F487582

General Info

Members Datasets Scaffolds Average Seq Length
989 468 938 276

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10037408|Ga0070710_100374082
Length 308
Sequence LNESHPSCQKVFAMVLSSMTGFARSHGASGPYTFEWELKSVNAKGFDLRFRVPQGWDELEAFAKKRAGEVLSRGTVYANLNVKRSNAASAVRINEDVLASIVKVAGTLAQRIDAVAPSIDGLLGIKGVIEVVEPESDXXXDKAAMDAAAKAFEEALDHLVEMRRREGAALGQILQQRMDQIERLAKKAEAAPGRKPEAIRARLAEQIAALLETSDRFDPDRLTQEAILIATKADIREELDRIASHIAQAREMIGKGGPVGRRLDFLAQEFNREVNTCCSKSNDIELTNTGLEMKNVVEQFREQVQNLE

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2791355199
17 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
18 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
19 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
20 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
21 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
24 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
25 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
26 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
27 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
28 2904699407
29 2906610324
30 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
31 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
32 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
33 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
34 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
35 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
36 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
37 2922425934
38 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
39 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
40 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
41 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
42 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
116 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
203 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
251 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
262 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
263 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
385 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
386 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
387 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
400 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
409 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
421 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
422 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
423 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
429 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
430 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
431 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
432 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
433 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
434 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
435 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
436 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
437 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
438 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
441 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
442 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
446 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
449 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
450 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
451 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
452 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
453 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
456 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
459 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
460 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
461 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
462 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
463 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
464 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
465 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
466 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
467 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
468 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 0.2
Isolates 4.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.74
Nodule 3.94
Rhizoplane 7.28
Rhizosphere 68.05
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008223 3300001979 Bacteria 4176
2 JGI24735J21928_10025237 3300002067 Bacteria 1794
3 JGI25406J46586_10000152 3300003203 Bacteria 30382
4 JGI25406J46586_10003672 3300003203 Bacteria 7190
5 JGI25406J46586_10018257 3300003203 Bacteria 2885
6 Ga0065165_1001750 3300005262 Bacteria 21614
7 Ga0065165_1008548 3300005262 Bacteria 4763
8 Ga0070658_10062966 3300005327 Bacteria 3023
9 Ga0070658_10117643 3300005327 Bacteria 2207
10 Ga0070676_10045828 3300005328 Bacteria 2548
11 Ga0070683_100235899 3300005329 Bacteria 1739
12 Ga0070683_100370811 3300005329 Bacteria 1364
13 Ga0070680_100123971 3300005336 Bacteria 2158
14 Ga0070682_100116438 3300005337 Bacteria 1788
15 Ga0068868_100043717 3300005338 Bacteria 3500
16 Ga0068868_100156056 3300005338 Bacteria 1882
17 Ga0068868_100248107 3300005338 Bacteria 1498
18 Ga0070660_100010407 3300005339 Bacteria 6575
19 Ga0070689_100007115 3300005340 Bacteria 7795
20 Ga0070661_100113258 3300005344 Bacteria 2027
21 Ga0070661_100131994 3300005344 Bacteria 1877
22 Ga0070668_100012922 3300005347 Bacteria 6218
23 Ga0070669_100055043 3300005353 Bacteria 2915
24 Ga0070669_100088284 3300005353 Bacteria 2321
25 Ga0070675_100299770 3300005354 Bacteria 1416
26 Ga0070671_100045468 3300005355 Bacteria 3650
27 Ga0070671_100168389 3300005355 Bacteria 1853
28 Ga0070671_100308084 3300005355 Bacteria 1348
29 Ga0070671_100313382 3300005355 Bacteria 1337
30 Ga0070674_100296878 3300005356 Bacteria 1287
31 Ga0070709_10001793 3300005434 Bacteria 11659
32 Ga0070709_10017837 3300005434 Bacteria 4078
33 Ga0070709_10249165 3300005434 Bacteria 1279
34 Ga0070714_100002869 3300005435 Bacteria 12748
35 Ga0070714_100060983 3300005435 Bacteria 3238
36 Ga0070714_100299368 3300005435 Bacteria 1499
37 Ga0070713_100006492 3300005436 Bacteria 8113
38 Ga0070713_100181081 3300005436 Bacteria 1894
39 Ga0070710_10001067 3300005437 Bacteria 12984
40 Ga0070710_10008800 3300005437 Bacteria 4924
41 Ga0070710_10037408 3300005437 Bacteria 2659
42 Ga0070711_100007374 3300005439 Bacteria 6690
43 Ga0070711_100017125 3300005439 Bacteria 4610
44 Ga0070711_100082054 3300005439 Bacteria 2300
45 Ga0070700_100081308 3300005441 Bacteria 2093
46 Ga0070700_100087884 3300005441 Bacteria 2021
47 Ga0070663_100004362 3300005455 Bacteria 8299
48 Ga0070663_100052418 3300005455 Bacteria 2909
49 Ga0070663_100066326 3300005455 Bacteria 2615
50 Ga0070663_100116293 3300005455 Bacteria 2015
51 Ga0070678_100024234 3300005456 Bacteria 4059
52 Ga0070678_100040180 3300005456 Bacteria 3307
53 Ga0070678_100169920 3300005456 Bacteria 1775
54 Ga0070662_100103498 3300005457 Bacteria 2159
55 Ga0070662_100120984 3300005457 Bacteria 2006
56 Ga0070681_10056806 3300005458 Bacteria 3895
57 Ga0070681_10217928 3300005458 Bacteria 1824
58 Ga0068867_100202463 3300005459 Bacteria 1590
59 Ga0070698_100249872 3300005471 Bacteria 1706
60 Ga0070679_100031881 3300005530 Bacteria 5210
61 Ga0070684_100364541 3300005535 Bacteria 1330
62 Ga0068853_100005075 3300005539 Bacteria 10272
63 Ga0068853_100031569 3300005539 Bacteria 4481
64 Ga0068853_100061828 3300005539 Bacteria 3239
65 Ga0070672_100170980 3300005543 Bacteria 1807
66 Ga0070686_100153504 3300005544 Bacteria 1615
67 Ga0070665_100050963 3300005548 Bacteria 4153
68 Ga0070665_100092227 3300005548 Bacteria 3034
69 Ga0070665_100184796 3300005548 Bacteria 2085
70 Ga0070665_100214785 3300005548 Bacteria 1924
71 Ga0070704_100109564 3300005549 Bacteria 2098
72 Ga0068855_100019340 3300005563 Bacteria 8183
73 Ga0068855_100028482 3300005563 Bacteria 6682
74 Ga0068855_100042552 3300005563 Bacteria 5381
75 Ga0068855_100055064 3300005563 Bacteria 4673
76 Ga0068855_100500802 3300005563 Bacteria 1320
77 Ga0070664_100055529 3300005564 Bacteria 3363
78 Ga0068857_100022108 3300005577 Bacteria 5595
79 Ga0068857_100068632 3300005577 Bacteria 3155
80 Ga0068857_100143704 3300005577 Bacteria 2158
81 Ga0068857_100158294 3300005577 Bacteria 2054
82 Ga0068854_100005468 3300005578 Bacteria 8025
83 Ga0068854_100028453 3300005578 Bacteria 3862
84 Ga0068854_100054844 3300005578 Bacteria 2868
85 Ga0068854_100208609 3300005578 Bacteria 1540
86 Ga0068856_100000205 3300005614 Bacteria 63226
87 Ga0068856_100004002 3300005614 Bacteria 14756
88 Ga0068856_100071140 3300005614 Bacteria 3443
89 Ga0068856_100434550 3300005614 Bacteria 1333
90 Ga0070702_100154258 3300005615 Bacteria 1478
91 Ga0068852_100006605 3300005616 Bacteria 8399
92 Ga0068852_100046472 3300005616 Bacteria 3700
93 Ga0068852_100100140 3300005616 Bacteria 2614
94 Ga0068852_100322161 3300005616 Bacteria 1501
95 Ga0068852_100353653 3300005616 Bacteria 1435
96 Ga0068859_100133789 3300005617 Bacteria 2551
97 Ga0068864_100027748 3300005618 Bacteria 4784
98 Ga0068864_100090642 3300005618 Bacteria 2695
99 Ga0068864_100135901 3300005618 Bacteria 2214
100 Ga0068866_10152513 3300005718 Bacteria 1339
101 Ga0068851_10001483 3300005834 Bacteria 10294
102 Ga0068851_10064950 3300005834 Bacteria 1877
103 Ga0068863_100141926 3300005841 Bacteria 2296
104 Ga0068863_100458343 3300005841 Bacteria 1252
105 Ga0068858_100083289 3300005842 Bacteria 2974
106 Ga0068860_100000316 3300005843 Bacteria 65709
107 Ga0068860_100026198 3300005843 Bacteria 5622
108 Ga0068862_100106293 3300005844 Bacteria 2460
109 Ga0068862_100258420 3300005844 Bacteria 1589
110 Ga0081455_10003466 3300005937 Bacteria 18131
111 Ga0081455_10003832 3300005937 Bacteria 17150
112 Ga0081455_10008528 3300005937 Bacteria 10640
113 Ga0081455_10008869 3300005937 Bacteria 10399
114 Ga0081455_10038535 3300005937 Bacteria 4232
115 Ga0081538_10110897 3300005981 Bacteria 1347
116 Ga0081540_1000913 3300005983 Bacteria 26625
117 Ga0081540_1003736 3300005983 Bacteria 11927
118 Ga0081540_1003874 3300005983 Bacteria 11677
119 Ga0081540_1005905 3300005983 Bacteria 9036
120 Ga0081540_1010410 3300005983 Bacteria 6304
121 Ga0081540_1010937 3300005983 Bacteria 6095
122 Ga0081540_1017125 3300005983 Bacteria 4499
123 Ga0081540_1030043 3300005983 Bacteria 3016
124 Ga0081539_10000273 3300005985 Bacteria 117936
125 Ga0081539_10000735 3300005985 Bacteria 65597
126 Ga0081539_10001242 3300005985 Bacteria 45360
127 Ga0081539_10013306 3300005985 Bacteria 6210
128 Ga0070717_10027316 3300006028 Bacteria 4561
129 Ga0075365_10000141 3300006038 Bacteria 22527
130 Ga0075365_10004501 3300006038 Bacteria 7397
131 Ga0075365_10020048 3300006038 Bacteria 4138
132 Ga0075365_10061671 3300006038 Bacteria 2505
133 Ga0075363_100007043 3300006048 Bacteria 5140
134 Ga0075363_100021765 3300006048 Bacteria 3235
135 Ga0075363_100032594 3300006048 Bacteria 2708
136 Ga0075364_10033462 3300006051 Bacteria 3310
137 Ga0075364_10038689 3300006051 Bacteria 3090
138 Ga0075364_10205542 3300006051 Bacteria 1335
139 Ga0070715_10000178 3300006163 Bacteria 14781
140 Ga0070716_100016704 3300006173 Bacteria 3793
141 Ga0070716_100035837 3300006173 Bacteria 2730
142 Ga0070712_100003228 3300006175 Bacteria 10049
143 Ga0070712_100030867 3300006175 Bacteria 3606
144 Ga0070712_100034527 3300006175 Bacteria 3428
145 Ga0070712_100043122 3300006175 Bacteria 3104
146 Ga0075362_10041433 3300006177 Bacteria 2031
147 Ga0075367_10046962 3300006178 Bacteria 2539
148 Ga0075367_10113667 3300006178 Bacteria 1664
149 Ga0075367_10123296 3300006178 Bacteria 1598
150 Ga0075367_10218117 3300006178 Bacteria 1193
151 Ga0075369_10023292 3300006186 Bacteria 2559
152 Ga0075369_10029054 3300006186 Bacteria 2320
153 Ga0075369_10053654 3300006186 Bacteria 1749
154 Ga0075369_10082956 3300006186 Bacteria 1423
155 Ga0075369_10083542 3300006186 Bacteria 1418
156 Ga0075366_10208871 3300006195 Bacteria 1188
157 Ga0097621_100192366 3300006237 Bacteria 1767
158 Ga0075370_10033181 3300006353 Bacteria 2889
159 Ga0075370_10087001 3300006353 Bacteria 1800
