | Ga0500568_0052623 | 3300053139 | Bacteria | 1598 |
| 952 | Ga0500577_0092611 | 3300053142 | Bacteria | 1224 |
| 953 | Ga0500588_0078594 | 3300053146 | Bacteria | 1099 |
| 954 | Ga0500589_138875 | 3300053147 | Bacteria | 1004 |
| 955 | Ga0500590_080589 | 3300053148 | Bacteria | 1599 |
| 956 | Ga0500603_000304 | 3300053150 | Bacteria | 12869 |
| 957 | Ga0500603_004209 | 3300053150 | Bacteria | 3075 |
| 958 | Ga0500604_0055704 | 3300053151 | Bacteria | 1230 |
| 959 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 960 | Ga0500616_0147958 | 3300053153 | Bacteria | 1090 |
| 961 | Ga0500622_0013268 | 3300053156 | Bacteria | 4445 |
| 962 | Ga0500622_0061141 | 3300053156 | Bacteria | 1920 |
| 963 | Ga0500622_0254306 | 3300053156 | Bacteria | 770 |
| 964 | Ga0500627_0027552 | 3300053158 | Bacteria | 2353 |
| 965 | Ga0500627_0072823 | 3300053158 | Bacteria | 1523 |
| 966 | Ga0500630_002602 | 3300053159 | Bacteria | 8690 |
| 967 | Ga0500634_0050414 | 3300053161 | Bacteria | 2242 |
| 968 | Ga0500634_0097771 | 3300053161 | Bacteria | 1476 |
| 969 | Ga0500638_005288 | 3300053162 | Bacteria | 5117 |
| 970 | Ga0500638_048231 | 3300053162 | Bacteria | 2061 |
| 971 | Ga0500639_000039 | 3300053163 | Bacteria | 65182 |
| 972 | Ga0500636_0015308 | 3300053177 | Bacteria | 4519 |
| 973 | Ga0500636_0033475 | 3300053177 | Bacteria | 3042 |
| 974 | Ga0500636_0146675 | 3300053177 | Bacteria | 1300 |
| 975 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 976 | Ga0500576_016710 | 3300053725 | Bacteria | 3331 |
| 977 | Ga0500576_118437 | 3300053725 | Bacteria | 1048 |
| 978 | Ga0500645_113256 | 3300053730 | Bacteria | 760 |
| 979 | Ga0500552_000562 | 3300053733 | Bacteria | 3474 |
| 980 | Ga0500596_001647 | 3300053735 | Bacteria | 4511 |
| 981 | Ga0500599_000986 | 3300053736 | Bacteria | 3184 |
| 982 | Ga0500601_000280 | 3300053737 | Bacteria | 9696 |
| 983 | Ga0501084_0005116 | 3300054114 | Bacteria | 10737 |
| 984 | Ga0501084_0301392 | 3300054114 | Bacteria | 1354 |
| 985 | Ga0500661_031303 | 3300055283 | Bacteria | 939 |
| 986 | Ga0501082_0004333 | 3300060353 | Bacteria | 12407 |
| 987 | Ga0501082_0134273 | 3300060353 | Bacteria | 2147 |
| 988 | Ga0530510_0014062 | 3300061734 | Bacteria | 5642 |
| 989 | Ga0530510_0569704 | 3300061734 | Bacteria | 861 |
| 990 | 2644290519 | 2643221651 | Bacteria | 4798932 |
| 991 | Ga0070714_100929593 | |||
| 992 | JGI25406J46586_10000233 | |||
| 993 | JGI25406J46586_10006333 | |||
| 994 | JGI25153J46596_10006692 | |||
| 995 | JGI25153J46596_10040042 | |||
| 996 | rootH2_10011831 | |||
| 997 | JGI25404J52841_10020882 | |||
| 998 | JGI25404J52841_10067893 | |||
| 999 | Ga0055526_1028100 | |||
| 1000 | Ga0055531_10005040 | |||
| 1001 | Ga0055531_10083370 | |||
| 1002 | Ga0070658_10525619 | |||
| 1003 | Ga0070670_100182004 | |||
| 1004 | Ga0068869_100030464 | |||
| 1005 | Ga0068869_100087498 | |||
| 1006 | Ga0068869_100160324 | |||
| 1007 | Ga0068869_100382431 | |||
| 1008 | Ga0070666_10273787 | |||
| 1009 | Ga0070680_100013830 | |||
| 1010 | Ga0070680_100196494 | |||
| 1011 | Ga0070682_100027255 | |||
| 1012 | Ga0070682_100194300 | |||
| 1013 | Ga0068868_100050101 | |||
| 1014 | Ga0068868_100338502 | |||
| 1015 | Ga0068868_100444242 | |||
| 1016 | Ga0068868_100560625 | |||
| 1017 | Ga0070660_100003692 | |||
| 1018 | Ga0070660_100129050 | |||
| 1019 | Ga0070660_100333322 | |||
| 1020 | Ga0070689_100099415 | |||
| 1021 | Ga0070687_100361678 | |||
| 1022 | Ga0070661_100055967 | |||
| 1023 | Ga0070661_100278907 | |||
| 1024 | Ga0070661_100461411 | |||
| 1025 | Ga0070668_100024341 | |||
| 1026 | Ga0070668_100059725 | |||
| 1027 | Ga0070668_100091702 | |||
| 1028 | Ga0070668_100127388 | |||
| 1029 | Ga0070669_100351449 | |||
| 1030 | Ga0070669_100433510 | |||
| 1031 | Ga0070675_100419897 | |||
| 1032 | Ga0070675_100848847 | |||
| 1033 | Ga0070674_100231814 | |||
| 1034 | Ga0070674_100373942 | |||
| 1035 | Ga0070673_100103078 | |||
| 1036 | Ga0070688_100472045 | |||
| 1037 | Ga0070659_100077774 | |||
| 1038 | Ga0070659_100189719 | |||
| 1039 | Ga0070709_10036585 | |||
| 1040 | Ga0070714_100015842 | |||
| 1041 | Ga0070714_100067089 | |||
| 1042 | Ga0070713_100269513 | |||
| 1043 | Ga0070713_100680283 | |||
| 1044 | Ga0070701_10199112 | |||
| 1045 | Ga0070711_100001130 | |||
| 1046 | Ga0070705_100707547 | |||
| 1047 | Ga0070694_100163094 | |||
| 1048 | Ga0070694_100490103 | |||
| 1049 | Ga0070708_100105209 | |||
| 1050 | Ga0070663_100032985 | |||
| 1051 | Ga0070663_100057207 | |||
| 1052 | Ga0070663_100292428 | |||
| 1053 | Ga0070663_100411763 | |||
| 1054 | Ga0070663_100417055 | |||
| 1055 | Ga0070663_100541761 | |||
| 1056 | Ga0070678_100034642 | |||
