F487601

General Info

Members Datasets Scaffolds Average Seq Length
990 454 1980 211

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100929593|Ga0070714_1009295931
Length 216
Sequence MSDLTSDPLSDTTAYSSDVGFTPTVKAIQSRKGSREAYARMEEKGGWRTGIDNDLAAFIGEQTSFFLATASAAGQPYIQHRGGPAGFLKVLDNTTLAFADFSGNRQFITQGNLSENPKAYIFLLDYVHRRRVKIWGEAKVIEDDPALVAALMPRGYKARPEQAIVFKVAAWDTNCPQHIPQKLDVADVAAVINARDQRIAELEAELAELKKHLTAV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
80 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
178 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
410 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
411 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
412 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
417 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
421 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
422 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
423 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
424 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
425 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
428 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
429 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
430 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
431 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
432 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
433 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
438 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
439 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
440 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
441 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
444 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
445 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
446 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
447 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
448 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
449 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
452 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
453 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
454 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.1
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.57
Nodule 1.21
Rhizoplane 5.56
Rhizosphere 68.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100929593 3300005435 Bacteria 845
2 JGI25406J46586_10000233 3300003203 Bacteria 24719
3 JGI25406J46586_10006333 3300003203 Bacteria 5460
4 JGI25153J46596_10006692 3300003215 Bacteria 5794
5 JGI25153J46596_10040042 3300003215 Bacteria 1458
6 rootH2_10011831 3300003320 Bacteria 2405
7 JGI25404J52841_10020882 3300003659 Bacteria 1418
8 JGI25404J52841_10067893 3300003659 Bacteria 746
9 Ga0055526_1028100 3300003771 Bacteria 1712
10 Ga0055531_10005040 3300003794 Bacteria 7829
11 Ga0055531_10083370 3300003794 Bacteria 697
12 Ga0070658_10525619 3300005327 Bacteria 1023
13 Ga0070670_100182004 3300005331 Bacteria 1825
14 Ga0068869_100030464 3300005334 Bacteria 3787
15 Ga0068869_100087498 3300005334 Bacteria 2337
16 Ga0068869_100160324 3300005334 Bacteria 1751
17 Ga0068869_100382431 3300005334 Bacteria 1154
18 Ga0070666_10273787 3300005335 Bacteria 1199
19 Ga0070680_100013830 3300005336 Bacteria 6296
20 Ga0070680_100196494 3300005336 Bacteria 1701
21 Ga0070682_100027255 3300005337 Bacteria 3428
22 Ga0070682_100194300 3300005337 Bacteria 1427
23 Ga0068868_100050101 3300005338 Bacteria 3278
24 Ga0068868_100338502 3300005338 Bacteria 1286
25 Ga0068868_100444242 3300005338 Bacteria 1127
26 Ga0068868_100560625 3300005338 Bacteria 1008
27 Ga0070660_100003692 3300005339 Bacteria 10562
28 Ga0070660_100129050 3300005339 Bacteria 2022
29 Ga0070660_100333322 3300005339 Bacteria 1248
30 Ga0070689_100099415 3300005340 Bacteria 2302
31 Ga0070687_100361678 3300005343 Bacteria 940
32 Ga0070661_100055967 3300005344 Bacteria 2888
33 Ga0070661_100278907 3300005344 Bacteria 1296
34 Ga0070661_100461411 3300005344 Bacteria 1012
35 Ga0070668_100024341 3300005347 Bacteria 4586
36 Ga0070668_100059725 3300005347 Bacteria 2951
37 Ga0070668_100091702 3300005347 Bacteria 2396
38 Ga0070668_100127388 3300005347 Bacteria 2040
39 Ga0070669_100351449 3300005353 Bacteria 1197
40 Ga0070669_100433510 3300005353 Bacteria 1081
41 Ga0070675_100419897 3300005354 Bacteria 1196
42 Ga0070675_100848847 3300005354 Bacteria 836
43 Ga0070674_100231814 3300005356 Bacteria 1441
44 Ga0070674_100373942 3300005356 Bacteria 1157
45 Ga0070673_100103078 3300005364 Bacteria 2353
46 Ga0070688_100472045 3300005365 Bacteria 942
47 Ga0070659_100077774 3300005366 Bacteria 2646
48 Ga0070659_100189719 3300005366 Bacteria 1689
49 Ga0070709_10036585 3300005434 Bacteria 2992
50 Ga0070714_100015842 3300005435 Bacteria 6077
51 Ga0070714_100067089 3300005435 Bacteria 3093
52 Ga0070713_100269513 3300005436 Bacteria 1559
53 Ga0070713_100680283 3300005436 Bacteria 981
54 Ga0070701_10199112 3300005438 Bacteria 1183
55 Ga0070711_100001130 3300005439 Bacteria 14272
56 Ga0070705_100707547 3300005440 Bacteria 792
57 Ga0070694_100163094 3300005444 Bacteria 1637
58 Ga0070694_100490103 3300005444 Bacteria 976
59 Ga0070708_100105209 3300005445 Bacteria 2589
60 Ga0070663_100032985 3300005455 Bacteria 3574
61 Ga0070663_100057207 3300005455 Bacteria 2797
62 Ga0070663_100292428 3300005455 Bacteria 1301
63 Ga0070663_100411763 3300005455 Bacteria 1107
64 Ga0070663_100417055 3300005455 Bacteria 1100
65 Ga0070663_100541761 3300005455 Bacteria 972
66 Ga0070678_100034642 3300005456 Bacteria 3518
67 Ga0070678_100999680 3300005456 Bacteria 769
68 Ga0070662_100091189 3300005457 Bacteria 2288
69 Ga0070681_10006411 3300005458 Bacteria 11447
70 Ga0070681_10007888 3300005458 Bacteria 10418
71 Ga0070685_10055262 3300005466 Bacteria 2306
72 Ga0070685_10079531 3300005466 Bacteria 1962
73 Ga0070685_10209492 3300005466 Bacteria 1271
74 Ga0070698_100400542 3300005471 Bacteria 1306
75 Ga0070698_100465666 3300005471 Bacteria 1200
76 Ga0070699_100796420 3300005518 Bacteria 865
77 Ga0070679_100018490 3300005530 Bacteria 6764
78 Ga0070679_100074252 3300005530 Bacteria 3391
79 Ga0070679_100084060 3300005530 Bacteria 3171
80 Ga0070679_100229905 3300005530 Bacteria 1814
81 Ga0070697_100054323 3300005536 Bacteria 3256
82 Ga0068853_100009612 3300005539 Bacteria 7791
83 Ga0068853_100422126 3300005539 Bacteria 1251
84 Ga0068853_100925826 3300005539 Bacteria 838
85 Ga0070686_100726033 3300005544 Bacteria 794
86 Ga0070693_100056138 3300005547 Bacteria 2272
87 Ga0070693_100210058 3300005547 Bacteria 1269
88 Ga0070693_100606723 3300005547 Bacteria 791
89 Ga0070665_100038699 3300005548 Bacteria 4794
90 Ga0070665_100060150 3300005548 Bacteria 3808
91 Ga0070665_100233037 3300005548 Bacteria 1841
92 Ga0070665_100355551 3300005548 Bacteria 1470
93 Ga0070665_100373554 3300005548 Bacteria 1433
94 Ga0070665_100386166 3300005548 Bacteria 1408
95 Ga0070665_100489586 3300005548 Bacteria 1241
96 Ga0070665_100519222 3300005548 Bacteria 1203
97 Ga0068855_100027307 3300005563 Bacteria 6830
98 Ga0068855_100160273 3300005563 Bacteria 2554
99 Ga0068855_100215023 3300005563 Bacteria 2158
100 Ga0068855_100249115 3300005563 Bacteria 1982
101 Ga0068855_100485141 3300005563 Bacteria 1345
102 Ga0068857_100013087 3300005577 Bacteria 7230
103 Ga0068857_100280101 3300005577 Bacteria 1534
104 Ga0068854_100090808 3300005578 Bacteria 2272
105 Ga0068856_100342777 3300005614 Bacteria 1513
106 Ga0068852_100103072 3300005616 Bacteria 2580
107 Ga0068852_100105170 3300005616 Bacteria 2556
108 Ga0068852_100497397 3300005616 Bacteria 1213
109 Ga0068859_100053072 3300005617 Bacteria 4076
110 Ga0068859_100146181 3300005617 Bacteria 2439
111 Ga0068859_101318636 3300005617 Bacteria 796
112 Ga0068864_100124538 3300005618 Bacteria 2308
113 Ga0068864_100846275 3300005618 Bacteria 901
114 Ga0068866_10152765 3300005718 Bacteria 1338
115 Ga0068861_100040899 3300005719 Bacteria 3469
116 Ga0068861_100122230 3300005719 Bacteria 2102
117 Ga0068870_10218316 3300005840 Bacteria 1166
118 Ga0068863_100550995 3300005841 Bacteria 1139
119 Ga0068858_100551252 3300005842 Bacteria 1116
120 Ga0068858_100642741 3300005842 Bacteria 1031
121 Ga0068858_100694274 3300005842 Bacteria 990
122 Ga0068858_101057945 3300005842 Bacteria 796
123 Ga0068860_100000313 3300005843 Bacteria 66545
124 Ga0068862_100221922 3300005844 Bacteria 1712
125 Ga0068862_101092449 3300005844 Bacteria 792
126 Ga0081455_10005731 3300005937 Bacteria 13539
127 Ga0081455_10029773 3300005937 Bacteria 4973
128 Ga0081455_10099630 3300005937 Bacteria 2337
129 Ga0081455_10109419 3300005937 Bacteria 2199
130 Ga0081540_1007566 3300005983 Bacteria 7722
131 Ga0081540_1008557 3300005983 Bacteria 7138
132 Ga0081540_1011157 3300005983 Bacteria 6030
133 Ga0081540_1012286 3300005983 Bacteria 5653
134 Ga0081540_1015476 3300005983 Bacteria 4830
135 Ga0081540_1016697 3300005983 Bacteria 4578
136 Ga0081540_1018292 3300005983 Bacteria 4305
137 Ga0081540_1035420 3300005983 Bacteria 2677
138 Ga0081540_1044694 3300005983 Bacteria 2258
139 Ga0081540_1059902 3300005983 Bacteria 1825
140 Ga0081540_1071540 3300005983 Bacteria 1602
141 Ga0081539_10000157 3300005985 Bacteria 158278
142 Ga0081539_10002599 3300005985 Bacteria 24763
143 Ga0081539_10106751 3300005985 Bacteria 1417
144 Ga0070717_10034976 3300006028 Bacteria 4063
145 Ga0070717_10315909 3300006028 Bacteria 1391