160 Ga0075428_100074905 3300006844 Bacteria 3697
161 Ga0075434_100112461 3300006871 Bacteria 2734
162 Ga0097620_100133791 3300006931 Bacteria 2551
163 Ga0099824_1004785 3300006942 Bacteria 19361
164 Ga0099822_1002380 3300006943 Bacteria 23355
165 Ga0099794_10062614 3300007265 Bacteria 1809
166 Ga0099794_10062743 3300007265 Bacteria 1808
167 Ga0099795_10001501 3300007788 Bacteria 5093
168 Ga0105240_10012605 3300009093 Bacteria 11658
169 Ga0105240_10020975 3300009093 Bacteria 8696
170 Ga0105240_10035586 3300009093 Bacteria 6415
171 Ga0111539_10394785 3300009094 Bacteria 1611
172 Ga0105245_10109432 3300009098 Bacteria 2568
173 Ga0105245_10240174 3300009098 Bacteria 1756
174 Ga0105245_10248483 3300009098 Bacteria 1727
175 Ga0105245_10310952 3300009098 Bacteria 1549
176 Ga0105247_10041793 3300009101 Bacteria 2806
177 Ga0105247_10094353 3300009101 Bacteria 1903
178 Ga0114129_10166595 3300009147 Bacteria 3007
179 Ga0105243_10017871 3300009148 Bacteria 5365
180 Ga0105243_10353430 3300009148 Bacteria 1350
181 Ga0105241_10003781 3300009174 Bacteria 11223
182 Ga0105242_10120948 3300009176 Bacteria 2247
183 Ga0105242_10457612 3300009176 Bacteria 1204
184 Ga0105248_10374482 3300009177 Bacteria 1603
185 Ga0105248_10500391 3300009177 Bacteria 1370
186 Ga0105237_10011938 3300009545 Bacteria 9181
187 Ga0105237_10012243 3300009545 Bacteria 9042
188 Ga0105237_10159612 3300009545 Bacteria 2253
189 Ga0105237_10345618 3300009545 Bacteria 1492
190 Ga0105237_10395226 3300009545 Bacteria 1387
191 Ga0105238_10001429 3300009551 Bacteria 23949
192 Ga0105238_10002798 3300009551 Bacteria 17414
193 Ga0105238_10112048 3300009551 Bacteria 2708
194 Ga0105238_10112321 3300009551 Bacteria 2704
195 Ga0105238_10210001 3300009551 Bacteria 1923
196 Ga0105238_10294232 3300009551 Bacteria 1606
197 Ga0099796_10003434 3300010159 Bacteria 3675
198 Ga0099796_10004964 3300010159 Bacteria 3277
199 Ga0099796_10013619 3300010159 Bacteria 2327
200 Ga0105239_10002676 3300010375 Bacteria 22436
201 Ga0105239_10017902 3300010375 Bacteria 7836
202 Ga0105239_10033786 3300010375 Bacteria 5615
203 Ga0105239_10059881 3300010375 Bacteria 4178
204 Ga0105239_10158066 3300010375 Bacteria 2532
205 Ga0105239_10384386 3300010375 Bacteria 1587
206 Ga0105239_10591676 3300010375 Bacteria 1265
207 Ga0105246_10093444 3300011119 Bacteria 2173
208 Ga0157373_10144467 3300013100 Bacteria 1673
209 Ga0157370_10015624 3300013104 Bacteria 7711
210 Ga0157370_10052947 3300013104 Bacteria 3872
211 Ga0157370_10237211 3300013104 Bacteria 1688
212 Ga0157369_10000996 3300013105 Bacteria 35806
213 Ga0157369_10007824 3300013105 Bacteria 12302
214 Ga0157369_10173167 3300013105 Bacteria 2273
215 Ga0157369_10225938 3300013105 Bacteria 1958
216 Ga0157374_10437459 3300013296 Bacteria 1308
217 Ga0157374_10694633 3300013296 Bacteria 1030
218 Ga0157378_10006214 3300013297 Bacteria 10456
219 Ga0157378_10273428 3300013297 Bacteria 1626
220 Ga0163162_10037734 3300013306 Bacteria 4822
221 Ga0163162_10147576 3300013306 Bacteria 2469
222 Ga0157372_10086103 3300013307 Bacteria 3565
223 Ga0157372_10179791 3300013307 Bacteria 2448
224 Ga0157375_10249811 3300013308 Bacteria 1934
225 Ga0163163_10006000 3300014325 Bacteria 10568
226 Ga0163163_10014928 3300014325 Bacteria 7157
227 Ga0163163_10048230 3300014325 Bacteria 4188
228 Ga0163163_10246170 3300014325 Bacteria 1838
229 Ga0163163_10382651 3300014325 Bacteria 1465
230 Ga0157380_10145885 3300014326 Bacteria 2040
231 Ga0157380_10152136 3300014326 Bacteria 2001
232 Ga0157380_10267482 3300014326 Bacteria 1556
233 Ga0157379_10100460 3300014968 Bacteria 2596
234 Ga0157379_10124348 3300014968 Bacteria 2321
235 Ga0157379_10276709 3300014968 Bacteria 1527
236 Ga0157376_10046977 3300014969 Bacteria 3563
237 Ga0157376_10055961 3300014969 Bacteria 3293
238 Ga0157376_10218760 3300014969 Bacteria 1763
239 Ga0157376_10532900 3300014969 Bacteria 1159
240 Ga0163161_10095861 3300017792 Bacteria 2201
241 Ga0213874_10012710 3300021377 Bacteria 2165
242 Ga0213876_10040414 3300021384 Bacteria 2464
243 Ga0213876_10128096 3300021384 Bacteria 1349
244 Ga0209564_1017177 3300025295 Bacteria 2836
245 Ga0209758_1003772 3300025297 Bacteria 13381
246 Ga0209758_1005082 3300025297 Bacteria 10418
247 Ga0209758_1017949 3300025297 Bacteria 3494
248 Ga0207656_10011620 3300025321 Bacteria 3332
249 Ga0207692_10000694 3300025898 Bacteria 11852
250 Ga0207692_10006740 3300025898 Bacteria 4670
251 Ga0207692_10040745 3300025898 Bacteria 2294
252 Ga0207642_10209410 3300025899 Bacteria 1082
253 Ga0207710_10010831 3300025900 Bacteria 3840
254 Ga0207688_10030797 3300025901 Bacteria 2960
255 Ga0207688_10177806 3300025901 Bacteria 1268
256 Ga0207647_10040791 3300025904 Bacteria 2921
257 Ga0207647_10211031 3300025904 Bacteria 1121
258 Ga0207685_10000188 3300025905 Bacteria 9423
259 Ga0207699_10003013 3300025906 Bacteria 8006
260 Ga0207699_10005980 3300025906 Bacteria 5857
261 Ga0207699_10185649 3300025906 Bacteria 1400
262 Ga0207699_10196897 3300025906 Bacteria 1363
263 Ga0207645_10092911 3300025907 Bacteria 1941
264 Ga0207705_10060763 3300025909 Bacteria 2730
265 Ga0207684_10197212 3300025910 Bacteria 1737
266 Ga0207654_10000308 3300025911 Bacteria 29561
267 Ga0207654_10008665 3300025911 Bacteria 5155
268 Ga0207654_10075082 3300025911 Bacteria 2019
269 Ga0207707_10000713 3300025912 Bacteria 32997
270 Ga0207707_10120412 3300025912 Bacteria 2294
271 Ga0207707_10252335 3300025912 Bacteria 1532
272 Ga0207695_10001719 3300025913 Bacteria 35011
273 Ga0207695_10001812 3300025913 Bacteria 33654
274 Ga0207695_10015101 3300025913 Bacteria 9111
275 Ga0207695_10019186 3300025913 Bacteria 7878
276 Ga0207695_10125342 3300025913 Bacteria 2531
277 Ga0207671_10008038 3300025914 Bacteria 9019
278 Ga0207671_10012301 3300025914 Bacteria 6888
279 Ga0207671_10045012 3300025914 Bacteria 3263
280 Ga0207693_10013902 3300025915 Bacteria 6482
281 Ga0207693_10036094 3300025915 Bacteria 3896
282 Ga0207693_10039343 3300025915 Bacteria 3724
283 Ga0207693_10054711 3300025915 Bacteria 3130
284 Ga0207693_10085133 3300025915 Bacteria 2477
285 Ga0207663_10019519 3300025916 Bacteria 3821
286 Ga0207663_10130835 3300025916 Bacteria 1733
287 Ga0207663_10192280 3300025916 Bacteria 1466
288 Ga0207660_10007065 3300025917 Bacteria 7274
289 Ga0207657_10001786 3300025919 Bacteria 23206
290 Ga0207657_10008840 3300025919 Bacteria 10189
291 Ga0207649_10030165 3300025920 Bacteria 3208
292 Ga0207649_10104861 3300025920 Bacteria 1878
293 Ga0207649_10119751 3300025920 Bacteria 1773
294 Ga0207652_10004315 3300025921 Bacteria 11591
295 Ga0207652_10011414 3300025921 Bacteria 7162
296 Ga0207652_10059661 3300025921 Bacteria 3289
297 Ga0207694_10000157 3300025924 Bacteria 70076
298 Ga0207694_10016368 3300025924 Bacteria 5599
299 Ga0207650_10183898 3300025925 Bacteria 1667
300 Ga0207700_10006113 3300025928 Bacteria 7250
301 Ga0207700_10015910 3300025928 Bacteria 4980
302 Ga0207700_10293584 3300025928 Bacteria 1402
303 Ga0207664_10026024 3300025929 Bacteria 4417
304 Ga0207664_10036839 3300025929 Bacteria 3782
305 Ga0207664_10360527 3300025929 Bacteria 1288
306 Ga0207644_10041067 3300025931 Bacteria 3271
307 Ga0207644_10366948 3300025931 Bacteria 1172
308 Ga0207690_10122168 3300025932 Bacteria 1893
309 Ga0207690_10218022 3300025932 Bacteria 1458
310 Ga0207706_10080399 3300025933 Bacteria 2866
311 Ga0207709_10003187 3300025935 Bacteria 9854
312 Ga0207709_10050919 3300025935 Bacteria 2535
313 Ga0207670_10001178 3300025936 Bacteria 13805
314 Ga0207669_10114878 3300025937 Bacteria 1813
315 Ga0207669_10149850 3300025937 Bacteria 1632
316 Ga0207704_10048856 3300025938 Bacteria 2540
317 Ga0207704_10245142 3300025938 Bacteria 1341
318 Ga0207665_10000133 3300025939 Bacteria 49199
319 Ga0207665_10092774 3300025939 Bacteria 2095
320 Ga0207665_10166733 3300025939 Bacteria 1588
321 Ga0207691_10192860 3300025940 Bacteria 1776
322 Ga0207691_10519729 3300025940 Bacteria 1010
323 Ga0207711_10123431 3300025941 Bacteria 2314
324 Ga0207689_10446716 3300025942 Bacteria 1080
325 Ga0207661_10032141 3300025944 Bacteria 4063
326 Ga0207661_10466767 3300025944 Bacteria 1151
327 Ga0207667_10008867 3300025949 Bacteria 11906
328 Ga0207667_10021446 3300025949 Bacteria 7158
329 Ga0207667_10036579 3300025949 Bacteria 5260
330 Ga0207667_10080065 3300025949 Bacteria 3385
331 Ga0207667_10151566 3300025949 Bacteria 2386
332 Ga0207667_10165755 3300025949 Bacteria 2272
333 Ga0207651_10322340 3300025960 Bacteria 1292
334 Ga0207668_10022787 3300025972 Bacteria 4014
335 Ga0207668_10109860 3300025972 Bacteria 2066
336 Ga0207640_10004396 3300025981 Bacteria 7641
337 Ga0207640_10161197 3300025981 Bacteria 1660
338 Ga0207640_10296866 3300025981 Bacteria 1276
339 Ga0207703_10206134 3300026035 Bacteria 1750
340 Ga0207639_10000967 3300026041 Bacteria 19506
341 Ga0207639_10009512 3300026041 Bacteria 6711
342 Ga0207639_10148257 3300026041 Bacteria 1962
343 Ga0207678_10014057 3300026067 Bacteria 7039
344 Ga0207678_10015103 3300026067 Bacteria 6793
345 Ga0207678_10022191 3300026067 Bacteria 5562
346 Ga0207678_10031827 3300026067 Bacteria 4600
347 Ga0207678_10065751 3300026067 Bacteria 3113
348 Ga0207678_10106075 3300026067 Bacteria 2397
349 Ga0207708_10049108 3300026075 Bacteria 3212
350 Ga0207708_10067621 3300026075 Bacteria 2733
351 Ga0207708_10118703 3300026075 Bacteria 2060
352 Ga0207702_10000002 3300026078 Bacteria 491507
353 Ga0207702_10000048 3300026078 Bacteria 143125
354 Ga0207702_10009353 3300026078 Bacteria 8233
355 Ga0207702_10085355 3300026078 Bacteria 2751
356 Ga0207702_10413493 3300026078 Bacteria 1303
357 Ga0207641_10040916 3300026088 Bacteria 3883
358 Ga0207676_10018918 3300026095 Bacteria 5016
359 Ga0207676_10034159 3300026095 Bacteria 3849
360 Ga0207676_10128245 3300026095 Bacteria 2152
361 Ga0207674_10009623 3300026116 Bacteria 11024
362 Ga0207674_10012246 3300026116 Bacteria 9591
363 Ga0207674_10016714 3300026116 Bacteria 8018
364 Ga0207674_10021165 3300026116 Bacteria 7011
365 Ga0207674_10165583 3300026116 Bacteria 2165
366 Ga0207675_100009319 3300026118 Bacteria 9206
367 Ga0207675_100193732 3300026118 Bacteria 1950
368 Ga0207675_100730166 3300026118 Bacteria 1001
369 Ga0207683_10018675 3300026121 Bacteria 5915
370 Ga0207683_10089152 3300026121 Bacteria 2745
371 Ga0207683_10145291 3300026121 Bacteria 2139
372 Ga0207683_10146025 3300026121 Bacteria 2133
373 Ga0207683_10176699 3300026121 Bacteria 1935
374 Ga0207698_10104185 3300026142 Bacteria 2360
375 Ga0207698_10211229 3300026142 Bacteria 1746
376 Ga0207698_10318380 3300026142 Bacteria 1456
377 Ga0209589_1000001 3300027357 Bacteria 794224
378 Ga0209489_100001 3300027361 Bacteria 794224
379 Ga0209700_100001 3300027363 Bacteria 794224
380 Ga0209179_1005890 3300027512 Bacteria 1945
381 Ga0209588_1009775 3300027671 Bacteria 2872
382 Ga0209588_1062838 3300027671 Bacteria 1200
383 Ga0209813_10003784 3300027866 Bacteria 3570
384 Ga0207428_10072008 3300027907 Bacteria 2714
385 Ga0268266_10008946 3300028379 Bacteria 8862
386 Ga0268266_10014631 3300028379 Bacteria 6742
387 Ga0268266_10104493 3300028379 Bacteria 2501
388 Ga0268266_10219088 3300028379 Bacteria 1748
389 Ga0268266_10458810 3300028379 Bacteria 1212
390 Ga0268265_10369309 3300028380 Bacteria 1316
391 Ga0268265_10463385 3300028380 Bacteria 1186
392 Ga0268264_10000430 3300028381 Bacteria 58144
393 Ga0268264_10333220 3300028381 Bacteria 1439
394 Ga0268264_10465060 3300028381 Bacteria 1228
395 Ga0307517_10000772 3300028786 Bacteria 55020
396 Ga0265330_10010655 3300031235 Bacteria 4327
397 Ga0265330_10051587 3300031235 Bacteria 1803
398 Ga0265332_10023963 3300031238 Bacteria 2689
399 Ga0265332_10079482 3300031238 Bacteria 1391
400 Ga0265325_10035454 3300031241 Bacteria 2650
401 Ga0265329_10055044 3300031242 Bacteria 1263
402 Ga0265340_10003545 3300031247 Bacteria 8783
403 Ga0307509_10080753 3300031507 Bacteria 3362
404 Ga0307408_100101901 3300031548 Bacteria 2189
405 Ga0307408_100141225 3300031548 Bacteria 1891
406 Ga0307508_10000009 3300031616 Bacteria 256966
407 Ga0307508_10016890 3300031616 Bacteria 6642
408 Ga0307508_10029626 3300031616 Bacteria 4947
409 Ga0307508_10070541 3300031616 Bacteria 3067