| 1057 | Ga0070678_100999680 | |||
| 1058 | Ga0070662_100091189 | |||
| 1059 | Ga0070681_10006411 | |||
| 1060 | Ga0070681_10007888 | |||
| 1061 | Ga0070685_10055262 | |||
| 1062 | Ga0070685_10079531 | |||
| 1063 | Ga0070685_10209492 | |||
| 1064 | Ga0070698_100400542 | |||
| 1065 | Ga0070698_100465666 | |||
| 1066 | Ga0070699_100796420 | |||
| 1067 | Ga0070679_100018490 | |||
| 1068 | Ga0070679_100074252 | |||
| 1069 | Ga0070679_100084060 | |||
| 1070 | Ga0070679_100229905 | |||
| 1071 | Ga0070697_100054323 | |||
| 1072 | Ga0068853_100009612 | |||
| 1073 | Ga0068853_100422126 | |||
| 1074 | Ga0068853_100925826 | |||
| 1075 | Ga0070686_100726033 | |||
| 1076 | Ga0070693_100056138 | |||
| 1077 | Ga0070693_100210058 | |||
| 1078 | Ga0070693_100606723 | |||
| 1079 | Ga0070665_100038699 | |||
| 1080 | Ga0070665_100060150 | |||
| 1081 | Ga0070665_100233037 | |||
| 1082 | Ga0070665_100355551 | |||
| 1083 | Ga0070665_100373554 | |||
| 1084 | Ga0070665_100386166 | |||
| 1085 | Ga0070665_100489586 | |||
| 1086 | Ga0070665_100519222 | |||
| 1087 | Ga0068855_100027307 | |||
| 1088 | Ga0068855_100160273 | |||
| 1089 | Ga0068855_100215023 | |||
| 1090 | Ga0068855_100249115 | |||
| 1091 | Ga0068855_100485141 | |||
| 1092 | Ga0068857_100013087 | |||
| 1093 | Ga0068857_100280101 | |||
| 1094 | Ga0068854_100090808 | |||
| 1095 | Ga0068856_100342777 | |||
| 1096 | Ga0068852_100103072 | |||
| 1097 | Ga0068852_100105170 | |||
| 1098 | Ga0068852_100497397 | |||
| 1099 | Ga0068859_100053072 | |||
| 1100 | Ga0068859_100146181 | |||
| 1101 | Ga0068859_101318636 | |||
| 1102 | Ga0068864_100124538 | |||
| 1103 | Ga0068864_100846275 | |||
| 1104 | Ga0068866_10152765 | |||
| 1105 | Ga0068861_100040899 | |||
| 1106 | Ga0068861_100122230 | |||
| 1107 | Ga0068870_10218316 | |||
| 1108 | Ga0068863_100550995 | |||
| 1109 | Ga0068858_100551252 | |||
| 1110 | Ga0068858_100642741 | |||
| 1111 | Ga0068858_100694274 | |||
| 1112 | Ga0068858_101057945 | |||
| 1113 | Ga0068860_100000313 | |||
| 1114 | Ga0068862_100221922 | |||
| 1115 | Ga0068862_101092449 | |||
| 1116 | Ga0081455_10005731 | |||
| 1117 | Ga0081455_10029773 | |||
| 1118 | Ga0081455_10099630 | |||
| 1119 | Ga0081455_10109419 | |||
| 1120 | Ga0081540_1007566 | |||
| 1121 | Ga0081540_1008557 | |||
| 1122 | Ga0081540_1011157 | |||
| 1123 | Ga0081540_1012286 | |||
| 1124 | Ga0081540_1015476 | |||
| 1125 | Ga0081540_1016697 | |||
| 1126 | Ga0081540_1018292 | |||
| 1127 | Ga0081540_1035420 | |||
| 1128 | Ga0081540_1044694 | |||
| 1129 | Ga0081540_1059902 | |||
| 1130 | Ga0081540_1071540 | |||
| 1131 | Ga0081539_10000157 | |||
| 1132 | Ga0081539_10002599 | |||
| 1133 | Ga0081539_10106751 | |||
| 1134 | Ga0070717_10034976 | |||
| 1135 | Ga0070717_10315909 | |||
| 1136 | Ga0070717_10339131 | |||
| 1137 | Ga0075365_10068327 | |||
| 1138 | Ga0075365_10093827 | |||
| 1139 | Ga0075365_10115880 | |||
| 1140 | Ga0075365_10401340 | |||
| 1141 | Ga0075365_10766777 | |||
| 1142 | Ga0075368_10002578 | |||
| 1143 | Ga0075368_10040110 | |||
| 1144 | Ga0075368_10044493 | |||
| 1145 | Ga0075363_100003641 | |||
| 1146 | Ga0075363_100012959 | |||
| 1147 | Ga0075363_100091186 | |||
| 1148 | Ga0075363_100128984 | |||
| 1149 | Ga0075363_100245248 | |||
| 1150 | Ga0075364_10012640 | |||
| 1151 | Ga0075364_10076141 | |||
| 1152 | Ga0075364_10084435 | |||
| 1153 | Ga0075364_10383488 | |||
| 1154 | Ga0075364_10406694 | |||
| 1155 | Ga0070716_100156175 | |||
| 1156 | Ga0075367_10008296 | |||
| 1157 | Ga0075367_10160099 | |||
| 1158 | Ga0075367_10167738 | |||
| 1159 | Ga0075367_10267582 | |||
| 1160 | Ga0075369_10031533 | |||
| 1161 | Ga0075369_10039347 | |||
| 1162 | Ga0075369_10080100 | |||
| 1163 | Ga0075369_10139008 | |||
| 1164 | Ga0075366_10068130 | |||
| 1165 | Ga0075366_10112181 | |||
| 1166 | Ga0097621_100748026 | |||
| 1167 | Ga0075370_10010672 | |||
| 1168 | Ga0075370_10264863 | |||
| 1169 | Ga0068871_100573485 | |||
| 1170 | Ga0075434_100023401 | |||
| 1171 | Ga0075434_100200870 | |||
| 1172 | Ga0075434_100310997 | |||
| 1173 | Ga0075434_100400957 | |||
| 1174 | Ga0068865_100598496 | |||
| 1175 | Ga0075436_100773008 | |||
| 1176 | Ga0097620_100053073 | |||
| 1177 | Ga0097620_100146183 | |||
| 1178 | Ga0097620_101318534 | |||
| 1179 | Ga0099824_1018691 | |||
| 1180 | Ga0099822_1000541 | |||
| 1181 | Ga0099822_1077802 | |||
| 1182 | Ga0075435_100087942 | |||
| 1183 | Ga0099794_10026556 | |||
| 1184 | Ga0099794_10035471 | |||
| 1185 | Ga0099794_10216336 | |||
| 1186 | Ga0099795_10027564 | |||
| 1187 | Ga0099795_10037370 | |||
| 1188 | Ga0105240_10002295 | |||
| 1189 | Ga0105240_10033307 | |||
| 1190 | Ga0105240_10303050 | |||
| 1191 | Ga0111539_10490578 | |||