146 Ga0070717_10339131 3300006028 Bacteria 1342
147 Ga0075365_10068327 3300006038 Bacteria 2387
148 Ga0075365_10093827 3300006038 Bacteria 2048
149 Ga0075365_10115880 3300006038 Bacteria 1845
150 Ga0075365_10401340 3300006038 Bacteria 967
151 Ga0075365_10766777 3300006038 Bacteria 681
152 Ga0075368_10002578 3300006042 Bacteria 5945
153 Ga0075368_10040110 3300006042 Bacteria 1838
154 Ga0075368_10044493 3300006042 Bacteria 1752
155 Ga0075363_100003641 3300006048 Bacteria 6610
156 Ga0075363_100012959 3300006048 Bacteria 4027
157 Ga0075363_100091186 3300006048 Bacteria 1677
158 Ga0075363_100128984 3300006048 Bacteria 1417
159 Ga0075363_100245248 3300006048 Bacteria 1031
160 Ga0075364_10012640 3300006051 Bacteria 5171
161 Ga0075364_10076141 3300006051 Bacteria 2214
162 Ga0075364_10084435 3300006051 Bacteria 2103
163 Ga0075364_10383488 3300006051 Bacteria 959
164 Ga0075364_10406694 3300006051 Bacteria 929
165 Ga0070716_100156175 3300006173 Bacteria 1473
166 Ga0075367_10008296 3300006178 Bacteria 5379
167 Ga0075367_10160099 3300006178 Bacteria 1399
168 Ga0075367_10167738 3300006178 Bacteria 1367
169 Ga0075367_10267582 3300006178 Bacteria 1073
170 Ga0075369_10031533 3300006186 Bacteria 2238
171 Ga0075369_10039347 3300006186 Bacteria 2019
172 Ga0075369_10080100 3300006186 Bacteria 1447
173 Ga0075369_10139008 3300006186 Bacteria 1107
174 Ga0075366_10068130 3300006195 Bacteria 2118
175 Ga0075366_10112181 3300006195 Bacteria 1641
176 Ga0097621_100748026 3300006237 Bacteria 903
177 Ga0075370_10010672 3300006353 Bacteria 4812
178 Ga0075370_10264863 3300006353 Bacteria 1020
179 Ga0068871_100573485 3300006358 Bacteria 1024
180 Ga0075434_100023401 3300006871 Bacteria 6020
181 Ga0075434_100200870 3300006871 Bacteria 2013
182 Ga0075434_100310997 3300006871 Bacteria 1596
183 Ga0075434_100400957 3300006871 Bacteria 1393
184 Ga0068865_100598496 3300006881 Bacteria 931
185 Ga0075436_100773008 3300006914 Bacteria 714
186 Ga0097620_100053073 3300006931 Bacteria 4076
187 Ga0097620_100146183 3300006931 Bacteria 2439
188 Ga0097620_101318534 3300006931 Bacteria 796
189 Ga0099824_1018691 3300006942 Bacteria 5613
190 Ga0099822_1000541 3300006943 Bacteria 35996
191 Ga0099822_1077802 3300006943 Bacteria 845
192 Ga0075435_100087942 3300007076 Bacteria 2560
193 Ga0099794_10026556 3300007265 Bacteria 2678
194 Ga0099794_10035471 3300007265 Bacteria 2354
195 Ga0099794_10216336 3300007265 Bacteria 983
196 Ga0099795_10027564 3300007788 Bacteria 1923
197 Ga0099795_10037370 3300007788 Bacteria 1708
198 Ga0105240_10002295 3300009093 Bacteria 30967
199 Ga0105240_10033307 3300009093 Bacteria 6659
200 Ga0105240_10303050 3300009093 Bacteria 1827
201 Ga0111539_10490578 3300009094 Bacteria 1431
202 Ga0111539_11329697 3300009094 Bacteria 834
203 Ga0105245_10406274 3300009098 Bacteria 1362
204 Ga0105247_10035521 3300009101 Bacteria 3038
205 Ga0105247_10121903 3300009101 Bacteria 1690
206 Ga0105243_10036778 3300009148 Bacteria 3802
207 Ga0105243_10208884 3300009148 Bacteria 1718
208 Ga0105241_10072901 3300009174 Bacteria 2670
209 Ga0105241_10075194 3300009174 Bacteria 2632
210 Ga0105241_10479912 3300009174 Bacteria 1105
211 Ga0105242_10266630 3300009176 Bacteria 1549
212 Ga0105248_10231301 3300009177 Bacteria 2081
213 Ga0105237_10002301 3300009545 Bacteria 23744
214 Ga0105237_10066311 3300009545 Bacteria 3605
215 Ga0105237_10314760 3300009545 Bacteria 1568
216 Ga0105238_10006268 3300009551 Bacteria 11820
217 Ga0105238_10022426 3300009551 Bacteria 6435
218 Ga0105238_10461190 3300009551 Bacteria 1268
219 Ga0105249_10333593 3300009553 Bacteria 1531
220 Ga0105249_10493636 3300009553 Bacteria 1268
221 Ga0105249_10545568 3300009553 Bacteria 1209
222 Ga0099796_10092218 3300010159 Bacteria 1128
223 Ga0105239_10017503 3300010375 Bacteria 7926
224 Ga0105239_10035625 3300010375 Bacteria 5465
225 Ga0105239_10066921 3300010375 Bacteria 3946
226 Ga0105239_10189208 3300010375 Bacteria 2304
227 Ga0105239_10191172 3300010375 Bacteria 2291
228 Ga0105239_10605283 3300010375 Bacteria 1250
229 Ga0105239_10650584 3300010375 Bacteria 1204
230 Ga0105239_10694815 3300010375 Bacteria 1163
231 Ga0105239_10831580 3300010375 Bacteria 1058
232 Ga0105239_10850948 3300010375 Bacteria 1046
233 Ga0105246_10035946 3300011119 Bacteria 3315
234 Ga0105246_10095428 3300011119 Bacteria 2153
235 Ga0105246_10264649 3300011119 Bacteria 1371
236 Ga0157371_10031405 3300013102 Bacteria 3826
237 Ga0157370_10075424 3300013104 Bacteria 3179
238 Ga0157370_10492533 3300013104 Bacteria 1126
239 Ga0157369_10018692 3300013105 Bacteria 7770
240 Ga0157374_10131548 3300013296 Bacteria 2422
241 Ga0157378_10008170 3300013297 Bacteria 9132
242 Ga0163162_10026136 3300013306 Bacteria 5769
243 Ga0163162_10127713 3300013306 Bacteria 2650
244 Ga0163162_10232436 3300013306 Bacteria 1974
245 Ga0163162_10485689 3300013306 Bacteria 1366
246 Ga0163162_10834378 3300013306 Bacteria 1038
247 Ga0157372_10075935 3300013307 Bacteria 3793
248 Ga0157372_11545435 3300013307 Bacteria 764
249 Ga0157375_10537241 3300013308 Bacteria 1332
250 Ga0163163_10007500 3300014325 Bacteria 9629
251 Ga0163163_10092490 3300014325 Bacteria 3040
252 Ga0163163_10490891 3300014325 Bacteria 1289
253 Ga0157380_10047597 3300014326 Bacteria 3374
254 Ga0157379_10060314 3300014968 Bacteria 3391
255 Ga0157379_10219909 3300014968 Bacteria 1721
256 Ga0157379_11094465 3300014968 Bacteria 763
257 Ga0157376_10127798 3300014969 Bacteria 2263
258 Ga0206356_10672806 3300020070 Bacteria 1282
259 Ga0209563_102736 3300025230 Bacteria 3871
260 Ga0209563_119376 3300025230 Bacteria 781
261 Ga0207425_1019877 3300025245 Bacteria 1442
262 Ga0209148_1000267 3300025254 Bacteria 81839
263 Ga0209233_1002344 3300025261 Bacteria 7057
264 Ga0209233_1018924 3300025261 Bacteria 1840
265 Ga0209233_1050685 3300025261 Bacteria 846
266 Ga0209455_1002785 3300025272 Bacteria 6531
267 Ga0209564_1021745 3300025295 Bacteria 2294
268 Ga0209564_1022449 3300025295 Bacteria 2230
269 Ga0209758_1000015 3300025297 Bacteria 851943
270 Ga0209758_1000711 3300025297 Bacteria 49164
271 Ga0209758_1001094 3300025297 Bacteria 35071
272 Ga0209758_1001864 3300025297 Bacteria 23116
273 Ga0209758_1031488 3300025297 Bacteria 2174
274 Ga0209758_1048288 3300025297 Bacteria 1514
275 Ga0209256_1004771 3300025299 Bacteria 8264
276 Ga0207426_1003610 3300025302 Bacteria 8206
277 Ga0209257_1001688 3300025304 Bacteria 24840
278 Ga0209257_1035198 3300025304 Bacteria 1552
279 Ga0207656_10018079 3300025321 Bacteria 2769
280 Ga0207710_10028664 3300025900 Bacteria 2418
281 Ga0207710_10288533 3300025900 Bacteria 827
282 Ga0207688_10054745 3300025901 Bacteria 2238
283 Ga0207688_10092165 3300025901 Bacteria 1741
284 Ga0207680_10568610 3300025903 Bacteria 810
285 Ga0207647_10009749 3300025904 Bacteria 6815
286 Ga0207647_10307119 3300025904 Bacteria 903
287 Ga0207699_10144934 3300025906 Bacteria 1565
288 Ga0207645_10063010 3300025907 Bacteria 2369
289 Ga0207645_10170646 3300025907 Bacteria 1426
290 Ga0207645_10374619 3300025907 Bacteria 955
291 Ga0207643_10189637 3300025908 Bacteria 1247
292 Ga0207705_10238678 3300025909 Bacteria 1384
293 Ga0207684_10618921 3300025910 Bacteria 924
294 Ga0207654_10011023 3300025911 Bacteria 4600
295 Ga0207654_10028697 3300025911 Bacteria 3036
296 Ga0207654_10045094 3300025911 Bacteria 2508
297 Ga0207654_10523149 3300025911 Bacteria 840
298 Ga0207707_10000143 3300025912 Bacteria 74226
299 Ga0207707_10014431 3300025912 Bacteria 6882
300 Ga0207707_10032951 3300025912 Bacteria 4536
301 Ga0207695_10000059 3300025913 Bacteria 363920
302 Ga0207695_10093922 3300025913 Bacteria 3008
303 Ga0207695_10179409 3300025913 Bacteria 2039
304 Ga0207695_10895162 3300025913 Bacteria 767
305 Ga0207671_10001109 3300025914 Bacteria 32478
306 Ga0207671_10130576 3300025914 Bacteria 1928
307 Ga0207671_10538603 3300025914 Bacteria 931
308 Ga0207693_10059333 3300025915 Bacteria 2997
309 Ga0207693_10184703 3300025915 Bacteria 1641
310 Ga0207693_10450114 3300025915 Bacteria 1006
311 Ga0207663_10021983 3300025916 Bacteria 3639
312 Ga0207660_10007904 3300025917 Bacteria 6882
313 Ga0207660_10079595 3300025917 Bacteria 2404
314 Ga0207660_10279084 3300025917 Bacteria 1325
315 Ga0207657_10005482 3300025919 Bacteria 13248
316 Ga0207657_10074276 3300025919 Bacteria 2871
317 Ga0207657_10251739 3300025919 Bacteria 1408
318 Ga0207657_10436016 3300025919 Bacteria 1029
319 Ga0207652_10024703 3300025921 Bacteria 4987
320 Ga0207652_10027515 3300025921 Bacteria 4738
321 Ga0207652_10045150 3300025921 Bacteria 3755
322 Ga0207681_10330550 3300025923 Bacteria 1215
323 Ga0207694_10110472 3300025924 Bacteria 2187
324 Ga0207650_10179960 3300025925 Bacteria 1684
325 Ga0207659_10221682 3300025926 Bacteria 1521
326 Ga0207687_10085748 3300025927 Bacteria 2285
327 Ga0207687_10298816 3300025927 Bacteria 1296
328 Ga0207700_10206963 3300025928 Bacteria 1656
329 Ga0207700_10272732 3300025928 Bacteria 1452
330 Ga0207664_10243512 3300025929 Bacteria 1567
331 Ga0207664_10282814 3300025929 Bacteria 1456
332 Ga0207664_10462245 3300025929 Bacteria 1133
333 Ga0207664_10542191 3300025929 Bacteria 1043
334 Ga0207664_10609971 3300025929 Bacteria 980
335 Ga0207644_10216876 3300025931 Bacteria 1515
336 Ga0207644_10492535 3300025931 Bacteria 1010
337 Ga0207690_10250658 3300025932 Bacteria 1367
338 Ga0207706_10107908 3300025933 Bacteria 2450