410 Ga0265314_10021549 3300031711 Bacteria 4950
411 Ga0265314_10060303 3300031711 Bacteria 2590
412 Ga0265342_10023489 3300031712 Bacteria 3902
413 Ga0265342_10025587 3300031712 Bacteria 3708
414 Ga0265342_10029712 3300031712 Bacteria 3391
415 Ga0307516_10017411 3300031730 Bacteria 7493
416 Ga0307516_10125734 3300031730 Bacteria 2349
417 Ga0307405_10183430 3300031731 Bacteria 1505
418 Ga0307410_10253269 3300031852 Bacteria 1370
419 Ga0307412_10252472 3300031911 Bacteria 1370
420 Ga0307409_100079363 3300031995 Bacteria 2644
421 Ga0307414_10259134 3300032004 Bacteria 1450
422 Ga0307415_100318737 3300032126 Bacteria 1295
423 Ga0307510_10061898 3300033180 Bacteria 3830
424 Ga0307510_10212961 3300033180 Bacteria 1452
425 Ga0315911_1000001 3300033442 Bacteria 1088602
426 Ga0373934_0029660 3300035086 Bacteria 2137
427 Ga0373949_0009711 3300035090 Bacteria 2107
428 Ga0373923_0011853 3300035111 Bacteria 3209
429 Ga0373936_0005011 3300035113 Bacteria 4989
430 Ga0373936_0115641 3300035113 Bacteria 1142
431 Ga0373945_0007341 3300035116 Bacteria 3573
432 Ga0373953_0001976 3300035117 Bacteria 6102
433 Ga0373954_0000070 3300035118 Bacteria 36271
434 Ga0373954_0019610 3300035118 Bacteria 3052
435 Ga0373956_0001764 3300035119 Bacteria 8915
436 Ga0373956_0004017 3300035119 Bacteria 5910
437 Ga0373957_0079219 3300035120 Bacteria 1295
438 Ga0373943_0057054 3300035170 Bacteria 1939
439 Ga0373946_0002945 3300035171 Bacteria 6034
440 Ga0373955_0000771 3300035172 Bacteria 13748
441 Ga0373931_0138254 3300035691 Bacteria 1408
442 Ga0373935_0001652 3300035692 Bacteria 12461
443 Ga0373935_0043241 3300035692 Bacteria 2835
444 Ga0373927_0009182 3300035695 Bacteria 6635
445 Ga0373927_0012054 3300035695 Bacteria 5751
446 Ga0373927_0031720 3300035695 Bacteria 3443
447 Ga0373933_0000041 3300035724 Bacteria 79805
448 Ga0373933_0088427 3300035724 Bacteria 1909
449 Ga0373947_0000308 3300035725 Bacteria 27609
450 Ga0373947_0001951 3300035725 Bacteria 12629
451 Ga0373947_0098617 3300035725 Bacteria 1833
452 Ga0373947_0178507 3300035725 Bacteria 1381
453 Ga0373937_0014091 3300036401 Bacteria 7051
454 Ga0372808_002089 3300036459 Bacteria 2235
455 Ga0310109_014758 3300036534 Bacteria 1059
456 Ga0373925_0004951 3300037068 Bacteria 10010
457 Ga0373925_0008222 3300037068 Bacteria 7595
458 Ga0373925_0044281 3300037068 Bacteria 3305
459 Ga0373925_0049086 3300037068 Bacteria 3146
460 Ga0373925_0123554 3300037068 Bacteria 2012
461 Ga0395900_0048752 3300037418 Bacteria 4363
462 Ga0395900_0100154 3300037418 Bacteria 2976
463 Ga0395900_0145687 3300037418 Bacteria 2422
464 Ga0395900_0345164 3300037418 Bacteria 1463
465 Ga0395898_0137190 3300037466 Bacteria 2342
466 Ga0395898_0467698 3300037466 Bacteria 1200
467 Ga0395905_0003894 3300037471 Bacteria 15744
468 Ga0395905_0564628 3300037471 Bacteria 1039
469 Ga0395905_0627455 3300037471 Bacteria 977
470 Ga0436364_1178281 3300037853 Bacteria 3164
471 Ga0395901_0058368 3300038443 Bacteria 4014
472 Ga0395901_0349449 3300038443 Bacteria 1526
473 Ga0436365_0028265 3300039437 Bacteria 4288
474 Ga0436365_0888504 3300039437 Bacteria 1225
475 Ga0436365_1664592 3300039437 Bacteria 1567
476 Ga0436363_0776803 3300039450 Bacteria 2295
477 Ga0439465_0079979 3300041413 Bacteria 1107
478 Ga0451793_0284192 3300041452 Bacteria 1064
479 Ga0451802_1938471 3300041460 Bacteria 1168
480 Ga0451841_0283415 3300041498 Bacteria 1163
481 Ga0451853_1007175 3300041512 Bacteria 1085
482 Ga0439432_033545 3300042006 Bacteria 1651
483 Ga0466969_0137691 3300044656 Bacteria 1129
484 Ga0466966_0146856 3300044684 Bacteria 1439
485 Ga0466963_0004339 3300044694 Bacteria 8230
486 Ga0466964_0010990 3300044706 Bacteria 3420
487 Ga0466957_0363188 3300044842 Bacteria 984
488 Ga0466959_0009642 3300045049 Bacteria 6870
489 Ga0466967_0144048 3300045976 Bacteria 2222
490 Ga0466967_0210837 3300045976 Bacteria 1842
491 Ga0466967_0308244 3300045976 Bacteria 1524
492 Ga0495617_035725 3300046452 Bacteria 1668
493 Ga0495627_038315 3300046453 Bacteria 1483
494 Ga0495592_0006603 3300046454 Bacteria 8646
495 Ga0495592_0010901 3300046454 Bacteria 6857
496 Ga0495603_0011228 3300046455 Bacteria 5425
497 Ga0495603_0031835 3300046455 Bacteria 3175
498 Ga0495603_0060342 3300046455 Bacteria 2241
499 Ga0495603_0096848 3300046455 Bacteria 1724
500 Ga0495603_0119488 3300046455 Bacteria 1536
501 Ga0495629_0001384 3300046459 Bacteria 19124
502 Ga0495629_0006304 3300046459 Bacteria 8802
503 Ga0495629_0060310 3300046459 Bacteria 2652
504 Ga0495638_0019065 3300046460 Bacteria 4542
505 Ga0495641_0008805 3300046461 Bacteria 6085
506 Ga0495651_0022001 3300046462 Bacteria 4958
507 Ga0495653_0003677 3300046463 Bacteria 12388
508 Ga0495653_0023789 3300046463 Bacteria 4945
509 Ga0495580_0048298 3300046472 Bacteria 3014
510 Ga0495580_0290458 3300046472 Bacteria 1115
511 Ga0495582_0000130 3300046473 Bacteria 40201
512 Ga0495582_0013157 3300046473 Bacteria 4554
513 Ga0495639_0000061 3300046475 Bacteria 48670
514 Ga0495639_0099122 3300046475 Bacteria 1374
515 Ga0495662_0000308 3300046476 Bacteria 21273
516 Ga0495662_0080056 3300046476 Bacteria 1589
517 Ga0495664_0006016 3300046477 Bacteria 6688
518 Ga0495664_0040115 3300046477 Bacteria 2767
519 Ga0495664_0045709 3300046477 Bacteria 2597
520 Ga0495584_0045246 3300046491 Bacteria 2220
521 Ga0495584_0108235 3300046491 Bacteria 1406
522 Ga0495585_0077971 3300046492 Bacteria 1798
523 Ga0495594_0001934 3300046499 Bacteria 10812
524 Ga0495594_0097894 3300046499 Bacteria 1649
525 Ga0495583_0015129 3300046506 Bacteria 4211
526 Ga0495606_0095009 3300046507 Bacteria 1826
527 Ga0495608_0016884 3300046511 Bacteria 5052
528 Ga0495608_0045497 3300046511 Bacteria 2925
529 Ga0495608_0151047 3300046511 Bacteria 1480
530 Ga0495610_0030503 3300046512 Bacteria 2825
531 Ga0495610_0034617 3300046512 Bacteria 2600
532 Ga0495618_0009298 3300046514 Bacteria 5932
533 Ga0495618_0030396 3300046514 Bacteria 3373
534 Ga0495628_0002643 3300046516 Bacteria 16072
535 Ga0495628_0009941 3300046516 Bacteria 8097
536 Ga0495628_0061986 3300046516 Bacteria 2932
537 Ga0495628_0062313 3300046516 Bacteria 2923
538 Ga0495631_0065787 3300046518 Bacteria 1569
539 Ga0495631_0095952 3300046518 Bacteria 1276
540 Ga0495637_0024344 3300046520 Bacteria 2740
541 Ga0495643_0056642 3300046522 Bacteria 2091
542 Ga0495652_0000858 3300046529 Bacteria 35023
543 Ga0495652_0016880 3300046529 Bacteria 6525
544 Ga0495652_0033362 3300046529 Bacteria 4494
545 Ga0495652_0113666 3300046529 Bacteria 2173
546 Ga0495652_0344568 3300046529 Bacteria 1069
547 Ga0495665_0002782 3300046531 Bacteria 9440
548 Ga0495665_0076330 3300046531 Bacteria 1764
549 Ga0495640_0003517 3300046533 Bacteria 12593
550 Ga0495640_0006692 3300046533 Bacteria 9091
551 Ga0495640_0018432 3300046533 Bacteria 5174
552 Ga0495640_0214689 3300046533 Bacteria 1215
553 Ga0495586_0009762 3300046535 Bacteria 5111
554 Ga0495587_0010506 3300046536 Bacteria 5888
555 Ga0495587_0060580 3300046536 Bacteria 2219
556 Ga0495597_0081962 3300046542 Bacteria 1379
557 Ga0495645_0003263 3300046543 Bacteria 11010
558 Ga0495645_0016949 3300046543 Bacteria 5213
559 Ga0495645_0030578 3300046543 Bacteria 3922
560 Ga0495645_0058213 3300046543 Bacteria 2803
561 Ga0495622_0012397 3300046557 Bacteria 3946
562 Ga0495622_0039894 3300046557 Bacteria 2186
563 Ga0495667_0066248 3300046559 Bacteria 2361
564 Ga0495667_0101335 3300046559 Bacteria 1863
565 Ga0495656_0021511 3300046615 Bacteria 2512
566 Ga0495656_0134415 3300046615 Bacteria 1180
567 Ga0495634_0000703 3300046642 Bacteria 32526
568 Ga0495634_0007605 3300046642 Bacteria 8118
569 Ga0495634_0013427 3300046642 Bacteria 5917
570 Ga0495611_0175580 3300046648 Bacteria 1001
571 Ga0495625_0295820 3300046660 Bacteria 1037
572 Ga0495635_0000644 3300046663 Bacteria 22418
573 Ga0495635_0004483 3300046663 Bacteria 9674
574 Ga0495635_0025471 3300046663 Bacteria 4121
575 Ga0495635_0207514 3300046663 Bacteria 1327
576 Ga0495659_0015681 3300046664 Bacteria 2493
577 Ga0495659_0023103 3300046664 Bacteria 2110
578 Ga0495661_0016500 3300046665 Bacteria 4893
579 Ga0495588_0003829 3300046674 Bacteria 6593
580 Ga0495588_0028025 3300046674 Bacteria 2817
581 Ga0495657_0001016 3300046675 Bacteria 24742
582 Ga0495657_0064686 3300046675 Bacteria 2408
583 Ga0495657_0171586 3300046675 Bacteria 1335
584 Ga0495599_0000637 3300046678 Bacteria 19794
585 Ga0495599_0018824 3300046678 Bacteria 4304
586 Ga0495599_0060991 3300046678 Bacteria 2357
587 Ga0495599_0224082 3300046678 Bacteria 1149
588 Ga0495623_0003015 3300046679 Bacteria 11083
589 Ga0495623_0005023 3300046679 Bacteria 8674
590 Ga0495623_0035354 3300046679 Bacteria 3202
591 Ga0495646_0001926 3300046680 Bacteria 12482
592 Ga0495646_0033462 3300046680 Bacteria 3195
593 Ga0495646_0047444 3300046680 Bacteria 2614
594 Ga0495647_0006362 3300046681 Bacteria 3908
595 Ga0495658_0002243 3300046683 Bacteria 9769
596 Ga0495669_0025247 3300046684 Bacteria 2590
597 Ga0495669_0185275 3300046684 Bacteria 992
598 Ga0495613_0005726 3300046689 Bacteria 9309
599 Ga0495613_0028892 3300046689 Bacteria 4124
600 Ga0495624_0000188 3300046690 Bacteria 46706
601 Ga0495624_0125215 3300046690 Bacteria 1577
602 Ga0495671_0011981 3300046692 Bacteria 4749
603 Ga0495649_0117823 3300046694 Bacteria 1405
604 Ga0495589_0043465 3300046794 Bacteria 2236
605 Ga0495589_0079223 3300046794 Bacteria 1599
606 Ga0495589_0114205 3300046794 Bacteria 1302
607 Ga0495600_0013271 3300046809 Bacteria 5172
608 Ga0495600_0035513 3300046809 Bacteria 3238
609 Ga0495600_0062033 3300046809 Bacteria 2442
610 Ga0495581_0000152 3300047315 Bacteria 30800
611 Ga0495604_0013258 3300047317 Bacteria 6565
612 Ga0495604_0013887 3300047317 Bacteria 6423
613 Ga0495604_0034842 3300047317 Bacteria 3979
614 Ga0495636_0027918 3300047318 Bacteria 2299
615 Ga0495674_0001256 3300047319 Bacteria 24623
616 Ga0495674_0011842 3300047319 Bacteria 8222
617 Ga0495674_0108330 3300047319 Bacteria 2357
618 Ga0495674_0332124 3300047319 Bacteria 1237
619 Ga0495672_0029963 3300047320 Bacteria 3420
620 Ga0495676_0027751 3300047321 Bacteria 4850
621 Ga0495676_0069382 3300047321 Bacteria 2720
622 Ga0495680_0004188 3300047322 Bacteria 13854
623 Ga0495680_0015409 3300047322 Bacteria 6597
624 Ga0495680_0051945 3300047322 Bacteria 3197
625 Ga0495680_0067800 3300047322 Bacteria 2727
626 Ga0495673_0027275 3300047469 Bacteria 2721
627 Ga0495681_0110453 3300047470 Bacteria 1191
628 Ga0495684_0000380 3300047471 Bacteria 36351
629 Ga0495684_0024464 3300047471 Bacteria 4648
630 Ga0495684_0042078 3300047471 Bacteria 3500
631 Ga0495686_0112569 3300047472 Bacteria 1630
632 Ga0495593_0000144 3300047673 Bacteria 34869
633 Ga0495593_0001866 3300047673 Bacteria 12550
634 Ga0495593_0079361 3300047673 Bacteria 1699
635 Ga0495602_0011077 3300048088 Bacteria 9336
636 Ga0495602_0042204 3300048088 Bacteria 4158
637 Ga0496100_0304251 3300048903 Bacteria 1194
638 Ga0496101_0043088 3300048904 Bacteria 3224
639 Ga0496101_0093294 3300048904 Bacteria 2242
640 Ga0496101_0156226 3300048904 Bacteria 1747
641 Ga0496102_0135422 3300048905 Bacteria 2308
642 Ga0496102_0221157 3300048905 Bacteria 1785
643 Ga0496102_0508312 3300048905 Bacteria 1127
644 Ga0496102_0690670 3300048905 Bacteria 944
645 Ga0496103_0002281 3300048906 Bacteria 12123
646 Ga0496103_0041159 3300048906 Bacteria 2840
647 Ga0496103_0158337 3300048906 Bacteria 1452
648 Ga0496103_0189905 3300048906 Bacteria 1321
649 Ga0496104_0004213 3300048907 Bacteria 12488
650 Ga0496104_0034075 3300048907 Bacteria 4745
651 Ga0496104_0040098 3300048907 Bacteria 4388
652 Ga0496104_0076610 3300048907 Bacteria 3185
653 Ga0496105_0008968 3300048908 Bacteria 7802
654 Ga0496105_0034896 3300048908 Bacteria 4139
655 Ga0496105_0075300 3300048908 Bacteria 2787
656 Ga0496105_0078403 3300048908 Bacteria 2728
657 Ga0496105_0087186 3300048908 Bacteria 2579
658 Ga0496105_0343412 3300048908 Bacteria 1193
659 Ga0496106_0000423 3300048909 Bacteria 30107
660 Ga0496106_0101459 3300048909 Bacteria 2232
661 Ga0496106_0275075 3300048909 Bacteria 1348
662 Ga0496106_0389467 3300048909 Bacteria 1120
663 Ga0496107_0000569 3300048910 Bacteria 20544
664 Ga0496107_0065443 3300048910 Bacteria 2635