| 1192 | Ga0111539_11329697 | |||
| 1193 | Ga0105245_10406274 | |||
| 1194 | Ga0105247_10035521 | |||
| 1195 | Ga0105247_10121903 | |||
| 1196 | Ga0105243_10036778 | |||
| 1197 | Ga0105243_10208884 | |||
| 1198 | Ga0105241_10072901 | |||
| 1199 | Ga0105241_10075194 | |||
| 1200 | Ga0105241_10479912 | |||
| 1201 | Ga0105242_10266630 | |||
| 1202 | Ga0105248_10231301 | |||
| 1203 | Ga0105237_10002301 | |||
| 1204 | Ga0105237_10066311 | |||
| 1205 | Ga0105237_10314760 | |||
| 1206 | Ga0105238_10006268 | |||
| 1207 | Ga0105238_10022426 | |||
| 1208 | Ga0105238_10461190 | |||
| 1209 | Ga0105249_10333593 | |||
| 1210 | Ga0105249_10493636 | |||
| 1211 | Ga0105249_10545568 | |||
| 1212 | Ga0099796_10092218 | |||
| 1213 | Ga0105239_10017503 | |||
| 1214 | Ga0105239_10035625 | |||
| 1215 | Ga0105239_10066921 | |||
| 1216 | Ga0105239_10189208 | |||
| 1217 | Ga0105239_10191172 | |||
| 1218 | Ga0105239_10605283 | |||
| 1219 | Ga0105239_10650584 | |||
| 1220 | Ga0105239_10694815 | |||
| 1221 | Ga0105239_10831580 | |||
| 1222 | Ga0105239_10850948 | |||
| 1223 | Ga0105246_10035946 | |||
| 1224 | Ga0105246_10095428 | |||
| 1225 | Ga0105246_10264649 | |||
| 1226 | Ga0157371_10031405 | |||
| 1227 | Ga0157370_10075424 | |||
| 1228 | Ga0157370_10492533 | |||
| 1229 | Ga0157369_10018692 | |||
| 1230 | Ga0157374_10131548 | |||
| 1231 | Ga0157378_10008170 | |||
| 1232 | Ga0163162_10026136 | |||
| 1233 | Ga0163162_10127713 | |||
| 1234 | Ga0163162_10232436 | |||
| 1235 | Ga0163162_10485689 | |||
| 1236 | Ga0163162_10834378 | |||
| 1237 | Ga0157372_10075935 | |||
| 1238 | Ga0157372_11545435 | |||
| 1239 | Ga0157375_10537241 | |||
| 1240 | Ga0163163_10007500 | |||
| 1241 | Ga0163163_10092490 | |||
| 1242 | Ga0163163_10490891 | |||
| 1243 | Ga0157380_10047597 | |||
| 1244 | Ga0157379_10060314 | |||
| 1245 | Ga0157379_10219909 | |||
| 1246 | Ga0157379_11094465 | |||
| 1247 | Ga0157376_10127798 | |||
| 1248 | Ga0206356_10672806 | |||
| 1249 | Ga0209563_102736 | |||
| 1250 | Ga0209563_119376 | |||
| 1251 | Ga0207425_1019877 | |||
| 1252 | Ga0209148_1000267 | |||
| 1253 | Ga0209233_1002344 | |||
| 1254 | Ga0209233_1018924 | |||
| 1255 | Ga0209233_1050685 | |||
| 1256 | Ga0209455_1002785 | |||
| 1257 | Ga0209564_1021745 | |||
| 1258 | Ga0209564_1022449 | |||
| 1259 | Ga0209758_1000015 | |||
| 1260 | Ga0209758_1000711 | |||
| 1261 | Ga0209758_1001094 | |||
| 1262 | Ga0209758_1001864 | |||
| 1263 | Ga0209758_1031488 | |||
| 1264 | Ga0209758_1048288 | |||
| 1265 | Ga0209256_1004771 | |||
| 1266 | Ga0207426_1003610 | |||
| 1267 | Ga0209257_1001688 | |||
| 1268 | Ga0209257_1035198 | |||
| 1269 | Ga0207656_10018079 | |||
| 1270 | Ga0207710_10028664 | |||
| 1271 | Ga0207710_10288533 | |||
| 1272 | Ga0207688_10054745 | |||
| 1273 | Ga0207688_10092165 | |||
| 1274 | Ga0207680_10568610 | |||
| 1275 | Ga0207647_10009749 | |||
| 1276 | Ga0207647_10307119 | |||
| 1277 | Ga0207699_10144934 | |||
| 1278 | Ga0207645_10063010 | |||
| 1279 | Ga0207645_10170646 | |||
| 1280 | Ga0207645_10374619 | |||
| 1281 | Ga0207643_10189637 | |||
| 1282 | Ga0207705_10238678 | |||
| 1283 | Ga0207684_10618921 | |||
| 1284 | Ga0207654_10011023 | |||
| 1285 | Ga0207654_10028697 | |||
| 1286 | Ga0207654_10045094 | |||
| 1287 | Ga0207654_10523149 | |||
| 1288 | Ga0207707_10000143 | |||
| 1289 | Ga0207707_10014431 | |||
| 1290 | Ga0207707_10032951 | |||
| 1291 | Ga0207695_10000059 | |||
| 1292 | Ga0207695_10093922 | |||
| 1293 | Ga0207695_10179409 | |||
| 1294 | Ga0207695_10895162 | |||
| 1295 | Ga0207671_10001109 | |||
| 1296 | Ga0207671_10130576 | |||
| 1297 | Ga0207671_10538603 | |||
| 1298 | Ga0207693_10059333 | |||
| 1299 | Ga0207693_10184703 | |||
| 1300 | Ga0207693_10450114 | |||
| 1301 | Ga0207663_10021983 | |||
| 1302 | Ga0207660_10007904 | |||
| 1303 | Ga0207660_10079595 | |||
| 1304 | Ga0207660_10279084 | |||
| 1305 | Ga0207657_10005482 | |||
| 1306 | Ga0207657_10074276 | |||
| 1307 | Ga0207657_10251739 | |||
| 1308 | Ga0207657_10436016 | |||
| 1309 | Ga0207652_10024703 | |||
| 1310 | Ga0207652_10027515 | |||
| 1311 | Ga0207652_10045150 | |||
| 1312 | Ga0207681_10330550 | |||
| 1313 | Ga0207694_10110472 | |||
| 1314 | Ga0207650_10179960 | |||
| 1315 | Ga0207659_10221682 | |||
| 1316 | Ga0207687_10085748 | |||
| 1317 | Ga0207687_10298816 | |||
| 1318 | Ga0207700_10206963 | |||
| 1319 | Ga0207700_10272732 | |||
| 1320 | Ga0207664_10243512 | |||
| 1321 | Ga0207664_10282814 | |||
| 1322 | Ga0207664_10462245 | |||
| 1323 | Ga0207664_10542191 | |||
| 1324 | Ga0207664_10609971 | |||
| 1325 | Ga0207644_10216876 | |||
| 1326 | Ga0207644_10492535 | |||
| 1327 | Ga0207690_10250658 | |||
| 1328 | Ga0207706_10107908 | |||
| 1329 | Ga0207706_10314047 | |||