339 Ga0207706_10314047 3300025933 Bacteria 1364
340 Ga0207706_10470633 3300025933 Bacteria 1086
341 Ga0207686_10237709 3300025934 Bacteria 1324
342 Ga0207686_10238933 3300025934 Bacteria 1321
343 Ga0207709_10010853 3300025935 Bacteria 5018
344 Ga0207709_10615410 3300025935 Bacteria 861
345 Ga0207670_10053964 3300025936 Bacteria 2710
346 Ga0207670_10230196 3300025936 Bacteria 1423
347 Ga0207669_10168381 3300025937 Bacteria 1556
348 Ga0207665_10501756 3300025939 Bacteria 937
349 Ga0207691_10259003 3300025940 Bacteria 1500
350 Ga0207691_10330741 3300025940 Bacteria 1306
351 Ga0207711_10112183 3300025941 Bacteria 2426
352 Ga0207711_10120999 3300025941 Bacteria 2337
353 Ga0207689_10052561 3300025942 Bacteria 3357
354 Ga0207689_10059101 3300025942 Bacteria 3154
355 Ga0207689_10371601 3300025942 Bacteria 1190
356 Ga0207661_10068018 3300025944 Bacteria 2899
357 Ga0207667_10020014 3300025949 Bacteria 7455
358 Ga0207667_10020505 3300025949 Bacteria 7348
359 Ga0207667_10154463 3300025949 Bacteria 2362
360 Ga0207667_10222922 3300025949 Bacteria 1932
361 Ga0207667_10779988 3300025949 Bacteria 954
362 Ga0207667_11119903 3300025949 Bacteria 770
363 Ga0207651_10572263 3300025960 Bacteria 985
364 Ga0207712_10039860 3300025961 Bacteria 3221
365 Ga0207712_10203648 3300025961 Bacteria 1571
366 Ga0207712_10770662 3300025961 Bacteria 844
367 Ga0207668_10061758 3300025972 Bacteria 2636
368 Ga0207668_10213756 3300025972 Bacteria 1544
369 Ga0207668_10674564 3300025972 Bacteria 906
370 Ga0207640_10342888 3300025981 Bacteria 1197
371 Ga0207658_10869302 3300025986 Bacteria 820
372 Ga0207677_10099933 3300026023 Bacteria 2132
373 Ga0207703_10045007 3300026035 Bacteria 3549
374 Ga0207703_10429822 3300026035 Bacteria 1230
375 Ga0207703_10539958 3300026035 Bacteria 1098
376 Ga0207703_10593231 3300026035 Bacteria 1047
377 Ga0207703_11263153 3300026035 Bacteria 710
378 Ga0207639_10076603 3300026041 Bacteria 2634
379 Ga0207639_10087416 3300026041 Bacteria 2485
380 Ga0207678_10030059 3300026067 Bacteria 4743
381 Ga0207678_10049937 3300026067 Bacteria 3615
382 Ga0207678_10067196 3300026067 Bacteria 3077
383 Ga0207678_10069172 3300026067 Bacteria 3027
384 Ga0207678_10077044 3300026067 Bacteria 2856
385 Ga0207678_10100244 3300026067 Bacteria 2474
386 Ga0207678_10334279 3300026067 Bacteria 1304
387 Ga0207702_10180166 3300026078 Bacteria 1945
388 Ga0207641_10415901 3300026088 Bacteria 1294
389 Ga0207648_10069067 3300026089 Bacteria 3079
390 Ga0207648_10079125 3300026089 Bacteria 2868
391 Ga0207676_10102795 3300026095 Bacteria 2373
392 Ga0207676_10765225 3300026095 Bacteria 940
393 Ga0207674_10018135 3300026116 Bacteria 7658
394 Ga0207674_10180637 3300026116 Bacteria 2061
395 Ga0207674_10482581 3300026116 Bacteria 1198
396 Ga0207675_100043034 3300026118 Bacteria 4217
397 Ga0207675_100099220 3300026118 Bacteria 2743
398 Ga0207675_100171194 3300026118 Bacteria 2076
399 Ga0207675_100377654 3300026118 Bacteria 1393
400 Ga0207683_10370569 3300026121 Bacteria 1316
401 Ga0207698_10230995 3300026142 Bacteria 1679
402 Ga0207698_10917746 3300026142 Bacteria 883
403 Ga0207698_10975898 3300026142 Bacteria 857
404 Ga0209389_1000012 3300027296 Bacteria 213243
405 Ga0209389_1000069 3300027296 Bacteria 98063
406 Ga0209589_1000015 3300027357 Bacteria 225913
407 Ga0209589_1000077 3300027357 Bacteria 98063
408 Ga0209489_100015 3300027361 Bacteria 225913
409 Ga0209489_100019 3300027361 Bacteria 213243
410 Ga0209489_100020 3300027361 Bacteria 207541
411 Ga0209700_100018 3300027363 Bacteria 238200
412 Ga0209700_100025 3300027363 Bacteria 225913
413 Ga0209179_1000903 3300027512 Bacteria 3335
414 Ga0209179_1006292 3300027512 Bacteria 1907
415 Ga0209588_1040830 3300027671 Bacteria 1497
416 Ga0207428_10103834 3300027907 Bacteria 2194
417 Ga0268266_10046869 3300028379 Bacteria 3700
418 Ga0268266_10047304 3300028379 Bacteria 3685
419 Ga0268266_10053850 3300028379 Bacteria 3457
420 Ga0268266_10091993 3300028379 Bacteria 2661
421 Ga0268266_10115674 3300028379 Bacteria 2381
422 Ga0268266_10318321 3300028379 Bacteria 1455
423 Ga0268266_10834863 3300028379 Bacteria 890
424 Ga0268265_10060372 3300028380 Bacteria 2905
425 Ga0268265_10182909 3300028380 Bacteria 1802
426 Ga0268265_10355274 3300028380 Bacteria 1339
427 Ga0268265_10575258 3300028380 Bacteria 1073
428 Ga0268264_10000356 3300028381 Bacteria 68810
429 Ga0265337_1011271 3300028556 Bacteria 3089
430 Ga0265326_10006827 3300028558 Bacteria 3524
431 Ga0265319_1024285 3300028563 Bacteria 2184
432 Ga0265334_10020212 3300028573 Bacteria 2729
433 Ga0265322_10013237 3300028654 Bacteria 2388
434 Ga0265336_10000850 3300028666 Bacteria 15908
435 Ga0307517_10010277 3300028786 Bacteria 13120
436 Ga0307515_10045648 3300028794 Bacteria 6723
437 Ga0307515_10121325 3300028794 Bacteria 2958
438 Ga0307515_10381058 3300028794 Bacteria 1043
439 Ga0265338_10000417 3300028800 Bacteria 76249
440 Ga0265324_10003779 3300029957 Bacteria 7073
441 Ga0307511_10034380 3300030521 Bacteria 4450
442 Ga0307511_10194222 3300030521 Bacteria 1067
443 Ga0265330_10012848 3300031235 Bacteria 3909
444 Ga0265330_10050026 3300031235 Bacteria 1834
445 Ga0265340_10055091 3300031247 Bacteria 1916
446 Ga0265339_10016661 3300031249 Bacteria 4373
447 Ga0265316_10301072 3300031344 Bacteria 1168
448 Ga0307509_10009216 3300031507 Bacteria 12388
449 Ga0265313_10052803 3300031595 Bacteria 1938
450 Ga0307508_10000715 3300031616 Bacteria 39415
451 Ga0307508_10033881 3300031616 Bacteria 4605
452 Ga0307508_10185701 3300031616 Bacteria 1681
453 Ga0265342_10003269 3300031712 Bacteria 13437
454 Ga0265342_10085372 3300031712 Bacteria 1817
455 Ga0265342_10105122 3300031712 Bacteria 1604
456 Ga0307516_10005305 3300031730 Bacteria 15512
457 Ga0307516_10009786 3300031730 Bacteria 10635
458 Ga0307516_10068945 3300031730 Bacteria 3403
459 Ga0307405_10105611 3300031731 Bacteria 1898
460 Ga0307410_10555398 3300031852 Bacteria 952
461 Ga0307412_10349068 3300031911 Bacteria 1187
462 Ga0307409_100220742 3300031995 Bacteria 1711
463 Ga0307409_100410238 3300031995 Bacteria 1296
464 Ga0307416_100151303 3300032002 Bacteria 2129
465 Ga0307416_101099872 3300032002 Bacteria 899
466 Ga0307415_100025456 3300032126 Bacteria 3714
467 Ga0307415_100521848 3300032126 Bacteria 1043
468 Ga0307415_100618633 3300032126 Bacteria 966
469 Ga0307507_10045602 3300033179 Bacteria 4310
470 Ga0307510_10010708 3300033180 Bacteria 10903
471 Ga0307510_10018266 3300033180 Bacteria 8254
472 Ga0307510_10075614 3300033180 Bacteria 3319
473 Ga0307510_10195727 3300033180 Bacteria 1563
474 Ga0307510_10435309 3300033180 Bacteria 753
475 Ga0373926_0023243 3300035083 Bacteria 2153
476 Ga0373923_0008743 3300035111 Bacteria 3629
477 Ga0373923_0130314 3300035111 Bacteria 1130
478 Ga0373936_0092173 3300035113 Bacteria 1271
479 Ga0373936_0111064 3300035113 Bacteria 1164
480 Ga0373939_0066133 3300035114 Bacteria 1165
481 Ga0373945_0004291 3300035116 Bacteria 4526
482 Ga0373954_0075857 3300035118 Bacteria 1602
483 Ga0373957_0019213 3300035120 Bacteria 2402
484 Ga0373943_0073105 3300035170 Bacteria 1741
485 Ga0373931_0105518 3300035691 Bacteria 1591
486 Ga0373935_0001812 3300035692 Bacteria 11998
487 Ga0373935_0005959 3300035692 Bacteria 7231
488 Ga0373935_0061189 3300035692 Bacteria 2410
489 Ga0373927_0000137 3300035695 Bacteria 56546
490 Ga0373927_0005646 3300035695 Bacteria 8601
491 Ga0373927_0014399 3300035695 Bacteria 5236
492 Ga0373947_0003829 3300035725 Bacteria 8862
493 Ga0373947_0176820 3300035725 Bacteria 1387
494 Ga0373937_0021625 3300036401 Bacteria 5773
495 Ga0373937_0105868 3300036401 Bacteria 2614
496 Ga0373925_0008084 3300037068 Bacteria 7662
497 Ga0373925_0034633 3300037068 Bacteria 3722
498 Ga0373925_0113338 3300037068 Bacteria 2097
499 Ga0373925_0277941 3300037068 Bacteria 1348
500 Ga0373925_0430530 3300037068 Bacteria 1079
501 Ga0373925_0823081 3300037068 Bacteria 765
502 Ga0395900_0280928 3300037418 Bacteria 1657
503 Ga0395898_0005085 3300037466 Bacteria 14256
504 Ga0395898_0058714 3300037466 Bacteria 3745
505 Ga0395898_0270797 3300037466 Bacteria 1620
506 Ga0395905_0136017 3300037471 Bacteria 2312
507 Ga0436364_1520197 3300037853 Bacteria 2904
508 Ga0395901_0017340 3300038443 Bacteria 7351
509 Ga0395901_0293685 3300038443 Bacteria 1686
510 Ga0395901_0441797 3300038443 Bacteria 1331
511 Ga0395901_0943648 3300038443 Bacteria 842
512 Ga0436365_0190765 3300039437 Bacteria 785
513 Ga0436365_1328606 3300039437 Bacteria 2770
514 Ga0436365_1363457 3300039437 Bacteria 860
515 Ga0436360_0868220 3300039438 Bacteria 1886
516 Ga0439465_0038800 3300041413 Bacteria 1535
517 Ga0439465_0070317 3300041413 Bacteria 1172
518 Ga0451789_0385457 3300041443 Bacteria 731
519 Ga0451807_0327781 3300041486 Bacteria 779
520 Ga0451849_0176703 3300041505 Bacteria 737
521 Ga0466969_0146013 3300044656 Bacteria 1091
522 Ga0466972_0123383 3300044658 Bacteria 1221
523 Ga0466972_0125330 3300044658 Bacteria 1210
524 Ga0466965_0045854 3300044683 Bacteria 2163
525 Ga0466966_0000411 3300044684 Bacteria 27522
526 Ga0466961_0000065 3300044693 Bacteria 63259
527 Ga0466964_0132154 3300044706 Bacteria 1138
528 Ga0466964_0154099 3300044706 Bacteria 1068
529 Ga0466968_0031952 3300044735 Bacteria 2187
530 Ga0466959_0000634 3300045049 Bacteria 20407
531 Ga0466959_0068203 3300045049 Bacteria 2578
532 Ga0495617_026277 3300046452 Bacteria 1960
533 Ga0495592_0046764 3300046454 Bacteria 3225