665 Ga0496107_0346309 3300048910 Bacteria 1106
666 Ga0496108_0013186 3300048911 Bacteria 6737
667 Ga0496108_0057488 3300048911 Bacteria 3268
668 Ga0496108_0098987 3300048911 Bacteria 2485
669 Ga0496109_0000393 3300048912 Bacteria 39750
670 Ga0496109_0021730 3300048912 Bacteria 5679
671 Ga0496109_0245261 3300048912 Bacteria 1686
672 Ga0496109_0252157 3300048912 Bacteria 1662
673 Ga0496110_0019105 3300048913 Bacteria 5760
674 Ga0496110_0019362 3300048913 Bacteria 5725
675 Ga0496110_0029779 3300048913 Bacteria 4702
676 Ga0496110_0173448 3300048913 Bacteria 1957
677 Ga0496110_0198007 3300048913 Bacteria 1825
678 Ga0496110_0385693 3300048913 Bacteria 1277
679 Ga0496111_0031722 3300048914 Bacteria 3764
680 Ga0496111_0118923 3300048914 Bacteria 1951
681 Ga0496111_0124393 3300048914 Bacteria 1906
682 Ga0496112_0000021 3300048915 Bacteria 156561
683 Ga0496112_0002518 3300048915 Bacteria 14792
684 Ga0496112_0031613 3300048915 Bacteria 5135
685 Ga0496112_0037193 3300048915 Bacteria 4752
686 Ga0496112_0045387 3300048915 Bacteria 4308
687 Ga0496112_0105162 3300048915 Bacteria 2792
688 Ga0496112_0331897 3300048915 Bacteria 1464
689 Ga0496112_0548163 3300048915 Bacteria 1090
690 Ga0496113_0053804 3300048916 Bacteria 3010
691 Ga0496113_0085795 3300048916 Bacteria 2419
692 Ga0496113_0088961 3300048916 Bacteria 2376
693 Ga0496113_0154479 3300048916 Bacteria 1811
694 Ga0496113_0179489 3300048916 Bacteria 1678
695 Ga0496113_0401746 3300048916 Bacteria 1100
696 Ga0496114_0033661 3300048917 Bacteria 4224
697 Ga0496114_0044714 3300048917 Bacteria 3676
698 Ga0496114_0046690 3300048917 Bacteria 3599
699 Ga0496114_0056373 3300048917 Bacteria 3279
700 Ga0496114_0164825 3300048917 Bacteria 1929
701 Ga0496115_0001490 3300048918 Bacteria 16832
702 Ga0496115_0024614 3300048918 Bacteria 4682
703 Ga0496115_0055924 3300048918 Bacteria 3171
704 Ga0496115_0193300 3300048918 Bacteria 1681
705 Ga0496116_0004870 3300048919 Bacteria 12662
706 Ga0496117_0136959 3300048920 Bacteria 1473
707 Ga0496117_0233571 3300048920 Bacteria 1014
708 Ga0496118_0075907 3300048921 Bacteria 2393
709 Ga0496118_0177629 3300048921 Bacteria 1291
710 Ga0496118_0237652 3300048921 Bacteria 1046
711 Ga0496119_0013974 3300048922 Bacteria 6328
712 Ga0496119_0075414 3300048922 Bacteria 1960
713 Ga0496120_0016201 3300048923 Bacteria 4878
714 Ga0496121_0000937 3300048924 Bacteria 52775
715 Ga0496121_0012844 3300048924 Bacteria 9063
716 Ga0496121_0021616 3300048924 Bacteria 6292
717 Ga0496121_0022931 3300048924 Bacteria 6033
718 Ga0496121_0057484 3300048924 Bacteria 3224
719 Ga0496121_0063766 3300048924 Bacteria 3008
720 Ga0496121_0117135 3300048924 Bacteria 2019
721 Ga0496121_0231063 3300048924 Bacteria 1295
722 Ga0496122_0017150 3300048925 Bacteria 6790
723 Ga0496122_0078385 3300048925 Bacteria 2314
724 Ga0496122_0079417 3300048925 Bacteria 2293
725 Ga0496122_0116773 3300048925 Bacteria 1734
726 Ga0496123_0013485 3300048926 Bacteria 6854
727 Ga0496123_0029839 3300048926 Bacteria 4004
728 Ga0496124_0101131 3300048927 Bacteria 2336
729 Ga0496124_0101433 3300048927 Bacteria 2332
730 Ga0496124_0161073 3300048927 Bacteria 1749
731 Ga0496125_0000272 3300048928 Bacteria 105490
732 Ga0496125_0035071 3300048928 Bacteria 4409
733 Ga0496125_0094080 3300048928 Bacteria 2234
734 Ga0496125_0099660 3300048928 Bacteria 2145
735 Ga0496125_0114063 3300048928 Bacteria 1947
736 Ga0496126_0005828 3300048929 Bacteria 13931
737 Ga0496126_0006091 3300048929 Bacteria 13526
738 Ga0496126_0006946 3300048929 Bacteria 12532
739 Ga0496126_0014947 3300048929 Bacteria 7826
740 Ga0496126_0032865 3300048929 Bacteria 4883
741 Ga0496126_0033274 3300048929 Bacteria 4850
742 Ga0496126_0057411 3300048929 Bacteria 3514
743 Ga0496126_0220016 3300048929 Bacteria 1595
744 Ga0496126_0224204 3300048929 Bacteria 1577
745 Ga0496126_0467612 3300048929 Bacteria 1012
746 Ga0495682_0045604 3300049460 Bacteria 1601
747 Ga0495682_0071953 3300049460 Bacteria 1244
748 Ga0501031_0009017 3300049568 Bacteria 6491
749 Ga0501031_0110443 3300049568 Bacteria 1795
750 Ga0501032_0000129 3300049569 Bacteria 62082
751 Ga0501032_0019530 3300049569 Bacteria 4739
752 Ga0501032_0120760 3300049569 Bacteria 1732
753 Ga0501033_0000113 3300049570 Bacteria 78028
754 Ga0501033_0000983 3300049570 Bacteria 25917
755 Ga0501033_0012970 3300049570 Bacteria 6355
756 Ga0501033_0320178 3300049570 Bacteria 1089
757 Ga0501034_0001074 3300049571 Bacteria 38708
758 Ga0501034_0052026 3300049571 Bacteria 4128
759 Ga0501034_0065055 3300049571 Bacteria 3659
760 Ga0501034_0067787 3300049571 Bacteria 3580
761 Ga0501034_0199925 3300049571 Bacteria 1957
762 Ga0501036_0000112 3300049572 Bacteria 50437
763 Ga0501036_0000232 3300049572 Bacteria 37236
764 Ga0501036_0054565 3300049572 Bacteria 3385
765 Ga0501037_0000106 3300049573 Bacteria 79430
766 Ga0501037_0000406 3300049573 Bacteria 36029
767 Ga0501037_0012572 3300049573 Bacteria 6237
768 Ga0501038_0000108 3300049574 Bacteria 70323
769 Ga0501038_0010003 3300049574 Bacteria 8684
770 Ga0501038_0021786 3300049574 Bacteria 5750
771 Ga0501038_0022220 3300049574 Bacteria 5685
772 Ga0501038_0037201 3300049574 Bacteria 4268
773 Ga0501038_0050435 3300049574 Bacteria 3595
774 Ga0501039_0000097 3300049575 Bacteria 60744
775 Ga0501039_0000460 3300049575 Bacteria 29614
776 Ga0501039_0003144 3300049575 Bacteria 12349
777 Ga0501039_0086334 3300049575 Bacteria 2443
778 Ga0501041_0117608 3300049577 Bacteria 1651
779 Ga0501042_0008165 3300049578 Bacteria 6897
780 Ga0501042_0038574 3300049578 Bacteria 3392
781 Ga0501042_0074035 3300049578 Bacteria 2437
782 Ga0501042_0243903 3300049578 Bacteria 1296
783 Ga0501043_0000035 3300049579 Bacteria 133200
784 Ga0501043_0014172 3300049579 Bacteria 6237
785 Ga0501043_0044795 3300049579 Bacteria 3479
786 Ga0501043_0125520 3300049579 Bacteria 2012
787 Ga0501046_0000944 3300049580 Bacteria 28515
788 Ga0501046_0001554 3300049580 Bacteria 21923
789 Ga0501047_0000792 3300049581 Bacteria 33063
790 Ga0501047_0006122 3300049581 Bacteria 11306
791 Ga0501047_0093423 3300049581 Bacteria 2887
792 Ga0501048_0000116 3300049582 Bacteria 45512
793 Ga0501067_0001402 3300049583 Bacteria 13081
794 Ga0501068_0000014 3300049584 Bacteria 62762
795 Ga0501068_0003479 3300049584 Bacteria 8485
796 Ga0501069_0010536 3300049585 Bacteria 4896
797 Ga0501069_0168111 3300049585 Bacteria 1264
798 Ga0501070_0001063 3300049586 Bacteria 24697
799 Ga0501070_0009144 3300049586 Bacteria 8379
800 Ga0501070_0282108 3300049586 Bacteria 1355
801 Ga0501070_0383002 3300049586 Bacteria 1139
802 Ga0501071_0046687 3300049587 Bacteria 3111
803 Ga0501071_0275525 3300049587 Bacteria 1273
804 Ga0501072_0000367 3300049588 Bacteria 32192
805 Ga0501073_0000368 3300049589 Bacteria 30350
806 Ga0501073_0151518 3300049589 Bacteria 1607
807 Ga0501074_0001037 3300049590 Bacteria 18048
808 Ga0501079_0011719 3300049741 Bacteria 6696
809 Ga0501079_0134260 3300049741 Bacteria 1926
810 Ga0501080_0000143 3300049742 Bacteria 50337
811 Ga0501080_0000332 3300049742 Bacteria 36151
812 Ga0501083_0141601 3300049744 Bacteria 1575
813 Ga0501035_0000250 3300049822 Bacteria 64768
814 Ga0501035_0000632 3300049822 Bacteria 38776
815 Ga0501035_0003056 3300049822 Bacteria 16047
816 Ga0501044_0000051 3300049823 Bacteria 143658
817 Ga0501044_0015386 3300049823 Bacteria 8239
818 Ga0501044_0051243 3300049823 Bacteria 4256
819 Ga0501044_0125764 3300049823 Bacteria 2561
820 Ga0501044_0154343 3300049823 Bacteria 2276
821 Ga0501044_0204060 3300049823 Bacteria 1934
822 Ga0501044_0235820 3300049823 Bacteria 1775
823 Ga0501044_0643955 3300049823 Bacteria 949
824 Ga0501045_0002440 3300049824 Bacteria 12638
825 nmdc:mga03683_24010_c1 3300050489 Bacteria 2382
826 nmdc:mga03n38_10965_c1 3300050490 Bacteria 3359
827 nmdc:mga03n38_8163_c1 3300050490 Bacteria 3743
828 nmdc:mga00v17_143039_c1 3300050491 Bacteria 1534
829 nmdc:mga00v17_15215_c1 3300050491 Bacteria 4313
830 nmdc:mga00v17_4283_c1 3300050491 Bacteria 7409
831 nmdc:mga00v17_55938_c1 3300050491 Bacteria 2411
832 nmdc:mga0yw44_104794_c1 3300050492 Bacteria 1806
833 nmdc:mga0yw44_157331_c1 3300050492 Bacteria 1486
834 nmdc:mga0yw44_18088_c1 3300050492 Bacteria 3853
835 nmdc:mga0yw44_19594_c1 3300050492 Bacteria 3734
836 nmdc:mga0yw44_27309_c1 3300050492 Bacteria 3268
837 nmdc:mga0yw44_387812_c1 3300050492 Bacteria 943
838 nmdc:mga0yw44_42642_c1 3300050492 Bacteria 2706
839 nmdc:mga0yw44_47797_c1 3300050492 Bacteria 2577
840 nmdc:mga0yw44_59641_c1 3300050492 Bacteria 2335
841 nmdc:mga0k408_261600_c1 3300050493 Bacteria 1033
842 nmdc:mga06z11_170062_c1 3300050494 Bacteria 1251
843 nmdc:mga06z11_29523_c1 3300050494 Bacteria 2642
844 nmdc:mga06z11_439333_c1 3300050494 Bacteria 788
845 nmdc:mga06z11_9916_c1 3300050494 Bacteria 4035
846 nmdc:mga04h51_4173_c1 3300050495 Bacteria 3570
847 nmdc:mga07m45_3431_c1 3300050496 Bacteria 2786
848 nmdc:mga07m45_45116_c1 3300050496 Bacteria 2475
849 nmdc:mga07m45_98420_c1 3300050496 Bacteria 1679
850 nmdc:mga07m45_99442_c1 3300050496 Bacteria 1670
851 nmdc:mga05p37_80160_c1 3300050507 Bacteria 4021
852 nmdc:mga08y16_125241_c1 3300050511 Bacteria 2673
853 nmdc:mga0a205_180925_c1 3300050515 Bacteria 2002
854 nmdc:mga0sz30_24232_c1 3300050516 Bacteria 2475
855 Ga0495601_0025742 3300053077 Bacteria 3629
856 Ga0495601_0051392 3300053077 Bacteria 2601
857 Ga0495601_0063896 3300053077 Bacteria 2339
858 Ga0495601_0152026 3300053077 Bacteria 1511
859 Ga0495601_0259741 3300053077 Bacteria 1134
860 Ga0495612_0018341 3300053078 Bacteria 2803
861 Ga0495612_0070953 3300053078 Bacteria 1452
862 Ga0500635_0000782 3300053080 Bacteria 7900
863 Ga0495655_0001518 3300053083 Bacteria 3564
864 Ga0495595_0002657 3300053084 Bacteria 7012
865 Ga0495595_0047080 3300053084 Bacteria 1988
866 Ga0495595_0070386 3300053084 Bacteria 1652
867 Ga0495619_0000355 3300053085 Bacteria 32054
868 Ga0495619_0051093 3300053085 Bacteria 2731
869 Ga0500643_015597 3300053087 Bacteria 2601
870 Ga0500643_018233 3300053087 Bacteria 2333
871 Ga0500646_0074163 3300053090 Bacteria 1026
872 Ga0500651_0008492 3300053093 Bacteria 6048
873 Ga0500651_0110382 3300053093 Bacteria 1679
874 Ga0500566_0000026 3300053094 Bacteria 77138
875 Ga0500566_0000892 3300053094 Bacteria 17037
876 Ga0500566_0050239 3300053094 Bacteria 2388
877 Ga0500640_011912 3300053095 Bacteria 3557
878 Ga0500641_0008858 3300053096 Bacteria 3604
879 Ga0500641_0036182 3300053096 Bacteria 1974
880 Ga0500641_0062982 3300053096 Bacteria 1547
881 Ga0500650_0001357 3300053098 Bacteria 7329
882 Ga0500554_015264 3300053102 Bacteria 2002
883 Ga0500555_004038 3300053103 Bacteria 4171
884 Ga0500556_0000004 3300053104 Bacteria 666287
885 Ga0500557_000015 3300053105 Bacteria 106282
886 Ga0500572_000565 3300053111 Bacteria 12619
887 Ga0500572_002560 3300053111 Bacteria 4337
888 Ga0500591_080606 3300053115 Bacteria 1448
889 Ga0500592_000324 3300053116 Bacteria 8167
890 Ga0500594_0001178 3300053118 Bacteria 5649
891 Ga0500595_002432 3300053119 Bacteria 9278
892 Ga0500595_002514 3300053119 Bacteria 9049
893 Ga0500595_003082 3300053119 Bacteria 7912
894 Ga0500595_004867 3300053119 Bacteria 5944
895 Ga0500595_056519 3300053119 Bacteria 1198
896 Ga0500608_007506 3300053122 Bacteria 4518
897 Ga0500608_113277 3300053122 Bacteria 1240
898 Ga0500614_000135 3300053123 Bacteria 18032
899 Ga0500618_019426 3300053125 Bacteria 1673
900 Ga0500621_028739 3300053126 Bacteria 2199
901 Ga0500642_0000037 3300053130 Bacteria 98684
902 Ga0500652_000355 3300053131 Bacteria 16420
903 Ga0500655_011412 3300053133 Bacteria 1610
904 Ga0500559_0000081 3300053136 Bacteria 75262
905 Ga0500559_0000859 3300053136 Bacteria 19515
906 Ga0500559_0004957 3300053136 Bacteria 6188
907 Ga0500559_0169954 3300053136 Bacteria 1025
908 Ga0500568_0000621 3300053139 Bacteria 25541
909 Ga0500568_0037225 3300053139 Bacteria 1975
910 Ga0500590_123554 3300053148 Bacteria 1209
911 Ga0500603_001715 3300053150 Bacteria 4938
912 Ga0500616_0000014 3300053153 Bacteria 637918
913 Ga0500616_0000372 3300053153 Bacteria 62890
914 Ga0500616_0137726 3300053153 Bacteria 1145
915 Ga0500622_0101586 3300053156 Bacteria 1415
916 Ga0500622_0137361 3300053156 Bacteria 1169
917 Ga0500627_0039582 3300053158 Bacteria 2019