| 1330 | Ga0207706_10470633 | |||
| 1331 | Ga0207686_10237709 | |||
| 1332 | Ga0207686_10238933 | |||
| 1333 | Ga0207709_10010853 | |||
| 1334 | Ga0207709_10615410 | |||
| 1335 | Ga0207670_10053964 | |||
| 1336 | Ga0207670_10230196 | |||
| 1337 | Ga0207669_10168381 | |||
| 1338 | Ga0207665_10501756 | |||
| 1339 | Ga0207691_10259003 | |||
| 1340 | Ga0207691_10330741 | |||
| 1341 | Ga0207711_10112183 | |||
| 1342 | Ga0207711_10120999 | |||
| 1343 | Ga0207689_10052561 | |||
| 1344 | Ga0207689_10059101 | |||
| 1345 | Ga0207689_10371601 | |||
| 1346 | Ga0207661_10068018 | |||
| 1347 | Ga0207667_10020014 | |||
| 1348 | Ga0207667_10020505 | |||
| 1349 | Ga0207667_10154463 | |||
| 1350 | Ga0207667_10222922 | |||
| 1351 | Ga0207667_10779988 | |||
| 1352 | Ga0207667_11119903 | |||
| 1353 | Ga0207651_10572263 | |||
| 1354 | Ga0207712_10039860 | |||
| 1355 | Ga0207712_10203648 | |||
| 1356 | Ga0207712_10770662 | |||
| 1357 | Ga0207668_10061758 | |||
| 1358 | Ga0207668_10213756 | |||
| 1359 | Ga0207668_10674564 | |||
| 1360 | Ga0207640_10342888 | |||
| 1361 | Ga0207658_10869302 | |||
| 1362 | Ga0207677_10099933 | |||
| 1363 | Ga0207703_10045007 | |||
| 1364 | Ga0207703_10429822 | |||
| 1365 | Ga0207703_10539958 | |||
| 1366 | Ga0207703_10593231 | |||
| 1367 | Ga0207703_11263153 | |||
| 1368 | Ga0207639_10076603 | |||
| 1369 | Ga0207639_10087416 | |||
| 1370 | Ga0207678_10030059 | |||
| 1371 | Ga0207678_10049937 | |||
| 1372 | Ga0207678_10067196 | |||
| 1373 | Ga0207678_10069172 | |||
| 1374 | Ga0207678_10077044 | |||
| 1375 | Ga0207678_10100244 | |||
| 1376 | Ga0207678_10334279 | |||
| 1377 | Ga0207702_10180166 | |||
| 1378 | Ga0207641_10415901 | |||
| 1379 | Ga0207648_10069067 | |||
| 1380 | Ga0207648_10079125 | |||
| 1381 | Ga0207676_10102795 | |||
| 1382 | Ga0207676_10765225 | |||
| 1383 | Ga0207674_10018135 | |||
| 1384 | Ga0207674_10180637 | |||
| 1385 | Ga0207674_10482581 | |||
| 1386 | Ga0207675_100043034 | |||
| 1387 | Ga0207675_100099220 | |||
| 1388 | Ga0207675_100171194 | |||
| 1389 | Ga0207675_100377654 | |||
| 1390 | Ga0207683_10370569 | |||
| 1391 | Ga0207698_10230995 | |||
| 1392 | Ga0207698_10917746 | |||
| 1393 | Ga0207698_10975898 | |||
| 1394 | Ga0209389_1000012 | |||
| 1395 | Ga0209389_1000069 | |||
| 1396 | Ga0209589_1000015 | |||
| 1397 | Ga0209589_1000077 | |||
| 1398 | Ga0209489_100015 | |||
| 1399 | Ga0209489_100019 | |||
| 1400 | Ga0209489_100020 | |||
| 1401 | Ga0209700_100018 | |||
| 1402 | Ga0209700_100025 | |||
| 1403 | Ga0209179_1000903 | |||
| 1404 | Ga0209179_1006292 | |||
| 1405 | Ga0209588_1040830 | |||
| 1406 | Ga0207428_10103834 | |||
| 1407 | Ga0268266_10046869 | |||
| 1408 | Ga0268266_10047304 | |||
| 1409 | Ga0268266_10053850 | |||
| 1410 | Ga0268266_10091993 | |||
| 1411 | Ga0268266_10115674 | |||
| 1412 | Ga0268266_10318321 | |||
| 1413 | Ga0268266_10834863 | |||
| 1414 | Ga0268265_10060372 | |||
| 1415 | Ga0268265_10182909 | |||
| 1416 | Ga0268265_10355274 | |||
| 1417 | Ga0268265_10575258 | |||
| 1418 | Ga0268264_10000356 | |||
| 1419 | Ga0265337_1011271 | |||
| 1420 | Ga0265326_10006827 | |||
| 1421 | Ga0265319_1024285 | |||
| 1422 | Ga0265334_10020212 | |||
| 1423 | Ga0265322_10013237 | |||
| 1424 | Ga0265336_10000850 | |||
| 1425 | Ga0307517_10010277 | |||
| 1426 | Ga0307515_10045648 | |||
| 1427 | Ga0307515_10121325 | |||
| 1428 | Ga0307515_10381058 | |||
| 1429 | Ga0265338_10000417 | |||
| 1430 | Ga0265324_10003779 | |||
| 1431 | Ga0307511_10034380 | |||
| 1432 | Ga0307511_10194222 | |||
| 1433 | Ga0265330_10012848 | |||
| 1434 | Ga0265330_10050026 | |||
| 1435 | Ga0265340_10055091 | |||
| 1436 | Ga0265339_10016661 | |||
| 1437 | Ga0265316_10301072 | |||
| 1438 | Ga0307509_10009216 | |||
| 1439 | Ga0265313_10052803 | |||
| 1440 | Ga0307508_10000715 | |||
| 1441 | Ga0307508_10033881 | |||
| 1442 | Ga0307508_10185701 | |||
| 1443 | Ga0265342_10003269 | |||
| 1444 | Ga0265342_10085372 | |||
| 1445 | Ga0265342_10105122 | |||
| 1446 | Ga0307516_10005305 | |||
| 1447 | Ga0307516_10009786 | |||
| 1448 | Ga0307516_10068945 | |||
| 1449 | Ga0307405_10105611 | |||
| 1450 | Ga0307410_10555398 | |||
| 1451 | Ga0307412_10349068 | |||
| 1452 | Ga0307409_100220742 | |||
| 1453 | Ga0307409_100410238 | |||
| 1454 | Ga0307416_100151303 | |||
| 1455 | Ga0307416_101099872 | |||
| 1456 | Ga0307415_100025456 | |||
| 1457 | Ga0307415_100521848 | |||
| 1458 | Ga0307415_100618633 | |||
| 1459 | Ga0307507_10045602 | |||
| 1460 | Ga0307510_10010708 | |||
| 1461 | Ga0307510_10018266 | |||
| 1462 | Ga0307510_10075614 | |||
| 1463 | Ga0307510_10195727 | |||
| 1464 | Ga0307510_10435309 | |||
| 1465 | Ga0373926_0023243 | |||
| 1466 | Ga0373923_0008743 | |||