534 Ga0495592_0091211 3300046454 Bacteria 2185
535 Ga0495603_0000029 3300046455 Bacteria 60872
536 Ga0495603_0004729 3300046455 Bacteria 8133
537 Ga0495603_0060500 3300046455 Bacteria 2238
538 Ga0495590_0053297 3300046457 Bacteria 1412
539 Ga0495629_0000029 3300046459 Bacteria 127000
540 Ga0495629_0006648 3300046459 Bacteria 8555
541 Ga0495629_0395369 3300046459 Bacteria 940
542 Ga0495638_0023790 3300046460 Bacteria 4001
543 Ga0495641_0004254 3300046461 Bacteria 10233
544 Ga0495641_0087336 3300046461 Bacteria 1395
545 Ga0495651_0004449 3300046462 Bacteria 10735
546 Ga0495651_0074068 3300046462 Bacteria 2584
547 Ga0495651_0074964 3300046462 Bacteria 2566
548 Ga0495651_0269635 3300046462 Bacteria 1154
549 Ga0495653_0160665 3300046463 Bacteria 1560
550 Ga0495653_0448239 3300046463 Bacteria 812
551 Ga0495653_0522029 3300046463 Bacteria 738
552 Ga0495650_0134364 3300046471 Bacteria 900
553 Ga0495580_0000321 3300046472 Bacteria 39093
554 Ga0495580_0077289 3300046472 Bacteria 2322
555 Ga0495582_0000024 3300046473 Bacteria 82444
556 Ga0495605_0084523 3300046474 Bacteria 1480
557 Ga0495605_0143523 3300046474 Bacteria 1069
558 Ga0495605_0244164 3300046474 Bacteria 770
559 Ga0495639_0000006 3300046475 Bacteria 100361
560 Ga0495662_0000068 3300046476 Bacteria 36559
561 Ga0495664_0002214 3300046477 Bacteria 10401
562 Ga0495664_0041194 3300046477 Bacteria 2732
563 Ga0495584_0106586 3300046491 Bacteria 1417
564 Ga0495585_0061660 3300046492 Bacteria 2061
565 Ga0495585_0125472 3300046492 Bacteria 1355
566 Ga0495594_0000170 3300046499 Bacteria 31295
567 Ga0495594_0086680 3300046499 Bacteria 1752
568 Ga0495607_0070149 3300046501 Bacteria 1959
569 Ga0495607_0161192 3300046501 Bacteria 1140
570 Ga0495607_0259189 3300046501 Bacteria 833
571 Ga0495583_0111949 3300046506 Bacteria 1156
572 Ga0495583_0187388 3300046506 Bacteria 845
573 Ga0495606_0025242 3300046507 Bacteria 4260
574 Ga0495606_0298667 3300046507 Bacteria 873
575 Ga0495608_0009906 3300046511 Bacteria 6653
576 Ga0495608_0073325 3300046511 Bacteria 2232
577 Ga0495610_0017507 3300046512 Bacteria 4083
578 Ga0495616_0100955 3300046513 Bacteria 1353
579 Ga0495618_0060568 3300046514 Bacteria 2400
580 Ga0495618_0107227 3300046514 Bacteria 1789
581 Ga0495618_0115478 3300046514 Bacteria 1719
582 Ga0495620_0028647 3300046515 Bacteria 2587
583 Ga0495628_0031335 3300046516 Bacteria 4302
584 Ga0495628_0051848 3300046516 Bacteria 3242
585 Ga0495628_0079160 3300046516 Bacteria 2555
586 Ga0495631_0136597 3300046518 Bacteria 1053
587 Ga0495631_0159190 3300046518 Bacteria 969
588 Ga0495643_0118196 3300046522 Bacteria 1341
589 Ga0495648_0002829 3300046524 Bacteria 15615
590 Ga0495648_0012566 3300046524 Bacteria 6304
591 Ga0495648_0087717 3300046524 Bacteria 1751
592 Ga0495648_0097974 3300046524 Bacteria 1625
593 Ga0495666_0003580 3300046526 Bacteria 7855
594 Ga0495652_0005458 3300046529 Bacteria 11981
595 Ga0495652_0005882 3300046529 Bacteria 11474
596 Ga0495652_0142977 3300046529 Bacteria 1879
597 Ga0495654_0134236 3300046530 Bacteria 1108
598 Ga0495665_0000158 3300046531 Bacteria 33789
599 Ga0495665_0067607 3300046531 Bacteria 1885
600 Ga0495640_0015043 3300046533 Bacteria 5830
601 Ga0495640_0028879 3300046533 Bacteria 3988
602 Ga0495640_0050475 3300046533 Bacteria 2865
603 Ga0495640_0220330 3300046533 Bacteria 1197
604 Ga0495587_0008038 3300046536 Bacteria 6810
605 Ga0495587_0157027 3300046536 Bacteria 1295
606 Ga0495598_0017810 3300046537 Bacteria 1837
607 Ga0495597_0223582 3300046542 Bacteria 747
608 Ga0495645_0010468 3300046543 Bacteria 6503
609 Ga0495622_0018938 3300046557 Bacteria 3208
610 Ga0495622_0052375 3300046557 Bacteria 1893
611 Ga0495622_0072868 3300046557 Bacteria 1585
612 Ga0495667_0005992 3300046559 Bacteria 8219
613 Ga0495667_0008458 3300046559 Bacteria 6985
614 Ga0495667_0329276 3300046559 Bacteria 966
615 Ga0495656_0058931 3300046615 Bacteria 1668
616 Ga0495656_0063515 3300046615 Bacteria 1618
617 Ga0495668_0044558 3300046616 Bacteria 2465
618 Ga0495668_0060956 3300046616 Bacteria 2081
619 Ga0495668_0153014 3300046616 Bacteria 1263
620 Ga0495668_0224752 3300046616 Bacteria 1028
621 Ga0495668_0425504 3300046616 Bacteria 730
622 Ga0495668_0481706 3300046616 Bacteria 683
623 Ga0495634_0000354 3300046642 Bacteria 44714
624 Ga0495634_0044463 3300046642 Bacteria 3006
625 Ga0495625_0108166 3300046660 Bacteria 1902
626 Ga0495625_0206080 3300046660 Bacteria 1295
627 Ga0495625_0235636 3300046660 Bacteria 1194
628 Ga0495625_0407981 3300046660 Bacteria 847
629 Ga0495635_0000179 3300046663 Bacteria 40014
630 Ga0495635_0029811 3300046663 Bacteria 3794
631 Ga0495635_0039091 3300046663 Bacteria 3284
632 Ga0495659_0034268 3300046664 Bacteria 1785
633 Ga0495661_0012280 3300046665 Bacteria 5785
634 Ga0495588_0001137 3300046674 Bacteria 11460
635 Ga0495588_0030267 3300046674 Bacteria 2720
636 Ga0495588_0174778 3300046674 Bacteria 1135
637 Ga0495657_0002384 3300046675 Bacteria 15809
638 Ga0495599_0049233 3300046678 Bacteria 2641
639 Ga0495623_0013961 3300046679 Bacteria 5205
640 Ga0495623_0197544 3300046679 Bacteria 1158
641 Ga0495623_0202305 3300046679 Bacteria 1141
642 Ga0495623_0294893 3300046679 Bacteria 898
643 Ga0495623_0338856 3300046679 Bacteria 822
644 Ga0495646_0103280 3300046680 Bacteria 1631
645 Ga0495646_0390608 3300046680 Bacteria 724
646 Ga0495647_0000068 3300046681 Bacteria 25521
647 Ga0495658_0000428 3300046683 Bacteria 23516
648 Ga0495669_0012020 3300046684 Bacteria 3682
649 Ga0495669_0149446 3300046684 Bacteria 1105
650 Ga0495613_0015638 3300046689 Bacteria 5647
651 Ga0495613_0056042 3300046689 Bacteria 2895
652 Ga0495613_0184516 3300046689 Bacteria 1476
653 Ga0495624_0010213 3300046690 Bacteria 6471
654 Ga0495624_0132283 3300046690 Bacteria 1529
655 Ga0495624_0314973 3300046690 Bacteria 943
656 Ga0495624_0418542 3300046690 Bacteria 804
657 Ga0495670_0012601 3300046691 Bacteria 4158
658 Ga0495671_0025533 3300046692 Bacteria 3070
659 Ga0495671_0069985 3300046692 Bacteria 1724
660 Ga0495671_0143422 3300046692 Bacteria 1164
661 Ga0495649_0037274 3300046694 Bacteria 2669
662 Ga0495649_0107005 3300046694 Bacteria 1484
663 Ga0495589_0228599 3300046794 Bacteria 873
664 Ga0495600_0021305 3300046809 Bacteria 4149
665 Ga0495600_0047916 3300046809 Bacteria 2788
666 Ga0495660_0022925 3300046810 Bacteria 3563
667 Ga0495581_0000004 3300047315 Bacteria 84424
668 Ga0495581_0013854 3300047315 Bacteria 4674
669 Ga0495581_0047767 3300047315 Bacteria 2473
670 Ga0495604_0002741 3300047317 Bacteria 14128
671 Ga0495604_0145613 3300047317 Bacteria 1688
672 Ga0495604_0175414 3300047317 Bacteria 1503
673 Ga0495604_0280002 3300047317 Bacteria 1127
674 Ga0495636_0029585 3300047318 Bacteria 2236
675 Ga0495674_0000415 3300047319 Bacteria 38235
676 Ga0495674_0018174 3300047319 Bacteria 6545
677 Ga0495674_0163154 3300047319 Bacteria 1863
678 Ga0495674_0241600 3300047319 Bacteria 1488
679 Ga0495676_0050060 3300047321 Bacteria 3353
680 Ga0495676_0054205 3300047321 Bacteria 3189
681 Ga0495680_0001876 3300047322 Bacteria 22116
682 Ga0495680_0095170 3300047322 Bacteria 2227
683 Ga0495683_0128554 3300047323 Bacteria 1197
684 Ga0495683_0133044 3300047323 Bacteria 1171
685 Ga0495683_0197211 3300047323 Bacteria 910
686 Ga0495675_0007387 3300047444 Bacteria 6766
687 Ga0495675_0047111 3300047444 Bacteria 2743
688 Ga0495677_0032399 3300047445 Bacteria 1904
689 Ga0495673_0006914 3300047469 Bacteria 6607
690 Ga0495673_0064011 3300047469 Bacteria 1566
691 Ga0495673_0174179 3300047469 Bacteria 818
692 Ga0495684_0021327 3300047471 Bacteria 4988
693 Ga0495686_0116808 3300047472 Bacteria 1594
694 Ga0495686_0203948 3300047472 Bacteria 1133
695 Ga0495686_0208156 3300047472 Bacteria 1119
696 Ga0495686_0258037 3300047472 Bacteria 977
697 Ga0495686_0271448 3300047472 Bacteria 946
698 Ga0495593_0000198 3300047673 Bacteria 31587
699 Ga0495602_0043056 3300048088 Bacteria 4108
700 Ga0495602_0123078 3300048088 Bacteria 2083
701 Ga0495626_0108988 3300048091 Bacteria 1201
702 Ga0496100_0117445 3300048903 Bacteria 1857
703 Ga0496100_0126267 3300048903 Bacteria 1796
704 Ga0496100_0583701 3300048903 Bacteria 867
705 Ga0496101_0130825 3300048904 Bacteria 1906
706 Ga0496101_0138158 3300048904 Bacteria 1856
707 Ga0496101_0223664 3300048904 Bacteria 1461
708 Ga0496101_0394043 3300048904 Bacteria 1090
709 Ga0496102_0020294 3300048905 Bacteria 5872
710 Ga0496102_0069096 3300048905 Bacteria 3242
711 Ga0496102_0155526 3300048905 Bacteria 2149
712 Ga0496102_0215653 3300048905 Bacteria 1809
713 Ga0496103_0160058 3300048906 Bacteria 1444
714 Ga0496103_0203537 3300048906 Bacteria 1273
715 Ga0496103_0366621 3300048906 Bacteria 926
716 Ga0496104_0009070 3300048907 Bacteria 8843
717 Ga0496104_0018816 3300048907 Bacteria 6309
718 Ga0496104_0299737 3300048907 Bacteria 1519
719 Ga0496105_0036292 3300048908 Bacteria 4060
720 Ga0496105_0201087 3300048908 Bacteria 1626
721 Ga0496106_0013477 3300048909 Bacteria 6036
722 Ga0496106_0186460 3300048909 Bacteria 1648
723 Ga0496106_0321064 3300048909 Bacteria 1243
724 Ga0496106_0365234 3300048909 Bacteria 1160
725 Ga0496106_0611907 3300048909 Bacteria 872
726 Ga0496107_0026324 3300048910 Bacteria 4122
727 Ga0496107_0066674 3300048910 Bacteria 2610
728 Ga0496107_0257753 3300048910 Bacteria 1298
729 Ga0496108_0007465 3300048911 Bacteria 8863
730 Ga0496108_0205236 3300048911 Bacteria 1710
731 Ga0496108_0406946 3300048911 Bacteria 1188