918 Ga0500627_0041152 3300053158 Bacteria 1985
919 Ga0500627_0097165 3300053158 Bacteria 1321
920 Ga0500630_000207 3300053159 Bacteria 22769
921 Ga0500634_0055047 3300053161 Bacteria 2130
922 Ga0500638_119689 3300053162 Bacteria 1206
923 Ga0500638_141260 3300053162 Bacteria 1081
924 Ga0500639_000939 3300053163 Bacteria 14837
925 Ga0500639_048783 3300053163 Bacteria 2210
926 Ga0500636_0075049 3300053177 Bacteria 1956
927 Ga0500637_0000122 3300053178 Bacteria 28103
928 Ga0500637_0012501 3300053178 Bacteria 4425
929 Ga0500637_0013976 3300053178 Bacteria 4223
930 Ga0500576_015404 3300053725 Bacteria 3457
931 Ga0500625_003216 3300053729 Bacteria 6393
932 Ga0500645_016064 3300053730 Bacteria 2363
933 Ga0500609_009589 3300053731 Bacteria 1305
934 Ga0500596_000101 3300053735 Bacteria 11781
935 Ga0500596_000408 3300053735 Bacteria 7848
936 Ga0501084_0000773 3300054114 Bacteria 24332
937 Ga0500661_000317 3300055283 Bacteria 8830
938 Ga0501082_0000396 3300060353 Bacteria 38652

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_439333_c1 nmdc:mga06z11_439333_c1_22_774 223
2 3300048915 Ga0496112_0548163 Ga0496112_0548163_222_1037 225
3 3300035171 Ga0373946_0002945 Ga0373946_0002945_5190_6005 243
4 3300046529 Ga0495652_0344568 Ga0495652_0344568_211_1026 243
5 3300005355 Ga0070671_100168389 Ga0070671_1001683891 247
6 3300005535 Ga0070684_100364541 Ga0070684_1003645411 247
7 3300025920 Ga0207649_10119751 Ga0207649_101197511 249
8 3300005616 Ga0068852_100100140 Ga0068852_1001001403 250
9 3300037471 Ga0395905_0627455 Ga0395905_0627455_55_942 250
10 3300005329 Ga0070683_100235899 Ga0070683_1002358992 251
11 3300005336 Ga0070680_100123971 Ga0070680_1001239712 251
12 3300005339 Ga0070660_100010407 Ga0070660_1000104074 251
13 3300005458 Ga0070681_10217928 Ga0070681_102179282 251
14 3300005530 Ga0070679_100031881 Ga0070679_1000318815 251
15 3300005539 Ga0068853_100005075 Ga0068853_1000050755 251
16 3300005577 Ga0068857_100143704 Ga0068857_1001437042 251
17 3300005616 Ga0068852_100046472 Ga0068852_1000464723 251
18 3300005834 Ga0068851_10001483 Ga0068851_100014833 251
19 3300009093 Ga0105240_10020975 Ga0105240_100209756 251
20 3300009545 Ga0105237_10011938 Ga0105237_100119385 251
21 3300009551 Ga0105238_10002798 Ga0105238_100027985 251
22 3300010375 Ga0105239_10017902 Ga0105239_100179025 251
23 3300011119 Ga0105246_10093444 Ga0105246_100934442 251
24 3300013104 Ga0157370_10015624 Ga0157370_100156243 251
25 3300013105 Ga0157369_10000996 Ga0157369_1000099626 251
26 3300025912 Ga0207707_10000713 Ga0207707_1000071321 251
27 3300025914 Ga0207671_10012301 Ga0207671_100123017 251
28 3300025917 Ga0207660_10007065 Ga0207660_100070653 251
29 3300025919 Ga0207657_10001786 Ga0207657_1000178613 251
30 3300025920 Ga0207649_10030165 Ga0207649_100301652 251
31 3300025921 Ga0207652_10004315 Ga0207652_1000431512 251
32 3300025924 Ga0207694_10016368 Ga0207694_100163683 251
33 3300025944 Ga0207661_10032141 Ga0207661_100321414 251
34 3300025949 Ga0207667_10008867 Ga0207667_100088673 251
35 3300026041 Ga0207639_10009512 Ga0207639_100095122 251
36 3300026116 Ga0207674_10012246 Ga0207674_100122469 251
37 3300026142 Ga0207698_10211229 Ga0207698_102112292 251
38 3300047319 Ga0495674_0332124 Ga0495674_0332124_318_1205 251
39 3300009101 Ga0105247_10094353 Ga0105247_100943533 252
40 3300010375 Ga0105239_10158066 Ga0105239_101580663 252
41 3300028381 Ga0268264_10333220 Ga0268264_103332201 252
42 3300048905 Ga0496102_0135422 Ga0496102_0135422_569_1456 252
43 3300048906 Ga0496103_0041159 Ga0496103_0041159_652_1539 252
44 3300048908 Ga0496105_0075300 Ga0496105_0075300_1766_2653 252
45 3300048913 Ga0496110_0019105 Ga0496110_0019105_3616_4503 252
46 3300048915 Ga0496112_0031613 Ga0496112_0031613_4027_4914 252
47 3300048916 Ga0496113_0053804 Ga0496113_0053804_41_928 252
48 3300048917 Ga0496114_0046690 Ga0496114_0046690_2392_3279 252
49 3300049823 Ga0501044_0235820 Ga0501044_0235820_366_1253 252
50 3300053122 Ga0500608_113277 Ga0500608_113277_393_1223 253
51 3300014968 Ga0157379_10276709 Ga0157379_102767092 254
52 3300048907 Ga0496104_0040098 Ga0496104_0040098_362_1279 254
53 3300048909 Ga0496106_0000423 Ga0496106_0000423_19038_19955 254
54 3300048910 Ga0496107_0000569 Ga0496107_0000569_19196_20113 254
55 3300048911 Ga0496108_0013186 Ga0496108_0013186_3707_4624 254
56 3300048912 Ga0496109_0000393 Ga0496109_0000393_25632_26549 254
57 3300048916 Ga0496113_0088961 Ga0496113_0088961_1153_2070 254
58 3300005937 Ga0081455_10038535 Ga0081455_100385353 256
59 3300009545 Ga0105237_10012243 Ga0105237_100122438 256
60 3300025914 Ga0207671_10045012 Ga0207671_100450122 256
61 3300048916 Ga0496113_0179489 Ga0496113_0179489_52_867 256
62 3300035695 Ga0373927_0031720 Ga0373927_0031720_2639_3412 257
63 3300005328 Ga0070676_10045828 Ga0070676_100458284 259
64 3300005340 Ga0070689_100007115 Ga0070689_1000071153 259
65 3300005353 Ga0070669_100055043 Ga0070669_1000550432 259
66 3300005354 Ga0070675_100299770 Ga0070675_1002997702 259
67 3300005355 Ga0070671_100045468 Ga0070671_1000454682 259
68 3300005441 Ga0070700_100081308 Ga0070700_1000813082 259
69 3300005455 Ga0070663_100066326 Ga0070663_1000663263 259
70 3300005459 Ga0068867_100202463 Ga0068867_1002024632 259
71 3300014325 Ga0163163_10014928 Ga0163163_100149284 259
72 3300014326 Ga0157380_10267482 Ga0157380_102674822 259
73 3300025936 Ga0207670_10001178 Ga0207670_100011787 259
74 3300025937 Ga0207669_10114878 Ga0207669_101148782 259
75 3300026035 Ga0207703_10206134 Ga0207703_102061342 259
76 3300026067 Ga0207678_10106075 Ga0207678_101060752 259
77 3300026075 Ga0207708_10049108 Ga0207708_100491082 259
78 3300026078 Ga0207702_10085355 Ga0207702_100853552 259
79 3300026095 Ga0207676_10128245 Ga0207676_101282452 259
80 3300026118 Ga0207675_100730166 Ga0207675_1007301661 259
81 3300028380 Ga0268265_10369309 Ga0268265_103693092 259
82 3300028381 Ga0268264_10465060 Ga0268264_104650602 259
83 3300035090 Ga0373949_0009711 Ga0373949_0009711_1055_1942 259
84 3300035691 Ga0373931_0138254 Ga0373931_0138254_70_957 259
85 3300048904 Ga0496101_0043088 Ga0496101_0043088_177_1064 259
86 3300048906 Ga0496103_0189905 Ga0496103_0189905_338_1225 259
87 3300048907 Ga0496104_0034075 Ga0496104_0034075_1539_2426 259
88 3300048908 Ga0496105_0008968 Ga0496105_0008968_5685_6572 259
89 3300048911 Ga0496108_0098987 Ga0496108_0098987_1385_2272 259
90 3300048912 Ga0496109_0021730 Ga0496109_0021730_4162_5049 259
91 3300048912 Ga0496109_0252157 Ga0496109_0252157_195_1082 259
92 3300048915 Ga0496112_0002518 Ga0496112_0002518_6404_7291 259
93 3300048916 Ga0496113_0085795 Ga0496113_0085795_1452_2339 259
94 3300005983 Ga0081540_1003736 Ga0081540_10037362 260
95 3300006038 Ga0075365_10061671 Ga0075365_100616711 260
96 3300006051 Ga0075364_10033462 Ga0075364_100334622 260
97 3300006178 Ga0075367_10113667 Ga0075367_101136672 260
98 3300006186 Ga0075369_10083542 Ga0075369_100835421 260
99 3300048919 Ga0496116_0004870 Ga0496116_0004870_10104_10991 260
100 3300048925 Ga0496122_0116773 Ga0496122_0116773_835_1722 260
101 3300048927 Ga0496124_0101131 Ga0496124_0101131_556_1443 260
102 3300048928 Ga0496125_0114063 Ga0496125_0114063_628_1515 260
103 3300050491 nmdc:mga00v17_15215_c1 nmdc:mga00v17_15215_c1_1928_2815 260
104 3300050492 nmdc:mga0yw44_157331_c1 nmdc:mga0yw44_157331_c1_27_914 260
105 3300050496 nmdc:mga07m45_98420_c1 nmdc:mga07m45_98420_c1_780_1667 260
106 3300046460 Ga0495638_0019065 Ga0495638_0019065_391_1278 261
107 3300046507 Ga0495606_0095009 Ga0495606_0095009_664_1551 261
108 3300046542 Ga0495597_0081962 Ga0495597_0081962_195_1082 261
109 3300046665 Ga0495661_0016500 Ga0495661_0016500_3937_4824 261
110 3300047470 Ga0495681_0110453 Ga0495681_0110453_273_1160 261
111 3300048922 Ga0496119_0075414 Ga0496119_0075414_495_1382 261
112 3300048925 Ga0496122_0017150 Ga0496122_0017150_1915_2802 261
113 3300048929 Ga0496126_0224204 Ga0496126_0224204_552_1439 261
114 3300050492 nmdc:mga0yw44_18088_c1 nmdc:mga0yw44_18088_c1_577_1464 261
115 3300053087 Ga0500643_018233 Ga0500643_018233_799_1686 261
116 3300053090 Ga0500646_0074163 Ga0500646_0074163_14_901 261
117 3300053116 Ga0500592_000324 Ga0500592_000324_1224_2111 261
118 3300053153 Ga0500616_0000014 Ga0500616_0000014_546509_547396 261
119 3300053156 Ga0500622_0137361 Ga0500622_0137361_182_1069 261
120 3300053161 Ga0500634_0055047 Ga0500634_0055047_768_1655 261
121 3300053731 Ga0500609_009589 Ga0500609_009589_338_1225 261
122 3300005338 Ga0068868_100156056 Ga0068868_1001560562 263
123 3300005841 Ga0068863_100458343 Ga0068863_1004583432 263
124 3300007265 Ga0099794_10062614 Ga0099794_100626142 263
125 3300031235 Ga0265330_10051587 Ga0265330_100515872 263
126 3300031238 Ga0265332_10023963 Ga0265332_100239632 263
127 3300031241 Ga0265325_10035454 Ga0265325_100354542 263
128 3300048921 Ga0496118_0237652 Ga0496118_0237652_52_939 263
129 3300048929 Ga0496126_0006091 Ga0496126_0006091_7543_8430 263
130 3300049573 Ga0501037_0012572 Ga0501037_0012572_4552_5439 263
131 3300049574 Ga0501038_0021786 Ga0501038_0021786_184_1071 263
132 3300049581 Ga0501047_0093423 Ga0501047_0093423_1585_2472 263
133 3300049586 Ga0501070_0383002 Ga0501070_0383002_217_1104 263
134 3300049823 Ga0501044_0015386 Ga0501044_0015386_4100_4987 263
135 3300010159 Ga0099796_10013619 Ga0099796_100136193 264
136 3300027671 Ga0209588_1009775 Ga0209588_10097752 264
137 3300035113 Ga0373936_0115641 Ga0373936_0115641_51_977 264
138 3300035118 Ga0373954_0019610 Ga0373954_0019610_37_924 264
139 3300035119 Ga0373956_0004017 Ga0373956_0004017_822_1709 264
140 3300035725 Ga0373947_0001951 Ga0373947_0001951_4357_5244 264
141 3300046454 Ga0495592_0006603 Ga0495592_0006603_3698_4585 264
142 3300046459 Ga0495629_0060310 Ga0495629_0060310_295_1182 264
143 3300046463 Ga0495653_0023789 Ga0495653_0023789_3782_4669 264
144 3300046476 Ga0495662_0080056 Ga0495662_0080056_366_1253 264
145 3300046477 Ga0495664_0045709 Ga0495664_0045709_1111_1998 264
146 3300046511 Ga0495608_0016884 Ga0495608_0016884_208_1095 264
147 3300046512 Ga0495610_0034617 Ga0495610_0034617_1295_2182 264
148 3300046514 Ga0495618_0030396 Ga0495618_0030396_2327_3214 264
149 3300046516 Ga0495628_0009941 Ga0495628_0009941_5474_6361 264
150 3300046520 Ga0495637_0024344 Ga0495637_0024344_546_1433 264
151 3300046522 Ga0495643_0056642 Ga0495643_0056642_546_1433 264
152 3300046529 Ga0495652_0016880 Ga0495652_0016880_5549_6436 264
153 3300046533 Ga0495640_0006692 Ga0495640_0006692_1614_2501 264
154 3300046535 Ga0495586_0009762 Ga0495586_0009762_3063_3950 264
155 3300046536 Ga0495587_0010506 Ga0495587_0010506_203_1090 264
156 3300046543 Ga0495645_0030578 Ga0495645_0030578_1737_2624 264
157 3300046559 Ga0495667_0066248 Ga0495667_0066248_846_1733 264
158 3300046642 Ga0495634_0013427 Ga0495634_0013427_892_1779 264
159 3300046663 Ga0495635_0207514 Ga0495635_0207514_221_1108 264
160 3300046675 Ga0495657_0064686 Ga0495657_0064686_1385_2272 264
161 3300046678 Ga0495599_0224082 Ga0495599_0224082_42_929 264
162 3300046679 Ga0495623_0035354 Ga0495623_0035354_2200_3087 264
163 3300046680 Ga0495646_0047444 Ga0495646_0047444_160_1047 264
164 3300046692 Ga0495671_0011981 Ga0495671_0011981_30_917 264
165 3300047317 Ga0495604_0013887 Ga0495604_0013887_371_1258 264
166 3300047322 Ga0495680_0051945 Ga0495680_0051945_2034_2921 264
167 3300047469 Ga0495673_0027275 Ga0495673_0027275_44_931 264
168 3300047471 Ga0495684_0024464 Ga0495684_0024464_3583_4470 264
169 3300048088 Ga0495602_0011077 Ga0495602_0011077_303_1190 264
170 3300048903 Ga0496100_0304251 Ga0496100_0304251_144_1031 264
171 3300048920 Ga0496117_0233571 Ga0496117_0233571_22_909 264
172 3300048924 Ga0496121_0012844 Ga0496121_0012844_5921_6808 264
173 3300048926 Ga0496123_0013485 Ga0496123_0013485_2126_3013 264
174 3300048928 Ga0496125_0035071 Ga0496125_0035071_2081_2968 264
175 3300053077 Ga0495601_0063896 Ga0495601_0063896_203_1090 264
176 3300053078 Ga0495612_0070953 Ga0495612_0070953_346_1233 264
177 3300053084 Ga0495595_0070386 Ga0495595_0070386_348_1235 264
178 3300053094 Ga0500566_0000892 Ga0500566_0000892_3212_4099 264
179 3300053098 Ga0500650_0001357 Ga0500650_0001357_6423_7310 264