| 1467 | Ga0373923_0130314 | |||
| 1468 | Ga0373936_0092173 | |||
| 1469 | Ga0373936_0111064 | |||
| 1470 | Ga0373939_0066133 | |||
| 1471 | Ga0373945_0004291 | |||
| 1472 | Ga0373954_0075857 | |||
| 1473 | Ga0373957_0019213 | |||
| 1474 | Ga0373943_0073105 | |||
| 1475 | Ga0373931_0105518 | |||
| 1476 | Ga0373935_0001812 | |||
| 1477 | Ga0373935_0005959 | |||
| 1478 | Ga0373935_0061189 | |||
| 1479 | Ga0373927_0000137 | |||
| 1480 | Ga0373927_0005646 | |||
| 1481 | Ga0373927_0014399 | |||
| 1482 | Ga0373947_0003829 | |||
| 1483 | Ga0373947_0176820 | |||
| 1484 | Ga0373937_0021625 | |||
| 1485 | Ga0373937_0105868 | |||
| 1486 | Ga0373925_0008084 | |||
| 1487 | Ga0373925_0034633 | |||
| 1488 | Ga0373925_0113338 | |||
| 1489 | Ga0373925_0277941 | |||
| 1490 | Ga0373925_0430530 | |||
| 1491 | Ga0373925_0823081 | |||
| 1492 | Ga0395900_0280928 | |||
| 1493 | Ga0395898_0005085 | |||
| 1494 | Ga0395898_0058714 | |||
| 1495 | Ga0395898_0270797 | |||
| 1496 | Ga0395905_0136017 | |||
| 1497 | Ga0436364_1520197 | |||
| 1498 | Ga0395901_0017340 | |||
| 1499 | Ga0395901_0293685 | |||
| 1500 | Ga0395901_0441797 | |||
| 1501 | Ga0395901_0943648 | |||
| 1502 | Ga0436365_0190765 | |||
| 1503 | Ga0436365_1328606 | |||
| 1504 | Ga0436365_1363457 | |||
| 1505 | Ga0436360_0868220 | |||
| 1506 | Ga0439465_0038800 | |||
| 1507 | Ga0439465_0070317 | |||
| 1508 | Ga0451789_0385457 | |||
| 1509 | Ga0451807_0327781 | |||
| 1510 | Ga0451849_0176703 | |||
| 1511 | Ga0466969_0146013 | |||
| 1512 | Ga0466972_0123383 | |||
| 1513 | Ga0466972_0125330 | |||
| 1514 | Ga0466965_0045854 | |||
| 1515 | Ga0466966_0000411 | |||
| 1516 | Ga0466961_0000065 | |||
| 1517 | Ga0466964_0132154 | |||
| 1518 | Ga0466964_0154099 | |||
| 1519 | Ga0466968_0031952 | |||
| 1520 | Ga0466959_0000634 | |||
| 1521 | Ga0466959_0068203 | |||
| 1522 | Ga0495617_026277 | |||
| 1523 | Ga0495592_0046764 | |||
| 1524 | Ga0495592_0091211 | |||
| 1525 | Ga0495603_0000029 | |||
| 1526 | Ga0495603_0004729 | |||
| 1527 | Ga0495603_0060500 | |||
| 1528 | Ga0495590_0053297 | |||
| 1529 | Ga0495629_0000029 | |||
| 1530 | Ga0495629_0006648 | |||
| 1531 | Ga0495629_0395369 | |||
| 1532 | Ga0495638_0023790 | |||
| 1533 | Ga0495641_0004254 | |||
| 1534 | Ga0495641_0087336 | |||
| 1535 | Ga0495651_0004449 | |||
| 1536 | Ga0495651_0074068 | |||
| 1537 | Ga0495651_0074964 | |||
| 1538 | Ga0495651_0269635 | |||
| 1539 | Ga0495653_0160665 | |||
| 1540 | Ga0495653_0448239 | |||
| 1541 | Ga0495653_0522029 | |||
| 1542 | Ga0495650_0134364 | |||
| 1543 | Ga0495580_0000321 | |||
| 1544 | Ga0495580_0077289 | |||
| 1545 | Ga0495582_0000024 | |||
| 1546 | Ga0495605_0084523 | |||
| 1547 | Ga0495605_0143523 | |||
| 1548 | Ga0495605_0244164 | |||
| 1549 | Ga0495639_0000006 | |||
| 1550 | Ga0495662_0000068 | |||
| 1551 | Ga0495664_0002214 | |||
| 1552 | Ga0495664_0041194 | |||
| 1553 | Ga0495584_0106586 | |||
| 1554 | Ga0495585_0061660 | |||
| 1555 | Ga0495585_0125472 | |||
| 1556 | Ga0495594_0000170 | |||
| 1557 | Ga0495594_0086680 | |||
| 1558 | Ga0495607_0070149 | |||
| 1559 | Ga0495607_0161192 | |||
| 1560 | Ga0495607_0259189 | |||
| 1561 | Ga0495583_0111949 | |||
| 1562 | Ga0495583_0187388 | |||
| 1563 | Ga0495606_0025242 | |||
| 1564 | Ga0495606_0298667 | |||
| 1565 | Ga0495608_0009906 | |||
| 1566 | Ga0495608_0073325 | |||
| 1567 | Ga0495610_0017507 | |||
| 1568 | Ga0495616_0100955 | |||
| 1569 | Ga0495618_0060568 | |||
| 1570 | Ga0495618_0107227 | |||
| 1571 | Ga0495618_0115478 | |||
| 1572 | Ga0495620_0028647 | |||
| 1573 | Ga0495628_0031335 | |||
| 1574 | Ga0495628_0051848 | |||
| 1575 | Ga0495628_0079160 | |||
| 1576 | Ga0495631_0136597 | |||
| 1577 | Ga0495631_0159190 | |||
| 1578 | Ga0495643_0118196 | |||
| 1579 | Ga0495648_0002829 | |||
| 1580 | Ga0495648_0012566 | |||
| 1581 | Ga0495648_0087717 | |||
| 1582 | Ga0495648_0097974 | |||
| 1583 | Ga0495666_0003580 | |||
| 1584 | Ga0495652_0005458 | |||
| 1585 | Ga0495652_0005882 | |||
| 1586 | Ga0495652_0142977 | |||
| 1587 | Ga0495654_0134236 | |||
| 1588 | Ga0495665_0000158 | |||
| 1589 | Ga0495665_0067607 | |||
| 1590 | Ga0495640_0015043 | |||
| 1591 | Ga0495640_0028879 | |||
| 1592 | Ga0495640_0050475 | |||
| 1593 | Ga0495640_0220330 | |||
| 1594 | Ga0495587_0008038 | |||
| 1595 | Ga0495587_0157027 | |||
| 1596 | Ga0495598_0017810 | |||
| 1597 | Ga0495597_0223582 | |||
| 1598 | Ga0495645_0010468 | |||
| 1599 | Ga0495622_0018938 | |||
| 1600 | Ga0495622_0052375 | |||
| 1601 | Ga0495622_0072868 | |||
| 1602 | Ga0495667_0005992 | |||
| 1603 | Ga0495667_0008458 | |||
| 1604 | Ga0495667_0329276 | |||
| 1605 | Ga0495656_0058931 | |||
| 1606 | Ga0495656_0063515 | |||
| 1607 | Ga0495668_0044558 | |||