732 Ga0496109_0000609 3300048912 Bacteria 29900
733 Ga0496109_0600231 3300048912 Bacteria 1037
734 Ga0496110_0008924 3300048913 Bacteria 8082
735 Ga0496110_0051009 3300048913 Bacteria 3635
736 Ga0496110_0106590 3300048913 Bacteria 2515
737 Ga0496110_0188518 3300048913 Bacteria 1873
738 Ga0496111_0248764 3300048914 Bacteria 1320
739 Ga0496112_0002437 3300048915 Bacteria 14996
740 Ga0496112_0063507 3300048915 Bacteria 3643
741 Ga0496112_0158624 3300048915 Bacteria 2229
742 Ga0496112_0208189 3300048915 Bacteria 1913
743 Ga0496112_0240664 3300048915 Bacteria 1762
744 Ga0496112_0475644 3300048915 Bacteria 1186
745 Ga0496112_0541120 3300048915 Bacteria 1099
746 Ga0496112_0591305 3300048915 Bacteria 1042
747 Ga0496113_0023429 3300048916 Bacteria 4377
748 Ga0496113_0186428 3300048916 Bacteria 1646
749 Ga0496114_0052300 3300048917 Bacteria 3403
750 Ga0496114_0596401 3300048917 Bacteria 974
751 Ga0496114_1155065 3300048917 Bacteria 660
752 Ga0496115_0042539 3300048918 Bacteria 3619
753 Ga0496115_0148788 3300048918 Bacteria 1933
754 Ga0496115_0172020 3300048918 Bacteria 1791
755 Ga0496116_0000965 3300048919 Bacteria 35491
756 Ga0496117_0014058 3300048920 Bacteria 6924
757 Ga0496117_0034522 3300048920 Bacteria 3809
758 Ga0496117_0037972 3300048920 Bacteria 3580
759 Ga0496117_0169203 3300048920 Bacteria 1270
760 Ga0496117_0292105 3300048920 Bacteria 867
761 Ga0496117_0330976 3300048920 Bacteria 794
762 Ga0496118_0003027 3300048921 Bacteria 21693
763 Ga0496118_0010242 3300048921 Bacteria 9306
764 Ga0496118_0098113 3300048921 Bacteria 1991
765 Ga0496118_0136894 3300048921 Bacteria 1561
766 Ga0496118_0219477 3300048921 Bacteria 1108
767 Ga0496119_0065293 3300048922 Bacteria 2156
768 Ga0496119_0099673 3300048922 Bacteria 1633
769 Ga0496119_0200392 3300048922 Bacteria 1033
770 Ga0496120_0094039 3300048923 Bacteria 1596
771 Ga0496121_0001622 3300048924 Bacteria 37285
772 Ga0496121_0002689 3300048924 Bacteria 26584
773 Ga0496121_0009316 3300048924 Bacteria 11324
774 Ga0496121_0023791 3300048924 Bacteria 5882
775 Ga0496121_0047888 3300048924 Bacteria 3642
776 Ga0496121_0049586 3300048924 Bacteria 3558
777 Ga0496121_0107036 3300048924 Bacteria 2142
778 Ga0496121_0111268 3300048924 Bacteria 2089
779 Ga0496121_0189225 3300048924 Bacteria 1477
780 Ga0496121_0216276 3300048924 Bacteria 1353
781 Ga0496122_0081574 3300048925 Bacteria 2250
782 Ga0496122_0307107 3300048925 Bacteria 852
783 Ga0496123_0049608 3300048926 Bacteria 2812
784 Ga0496124_0002957 3300048927 Bacteria 21339
785 Ga0496124_0245021 3300048927 Bacteria 1330
786 Ga0496124_0269286 3300048927 Bacteria 1248
787 Ga0496125_0001630 3300048928 Bacteria 31638
788 Ga0496125_0076533 3300048928 Bacteria 2583
789 Ga0496125_0094047 3300048928 Bacteria 2235
790 Ga0496125_0099905 3300048928 Bacteria 2141
791 Ga0496125_0135884 3300048928 Bacteria 1720
792 Ga0496126_0003472 3300048929 Bacteria 19892
793 Ga0496126_0003803 3300048929 Bacteria 18741
794 Ga0496126_0022661 3300048929 Bacteria 6104
795 Ga0496126_0033427 3300048929 Bacteria 4838
796 Ga0496126_0062063 3300048929 Bacteria 3354
797 Ga0496126_0074642 3300048929 Bacteria 3011
798 Ga0496126_0085033 3300048929 Bacteria 2789
799 Ga0496126_0128008 3300048929 Bacteria 2196
800 Ga0496126_0132568 3300048929 Bacteria 2152
801 Ga0496126_0138734 3300048929 Bacteria 2095
802 Ga0496126_0166265 3300048929 Bacteria 1882
803 Ga0496126_0176282 3300048929 Bacteria 1818
804 Ga0496126_0786760 3300048929 Bacteria 731
805 Ga0495682_0139544 3300049460 Bacteria 866
806 Ga0495682_0168838 3300049460 Bacteria 778
807 Ga0501031_0003114 3300049568 Bacteria 10626
808 Ga0501031_0031671 3300049568 Bacteria 3450
809 Ga0501032_0000762 3300049569 Bacteria 26183
810 Ga0501032_0051974 3300049569 Bacteria 2761
811 Ga0501032_0094743 3300049569 Bacteria 1979
812 Ga0501033_0000136 3300049570 Bacteria 70952
813 Ga0501034_0000251 3300049571 Bacteria 99406
814 Ga0501036_0000036 3300049572 Bacteria 87244
815 Ga0501036_0236357 3300049572 Bacteria 1533
816 Ga0501036_0429974 3300049572 Bacteria 1100
817 Ga0501036_0721492 3300049572 Bacteria 823
818 Ga0501037_0000867 3300049573 Bacteria 22596
819 Ga0501037_0506296 3300049573 Bacteria 819
820 Ga0501038_0000428 3300049574 Bacteria 36623
821 Ga0501038_0132405 3300049574 Bacteria 2045
822 Ga0501039_0000273 3300049575 Bacteria 37431
823 Ga0501039_0050295 3300049575 Bacteria 3224
824 Ga0501039_0208823 3300049575 Bacteria 1535
825 Ga0501042_0010927 3300049578 Bacteria 6113
826 Ga0501043_0000165 3300049579 Bacteria 59980
827 Ga0501043_0656988 3300049579 Bacteria 769
828 Ga0501046_0000839 3300049580 Bacteria 29959
829 Ga0501046_0235849 3300049580 Bacteria 1350
830 Ga0501047_0000340 3300049581 Bacteria 53278
831 Ga0501047_0041364 3300049581 Bacteria 4454
832 Ga0501047_0313117 3300049581 Bacteria 1410
833 Ga0501048_0001309 3300049582 Bacteria 18872
834 Ga0501048_0127719 3300049582 Bacteria 1798
835 Ga0501067_0000457 3300049583 Bacteria 22383
836 Ga0501067_0013941 3300049583 Bacteria 4452
837 Ga0501067_0395309 3300049583 Bacteria 771
838 Ga0501068_0000839 3300049584 Bacteria 15999
839 Ga0501068_0136215 3300049584 Bacteria 1538
840 Ga0501069_0008491 3300049585 Bacteria 5401
841 Ga0501070_0000971 3300049586 Bacteria 25732
842 Ga0501071_0088114 3300049587 Bacteria 2277
843 Ga0501071_0134855 3300049587 Bacteria 1836
844 Ga0501072_0003301 3300049588 Bacteria 12139
845 Ga0501072_0422464 3300049588 Bacteria 1056
846 Ga0501072_0434625 3300049588 Bacteria 1040
847 Ga0501073_0000037 3300049589 Bacteria 87345
848 Ga0501073_0074644 3300049589 Bacteria 2361
849 Ga0501074_0037310 3300049590 Bacteria 3523
850 Ga0501076_0383952 3300049592 Bacteria 1154
851 Ga0501076_0514584 3300049592 Bacteria 987
852 Ga0501077_0175557 3300049593 Bacteria 1361
853 Ga0501079_0002302 3300049741 Bacteria 13814
854 Ga0501080_0006603 3300049742 Bacteria 10426
855 Ga0501080_1011448 3300049742 Bacteria 721
856 Ga0501083_0001812 3300049744 Bacteria 14636
857 Ga0501035_0000142 3300049822 Bacteria 87561
858 Ga0501044_0000414 3300049823 Bacteria 52784
859 Ga0501044_0021563 3300049823 Bacteria 6869
860 Ga0501044_0467028 3300049823 Bacteria 1166
861 Ga0501045_0002539 3300049824 Bacteria 12434
862 Ga0501045_0115652 3300049824 Bacteria 1990
863 nmdc:mga03n38_20242_c1 3300050490 Bacteria 2658
864 nmdc:mga03n38_225627_c1 3300050490 Bacteria 980
865 nmdc:mga03n38_336891_c1 3300050490 Bacteria 818
866 nmdc:mga00v17_266897_c1 3300050491 Bacteria 1111
867 nmdc:mga00v17_31303_c1 3300050491 Bacteria 3137
868 nmdc:mga0yw44_183313_c1 3300050492 Bacteria 1379
869 nmdc:mga0yw44_203975_c1 3300050492 Bacteria 1307
870 nmdc:mga0yw44_370018_c1 3300050492 Bacteria 967
871 nmdc:mga0yw44_38229_c1 3300050492 Bacteria 2838
872 nmdc:mga0yw44_38444_c1 3300050492 Bacteria 2832
873 nmdc:mga0k408_135340_c1 3300050493 Bacteria 1464
874 nmdc:mga0k408_34806_c1 3300050493 Bacteria 2885
875 nmdc:mga06z11_27972_c1 3300050494 Bacteria 2700
876 nmdc:mga06z11_41041_c1 3300050494 Bacteria 2313
877 nmdc:mga06z11_61431_c1 3300050494 Bacteria 1960
878 nmdc:mga06z11_72222_c1 3300050494 Bacteria 1829
879 nmdc:mga06z11_84378_c1 3300050494 Bacteria 1712
880 nmdc:mga04h51_80619_c1 3300050495 Bacteria 1154
881 nmdc:mga07m45_142421_c1 3300050496 Bacteria 1388
882 nmdc:mga07m45_147292_c1 3300050496 Bacteria 1365
883 nmdc:mga05p37_811294_c1 3300050507 Bacteria 1022
884 nmdc:mga08y16_40533_c1 3300050511 Bacteria 4881
885 nmdc:mga0n895_15181_c1 3300050512 Bacteria 7018
886 nmdc:mga0n895_161206_c1 3300050512 Bacteria 2274
887 nmdc:mga0n895_247010_c1 3300050512 Bacteria 1811
888 nmdc:mga0rr50_88622_c1 3300050513 Bacteria 2404
889 nmdc:mga08x19_275118_c1 3300050514 Bacteria 1166
890 nmdc:mga0sz30_1774_c1 3300050516 Bacteria 7659
891 nmdc:mga0sz30_32158_c1 3300050516 Bacteria 2175
892 nmdc:mga0sz30_73654_c1 3300050516 Bacteria 1472
893 Ga0495601_0029491 3300053077 Bacteria 3403
894 Ga0495601_0221445 3300053077 Bacteria 1236
895 Ga0500635_0140244 3300053080 Bacteria 917
896 Ga0495595_0034044 3300053084 Bacteria 2303
897 Ga0495619_0149002 3300053085 Bacteria 1613
898 Ga0495619_0283258 3300053085 Bacteria 1148
899 Ga0500578_0040493 3300053086 Bacteria 2994
900 Ga0500578_0308065 3300053086 Bacteria 937
901 Ga0500578_0413856 3300053086 Bacteria 774
902 Ga0500643_000048 3300053087 Bacteria 147879
903 Ga0500643_012220 3300053087 Bacteria 3083
904 Ga0500581_167153 3300053089 Bacteria 1014
905 Ga0500647_0003150 3300053091 Bacteria 6361
906 Ga0500583_0114375 3300053092 Bacteria 1331
907 Ga0500651_0016774 3300053093 Bacteria 4508
908 Ga0500651_0080962 3300053093 Bacteria 2011
909 Ga0500651_0167795 3300053093 Bacteria 1310
910 Ga0500566_0000126 3300053094 Bacteria 39286
911 Ga0500566_0001615 3300053094 Bacteria 13269
912 Ga0500566_0002605 3300053094 Bacteria 10733
913 Ga0500566_0032785 3300053094 Bacteria 3029
914 Ga0500640_003090 3300053095 Bacteria 5700
915 Ga0500641_0005231 3300053096 Bacteria 4598
916 Ga0500641_0005276 3300053096 Bacteria 4576
917 Ga0500648_072568 3300053097 Bacteria 1945
918 Ga0500650_0002007 3300053098 Bacteria 6500
919 Ga0500556_0137217 3300053104 Bacteria 961
920 Ga0500556_0207441 3300053104 Bacteria 774
921 Ga0500557_119428 3300053105 Bacteria 875
922 Ga0500562_040306 3300053108 Bacteria 1241
923 Ga0500562_044557 3300053108 Bacteria 1181
924 Ga0500569_010177 3300053109 Bacteria 2206
925 Ga0500569_017337 3300053109 Bacteria 1840