180 3300053104 Ga0500556_0000004 Ga0500556_0000004_574425_575312 264
181 3300053122 Ga0500608_007506 Ga0500608_007506_306_1193 264
182 3300053131 Ga0500652_000355 Ga0500652_000355_14102_14989 264
183 3300053136 Ga0500559_0000859 Ga0500559_0000859_6287_7174 264
184 3300053139 Ga0500568_0000621 Ga0500568_0000621_18393_19280 264
185 3300053158 Ga0500627_0041152 Ga0500627_0041152_198_1085 264
186 3300053730 Ga0500645_016064 Ga0500645_016064_1179_2066 264
187 3300005937 Ga0081455_10008528 Ga0081455_100085287 265
188 3300005983 Ga0081540_1005905 Ga0081540_10059054 265
189 3300005983 Ga0081540_1017125 Ga0081540_10171255 265
190 3300007788 Ga0099795_10001501 Ga0099795_100015013 265
191 3300031616 Ga0307508_10070541 Ga0307508_100705414 265
192 3300031711 Ga0265314_10021549 Ga0265314_100215493 265
193 3300031712 Ga0265342_10023489 Ga0265342_100234891 265
194 3300037068 Ga0373925_0044281 Ga0373925_0044281_826_1713 265
195 3300046472 Ga0495580_0290458 Ga0495580_0290458_73_960 265
196 3300046491 Ga0495584_0108235 Ga0495584_0108235_181_1068 265
197 3300048929 Ga0496126_0005828 Ga0496126_0005828_10135_11022 265
198 3300049571 Ga0501034_0065055 Ga0501034_0065055_842_1729 265
199 3300049579 Ga0501043_0125520 Ga0501043_0125520_615_1502 265
200 3300005355 Ga0070671_100308084 Ga0070671_1003080841 266
201 3300005435 Ga0070714_100060983 Ga0070714_1000609832 266
202 3300005439 Ga0070711_100082054 Ga0070711_1000820542 266
203 3300005614 Ga0068856_100000205 Ga0068856_10000020545 266
204 3300006871 Ga0075434_100112461 Ga0075434_1001124613 266
205 3300009177 Ga0105248_10500391 Ga0105248_105003911 266
206 3300013105 Ga0157369_10225938 Ga0157369_102259383 266
207 3300013296 Ga0157374_10437459 Ga0157374_104374591 266
208 3300013296 Ga0157374_10694633 Ga0157374_106946332 266
209 3300021384 Ga0213876_10128096 Ga0213876_101280961 266
210 3300025912 Ga0207707_10252335 Ga0207707_102523352 266
211 3300025916 Ga0207663_10192280 Ga0207663_101922802 266
212 3300025928 Ga0207700_10006113 Ga0207700_100061131 266
213 3300025929 Ga0207664_10026024 Ga0207664_100260244 266
214 3300025931 Ga0207644_10366948 Ga0207644_103669482 266
215 3300025949 Ga0207667_10080065 Ga0207667_100800651 266
216 3300026078 Ga0207702_10000048 Ga0207702_10000048112 266
217 3300037418 Ga0395900_0100154 Ga0395900_0100154_982_1869 266
218 3300037418 Ga0395900_0345164 Ga0395900_0345164_361_1248 266
219 3300037466 Ga0395898_0137190 Ga0395898_0137190_510_1397 266
220 3300037466 Ga0395898_0467698 Ga0395898_0467698_52_939 266
221 3300039437 Ga0436365_0888504 Ga0436365_0888504_96_983 266
222 3300047320 Ga0495672_0029963 Ga0495672_0029963_393_1280 266
223 3300048913 Ga0496110_0385693 Ga0496110_0385693_92_979 266
224 3300048918 Ga0496115_0024614 Ga0496115_0024614_1225_2112 266
225 3300048924 Ga0496121_0022931 Ga0496121_0022931_1089_1976 266
226 3300048929 Ga0496126_0220016 Ga0496126_0220016_184_1056 266
227 3300049568 Ga0501031_0110443 Ga0501031_0110443_540_1427 266
228 3300049569 Ga0501032_0019530 Ga0501032_0019530_2942_3829 266
229 3300049571 Ga0501034_0067787 Ga0501034_0067787_288_1175 266
230 3300049574 Ga0501038_0022220 Ga0501038_0022220_4582_5469 266
231 3300049575 Ga0501039_0086334 Ga0501039_0086334_701_1588 266
232 3300049586 Ga0501070_0282108 Ga0501070_0282108_12_899 266
233 3300049823 Ga0501044_0204060 Ga0501044_0204060_274_1161 266
234 3300053139 Ga0500568_0037225 Ga0500568_0037225_1077_1964 266
235 3300053153 Ga0500616_0137726 Ga0500616_0137726_105_992 266
236 3300053158 Ga0500627_0097165 Ga0500627_0097165_57_944 266
237 3300053177 Ga0500636_0075049 Ga0500636_0075049_226_1113 266
238 3300005441 Ga0070700_100087884 Ga0070700_1000878842 267
239 3300005458 Ga0070681_10056806 Ga0070681_100568063 267
240 3300005471 Ga0070698_100249872 Ga0070698_1002498722 267
241 3300005549 Ga0070704_100109564 Ga0070704_1001095642 267
242 3300005578 Ga0068854_100005468 Ga0068854_1000054683 267
243 3300005844 Ga0068862_100258420 Ga0068862_1002584202 267
244 3300005985 Ga0081539_10013306 Ga0081539_100133066 267
245 3300006186 Ga0075369_10029054 Ga0075369_100290541 267
246 3300013307 Ga0157372_10179791 Ga0157372_101797912 267
247 3300025935 Ga0207709_10050919 Ga0207709_100509192 267
248 3300025972 Ga0207668_10109860 Ga0207668_101098602 267
249 3300025981 Ga0207640_10004396 Ga0207640_100043966 267
250 3300031235 Ga0265330_10010655 Ga0265330_100106552 267
251 3300031247 Ga0265340_10003545 Ga0265340_100035457 267
252 3300031712 Ga0265342_10029712 Ga0265342_100297123 267
253 3300031730 Ga0307516_10017411 Ga0307516_100174112 267
254 3300035113 Ga0373936_0005011 Ga0373936_0005011_3798_4685 267
255 3300035116 Ga0373945_0007341 Ga0373945_0007341_1981_2868 267
256 3300035120 Ga0373957_0079219 Ga0373957_0079219_386_1273 267
257 3300035170 Ga0373943_0057054 Ga0373943_0057054_600_1487 267
258 3300035692 Ga0373935_0001652 Ga0373935_0001652_10956_11843 267
259 3300035695 Ga0373927_0012054 Ga0373927_0012054_3734_4621 267
260 3300035724 Ga0373933_0088427 Ga0373933_0088427_708_1595 267
261 3300035725 Ga0373947_0000308 Ga0373947_0000308_5659_6546 267
262 3300035725 Ga0373947_0098617 Ga0373947_0098617_805_1692 267
263 3300036401 Ga0373937_0014091 Ga0373937_0014091_3031_3918 267
264 3300037068 Ga0373925_0004951 Ga0373925_0004951_1964_2851 267
265 3300046454 Ga0495592_0010901 Ga0495592_0010901_5252_6139 267
266 3300046455 Ga0495603_0011228 Ga0495603_0011228_2158_3045 267
267 3300046459 Ga0495629_0001384 Ga0495629_0001384_16928_17815 267
268 3300046461 Ga0495641_0008805 Ga0495641_0008805_476_1363 267
269 3300046472 Ga0495580_0048298 Ga0495580_0048298_1977_2864 267
270 3300046473 Ga0495582_0000130 Ga0495582_0000130_22177_23064 267
271 3300046473 Ga0495582_0013157 Ga0495582_0013157_510_1397 267
272 3300046475 Ga0495639_0000061 Ga0495639_0000061_40751_41638 267
273 3300046476 Ga0495662_0000308 Ga0495662_0000308_9863_10750 267
274 3300046477 Ga0495664_0040115 Ga0495664_0040115_433_1320 267
275 3300046499 Ga0495594_0001934 Ga0495594_0001934_2893_3780 267
276 3300046511 Ga0495608_0151047 Ga0495608_0151047_63_950 267
277 3300046516 Ga0495628_0061986 Ga0495628_0061986_1492_2379 267
278 3300046531 Ga0495665_0002782 Ga0495665_0002782_6183_7070 267
279 3300046533 Ga0495640_0003517 Ga0495640_0003517_8763_9650 267
280 3300046557 Ga0495622_0012397 Ga0495622_0012397_516_1403 267
281 3300046642 Ga0495634_0000703 Ga0495634_0000703_9340_10227 267
282 3300046674 Ga0495588_0003829 Ga0495588_0003829_5278_6165 267
283 3300046681 Ga0495647_0006362 Ga0495647_0006362_743_1630 267
284 3300046683 Ga0495658_0002243 Ga0495658_0002243_3140_4027 267
285 3300046689 Ga0495613_0005726 Ga0495613_0005726_1643_2530 267
286 3300046690 Ga0495624_0000188 Ga0495624_0000188_4303_5190 267
287 3300047315 Ga0495581_0000152 Ga0495581_0000152_7161_8048 267
288 3300047319 Ga0495674_0001256 Ga0495674_0001256_14177_15064 267
289 3300047321 Ga0495676_0027751 Ga0495676_0027751_745_1632 267
290 3300047322 Ga0495680_0067800 Ga0495680_0067800_415_1302 267
291 3300047471 Ga0495684_0042078 Ga0495684_0042078_181_1068 267
292 3300047673 Ga0495593_0000144 Ga0495593_0000144_12666_13553 267
293 3300053077 Ga0495601_0152026 Ga0495601_0152026_367_1254 267
294 3300053077 Ga0495601_0259741 Ga0495601_0259741_222_1109 267
295 3300053084 Ga0495595_0047080 Ga0495595_0047080_664_1551 267
296 3300053085 Ga0495619_0051093 Ga0495619_0051093_827_1714 267
297 3300005338 Ga0068868_100248107 Ga0068868_1002481072 268
298 3300005344 Ga0070661_100113258 Ga0070661_1001132582 268
299 3300005347 Ga0070668_100012922 Ga0070668_1000129222 268
300 3300005355 Ga0070671_100313382 Ga0070671_1003133822 268
301 3300005456 Ga0070678_100040180 Ga0070678_1000401802 268
302 3300005457 Ga0070662_100120984 Ga0070662_1001209842 268
303 3300005544 Ga0070686_100153504 Ga0070686_1001535042 268
304 3300005548 Ga0070665_100050963 Ga0070665_1000509632 268
305 3300005563 Ga0068855_100055064 Ga0068855_1000550645 268
306 3300005616 Ga0068852_100353653 Ga0068852_1003536532 268
307 3300005617 Ga0068859_100133789 Ga0068859_1001337892 268
308 3300005618 Ga0068864_100090642 Ga0068864_1000906423 268
309 3300005842 Ga0068858_100083289 Ga0068858_1000832892 268
310 3300005983 Ga0081540_1003874 Ga0081540_10038743 268
311 3300006038 Ga0075365_10004501 Ga0075365_100045012 268
312 3300006038 Ga0075365_10020048 Ga0075365_100200485 268
313 3300006048 Ga0075363_100007043 Ga0075363_1000070432 268
314 3300006048 Ga0075363_100021765 Ga0075363_1000217654 268
315 3300006051 Ga0075364_10205542 Ga0075364_102055421 268
316 3300006237 Ga0097621_100192366 Ga0097621_1001923662 268
317 3300006353 Ga0075370_10033181 Ga0075370_100331812 268
318 3300006931 Ga0097620_100133791 Ga0097620_1001337913 268
319 3300009093 Ga0105240_10035586 Ga0105240_100355864 268
320 3300009098 Ga0105245_10310952 Ga0105245_103109522 268
321 3300009177 Ga0105248_10374482 Ga0105248_103744822 268
322 3300013104 Ga0157370_10052947 Ga0157370_100529473 268
323 3300013105 Ga0157369_10007824 Ga0157369_100078247 268
324 3300013297 Ga0157378_10273428 Ga0157378_102734282 268
325 3300013307 Ga0157372_10086103 Ga0157372_100861034 268
326 3300014325 Ga0163163_10048230 Ga0163163_100482302 268
327 3300014969 Ga0157376_10218760 Ga0157376_102187602 268
328 3300025901 Ga0207688_10030797 Ga0207688_100307973 268
329 3300025904 Ga0207647_10211031 Ga0207647_102110311 268
330 3300025911 Ga0207654_10008665 Ga0207654_100086653 268
331 3300025913 Ga0207695_10019186 Ga0207695_100191863 268
332 3300025931 Ga0207644_10041067 Ga0207644_100410673 268
333 3300025932 Ga0207690_10122168 Ga0207690_101221682 268
334 3300025942 Ga0207689_10446716 Ga0207689_104467161 268
335 3300025949 Ga0207667_10165755 Ga0207667_101657552 268
336 3300025960 Ga0207651_10322340 Ga0207651_103223402 268
337 3300026067 Ga0207678_10065751 Ga0207678_100657512 268
338 3300026088 Ga0207641_10040916 Ga0207641_100409164 268
339 3300026095 Ga0207676_10034159 Ga0207676_100341592 268
340 3300026116 Ga0207674_10165583 Ga0207674_101655833 268
341 3300026121 Ga0207683_10145291 Ga0207683_101452912 268
342 3300026142 Ga0207698_10318380 Ga0207698_103183801 268
343 3300027866 Ga0209813_10003784 Ga0209813_100037843 268
344 3300028379 Ga0268266_10008946 Ga0268266_100089468 268
345 3300028379 Ga0268266_10014631 Ga0268266_100146313 268
346 3300031731 Ga0307405_10183430 Ga0307405_101834302 268
347 3300037418 Ga0395900_0048752 Ga0395900_0048752_43_930 268
348 3300038443 Ga0395901_0349449 Ga0395901_0349449_111_998 268
349 3300042006 Ga0439432_033545 Ga0439432_033545_722_1609 268
350 3300046455 Ga0495603_0031835 Ga0495603_0031835_745_1632 268
351 3300048905 Ga0496102_0690670 Ga0496102_0690670_20_907 268
352 3300048906 Ga0496103_0158337 Ga0496103_0158337_67_954 268
353 3300048908 Ga0496105_0078403 Ga0496105_0078403_981_1868 268
354 3300048913 Ga0496110_0173448 Ga0496110_0173448_419_1306 268
355 3300048914 Ga0496111_0124393 Ga0496111_0124393_821_1708 268
356 3300048915 Ga0496112_0045387 Ga0496112_0045387_2360_3247 268
357 3300048917 Ga0496114_0044714 Ga0496114_0044714_622_1509 268
358 3300048918 Ga0496115_0055924 Ga0496115_0055924_822_1709 268
359 3300048924 Ga0496121_0231063 Ga0496121_0231063_14_901 268
360 3300048927 Ga0496124_0161073 Ga0496124_0161073_631_1518 268
361 3300048929 Ga0496126_0006946 Ga0496126_0006946_2460_3347 268
362 3300050492 nmdc:mga0yw44_27309_c1 nmdc:mga0yw44_27309_c1_1900_2787 268
363 3300050492 nmdc:mga0yw44_42642_c1 nmdc:mga0yw44_42642_c1_1622_2509 268
364 3300050495 nmdc:mga04h51_4173_c1 nmdc:mga04h51_4173_c1_227_1114 268
365 3300050496 nmdc:mga07m45_3431_c1 nmdc:mga07m45_3431_c1_199_1086 268
366 3300050496 nmdc:mga07m45_45116_c1 nmdc:mga07m45_45116_c1_716_1603 268
367 3300050515 nmdc:mga0a205_180925_c1 nmdc:mga0a205_180925_c1_14_901 268
368 3300053080 Ga0500635_0000782 Ga0500635_0000782_5620_6507 268
369 3300053093 Ga0500651_0110382 Ga0500651_0110382_733_1620 268
370 3300053119 Ga0500595_004867 Ga0500595_004867_4914_5801 268
371 3300053162 Ga0500638_141260 Ga0500638_141260_62_949 268
372 3300053178 Ga0500637_0012501 Ga0500637_0012501_3079_3966 268
373 3300005981 Ga0081538_10110897 Ga0081538_101108972 269