| 1608 | Ga0495668_0060956 | |||
| 1609 | Ga0495668_0153014 | |||
| 1610 | Ga0495668_0224752 | |||
| 1611 | Ga0495668_0425504 | |||
| 1612 | Ga0495668_0481706 | |||
| 1613 | Ga0495634_0000354 | |||
| 1614 | Ga0495634_0044463 | |||
| 1615 | Ga0495625_0108166 | |||
| 1616 | Ga0495625_0206080 | |||
| 1617 | Ga0495625_0235636 | |||
| 1618 | Ga0495625_0407981 | |||
| 1619 | Ga0495635_0000179 | |||
| 1620 | Ga0495635_0029811 | |||
| 1621 | Ga0495635_0039091 | |||
| 1622 | Ga0495659_0034268 | |||
| 1623 | Ga0495661_0012280 | |||
| 1624 | Ga0495588_0001137 | |||
| 1625 | Ga0495588_0030267 | |||
| 1626 | Ga0495588_0174778 | |||
| 1627 | Ga0495657_0002384 | |||
| 1628 | Ga0495599_0049233 | |||
| 1629 | Ga0495623_0013961 | |||
| 1630 | Ga0495623_0197544 | |||
| 1631 | Ga0495623_0202305 | |||
| 1632 | Ga0495623_0294893 | |||
| 1633 | Ga0495623_0338856 | |||
| 1634 | Ga0495646_0103280 | |||
| 1635 | Ga0495646_0390608 | |||
| 1636 | Ga0495647_0000068 | |||
| 1637 | Ga0495658_0000428 | |||
| 1638 | Ga0495669_0012020 | |||
| 1639 | Ga0495669_0149446 | |||
| 1640 | Ga0495613_0015638 | |||
| 1641 | Ga0495613_0056042 | |||
| 1642 | Ga0495613_0184516 | |||
| 1643 | Ga0495624_0010213 | |||
| 1644 | Ga0495624_0132283 | |||
| 1645 | Ga0495624_0314973 | |||
| 1646 | Ga0495624_0418542 | |||
| 1647 | Ga0495670_0012601 | |||
| 1648 | Ga0495671_0025533 | |||
| 1649 | Ga0495671_0069985 | |||
| 1650 | Ga0495671_0143422 | |||
| 1651 | Ga0495649_0037274 | |||
| 1652 | Ga0495649_0107005 | |||
| 1653 | Ga0495589_0228599 | |||
| 1654 | Ga0495600_0021305 | |||
| 1655 | Ga0495600_0047916 | |||
| 1656 | Ga0495660_0022925 | |||
| 1657 | Ga0495581_0000004 | |||
| 1658 | Ga0495581_0013854 | |||
| 1659 | Ga0495581_0047767 | |||
| 1660 | Ga0495604_0002741 | |||
| 1661 | Ga0495604_0145613 | |||
| 1662 | Ga0495604_0175414 | |||
| 1663 | Ga0495604_0280002 | |||
| 1664 | Ga0495636_0029585 | |||
| 1665 | Ga0495674_0000415 | |||
| 1666 | Ga0495674_0018174 | |||
| 1667 | Ga0495674_0163154 | |||
| 1668 | Ga0495674_0241600 | |||
| 1669 | Ga0495676_0050060 | |||
| 1670 | Ga0495676_0054205 | |||
| 1671 | Ga0495680_0001876 | |||
| 1672 | Ga0495680_0095170 | |||
| 1673 | Ga0495683_0128554 | |||
| 1674 | Ga0495683_0133044 | |||
| 1675 | Ga0495683_0197211 | |||
| 1676 | Ga0495675_0007387 | |||
| 1677 | Ga0495675_0047111 | |||
| 1678 | Ga0495677_0032399 | |||
| 1679 | Ga0495673_0006914 | |||
| 1680 | Ga0495673_0064011 | |||
| 1681 | Ga0495673_0174179 | |||
| 1682 | Ga0495684_0021327 | |||
| 1683 | Ga0495686_0116808 | |||
| 1684 | Ga0495686_0203948 | |||
| 1685 | Ga0495686_0208156 | |||
| 1686 | Ga0495686_0258037 | |||
| 1687 | Ga0495686_0271448 | |||
| 1688 | Ga0495593_0000198 | |||
| 1689 | Ga0495602_0043056 | |||
| 1690 | Ga0495602_0123078 | |||
| 1691 | Ga0495626_0108988 | |||
| 1692 | Ga0496100_0117445 | |||
| 1693 | Ga0496100_0126267 | |||
| 1694 | Ga0496100_0583701 | |||
| 1695 | Ga0496101_0130825 | |||
| 1696 | Ga0496101_0138158 | |||
| 1697 | Ga0496101_0223664 | |||
| 1698 | Ga0496101_0394043 | |||
| 1699 | Ga0496102_0020294 | |||
| 1700 | Ga0496102_0069096 | |||
| 1701 | Ga0496102_0155526 | |||
| 1702 | Ga0496102_0215653 | |||
| 1703 | Ga0496103_0160058 | |||
| 1704 | Ga0496103_0203537 | |||
| 1705 | Ga0496103_0366621 | |||
| 1706 | Ga0496104_0009070 | |||
| 1707 | Ga0496104_0018816 | |||
| 1708 | Ga0496104_0299737 | |||
| 1709 | Ga0496105_0036292 | |||
| 1710 | Ga0496105_0201087 | |||
| 1711 | Ga0496106_0013477 | |||
| 1712 | Ga0496106_0186460 | |||
| 1713 | Ga0496106_0321064 | |||
| 1714 | Ga0496106_0365234 | |||
| 1715 | Ga0496106_0611907 | |||
| 1716 | Ga0496107_0026324 | |||
| 1717 | Ga0496107_0066674 | |||
| 1718 | Ga0496107_0257753 | |||
| 1719 | Ga0496108_0007465 | |||
| 1720 | Ga0496108_0205236 | |||
| 1721 | Ga0496108_0406946 | |||
| 1722 | Ga0496109_0000609 | |||
| 1723 | Ga0496109_0600231 | |||
| 1724 | Ga0496110_0008924 | |||
| 1725 | Ga0496110_0051009 | |||
| 1726 | Ga0496110_0106590 | |||
| 1727 | Ga0496110_0188518 | |||
| 1728 | Ga0496111_0248764 | |||
| 1729 | Ga0496112_0002437 | |||
| 1730 | Ga0496112_0063507 | |||
| 1731 | Ga0496112_0158624 | |||
| 1732 | Ga0496112_0208189 | |||
| 1733 | Ga0496112_0240664 | |||
| 1734 | Ga0496112_0475644 | |||
| 1735 | Ga0496112_0541120 | |||
| 1736 | Ga0496112_0591305 | |||
| 1737 | Ga0496113_0023429 | |||
| 1738 | Ga0496113_0186428 | |||
| 1739 | Ga0496114_0052300 | |||
| 1740 | Ga0496114_0596401 | |||
| 1741 | Ga0496114_1155065 | |||
| 1742 | Ga0496115_0042539 | |||
| 1743 | Ga0496115_0148788 | |||
| 1744 | Ga0496115_0172020 | |||
| 1745 | Ga0496116_0000965 | |||
| 1746 | Ga0496117_0014058 | |||
| 1747 | Ga0496117_0034522 | |||
| 1748 | Ga0496117_0037972 | |||