926 Ga0500572_000152 3300053111 Bacteria 24027
927 Ga0500572_003010 3300053111 Bacteria 3933
928 Ga0500594_0008171 3300053118 Bacteria 2380
929 Ga0500595_000333 3300053119 Bacteria 30925
930 Ga0500595_000497 3300053119 Bacteria 23997
931 Ga0500595_010458 3300053119 Bacteria 3687
932 Ga0500595_030978 3300053119 Bacteria 1797
933 Ga0500607_146783 3300053121 Bacteria 1100
934 Ga0500614_001649 3300053123 Bacteria 5240
935 Ga0500618_013821 3300053125 Bacteria 2077
936 Ga0500642_0000015 3300053130 Bacteria 181424
937 Ga0500642_0005741 3300053130 Bacteria 4033
938 Ga0500642_0123977 3300053130 Bacteria 1209
939 Ga0500652_010728 3300053131 Bacteria 3151
940 Ga0500652_188156 3300053131 Bacteria 843
941 Ga0500658_0024606 3300053134 Bacteria 2308
942 Ga0500658_0153129 3300053134 Bacteria 1040
943 Ga0500559_0000230 3300053136 Bacteria 44504
944 Ga0500559_0001714 3300053136 Bacteria 12043
945 Ga0500559_0052763 3300053136 Bacteria 1798
946 Ga0500559_0074726 3300053136 Bacteria 1532
947 Ga0500564_052876 3300053138 Bacteria 1855
948 Ga0500568_0000536 3300053139 Bacteria 27978
949 Ga0500568_0007618 3300053139 Bacteria 5292
950 Ga0500568_0028888 3300053139 Bacteria 2308
951 Ga0500568_0052623 3300053139 Bacteria 1598
952 Ga0500577_0092611 3300053142 Bacteria 1224
953 Ga0500588_0078594 3300053146 Bacteria 1099
954 Ga0500589_138875 3300053147 Bacteria 1004
955 Ga0500590_080589 3300053148 Bacteria 1599
956 Ga0500603_000304 3300053150 Bacteria 12869
957 Ga0500603_004209 3300053150 Bacteria 3075
958 Ga0500604_0055704 3300053151 Bacteria 1230
959 Ga0500616_0000033 3300053153 Bacteria 398830
960 Ga0500616_0147958 3300053153 Bacteria 1090
961 Ga0500622_0013268 3300053156 Bacteria 4445
962 Ga0500622_0061141 3300053156 Bacteria 1920
963 Ga0500622_0254306 3300053156 Bacteria 770
964 Ga0500627_0027552 3300053158 Bacteria 2353
965 Ga0500627_0072823 3300053158 Bacteria 1523
966 Ga0500630_002602 3300053159 Bacteria 8690
967 Ga0500634_0050414 3300053161 Bacteria 2242
968 Ga0500634_0097771 3300053161 Bacteria 1476
969 Ga0500638_005288 3300053162 Bacteria 5117
970 Ga0500638_048231 3300053162 Bacteria 2061
971 Ga0500639_000039 3300053163 Bacteria 65182
972 Ga0500636_0015308 3300053177 Bacteria 4519
973 Ga0500636_0033475 3300053177 Bacteria 3042
974 Ga0500636_0146675 3300053177 Bacteria 1300
975 Ga0500637_0000060 3300053178 Bacteria 38881
976 Ga0500576_016710 3300053725 Bacteria 3331
977 Ga0500576_118437 3300053725 Bacteria 1048
978 Ga0500645_113256 3300053730 Bacteria 760
979 Ga0500552_000562 3300053733 Bacteria 3474
980 Ga0500596_001647 3300053735 Bacteria 4511
981 Ga0500599_000986 3300053736 Bacteria 3184
982 Ga0500601_000280 3300053737 Bacteria 9696
983 Ga0501084_0005116 3300054114 Bacteria 10737
984 Ga0501084_0301392 3300054114 Bacteria 1354
985 Ga0500661_031303 3300055283 Bacteria 939
986 Ga0501082_0004333 3300060353 Bacteria 12407
987 Ga0501082_0134273 3300060353 Bacteria 2147
988 Ga0530510_0014062 3300061734 Bacteria 5642
989 Ga0530510_0569704 3300061734 Bacteria 861
990 2644290519 2643221651 Bacteria 4798932
991 Ga0070714_100929593
992 JGI25406J46586_10000233
993 JGI25406J46586_10006333
994 JGI25153J46596_10006692
995 JGI25153J46596_10040042
996 rootH2_10011831
997 JGI25404J52841_10020882
998 JGI25404J52841_10067893
999 Ga0055526_1028100
1000 Ga0055531_10005040
1001 Ga0055531_10083370
1002 Ga0070658_10525619
1003 Ga0070670_100182004
1004 Ga0068869_100030464
1005 Ga0068869_100087498
1006 Ga0068869_100160324
1007 Ga0068869_100382431
1008 Ga0070666_10273787
1009 Ga0070680_100013830
1010 Ga0070680_100196494
1011 Ga0070682_100027255
1012 Ga0070682_100194300
1013 Ga0068868_100050101
1014 Ga0068868_100338502
1015 Ga0068868_100444242
1016 Ga0068868_100560625
1017 Ga0070660_100003692
1018 Ga0070660_100129050
1019 Ga0070660_100333322
1020 Ga0070689_100099415
1021 Ga0070687_100361678
1022 Ga0070661_100055967
1023 Ga0070661_100278907
1024 Ga0070661_100461411
1025 Ga0070668_100024341
1026 Ga0070668_100059725
1027 Ga0070668_100091702
1028 Ga0070668_100127388
1029 Ga0070669_100351449
1030 Ga0070669_100433510
1031 Ga0070675_100419897
1032 Ga0070675_100848847
1033 Ga0070674_100231814
1034 Ga0070674_100373942
1035 Ga0070673_100103078
1036 Ga0070688_100472045
1037 Ga0070659_100077774
1038 Ga0070659_100189719
1039 Ga0070709_10036585
1040 Ga0070714_100015842
1041 Ga0070714_100067089
1042 Ga0070713_100269513
1043 Ga0070713_100680283
1044 Ga0070701_10199112
1045 Ga0070711_100001130
1046 Ga0070705_100707547
1047 Ga0070694_100163094
1048 Ga0070694_100490103
1049 Ga0070708_100105209
1050 Ga0070663_100032985
1051 Ga0070663_100057207
1052 Ga0070663_100292428
1053 Ga0070663_100411763
1054 Ga0070663_100417055
1055 Ga0070663_100541761
1056 Ga0070678_100034642
1057 Ga0070678_100999680
1058 Ga0070662_100091189
1059 Ga0070681_10006411
1060 Ga0070681_10007888
1061 Ga0070685_10055262
1062 Ga0070685_10079531
1063 Ga0070685_10209492
1064 Ga0070698_100400542
1065 Ga0070698_100465666
1066 Ga0070699_100796420
1067 Ga0070679_100018490
1068 Ga0070679_100074252
1069 Ga0070679_100084060
1070 Ga0070679_100229905
1071 Ga0070697_100054323
1072 Ga0068853_100009612
1073 Ga0068853_100422126
1074 Ga0068853_100925826
1075 Ga0070686_100726033
1076 Ga0070693_100056138
1077 Ga0070693_100210058
1078 Ga0070693_100606723
1079 Ga0070665_100038699
1080 Ga0070665_100060150
1081 Ga0070665_100233037
1082 Ga0070665_100355551
1083 Ga0070665_100373554
1084 Ga0070665_100386166
1085 Ga0070665_100489586
1086 Ga0070665_100519222
1087 Ga0068855_100027307
1088 Ga0068855_100160273
1089 Ga0068855_100215023
1090 Ga0068855_100249115
1091 Ga0068855_100485141
1092 Ga0068857_100013087
1093 Ga0068857_100280101
1094 Ga0068854_100090808
1095 Ga0068856_100342777
1096 Ga0068852_100103072
1097 Ga0068852_100105170
1098 Ga0068852_100497397
1099 Ga0068859_100053072
1100 Ga0068859_100146181
1101 Ga0068859_101318636
1102 Ga0068864_100124538
1103 Ga0068864_100846275
1104 Ga0068866_10152765
1105 Ga0068861_100040899
1106 Ga0068861_100122230
1107 Ga0068870_10218316
1108 Ga0068863_100550995
1109 Ga0068858_100551252
1110 Ga0068858_100642741
1111 Ga0068858_100694274
1112 Ga0068858_101057945
1113 Ga0068860_100000313
1114 Ga0068862_100221922
1115 Ga0068862_101092449
1116 Ga0081455_10005731
1117 Ga0081455_10029773
1118 Ga0081455_10099630
1119 Ga0081455_10109419
1120 Ga0081540_1007566
1121 Ga0081540_1008557
1122 Ga0081540_1011157
1123 Ga0081540_1012286
1124 Ga0081540_1015476
1125 Ga0081540_1016697
1126 Ga0081540_1018292
1127 Ga0081540_1035420
1128 Ga0081540_1044694
1129 Ga0081540_1059902
1130 Ga0081540_1071540
1131 Ga0081539_10000157
1132 Ga0081539_10002599
1133 Ga0081539_10106751
1134 Ga0070717_10034976
1135 Ga0070717_10315909
1136 Ga0070717_10339131
1137 Ga0075365_10068327
1138 Ga0075365_10093827
1139 Ga0075365_10115880
1140 Ga0075365_10401340
1141 Ga0075365_10766777
1142 Ga0075368_10002578
1143 Ga0075368_10040110
1144 Ga0075368_10044493
1145 Ga0075363_100003641
1146 Ga0075363_100012959
1147 Ga0075363_100091186
1148 Ga0075363_100128984
1149 Ga0075363_100245248
1150 Ga0075364_10012640
1151 Ga0075364_10076141
1152 Ga0075364_10084435
1153 Ga0075364_10383488
1154 Ga0075364_10406694
1155 Ga0070716_100156175
1156 Ga0075367_10008296
1157 Ga0075367_10160099
1158 Ga0075367_10167738
1159 Ga0075367_10267582
1160 Ga0075369_10031533
1161 Ga0075369_10039347
1162 Ga0075369_10080100
1163 Ga0075369_10139008
1164 Ga0075366_10068130
1165 Ga0075366_10112181
1166 Ga0097621_100748026
1167 Ga0075370_10010672
1168 Ga0075370_10264863
1169 Ga0068871_100573485
1170 Ga0075434_100023401
1171 Ga0075434_100200870
1172 Ga0075434_100310997
1173 Ga0075434_100400957
1174 Ga0068865_100598496
1175 Ga0075436_100773008
1176 Ga0097620_100053073
1177 Ga0097620_100146183
1178 Ga0097620_101318534
1179 Ga0099824_1018691
1180 Ga0099822_1000541
1181 Ga0099822_1077802
1182 Ga0075435_100087942
1183 Ga0099794_10026556
1184 Ga0099794_10035471
1185 Ga0099794_10216336
1186 Ga0099795_10027564
1187 Ga0099795_10037370
1188 Ga0105240_10002295
1189 Ga0105240_10033307
1190 Ga0105240_10303050
1191 Ga0111539_10490578
1192 Ga0111539_11329697
1193 Ga0105245_10406274
1194 Ga0105247_10035521
1195 Ga0105247_10121903
1196 Ga0105243_10036778
1197 Ga0105243_10208884
1198 Ga0105241_10072901
1199 Ga0105241_10075194
1200 Ga0105241_10479912
1201 Ga0105242_10266630
1202 Ga0105248_10231301
1203 Ga0105237_10002301
1204 Ga0105237_10066311
1205 Ga0105237_10314760
1206 Ga0105238_10006268
1207 Ga0105238_10022426
1208 Ga0105238_10461190
1209 Ga0105249_10333593
1210 Ga0105249_10493636
1211 Ga0105249_10545568
1212 Ga0099796_10092218
1213 Ga0105239_10017503
1214 Ga0105239_10035625
1215 Ga0105239_10066921
1216 Ga0105239_10189208
1217 Ga0105239_10191172
1218 Ga0105239_10605283
1219 Ga0105239_10650584
1220 Ga0105239_10694815
1221 Ga0105239_10831580
1222 Ga0105239_10850948
1223 Ga0105246_10035946
1224 Ga0105246_10095428
1225 Ga0105246_10264649
1226 Ga0157371_10031405
1227 Ga0157370_10075424
1228 Ga0157370_10492533
1229 Ga0157369_10018692
1230 Ga0157374_10131548
1231 Ga0157378_10008170
1232 Ga0163162_10026136
1233 Ga0163162_10127713
1234 Ga0163162_10232436
1235 Ga0163162_10485689
1236 Ga0163162_10834378
1237 Ga0157372_10075935
1238 Ga0157372_11545435
1239 Ga0157375_10537241
1240 Ga0163163_10007500
1241 Ga0163163_10092490
1242 Ga0163163_10490891
1243 Ga0157380_10047597
1244 Ga0157379_10060314
1245 Ga0157379_10219909