374 3300014968 Ga0157379_10100460 Ga0157379_101004602 269
375 3300025295 Ga0209564_1017177 Ga0209564_10171773 269
376 3300028379 Ga0268266_10458810 Ga0268266_104588102 269
377 3300031852 Ga0307410_10253269 Ga0307410_102532692 269
378 3300044656 Ga0466969_0137691 Ga0466969_0137691_47_934 269
379 3300045049 Ga0466959_0009642 Ga0466959_0009642_4030_4917 269
380 3300048925 Ga0496122_0078385 Ga0496122_0078385_1247_2119 269
381 3300048929 Ga0496126_0014947 Ga0496126_0014947_3488_4360 269
382 3300049587 Ga0501071_0275525 Ga0501071_0275525_41_928 269
383 3300005543 Ga0070672_100170980 Ga0070672_1001709802 270
384 3300026121 Ga0207683_10018675 Ga0207683_100186752 270
385 3300031548 Ga0307408_100141225 Ga0307408_1001412252 270
386 3300031911 Ga0307412_10252472 Ga0307412_102524722 270
387 3300036534 Ga0310109_014758 Ga0310109_014758_84_971 270
388 3300048929 Ga0496126_0467612 Ga0496126_0467612_35_907 270
389 3300049570 Ga0501033_0012970 Ga0501033_0012970_556_1443 270
390 3300049571 Ga0501034_0052026 Ga0501034_0052026_474_1361 270
391 3300049572 Ga0501036_0000112 Ga0501036_0000112_3019_3906 270
392 3300049573 Ga0501037_0000406 Ga0501037_0000406_8250_9137 270
393 3300049574 Ga0501038_0010003 Ga0501038_0010003_5434_6321 270
394 3300049575 Ga0501039_0000097 Ga0501039_0000097_59620_60507 270
395 3300049578 Ga0501042_0074035 Ga0501042_0074035_25_912 270
396 3300049579 Ga0501043_0014172 Ga0501043_0014172_2987_3874 270
397 3300049580 Ga0501046_0001554 Ga0501046_0001554_8018_8905 270
398 3300049581 Ga0501047_0006122 Ga0501047_0006122_3019_3906 270
399 3300049584 Ga0501068_0003479 Ga0501068_0003479_1724_2611 270
400 3300049585 Ga0501069_0010536 Ga0501069_0010536_1856_2743 270
401 3300049586 Ga0501070_0001063 Ga0501070_0001063_3146_4033 270
402 3300049589 Ga0501073_0151518 Ga0501073_0151518_555_1442 270
403 3300049741 Ga0501079_0134260 Ga0501079_0134260_533_1420 270
404 3300049742 Ga0501080_0000143 Ga0501080_0000143_47522_48409 270
405 3300049822 Ga0501035_0000250 Ga0501035_0000250_58969_59856 270
406 3300049823 Ga0501044_0125764 Ga0501044_0125764_1119_2006 270
407 3300050493 nmdc:mga0k408_261600_c1 nmdc:mga0k408_261600_c1_126_1013 270
408 3300005456 Ga0070678_100169920 Ga0070678_1001699202 271
409 3300005843 Ga0068860_100000316 Ga0068860_10000031635 271
410 3300009101 Ga0105247_10041793 Ga0105247_100417932 271
411 3300014325 Ga0163163_10382651 Ga0163163_103826512 271
412 3300014326 Ga0157380_10152136 Ga0157380_101521361 271
413 3300014969 Ga0157376_10055961 Ga0157376_100559612 271
414 3300025297 Ga0209758_1003772 Ga0209758_10037728 271
415 3300025900 Ga0207710_10010831 Ga0207710_100108312 271
416 3300025906 Ga0207699_10196897 Ga0207699_101968971 271
417 3300025929 Ga0207664_10360527 Ga0207664_103605272 271
418 3300025932 Ga0207690_10218022 Ga0207690_102180222 271
419 3300025937 Ga0207669_10149850 Ga0207669_101498502 271
420 3300025938 Ga0207704_10245142 Ga0207704_102451421 271
421 3300026121 Ga0207683_10176699 Ga0207683_101766992 271
422 3300028381 Ga0268264_10000430 Ga0268264_1000043035 271
423 3300028786 Ga0307517_10000772 Ga0307517_100007726 271
424 3300031507 Ga0307509_10080753 Ga0307509_100807532 271
425 3300036459 Ga0372808_002089 Ga0372808_002089_343_1230 271
426 3300037471 Ga0395905_0564628 Ga0395905_0564628_37_909 271
427 3300046615 Ga0495656_0134415 Ga0495656_0134415_41_928 271
428 3300049579 Ga0501043_0044795 Ga0501043_0044795_29_844 271
429 3300005983 Ga0081540_1010410 Ga0081540_10104102 272
430 3300010159 Ga0099796_10004964 Ga0099796_100049642 272
431 3300027512 Ga0209179_1005890 Ga0209179_10058902 272
432 3300046794 Ga0495589_0043465 Ga0495589_0043465_10_882 272
433 3300053094 Ga0500566_0000026 Ga0500566_0000026_66524_67411 272
434 3300053095 Ga0500640_011912 Ga0500640_011912_2497_3384 272
435 3300053111 Ga0500572_002560 Ga0500572_002560_2113_3000 272
436 3300053115 Ga0500591_080606 Ga0500591_080606_76_963 272
437 3300053123 Ga0500614_000135 Ga0500614_000135_6218_7105 272
438 3300053136 Ga0500559_0004957 Ga0500559_0004957_3144_4031 272
439 3300053148 Ga0500590_123554 Ga0500590_123554_227_1114 272
440 3300053150 Ga0500603_001715 Ga0500603_001715_2455_3342 272
441 3300053159 Ga0500630_000207 Ga0500630_000207_20148_21035 272
442 3300053162 Ga0500638_119689 Ga0500638_119689_227_1114 272
443 3300053163 Ga0500639_000939 Ga0500639_000939_5116_6003 272
444 3300053735 Ga0500596_000101 Ga0500596_000101_10508_11395 272
445 3300009094 Ga0111539_10394785 Ga0111539_103947852 273
446 3300025925 Ga0207650_10183898 Ga0207650_101838982 273
447 3300026121 Ga0207683_10146025 Ga0207683_101460253 273
448 3300027907 Ga0207428_10072008 Ga0207428_100720083 273
449 3300035086 Ga0373934_0029660 Ga0373934_0029660_276_1163 273
450 3300035111 Ga0373923_0011853 Ga0373923_0011853_203_1090 273
451 3300035117 Ga0373953_0001976 Ga0373953_0001976_3986_4873 273
452 3300035118 Ga0373954_0000070 Ga0373954_0000070_9304_10191 273
453 3300035119 Ga0373956_0001764 Ga0373956_0001764_5526_6413 273
454 3300035172 Ga0373955_0000771 Ga0373955_0000771_3890_4777 273
455 3300046462 Ga0495651_0022001 Ga0495651_0022001_204_1091 273
456 3300046463 Ga0495653_0003677 Ga0495653_0003677_10920_11807 273
457 3300046477 Ga0495664_0006016 Ga0495664_0006016_641_1528 273
458 3300046514 Ga0495618_0009298 Ga0495618_0009298_1900_2787 273
459 3300046516 Ga0495628_0002643 Ga0495628_0002643_5645_6532 273
460 3300046529 Ga0495652_0000858 Ga0495652_0000858_31455_32342 273
461 3300046533 Ga0495640_0018432 Ga0495640_0018432_2759_3646 273
462 3300046543 Ga0495645_0003263 Ga0495645_0003263_821_1708 273
463 3300046543 Ga0495645_0058213 Ga0495645_0058213_740_1627 273
464 3300046642 Ga0495634_0007605 Ga0495634_0007605_4883_5770 273
465 3300046663 Ga0495635_0000644 Ga0495635_0000644_19505_20392 273
466 3300046675 Ga0495657_0001016 Ga0495657_0001016_21013_21900 273
467 3300046678 Ga0495599_0000637 Ga0495599_0000637_582_1469 273
468 3300046678 Ga0495599_0018824 Ga0495599_0018824_515_1402 273
469 3300046679 Ga0495623_0003015 Ga0495623_0003015_5997_6884 273
470 3300046680 Ga0495646_0001926 Ga0495646_0001926_5395_6282 273
471 3300046689 Ga0495613_0028892 Ga0495613_0028892_96_983 273
472 3300047319 Ga0495674_0108330 Ga0495674_0108330_450_1337 273
473 3300047322 Ga0495680_0004188 Ga0495680_0004188_8972_9859 273
474 3300047471 Ga0495684_0000380 Ga0495684_0000380_19159_20046 273
475 3300047673 Ga0495593_0001866 Ga0495593_0001866_3898_4785 273
476 3300048088 Ga0495602_0042204 Ga0495602_0042204_557_1444 273
477 3300049744 Ga0501083_0141601 Ga0501083_0141601_50_937 273
478 3300050511 nmdc:mga08y16_125241_c1 nmdc:mga08y16_125241_c1_180_1067 273
479 3300053077 Ga0495601_0025742 Ga0495601_0025742_2487_3374 273
480 3300053077 Ga0495601_0051392 Ga0495601_0051392_269_1156 273
481 3300053084 Ga0495595_0002657 Ga0495595_0002657_3152_4039 273
482 3300053085 Ga0495619_0000355 Ga0495619_0000355_15758_16645 273
483 3300053094 Ga0500566_0050239 Ga0500566_0050239_1289_2176 273
484 3300053102 Ga0500554_015264 Ga0500554_015264_520_1407 273
485 3300053119 Ga0500595_002514 Ga0500595_002514_1329_2216 273
486 3300053130 Ga0500642_0000037 Ga0500642_0000037_45879_46766 273
487 3300053136 Ga0500559_0169954 Ga0500559_0169954_90_977 273
488 3300053178 Ga0500637_0000122 Ga0500637_0000122_9011_9898 273
489 3300053178 Ga0500637_0013976 Ga0500637_0013976_2871_3758 273
490 3300055283 Ga0500661_000317 Ga0500661_000317_4442_5329 273
491 3300031616 Ga0307508_10000009 Ga0307508_10000009120 274
492 3300035692 Ga0373935_0043241 Ga0373935_0043241_1249_2136 274
493 3300048907 Ga0496104_0076610 Ga0496104_0076610_1828_2715 274
494 3300048908 Ga0496105_0343412 Ga0496105_0343412_253_1140 274
495 3300048911 Ga0496108_0057488 Ga0496108_0057488_1377_2264 274
496 3300048912 Ga0496109_0245261 Ga0496109_0245261_165_1052 274
497 3300048913 Ga0496110_0019362 Ga0496110_0019362_4418_5305 274
498 3300048914 Ga0496111_0031722 Ga0496111_0031722_1145_2032 274
499 3300048915 Ga0496112_0105162 Ga0496112_0105162_508_1395 274
500 3300048916 Ga0496113_0154479 Ga0496113_0154479_174_1061 274
501 3300005337 Ga0070682_100116438 Ga0070682_1001164382 275
502 3300005338 Ga0068868_100043717 Ga0068868_1000437174 275
503 3300005344 Ga0070661_100131994 Ga0070661_1001319942 275
504 3300005455 Ga0070663_100004362 Ga0070663_1000043622 275
505 3300005456 Ga0070678_100024234 Ga0070678_1000242343 275
506 3300005548 Ga0070665_100092227 Ga0070665_1000922273 275
507 3300005564 Ga0070664_100055529 Ga0070664_1000555292 275
508 3300005578 Ga0068854_100208609 Ga0068854_1002086092 275
509 3300005618 Ga0068864_100027748 Ga0068864_1000277485 275
510 3300005834 Ga0068851_10064950 Ga0068851_100649502 275
511 3300005841 Ga0068863_100141926 Ga0068863_1001419262 275
512 3300009098 Ga0105245_10109432 Ga0105245_101094322 275
513 3300009176 Ga0105242_10457612 Ga0105242_104576122 275
514 3300013306 Ga0163162_10037734 Ga0163162_100377343 275
515 3300014325 Ga0163163_10006000 Ga0163163_100060005 275
516 3300014968 Ga0157379_10124348 Ga0157379_101243482 275
517 3300014969 Ga0157376_10046977 Ga0157376_100469774 275
518 3300021377 Ga0213874_10012710 Ga0213874_100127102 275
519 3300021384 Ga0213876_10040414 Ga0213876_100404142 275
520 3300025920 Ga0207649_10104861 Ga0207649_101048613 275
521 3300025940 Ga0207691_10519729 Ga0207691_105197291 275
522 3300025944 Ga0207661_10466767 Ga0207661_104667672 275
523 3300025981 Ga0207640_10296866 Ga0207640_102968661 275
524 3300026067 Ga0207678_10015103 Ga0207678_100151036 275
525 3300026095 Ga0207676_10018918 Ga0207676_100189185 275
526 3300028379 Ga0268266_10104493 Ga0268266_101044932 275
527 3300031238 Ga0265332_10079482 Ga0265332_100794822 275
528 3300039437 Ga0436365_0028265 Ga0436365_0028265_2715_3602 275
529 3300039450 Ga0436363_0776803 Ga0436363_0776803_259_1146 275
530 3300046511 Ga0495608_0045497 Ga0495608_0045497_1609_2481 275
531 3300048904 Ga0496101_0093294 Ga0496101_0093294_15_902 275
532 3300048906 Ga0496103_0002281 Ga0496103_0002281_6584_7471 275
533 3300048908 Ga0496105_0087186 Ga0496105_0087186_300_1268 275
534 3300048910 Ga0496107_0065443 Ga0496107_0065443_268_1155 275
535 3300048913 Ga0496110_0029779 Ga0496110_0029779_3313_4200 275
536 3300048915 Ga0496112_0331897 Ga0496112_0331897_564_1451 275
537 3300048917 Ga0496114_0056373 Ga0496114_0056373_2265_3233 275
538 3300048918 Ga0496115_0001490 Ga0496115_0001490_12571_13458 275
539 3300049569 Ga0501032_0000129 Ga0501032_0000129_5649_6536 275
540 3300049570 Ga0501033_0000983 Ga0501033_0000983_24247_25134 275
541 3300049571 Ga0501034_0001074 Ga0501034_0001074_1328_2215 275
542 3300049572 Ga0501036_0000232 Ga0501036_0000232_34260_35147 275
543 3300049573 Ga0501037_0000106 Ga0501037_0000106_22308_23195 275
544 3300049574 Ga0501038_0000108 Ga0501038_0000108_36828_37715 275
545 3300049575 Ga0501039_0000460 Ga0501039_0000460_14615_15502 275
546 3300049578 Ga0501042_0038574 Ga0501042_0038574_77_964 275
547 3300049579 Ga0501043_0000035 Ga0501043_0000035_92522_93409 275
548 3300049580 Ga0501046_0000944 Ga0501046_0000944_24769_25656 275
549 3300049581 Ga0501047_0000792 Ga0501047_0000792_18938_19825 275
550 3300049582 Ga0501048_0000116 Ga0501048_0000116_12988_13875 275
551 3300049583 Ga0501067_0001402 Ga0501067_0001402_6178_7065 275
552 3300049584 Ga0501068_0000014 Ga0501068_0000014_49556_50443 275
553 3300049585 Ga0501069_0168111 Ga0501069_0168111_40_927 275
554 3300049586 Ga0501070_0009144 Ga0501070_0009144_1200_2087 275
555 3300049587 Ga0501071_0046687 Ga0501071_0046687_1143_2030 275
556 3300049588 Ga0501072_0000367 Ga0501072_0000367_14053_14940 275
557 3300049589 Ga0501073_0000368 Ga0501073_0000368_13612_14499 275
558 3300049590 Ga0501074_0001037 Ga0501074_0001037_2466_3353 275
559 3300049741 Ga0501079_0011719 Ga0501079_0011719_648_1535 275
560 3300049742 Ga0501080_0000332 Ga0501080_0000332_23075_23962 275
561 3300049822 Ga0501035_0000632 Ga0501035_0000632_1725_2612 275
562 3300049823 Ga0501044_0000051 Ga0501044_0000051_86406_87293 275
563 3300049824 Ga0501045_0002440 Ga0501045_0002440_11185_12072 275
564 3300054114 Ga0501084_0000773 Ga0501084_0000773_14357_15244 275
565 3300060353 Ga0501082_0000396 Ga0501082_0000396_37235_38122 275