| 1749 | Ga0496117_0169203 | |||
| 1750 | Ga0496117_0292105 | |||
| 1751 | Ga0496117_0330976 | |||
| 1752 | Ga0496118_0003027 | |||
| 1753 | Ga0496118_0010242 | |||
| 1754 | Ga0496118_0098113 | |||
| 1755 | Ga0496118_0136894 | |||
| 1756 | Ga0496118_0219477 | |||
| 1757 | Ga0496119_0065293 | |||
| 1758 | Ga0496119_0099673 | |||
| 1759 | Ga0496119_0200392 | |||
| 1760 | Ga0496120_0094039 | |||
| 1761 | Ga0496121_0001622 | |||
| 1762 | Ga0496121_0002689 | |||
| 1763 | Ga0496121_0009316 | |||
| 1764 | Ga0496121_0023791 | |||
| 1765 | Ga0496121_0047888 | |||
| 1766 | Ga0496121_0049586 | |||
| 1767 | Ga0496121_0107036 | |||
| 1768 | Ga0496121_0111268 | |||
| 1769 | Ga0496121_0189225 | |||
| 1770 | Ga0496121_0216276 | |||
| 1771 | Ga0496122_0081574 | |||
| 1772 | Ga0496122_0307107 | |||
| 1773 | Ga0496123_0049608 | |||
| 1774 | Ga0496124_0002957 | |||
| 1775 | Ga0496124_0245021 | |||
| 1776 | Ga0496124_0269286 | |||
| 1777 | Ga0496125_0001630 | |||
| 1778 | Ga0496125_0076533 | |||
| 1779 | Ga0496125_0094047 | |||
| 1780 | Ga0496125_0099905 | |||
| 1781 | Ga0496125_0135884 | |||
| 1782 | Ga0496126_0003472 | |||
| 1783 | Ga0496126_0003803 | |||
| 1784 | Ga0496126_0022661 | |||
| 1785 | Ga0496126_0033427 | |||
| 1786 | Ga0496126_0062063 | |||
| 1787 | Ga0496126_0074642 | |||
| 1788 | Ga0496126_0085033 | |||
| 1789 | Ga0496126_0128008 | |||
| 1790 | Ga0496126_0132568 | |||
| 1791 | Ga0496126_0138734 | |||
| 1792 | Ga0496126_0166265 | |||
| 1793 | Ga0496126_0176282 | |||
| 1794 | Ga0496126_0786760 | |||
| 1795 | Ga0495682_0139544 | |||
| 1796 | Ga0495682_0168838 | |||
| 1797 | Ga0501031_0003114 | |||
| 1798 | Ga0501031_0031671 | |||
| 1799 | Ga0501032_0000762 | |||
| 1800 | Ga0501032_0051974 | |||
| 1801 | Ga0501032_0094743 | |||
| 1802 | Ga0501033_0000136 | |||
| 1803 | Ga0501034_0000251 | |||
| 1804 | Ga0501036_0000036 | |||
| 1805 | Ga0501036_0236357 | |||
| 1806 | Ga0501036_0429974 | |||
| 1807 | Ga0501036_0721492 | |||
| 1808 | Ga0501037_0000867 | |||
| 1809 | Ga0501037_0506296 | |||
| 1810 | Ga0501038_0000428 | |||
| 1811 | Ga0501038_0132405 | |||
| 1812 | Ga0501039_0000273 | |||
| 1813 | Ga0501039_0050295 | |||
| 1814 | Ga0501039_0208823 | |||
| 1815 | Ga0501042_0010927 | |||
| 1816 | Ga0501043_0000165 | |||
| 1817 | Ga0501043_0656988 | |||
| 1818 | Ga0501046_0000839 | |||
| 1819 | Ga0501046_0235849 | |||
| 1820 | Ga0501047_0000340 | |||
| 1821 | Ga0501047_0041364 | |||
| 1822 | Ga0501047_0313117 | |||
| 1823 | Ga0501048_0001309 | |||
| 1824 | Ga0501048_0127719 | |||
| 1825 | Ga0501067_0000457 | |||
| 1826 | Ga0501067_0013941 | |||
| 1827 | Ga0501067_0395309 | |||
| 1828 | Ga0501068_0000839 | |||
| 1829 | Ga0501068_0136215 | |||
| 1830 | Ga0501069_0008491 | |||
| 1831 | Ga0501070_0000971 | |||
| 1832 | Ga0501071_0088114 | |||
| 1833 | Ga0501071_0134855 | |||
| 1834 | Ga0501072_0003301 | |||
| 1835 | Ga0501072_0422464 | |||
| 1836 | Ga0501072_0434625 | |||
| 1837 | Ga0501073_0000037 | |||
| 1838 | Ga0501073_0074644 | |||
| 1839 | Ga0501074_0037310 | |||
| 1840 | Ga0501076_0383952 | |||
| 1841 | Ga0501076_0514584 | |||
| 1842 | Ga0501077_0175557 | |||
| 1843 | Ga0501079_0002302 | |||
| 1844 | Ga0501080_0006603 | |||
| 1845 | Ga0501080_1011448 | |||
| 1846 | Ga0501083_0001812 | |||
| 1847 | Ga0501035_0000142 | |||
| 1848 | Ga0501044_0000414 | |||
| 1849 | Ga0501044_0021563 | |||
| 1850 | Ga0501044_0467028 | |||
| 1851 | Ga0501045_0002539 | |||
| 1852 | Ga0501045_0115652 | |||
| 1853 | nmdc:mga03n38_20242_c1 | |||
| 1854 | nmdc:mga03n38_225627_c1 | |||
| 1855 | nmdc:mga03n38_336891_c1 | |||
| 1856 | nmdc:mga00v17_266897_c1 | |||
| 1857 | nmdc:mga00v17_31303_c1 | |||
| 1858 | nmdc:mga0yw44_183313_c1 | |||
| 1859 | nmdc:mga0yw44_203975_c1 | |||
| 1860 | nmdc:mga0yw44_370018_c1 | |||
| 1861 | nmdc:mga0yw44_38229_c1 | |||
| 1862 | nmdc:mga0yw44_38444_c1 | |||
| 1863 | nmdc:mga0k408_135340_c1 | |||
| 1864 | nmdc:mga0k408_34806_c1 | |||
| 1865 | nmdc:mga06z11_27972_c1 | |||
| 1866 | nmdc:mga06z11_41041_c1 | |||
| 1867 | nmdc:mga06z11_61431_c1 | |||
| 1868 | nmdc:mga06z11_72222_c1 | |||
| 1869 | nmdc:mga06z11_84378_c1 | |||
| 1870 | nmdc:mga04h51_80619_c1 | |||
| 1871 | nmdc:mga07m45_142421_c1 | |||
| 1872 | nmdc:mga07m45_147292_c1 | |||
| 1873 | nmdc:mga05p37_811294_c1 | |||
| 1874 | nmdc:mga08y16_40533_c1 | |||
| 1875 | nmdc:mga0n895_15181_c1 | |||
| 1876 | nmdc:mga0n895_161206_c1 | |||
| 1877 | nmdc:mga0n895_247010_c1 | |||
| 1878 | nmdc:mga0rr50_88622_c1 | |||
| 1879 | nmdc:mga08x19_275118_c1 | |||
| 1880 | nmdc:mga0sz30_1774_c1 | |||
| 1881 | nmdc:mga0sz30_32158_c1 | |||
| 1882 | nmdc:mga0sz30_73654_c1 | |||
| 1883 | Ga0495601_0029491 | |||
| 1884 | Ga0495601_0221445 | |||