1246 Ga0157379_11094465
1247 Ga0157376_10127798
1248 Ga0206356_10672806
1249 Ga0209563_102736
1250 Ga0209563_119376
1251 Ga0207425_1019877
1252 Ga0209148_1000267
1253 Ga0209233_1002344
1254 Ga0209233_1018924
1255 Ga0209233_1050685
1256 Ga0209455_1002785
1257 Ga0209564_1021745
1258 Ga0209564_1022449
1259 Ga0209758_1000015
1260 Ga0209758_1000711
1261 Ga0209758_1001094
1262 Ga0209758_1001864
1263 Ga0209758_1031488
1264 Ga0209758_1048288
1265 Ga0209256_1004771
1266 Ga0207426_1003610
1267 Ga0209257_1001688
1268 Ga0209257_1035198
1269 Ga0207656_10018079
1270 Ga0207710_10028664
1271 Ga0207710_10288533
1272 Ga0207688_10054745
1273 Ga0207688_10092165
1274 Ga0207680_10568610
1275 Ga0207647_10009749
1276 Ga0207647_10307119
1277 Ga0207699_10144934
1278 Ga0207645_10063010
1279 Ga0207645_10170646
1280 Ga0207645_10374619
1281 Ga0207643_10189637
1282 Ga0207705_10238678
1283 Ga0207684_10618921
1284 Ga0207654_10011023
1285 Ga0207654_10028697
1286 Ga0207654_10045094
1287 Ga0207654_10523149
1288 Ga0207707_10000143
1289 Ga0207707_10014431
1290 Ga0207707_10032951
1291 Ga0207695_10000059
1292 Ga0207695_10093922
1293 Ga0207695_10179409
1294 Ga0207695_10895162
1295 Ga0207671_10001109
1296 Ga0207671_10130576
1297 Ga0207671_10538603
1298 Ga0207693_10059333
1299 Ga0207693_10184703
1300 Ga0207693_10450114
1301 Ga0207663_10021983
1302 Ga0207660_10007904
1303 Ga0207660_10079595
1304 Ga0207660_10279084
1305 Ga0207657_10005482
1306 Ga0207657_10074276
1307 Ga0207657_10251739
1308 Ga0207657_10436016
1309 Ga0207652_10024703
1310 Ga0207652_10027515
1311 Ga0207652_10045150
1312 Ga0207681_10330550
1313 Ga0207694_10110472
1314 Ga0207650_10179960
1315 Ga0207659_10221682
1316 Ga0207687_10085748
1317 Ga0207687_10298816
1318 Ga0207700_10206963
1319 Ga0207700_10272732
1320 Ga0207664_10243512
1321 Ga0207664_10282814
1322 Ga0207664_10462245
1323 Ga0207664_10542191
1324 Ga0207664_10609971
1325 Ga0207644_10216876
1326 Ga0207644_10492535
1327 Ga0207690_10250658
1328 Ga0207706_10107908
1329 Ga0207706_10314047
1330 Ga0207706_10470633
1331 Ga0207686_10237709
1332 Ga0207686_10238933
1333 Ga0207709_10010853
1334 Ga0207709_10615410
1335 Ga0207670_10053964
1336 Ga0207670_10230196
1337 Ga0207669_10168381
1338 Ga0207665_10501756
1339 Ga0207691_10259003
1340 Ga0207691_10330741
1341 Ga0207711_10112183
1342 Ga0207711_10120999
1343 Ga0207689_10052561
1344 Ga0207689_10059101
1345 Ga0207689_10371601
1346 Ga0207661_10068018
1347 Ga0207667_10020014
1348 Ga0207667_10020505
1349 Ga0207667_10154463
1350 Ga0207667_10222922
1351 Ga0207667_10779988
1352 Ga0207667_11119903
1353 Ga0207651_10572263
1354 Ga0207712_10039860
1355 Ga0207712_10203648
1356 Ga0207712_10770662
1357 Ga0207668_10061758
1358 Ga0207668_10213756
1359 Ga0207668_10674564
1360 Ga0207640_10342888
1361 Ga0207658_10869302
1362 Ga0207677_10099933
1363 Ga0207703_10045007
1364 Ga0207703_10429822
1365 Ga0207703_10539958
1366 Ga0207703_10593231
1367 Ga0207703_11263153
1368 Ga0207639_10076603
1369 Ga0207639_10087416
1370 Ga0207678_10030059
1371 Ga0207678_10049937
1372 Ga0207678_10067196
1373 Ga0207678_10069172
1374 Ga0207678_10077044
1375 Ga0207678_10100244
1376 Ga0207678_10334279
1377 Ga0207702_10180166
1378 Ga0207641_10415901
1379 Ga0207648_10069067
1380 Ga0207648_10079125
1381 Ga0207676_10102795
1382 Ga0207676_10765225
1383 Ga0207674_10018135
1384 Ga0207674_10180637
1385 Ga0207674_10482581
1386 Ga0207675_100043034
1387 Ga0207675_100099220
1388 Ga0207675_100171194
1389 Ga0207675_100377654
1390 Ga0207683_10370569
1391 Ga0207698_10230995
1392 Ga0207698_10917746
1393 Ga0207698_10975898
1394 Ga0209389_1000012
1395 Ga0209389_1000069
1396 Ga0209589_1000015
1397 Ga0209589_1000077
1398 Ga0209489_100015
1399 Ga0209489_100019
1400 Ga0209489_100020
1401 Ga0209700_100018
1402 Ga0209700_100025
1403 Ga0209179_1000903
1404 Ga0209179_1006292
1405 Ga0209588_1040830
1406 Ga0207428_10103834
1407 Ga0268266_10046869
1408 Ga0268266_10047304
1409 Ga0268266_10053850
1410 Ga0268266_10091993
1411 Ga0268266_10115674
1412 Ga0268266_10318321
1413 Ga0268266_10834863
1414 Ga0268265_10060372
1415 Ga0268265_10182909
1416 Ga0268265_10355274
1417 Ga0268265_10575258
1418 Ga0268264_10000356
1419 Ga0265337_1011271
1420 Ga0265326_10006827
1421 Ga0265319_1024285
1422 Ga0265334_10020212
1423 Ga0265322_10013237
1424 Ga0265336_10000850
1425 Ga0307517_10010277
1426 Ga0307515_10045648
1427 Ga0307515_10121325
1428 Ga0307515_10381058
1429 Ga0265338_10000417
1430 Ga0265324_10003779
1431 Ga0307511_10034380
1432 Ga0307511_10194222
1433 Ga0265330_10012848
1434 Ga0265330_10050026
1435 Ga0265340_10055091
1436 Ga0265339_10016661
1437 Ga0265316_10301072
1438 Ga0307509_10009216
1439 Ga0265313_10052803
1440 Ga0307508_10000715
1441 Ga0307508_10033881
1442 Ga0307508_10185701
1443 Ga0265342_10003269
1444 Ga0265342_10085372
1445 Ga0265342_10105122
1446 Ga0307516_10005305
1447 Ga0307516_10009786
1448 Ga0307516_10068945
1449 Ga0307405_10105611
1450 Ga0307410_10555398
1451 Ga0307412_10349068
1452 Ga0307409_100220742
1453 Ga0307409_100410238
1454 Ga0307416_100151303
1455 Ga0307416_101099872
1456 Ga0307415_100025456
1457 Ga0307415_100521848
1458 Ga0307415_100618633
1459 Ga0307507_10045602
1460 Ga0307510_10010708
1461 Ga0307510_10018266
1462 Ga0307510_10075614
1463 Ga0307510_10195727
1464 Ga0307510_10435309
1465 Ga0373926_0023243
1466 Ga0373923_0008743
1467 Ga0373923_0130314
1468 Ga0373936_0092173
1469 Ga0373936_0111064
1470 Ga0373939_0066133
1471 Ga0373945_0004291
1472 Ga0373954_0075857
1473 Ga0373957_0019213
1474 Ga0373943_0073105
1475 Ga0373931_0105518
1476 Ga0373935_0001812
1477 Ga0373935_0005959
1478 Ga0373935_0061189
1479 Ga0373927_0000137
1480 Ga0373927_0005646
1481 Ga0373927_0014399
1482 Ga0373947_0003829
1483 Ga0373947_0176820
1484 Ga0373937_0021625
1485 Ga0373937_0105868
1486 Ga0373925_0008084
1487 Ga0373925_0034633
1488 Ga0373925_0113338
1489 Ga0373925_0277941
1490 Ga0373925_0430530
1491 Ga0373925_0823081
1492 Ga0395900_0280928
1493 Ga0395898_0005085
1494 Ga0395898_0058714
1495 Ga0395898_0270797
1496 Ga0395905_0136017
1497 Ga0436364_1520197
1498 Ga0395901_0017340
1499 Ga0395901_0293685
1500 Ga0395901_0441797
1501 Ga0395901_0943648
1502 Ga0436365_0190765
1503 Ga0436365_1328606
1504 Ga0436365_1363457
1505 Ga0436360_0868220
1506 Ga0439465_0038800
1507 Ga0439465_0070317
1508 Ga0451789_0385457
1509 Ga0451807_0327781
1510 Ga0451849_0176703
1511 Ga0466969_0146013
1512 Ga0466972_0123383
1513 Ga0466972_0125330
1514 Ga0466965_0045854
1515 Ga0466966_0000411
1516 Ga0466961_0000065
1517 Ga0466964_0132154
1518 Ga0466964_0154099
1519 Ga0466968_0031952
1520 Ga0466959_0000634
1521 Ga0466959_0068203
1522 Ga0495617_026277
1523 Ga0495592_0046764
1524 Ga0495592_0091211
1525 Ga0495603_0000029
1526 Ga0495603_0004729
1527 Ga0495603_0060500
1528 Ga0495590_0053297
1529 Ga0495629_0000029
1530 Ga0495629_0006648
1531 Ga0495629_0395369
1532 Ga0495638_0023790
1533 Ga0495641_0004254
1534 Ga0495641_0087336
1535 Ga0495651_0004449
1536 Ga0495651_0074068
1537 Ga0495651_0074964
1538 Ga0495651_0269635
1539 Ga0495653_0160665
1540 Ga0495653_0448239
1541 Ga0495653_0522029
1542 Ga0495650_0134364
1543 Ga0495580_0000321
1544 Ga0495580_0077289
1545 Ga0495582_0000024
1546 Ga0495605_0084523
1547 Ga0495605_0143523
1548 Ga0495605_0244164
1549 Ga0495639_0000006
1550 Ga0495662_0000068
1551 Ga0495664_0002214
1552 Ga0495664_0041194
1553 Ga0495584_0106586
1554 Ga0495585_0061660
1555 Ga0495585_0125472
1556 Ga0495594_0000170
1557 Ga0495594_0086680
1558 Ga0495607_0070149
1559 Ga0495607_0161192
1560 Ga0495607_0259189
1561 Ga0495583_0111949
1562 Ga0495583_0187388
1563 Ga0495606_0025242
1564 Ga0495606_0298667
1565 Ga0495608_0009906
1566 Ga0495608_0073325
1567 Ga0495610_0017507
1568 Ga0495616_0100955
1569 Ga0495618_0060568
1570 Ga0495618_0107227
1571 Ga0495618_0115478
1572 Ga0495620_0028647
1573 Ga0495628_0031335
1574 Ga0495628_0051848
1575 Ga0495628_0079160
1576 Ga0495631_0136597
1577 Ga0495631_0159190
1578 Ga0495643_0118196
1579 Ga0495648_0002829
1580 Ga0495648_0012566
1581 Ga0495648_0087717
1582 Ga0495648_0097974
1583 Ga0495666_0003580
1584 Ga0495652_0005458
1585 Ga0495652_0005882
1586 Ga0495652_0142977
1587 Ga0495654_0134236
1588 Ga0495665_0000158
1589 Ga0495665_0067607
1590 Ga0495640_0015043
1591 Ga0495640_0028879
1592 Ga0495640_0050475
1593 Ga0495640_0220330
1594 Ga0495587_0008038
1595 Ga0495587_0157027
1596 Ga0495598_0017810
1597 Ga0495597_0223582
1598 Ga0495645_0010468
1599 Ga0495622_0018938
1600 Ga0495622_0052375
1601 Ga0495622_0072868
1602 Ga0495667_0005992
1603 Ga0495667_0008458
1604 Ga0495667_0329276
1605 Ga0495656_0058931
1606 Ga0495656_0063515
1607 Ga0495668_0044558
1608 Ga0495668_0060956
1609 Ga0495668_0153014
1610 Ga0495668_0224752
1611 Ga0495668_0425504
1612 Ga0495668_0481706
1613 Ga0495634_0000354
1614 Ga0495634_0044463
1615 Ga0495625_0108166
1616 Ga0495625_0206080
1617 Ga0495625_0235636
1618 Ga0495625_0407981
1619 Ga0495635_0000179
1620 Ga0495635_0029811
1621 Ga0495635_0039091
1622 Ga0495659_0034268
1623 Ga0495661_0012280
1624 Ga0495588_0001137
1625 Ga0495588_0030267
1626 Ga0495588_0174778
1627 Ga0495657_0002384
1628 Ga0495599_0049233
1629 Ga0495623_0013961
1630 Ga0495623_0197544
1631 Ga0495623_0202305
1632 Ga0495623_0294893
1633 Ga0495623_0338856
1634 Ga0495646_0103280
1635 Ga0495646_0390608
1636 Ga0495647_0000068
1637 Ga0495658_0000428
1638 Ga0495669_0012020
1639 Ga0495669_0149446
1640 Ga0495613_0015638
1641 Ga0495613_0056042
1642 Ga0495613_0184516
1643 Ga0495624_0010213
1644 Ga0495624_0132283
1645 Ga0495624_0314973
1646 Ga0495624_0418542
1647 Ga0495670_0012601
1648 Ga0495671_0025533
1649 Ga0495671_0069985
1650 Ga0495671_0143422
1651 Ga0495649_0037274
1652 Ga0495649_0107005
1653 Ga0495589_0228599
1654 Ga0495600_0021305
1655 Ga0495600_0047916
1656 Ga0495660_0022925
1657 Ga0495581_0000004
1658 Ga0495581_0013854
1659 Ga0495581_0047767
1660 Ga0495604_0002741
1661 Ga0495604_0145613
1662 Ga0495604_0175414
1663 Ga0495604_0280002
1664 Ga0495636_0029585
1665 Ga0495674_0000415
1666 Ga0495674_0018174
1667 Ga0495674_0163154
1668 Ga0495674_0241600
1669 Ga0495676_0050060
1670 Ga0495676_0054205
1671 Ga0495680_0001876
1672 Ga0495680_0095170
1673 Ga0495683_0128554
1674 Ga0495683_0133044
1675 Ga0495683_0197211
1676 Ga0495675_0007387
1677 Ga0495675_0047111
1678 Ga0495677_0032399
1679 Ga0495673_0006914
1680 Ga0495673_0064011
1681 Ga0495673_0174179
1682 Ga0495684_0021327
1683 Ga0495686_0116808
1684 Ga0495686_0203948
1685 Ga0495686_0208156
1686 Ga0495686_0258037
1687 Ga0495686_0271448
1688 Ga0495593_0000198
1689 Ga0495602_0043056
1690 Ga0495602_0123078
1691 Ga0495626_0108988
1692 Ga0496100_0117445
1693 Ga0496100_0126267
1694 Ga0496100_0583701
1695 Ga0496101_0130825
1696 Ga0496101_0138158
1697 Ga0496101_0223664
1698 Ga0496101_0394043
1699 Ga0496102_0020294
1700 Ga0496102_0069096
1701 Ga0496102_0155526
1702 Ga0496102_0215653
1703 Ga0496103_0160058
1704 Ga0496103_0203537
1705 Ga0496103_0366621
1706 Ga0496104_0009070
1707 Ga0496104_0018816
1708 Ga0496104_0299737
1709 Ga0496105_0036292
1710 Ga0496105_0201087
1711 Ga0496106_0013477
1712 Ga0496106_0186460
1713 Ga0496106_0321064
1714 Ga0496106_0365234
1715 Ga0496106_0611907
1716 Ga0496107_0026324
1717 Ga0496107_0066674
1718 Ga0496107_0257753
1719 Ga0496108_0007465
1720 Ga0496108_0205236
1721 Ga0496108_0406946
1722 Ga0496109_0000609
1723 Ga0496109_0600231
1724 Ga0496110_0008924
1725 Ga0496110_0051009
1726 Ga0496110_0106590
1727 Ga0496110_0188518
1728 Ga0496111_0248764
1729 Ga0496112_0002437
1730 Ga0496112_0063507
1731 Ga0496112_0158624
1732 Ga0496112_0208189
1733 Ga0496112_0240664
1734 Ga0496112_0475644
1735 Ga0496112_0541120
1736 Ga0496112_0591305
1737 Ga0496113_0023429
1738 Ga0496113_0186428
1739 Ga0496114_0052300
1740 Ga0496114_0596401
1741 Ga0496114_1155065
1742 Ga0496115_0042539
1743 Ga0496115_0148788
1744 Ga0496115_0172020
1745 Ga0496116_0000965
1746 Ga0496117_0014058
1747 Ga0496117_0034522
1748 Ga0496117_0037972
1749 Ga0496117_0169203
1750 Ga0496117_0292105
1751 Ga0496117_0330976
1752 Ga0496118_0003027
1753 Ga0496118_0010242
1754 Ga0496118_0098113
1755 Ga0496118_0136894
1756 Ga0496118_0219477
1757 Ga0496119_0065293
1758 Ga0496119_0099673
1759 Ga0496119_0200392
1760 Ga0496120_0094039
1761 Ga0496121_0001622
1762 Ga0496121_0002689
1763 Ga0496121_0009316
1764 Ga0496121_0023791
1765 Ga0496121_0047888
1766 Ga0496121_0049586
1767 Ga0496121_0107036
1768 Ga0496121_0111268
1769 Ga0496121_0189225
1770 Ga0496121_0216276
1771 Ga0496122_0081574
1772 Ga0496122_0307107
1773 Ga0496123_0049608
1774 Ga0496124_0002957
1775 Ga0496124_0245021
1776 Ga0496124_0269286
1777 Ga0496125_0001630
1778 Ga0496125_0076533
1779 Ga0496125_0094047
1780 Ga0496125_0099905
1781 Ga0496125_0135884
1782 Ga0496126_0003472
1783 Ga0496126_0003803
1784 Ga0496126_0022661
1785 Ga0496126_0033427
1786 Ga0496126_0062063
1787 Ga0496126_0074642
1788 Ga0496126_0085033
1789 Ga0496126_0128008
1790 Ga0496126_0132568
1791 Ga0496126_0138734
1792 Ga0496126_0166265
1793 Ga0496126_0176282
1794 Ga0496126_0786760
1795 Ga0495682_0139544
1796 Ga0495682_0168838
1797 Ga0501031_0003114
1798 Ga0501031_0031671
1799 Ga0501032_0000762
1800 Ga0501032_0051974
1801 Ga0501032_0094743
1802 Ga0501033_0000136
1803 Ga0501034_0000251
1804 Ga0501036_0000036
1805 Ga0501036_0236357
1806 Ga0501036_0429974
1807 Ga0501036_0721492
1808 Ga0501037_0000867
1809 Ga0501037_0506296
1810 Ga0501038_0000428
1811 Ga0501038_0132405
1812 Ga0501039_0000273
1813 Ga0501039_0050295
1814 Ga0501039_0208823
1815 Ga0501042_0010927
1816 Ga0501043_0000165
1817 Ga0501043_0656988
1818 Ga0501046_0000839
1819 Ga0501046_0235849
1820 Ga0501047_0000340
1821 Ga0501047_0041364
1822 Ga0501047_0313117
1823 Ga0501048_0001309
1824 Ga0501048_0127719
1825 Ga0501067_0000457
1826 Ga0501067_0013941
1827 Ga0501067_0395309
1828 Ga0501068_0000839
1829 Ga0501068_0136215
1830 Ga0501069_0008491
1831 Ga0501070_0000971
1832 Ga0501071_0088114
1833 Ga0501071_0134855
1834 Ga0501072_0003301
1835 Ga0501072_0422464
1836 Ga0501072_0434625
1837 Ga0501073_0000037
1838 Ga0501073_0074644
1839 Ga0501074_0037310
1840 Ga0501076_0383952
1841 Ga0501076_0514584
1842 Ga0501077_0175557
1843 Ga0501079_0002302
1844 Ga0501080_0006603
1845 Ga0501080_1011448
1846 Ga0501083_0001812
1847 Ga0501035_0000142
1848 Ga0501044_0000414
1849 Ga0501044_0021563
1850 Ga0501044_0467028
1851 Ga0501045_0002539
1852 Ga0501045_0115652
1853 nmdc:mga03n38_20242_c1
1854 nmdc:mga03n38_225627_c1
1855 nmdc:mga03n38_336891_c1
1856 nmdc:mga00v17_266897_c1
1857 nmdc:mga00v17_31303_c1
1858 nmdc:mga0yw44_183313_c1
1859 nmdc:mga0yw44_203975_c1
1860 nmdc:mga0yw44_370018_c1
1861 nmdc:mga0yw44_38229_c1
1862 nmdc:mga0yw44_38444_c1
1863 nmdc:mga0k408_135340_c1
1864 nmdc:mga0k408_34806_c1
1865 nmdc:mga06z11_27972_c1
1866 nmdc:mga06z11_41041_c1
1867 nmdc:mga06z11_61431_c1
1868 nmdc:mga06z11_72222_c1
1869 nmdc:mga06z11_84378_c1
1870 nmdc:mga04h51_80619_c1
1871 nmdc:mga07m45_142421_c1
1872 nmdc:mga07m45_147292_c1
1873 nmdc:mga05p37_811294_c1
1874 nmdc:mga08y16_40533_c1
1875 nmdc:mga0n895_15181_c1
1876 nmdc:mga0n895_161206_c1
1877 nmdc:mga0n895_247010_c1
1878 nmdc:mga0rr50_88622_c1
1879 nmdc:mga08x19_275118_c1
1880 nmdc:mga0sz30_1774_c1
1881 nmdc:mga0sz30_32158_c1
1882 nmdc:mga0sz30_73654_c1
1883 Ga0495601_0029491
1884 Ga0495601_0221445
1885 Ga0500635_0140244
1886 Ga0495595_0034044
1887 Ga0495619_0149002
1888 Ga0495619_0283258
1889 Ga0500578_0040493
1890 Ga0500578_0308065
1891 Ga0500578_0413856
1892 Ga0500643_000048
1893 Ga0500643_012220
1894 Ga0500581_167153
1895 Ga0500647_0003150
1896 Ga0500583_0114375
1897 Ga0500651_0016774
1898 Ga0500651_0080962
1899 Ga0500651_0167795
1900 Ga0500566_0000126
1901 Ga0500566_0001615
1902 Ga0500566_0002605
1903 Ga0500566_0032785
1904 Ga0500640_003090
1905 Ga0500641_0005231
1906 Ga0500641_0005276
1907 Ga0500648_072568
1908 Ga0500650_0002007
1909 Ga0500556_0137217
1910 Ga0500556_0207441
1911 Ga0500557_119428
1912 Ga0500562_040306
1913 Ga0500562_044557
1914 Ga0500569_010177
1915 Ga0500569_017337
1916 Ga0500572_000152
1917 Ga0500572_003010
1918 Ga0500594_0008171
1919 Ga0500595_000333
1920 Ga0500595_000497
1921 Ga0500595_010458
1922 Ga0500595_030978
1923 Ga0500607_146783
1924 Ga0500614_001649
1925 Ga0500618_013821
1926 Ga0500642_0000015
1927 Ga0500642_0005741
1928 Ga0500642_0123977
1929 Ga0500652_010728
1930 Ga0500652_188156
1931 Ga0500658_0024606
1932 Ga0500658_0153129
1933 Ga0500559_0000230
1934 Ga0500559_0001714
1935 Ga0500559_0052763
1936 Ga0500559_0074726
1937 Ga0500564_052876
1938 Ga0500568_0000536
1939 Ga0500568_0007618
1940 Ga0500568_0028888
1941 Ga0500568_0052623
1942 Ga0500577_0092611
1943 Ga0500588_0078594
1944 Ga0500589_138875
1945 Ga0500590_080589
1946 Ga0500603_000304
1947 Ga0500603_004209
1948 Ga0500604_0055704
1949 Ga0500616_0000033
1950 Ga0500616_0147958
1951 Ga0500622_0013268
1952 Ga0500622_0061141
1953 Ga0500622_0254306
1954 Ga0500627_0027552
1955 Ga0500627_0072823
1956 Ga0500630_002602
1957 Ga0500634_0050414
1958 Ga0500634_0097771
1959 Ga0500638_005288
1960 Ga0500638_048231
1961 Ga0500639_000039
1962 Ga0500636_0015308
1963 Ga0500636_0033475
1964 Ga0500636_0146675
1965 Ga0500637_0000060
1966 Ga0500576_016710
1967 Ga0500576_118437
1968 Ga0500645_113256
1969 Ga0500552_000562
1970 Ga0500596_001647
1971 Ga0500599_000986
1972 Ga0500601_000280
1973 Ga0501084_0005116
1974 Ga0501084_0301392
1975 Ga0500661_031303
1976 Ga0501082_0004333
1977 Ga0501082_0134273
1978 Ga0530510_0014062
1979 Ga0530510_0569704
1980 2644290519

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

51

145

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h00-assembly1.cif.gz_A-2 crystal structure of human pyridoxine 5-phophate oxidase, r116q variant 0.801 55 135
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.7771 42 163
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7537 43 166
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.7531 43 160
3db0-assembly1.cif.gz_A crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.7465 45 167
ID Description Score Start End Superfamily
6h00A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.801 55 135 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7816 42 163 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7633 43 167 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.752 43 167 2.30.110.10
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7462 55 160 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1P8FH70-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9273 40 178
AF-A0A529AB23-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9219 38 169
AF-A0A503EBD2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9218 38 169
AF-A0A4R4ZX25-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9217 39 169
AF-L0KGM4-F1-model_v4 PPOX class probable FMN-dependent enzyme, DR_2398 family 0.9217 38 169

Map