| 1885 | Ga0500635_0140244 | |||
| 1886 | Ga0495595_0034044 | |||
| 1887 | Ga0495619_0149002 | |||
| 1888 | Ga0495619_0283258 | |||
| 1889 | Ga0500578_0040493 | |||
| 1890 | Ga0500578_0308065 | |||
| 1891 | Ga0500578_0413856 | |||
| 1892 | Ga0500643_000048 | |||
| 1893 | Ga0500643_012220 | |||
| 1894 | Ga0500581_167153 | |||
| 1895 | Ga0500647_0003150 | |||
| 1896 | Ga0500583_0114375 | |||
| 1897 | Ga0500651_0016774 | |||
| 1898 | Ga0500651_0080962 | |||
| 1899 | Ga0500651_0167795 | |||
| 1900 | Ga0500566_0000126 | |||
| 1901 | Ga0500566_0001615 | |||
| 1902 | Ga0500566_0002605 | |||
| 1903 | Ga0500566_0032785 | |||
| 1904 | Ga0500640_003090 | |||
| 1905 | Ga0500641_0005231 | |||
| 1906 | Ga0500641_0005276 | |||
| 1907 | Ga0500648_072568 | |||
| 1908 | Ga0500650_0002007 | |||
| 1909 | Ga0500556_0137217 | |||
| 1910 | Ga0500556_0207441 | |||
| 1911 | Ga0500557_119428 | |||
| 1912 | Ga0500562_040306 | |||
| 1913 | Ga0500562_044557 | |||
| 1914 | Ga0500569_010177 | |||
| 1915 | Ga0500569_017337 | |||
| 1916 | Ga0500572_000152 | |||
| 1917 | Ga0500572_003010 | |||
| 1918 | Ga0500594_0008171 | |||
| 1919 | Ga0500595_000333 | |||
| 1920 | Ga0500595_000497 | |||
| 1921 | Ga0500595_010458 | |||
| 1922 | Ga0500595_030978 | |||
| 1923 | Ga0500607_146783 | |||
| 1924 | Ga0500614_001649 | |||
| 1925 | Ga0500618_013821 | |||
| 1926 | Ga0500642_0000015 | |||
| 1927 | Ga0500642_0005741 | |||
| 1928 | Ga0500642_0123977 | |||
| 1929 | Ga0500652_010728 | |||
| 1930 | Ga0500652_188156 | |||
| 1931 | Ga0500658_0024606 | |||
| 1932 | Ga0500658_0153129 | |||
| 1933 | Ga0500559_0000230 | |||
| 1934 | Ga0500559_0001714 | |||
| 1935 | Ga0500559_0052763 | |||
| 1936 | Ga0500559_0074726 | |||
| 1937 | Ga0500564_052876 | |||
| 1938 | Ga0500568_0000536 | |||
| 1939 | Ga0500568_0007618 | |||
| 1940 | Ga0500568_0028888 | |||
| 1941 | Ga0500568_0052623 | |||
| 1942 | Ga0500577_0092611 | |||
| 1943 | Ga0500588_0078594 | |||
| 1944 | Ga0500589_138875 | |||
| 1945 | Ga0500590_080589 | |||
| 1946 | Ga0500603_000304 | |||
| 1947 | Ga0500603_004209 | |||
| 1948 | Ga0500604_0055704 | |||
| 1949 | Ga0500616_0000033 | |||
| 1950 | Ga0500616_0147958 | |||
| 1951 | Ga0500622_0013268 | |||
| 1952 | Ga0500622_0061141 | |||
| 1953 | Ga0500622_0254306 | |||
| 1954 | Ga0500627_0027552 | |||
| 1955 | Ga0500627_0072823 | |||
| 1956 | Ga0500630_002602 | |||
| 1957 | Ga0500634_0050414 | |||
| 1958 | Ga0500634_0097771 | |||
| 1959 | Ga0500638_005288 | |||
| 1960 | Ga0500638_048231 | |||
| 1961 | Ga0500639_000039 | |||
| 1962 | Ga0500636_0015308 | |||
| 1963 | Ga0500636_0033475 | |||
| 1964 | Ga0500636_0146675 | |||
| 1965 | Ga0500637_0000060 | |||
| 1966 | Ga0500576_016710 | |||
| 1967 | Ga0500576_118437 | |||
| 1968 | Ga0500645_113256 | |||
| 1969 | Ga0500552_000562 | |||
| 1970 | Ga0500596_001647 | |||
| 1971 | Ga0500599_000986 | |||
| 1972 | Ga0500601_000280 | |||
| 1973 | Ga0501084_0005116 | |||
| 1974 | Ga0501084_0301392 | |||
| 1975 | Ga0500661_031303 | |||
| 1976 | Ga0501082_0004333 | |||
| 1977 | Ga0501082_0134273 | |||
| 1978 | Ga0530510_0014062 | |||
| 1979 | Ga0530510_0569704 | |||
| 1980 | 2644290519 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h00-assembly1.cif.gz_A-2 | crystal structure of human pyridoxine 5-phophate oxidase, r116q variant | 0.801 | 55 | 135 |
| 2htd-assembly1.cif.gz_A | crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution | 0.7771 | 42 | 163 |
| 7kq2-assembly1.cif.gz_A | 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 | 0.7537 | 43 | 166 |
| 7kpz-assembly1.cif.gz_A | 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 | 0.7531 | 43 | 160 |
| 3db0-assembly1.cif.gz_A | crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution | 0.7465 | 45 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6h00A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.801 | 55 | 135 | 2.30.110.10 |
| 2htdA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7816 | 42 | 163 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7633 | 43 | 167 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.752 | 43 | 167 | 2.30.110.10 |
| 1wv4B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7462 | 55 | 160 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8FH70-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.9273 | 40 | 178 |
|
| AF-A0A529AB23-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9219 | 38 | 169 |
|
| AF-A0A503EBD2-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9218 | 38 | 169 |
|
| AF-A0A4R4ZX25-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9217 | 39 | 169 |
|
| AF-L0KGM4-F1-model_v4 | PPOX class probable FMN-dependent enzyme, DR_2398 family | 0.9217 | 38 | 169 |
|