566 3300005327 Ga0070658_10062966 Ga0070658_100629663 276
567 3300005455 Ga0070663_100052418 Ga0070663_1000524182 276
568 3300005618 Ga0068864_100135901 Ga0068864_1001359012 276
569 3300005937 Ga0081455_10003832 Ga0081455_1000383211 276
570 3300005983 Ga0081540_1010937 Ga0081540_10109373 276
571 3300025297 Ga0209758_1017949 Ga0209758_10179492 276
572 3300031548 Ga0307408_100101901 Ga0307408_1001019013 276
573 3300035724 Ga0373933_0000041 Ga0373933_0000041_70576_71463 276
574 3300041413 Ga0439465_0079979 Ga0439465_0079979_150_1037 276
575 3300044684 Ga0466966_0146856 Ga0466966_0146856_389_1276 276
576 3300053158 Ga0500627_0039582 Ga0500627_0039582_340_1227 276
577 3300005262 Ga0065165_1001750 Ga0065165_100175020 277
578 3300005548 Ga0070665_100184796 Ga0070665_1001847961 277
579 3300009551 Ga0105238_10294232 Ga0105238_102942322 277
580 3300025941 Ga0207711_10123431 Ga0207711_101234313 277
581 3300031242 Ga0265329_10055044 Ga0265329_100550442 277
582 3300031730 Ga0307516_10125734 Ga0307516_101257341 277
583 3300035695 Ga0373927_0009182 Ga0373927_0009182_5560_6447 277
584 3300035725 Ga0373947_0178507 Ga0373947_0178507_421_1308 277
585 3300045976 Ga0466967_0308244 Ga0466967_0308244_50_937 277
586 3300046453 Ga0495627_038315 Ga0495627_038315_163_1050 277
587 3300046455 Ga0495603_0096848 Ga0495603_0096848_679_1566 277
588 3300046475 Ga0495639_0099122 Ga0495639_0099122_13_900 277
589 3300046491 Ga0495584_0045246 Ga0495584_0045246_590_1477 277
590 3300046512 Ga0495610_0030503 Ga0495610_0030503_1033_1920 277
591 3300046518 Ga0495631_0095952 Ga0495631_0095952_195_1082 277
592 3300046557 Ga0495622_0039894 Ga0495622_0039894_44_931 277
593 3300046615 Ga0495656_0021511 Ga0495656_0021511_1349_2236 277
594 3300046660 Ga0495625_0295820 Ga0495625_0295820_19_906 277
595 3300046664 Ga0495659_0015681 Ga0495659_0015681_907_1794 277
596 3300046674 Ga0495588_0028025 Ga0495588_0028025_1359_2246 277
597 3300046694 Ga0495649_0117823 Ga0495649_0117823_97_984 277
598 3300047318 Ga0495636_0027918 Ga0495636_0027918_1046_1933 277
599 3300047321 Ga0495676_0069382 Ga0495676_0069382_1073_1960 277
600 3300048927 Ga0496124_0101433 Ga0496124_0101433_117_1004 277
601 3300049460 Ga0495682_0045604 Ga0495682_0045604_486_1373 277
602 3300053119 Ga0500595_003082 Ga0500595_003082_2526_3413 277
603 3300005983 Ga0081540_1000913 Ga0081540_100091329 278
604 3300025297 Ga0209758_1005082 Ga0209758_10050826 278
605 3300032126 Ga0307415_100318737 Ga0307415_1003187372 278
606 3300045976 Ga0466967_0210837 Ga0466967_0210837_374_1261 278
607 3300006186 Ga0075369_10082956 Ga0075369_100829562 279
608 3300037853 Ga0436364_1178281 Ga0436364_1178281_2267_3154 279
609 3300041452 Ga0451793_0284192 Ga0451793_0284192_131_1018 279
610 3300041460 Ga0451802_1938471 Ga0451802_1938471_100_987 279
611 3300046455 Ga0495603_0060342 Ga0495603_0060342_1159_2046 279
612 3300046794 Ga0495589_0079223 Ga0495589_0079223_675_1562 279
613 3300047472 Ga0495686_0112569 Ga0495686_0112569_607_1494 279
614 3300050492 nmdc:mga0yw44_104794_c1 nmdc:mga0yw44_104794_c1_175_1062 279
615 3300053105 Ga0500557_000015 Ga0500557_000015_104008_104895 279
616 3300006173 Ga0070716_100035837 Ga0070716_1000358372 280
617 3300007265 Ga0099794_10062743 Ga0099794_100627432 280
618 3300009098 Ga0105245_10248483 Ga0105245_102484832 280
619 3300010159 Ga0099796_10003434 Ga0099796_100034342 280
620 3300010375 Ga0105239_10059881 Ga0105239_100598814 280
621 3300025915 Ga0207693_10085133 Ga0207693_100851333 280
622 3300025921 Ga0207652_10059661 Ga0207652_100596612 280
623 3300025928 Ga0207700_10293584 Ga0207700_102935842 280
624 3300026075 Ga0207708_10118703 Ga0207708_101187032 280
625 3300027671 Ga0209588_1062838 Ga0209588_10628382 280
626 3300037068 Ga0373925_0123554 Ga0373925_0123554_648_1535 280
627 3300041512 Ga0451853_1007175 Ga0451853_1007175_100_987 280
628 3300046459 Ga0495629_0006304 Ga0495629_0006304_7454_8341 280
629 3300046506 Ga0495583_0015129 Ga0495583_0015129_3220_4107 280
630 3300046516 Ga0495628_0062313 Ga0495628_0062313_27_914 280
631 3300046529 Ga0495652_0033362 Ga0495652_0033362_1752_2639 280
632 3300046529 Ga0495652_0113666 Ga0495652_0113666_1273_2160 280
633 3300046533 Ga0495640_0214689 Ga0495640_0214689_24_911 280
634 3300046536 Ga0495587_0060580 Ga0495587_0060580_668_1555 280
635 3300046543 Ga0495645_0016949 Ga0495645_0016949_3907_4794 280
636 3300046663 Ga0495635_0004483 Ga0495635_0004483_661_1548 280
637 3300046663 Ga0495635_0025471 Ga0495635_0025471_1751_2638 280
638 3300046675 Ga0495657_0171586 Ga0495657_0171586_211_1098 280
639 3300046678 Ga0495599_0060991 Ga0495599_0060991_1448_2335 280
640 3300046679 Ga0495623_0005023 Ga0495623_0005023_3459_4346 280
641 3300046680 Ga0495646_0033462 Ga0495646_0033462_1398_2285 280
642 3300046690 Ga0495624_0125215 Ga0495624_0125215_371_1258 280
643 3300046809 Ga0495600_0013271 Ga0495600_0013271_2411_3298 280
644 3300046809 Ga0495600_0062033 Ga0495600_0062033_550_1437 280
645 3300047317 Ga0495604_0013258 Ga0495604_0013258_4541_5428 280
646 3300047317 Ga0495604_0034842 Ga0495604_0034842_183_1070 280
647 3300047319 Ga0495674_0011842 Ga0495674_0011842_4386_5273 280
648 3300047322 Ga0495680_0015409 Ga0495680_0015409_2569_3456 280
649 3300047673 Ga0495593_0079361 Ga0495593_0079361_477_1364 280
650 3300048907 Ga0496104_0004213 Ga0496104_0004213_2208_3095 280
651 3300048908 Ga0496105_0034896 Ga0496105_0034896_72_959 280
652 3300048918 Ga0496115_0193300 Ga0496115_0193300_139_1026 280
653 3300048921 Ga0496118_0177629 Ga0496118_0177629_198_1085 280
654 3300048922 Ga0496119_0013974 Ga0496119_0013974_4364_5251 280
655 3300048923 Ga0496120_0016201 Ga0496120_0016201_942_1829 280
656 3300048924 Ga0496121_0063766 Ga0496121_0063766_492_1379 280
657 3300048925 Ga0496122_0079417 Ga0496122_0079417_899_1786 280
658 3300048928 Ga0496125_0099660 Ga0496125_0099660_1222_2109 280
659 3300048929 Ga0496126_0033274 Ga0496126_0033274_533_1420 280
660 3300053083 Ga0495655_0001518 Ga0495655_0001518_451_1338 280
661 3300053111 Ga0500572_000565 Ga0500572_000565_10875_11762 280
662 3300053136 Ga0500559_0000081 Ga0500559_0000081_20150_21037 280
663 3300053163 Ga0500639_048783 Ga0500639_048783_546_1433 280
664 3300053725 Ga0500576_015404 Ga0500576_015404_1732_2619 280
665 3300053729 Ga0500625_003216 Ga0500625_003216_4282_5169 280
666 3300053735 Ga0500596_000408 Ga0500596_000408_858_1745 280
667 3300005434 Ga0070709_10249165 Ga0070709_102491651 281
668 3300005435 Ga0070714_100299368 Ga0070714_1002993682 281
669 3300006048 Ga0075363_100032594 Ga0075363_1000325942 281
670 3300006178 Ga0075367_10123296 Ga0075367_101232962 281
671 3300025906 Ga0207699_10185649 Ga0207699_101856492 281
672 3300046452 Ga0495617_035725 Ga0495617_035725_475_1362 281
673 3300046664 Ga0495659_0023103 Ga0495659_0023103_361_1248 281
674 3300046684 Ga0495669_0185275 Ga0495669_0185275_93_980 281
675 3300048921 Ga0496118_0075907 Ga0496118_0075907_91_978 281
676 3300048924 Ga0496121_0000937 Ga0496121_0000937_20784_21671 281
677 3300049460 Ga0495682_0071953 Ga0495682_0071953_201_1088 281
678 3300050490 nmdc:mga03n38_8163_c1 nmdc:mga03n38_8163_c1_415_1302 281
679 3300050494 nmdc:mga06z11_9916_c1 nmdc:mga06z11_9916_c1_369_1256 281
680 3300053103 Ga0500555_004038 Ga0500555_004038_1655_2542 281
681 3300053119 Ga0500595_056519 Ga0500595_056519_192_1079 281
682 3300053133 Ga0500655_011412 Ga0500655_011412_197_1084 281
683 3300005329 Ga0070683_100370811 Ga0070683_1003708112 282
684 3300005577 Ga0068857_100068632 Ga0068857_1000686322 282
685 3300005614 Ga0068856_100434550 Ga0068856_1004345502 282
686 3300006175 Ga0070712_100034527 Ga0070712_1000345272 282
687 3300006186 Ga0075369_10023292 Ga0075369_100232922 282
688 3300006186 Ga0075369_10053654 Ga0075369_100536542 282
689 3300006353 Ga0075370_10087001 Ga0075370_100870012 282
690 3300009148 Ga0105243_10353430 Ga0105243_103534302 282
691 3300009545 Ga0105237_10395226 Ga0105237_103952261 282
692 3300009551 Ga0105238_10112321 Ga0105238_101123212 282
693 3300013105 Ga0157369_10173167 Ga0157369_101731672 282
694 3300014325 Ga0163163_10246170 Ga0163163_102461702 282
695 3300025915 Ga0207693_10039343 Ga0207693_100393433 282
696 3300026078 Ga0207702_10413493 Ga0207702_104134932 282
697 3300026116 Ga0207674_10021165 Ga0207674_100211652 282
698 3300037471 Ga0395905_0003894 Ga0395905_0003894_229_1116 282
699 3300039437 Ga0436365_1664592 Ga0436365_1664592_631_1503 282
700 3300041498 Ga0451841_0283415 Ga0451841_0283415_46_933 282
701 3300044694 Ga0466963_0004339 Ga0466963_0004339_970_1857 282
702 3300044706 Ga0466964_0010990 Ga0466964_0010990_1493_2380 282
703 3300044842 Ga0466957_0363188 Ga0466957_0363188_79_966 282
704 3300048928 Ga0496125_0094080 Ga0496125_0094080_998_1885 282
705 3300050491 nmdc:mga00v17_143039_c1 nmdc:mga00v17_143039_c1_356_1243 282
706 3300050496 nmdc:mga07m45_99442_c1 nmdc:mga07m45_99442_c1_472_1359 282
707 3300050516 nmdc:mga0sz30_24232_c1 nmdc:mga0sz30_24232_c1_1180_2067 282
708 3300053093 Ga0500651_0008492 Ga0500651_0008492_1023_1910 282
709 3300053118 Ga0500594_0001178 Ga0500594_0001178_1273_2160 282
710 3300053156 Ga0500622_0101586 Ga0500622_0101586_164_1051 282
711 3300002067 JGI24735J21928_10025237 JGI24735J21928_100252372 283
712 3300005262 Ga0065165_1008548 Ga0065165_10085483 283
713 3300005457 Ga0070662_100103498 Ga0070662_1001034981 283
714 3300005539 Ga0068853_100031569 Ga0068853_1000315691 283
715 3300005563 Ga0068855_100028482 Ga0068855_1000284822 283
716 3300005577 Ga0068857_100022108 Ga0068857_1000221087 283
717 3300005578 Ga0068854_100028453 Ga0068854_1000284532 283
718 3300005578 Ga0068854_100054844 Ga0068854_1000548442 283
719 3300005614 Ga0068856_100071140 Ga0068856_1000711402 283
720 3300005616 Ga0068852_100006605 Ga0068852_1000066052 283
721 3300009093 Ga0105240_10012605 Ga0105240_100126058 283
722 3300009545 Ga0105237_10159612 Ga0105237_101596122 283
723 3300009551 Ga0105238_10112048 Ga0105238_101120482 283
724 3300010375 Ga0105239_10002676 Ga0105239_100026764 283
725 3300014969 Ga0157376_10532900 Ga0157376_105329002 283
726 3300025904 Ga0207647_10040791 Ga0207647_100407912 283
727 3300025911 Ga0207654_10075082 Ga0207654_100750822 283
728 3300025913 Ga0207695_10001812 Ga0207695_1000181224 283
729 3300025913 Ga0207695_10015101 Ga0207695_100151016 283
730 3300025914 Ga0207671_10008038 Ga0207671_100080389 283
731 3300025949 Ga0207667_10021446 Ga0207667_100214462 283
732 3300025981 Ga0207640_10161197 Ga0207640_101611971 283
733 3300026078 Ga0207702_10009353 Ga0207702_100093536 283
734 3300026116 Ga0207674_10009623 Ga0207674_100096237 283
735 3300037068 Ga0373925_0008222 Ga0373925_0008222_773_1681 283
736 3300053096 Ga0500641_0008858 Ga0500641_0008858_1293_2180 283
737 3300053126 Ga0500621_028739 Ga0500621_028739_303_1190 283
738 3300031616 Ga0307508_10016890 Ga0307508_100168904 284
739 3300037418 Ga0395900_0145687 Ga0395900_0145687_1540_2412 284
740 3300003203 JGI25406J46586_10003672 JGI25406J46586_100036725 286
741 3300005985 Ga0081539_10001242 Ga0081539_1000124216 286
742 3300025939 Ga0207665_10166733 Ga0207665_101667332 286
743 3300048920 Ga0496117_0136959 Ga0496117_0136959_129_1016 286
744 iso_pu_bacteria 2513237098 2513674920 286
745 iso_pu_bacteria 2524023210 2524470620 286
746 iso_pu_bacteria 2885383462 2885388347 286
747 iso_pu_bacteria 2903768456 2903776484 286
748 iso_pu_bacteria 2922361189 2922365488 286
749 3300025940 Ga0207691_10192860 Ga0207691_101928603 287
750 3300045976 Ga0466967_0144048 Ga0466967_0144048_428_1315 287
751 3300046531 Ga0495665_0076330 Ga0495665_0076330_40_927 287
752 3300053119 Ga0500595_002432 Ga0500595_002432_1442_2329 287
753 3300005937 Ga0081455_10003466 Ga0081455_1000346618 288
754 3300026041 Ga0207639_10148257 Ga0207639_101482572 288
755 3300026067 Ga0207678_10031827 Ga0207678_100318273 288
756 3300005434 Ga0070709_10001793 Ga0070709_100017938 289
757 3300025906 Ga0207699_10005980 Ga0207699_100059802 289
758 3300038443 Ga0395901_0058368 Ga0395901_0058368_2228_3115 289
759 3300005539 Ga0068853_100061828 Ga0068853_1000618282 290
760 3300005983 Ga0081540_1030043 Ga0081540_10300434 290
761 3300048928 Ga0496125_0000272 Ga0496125_0000272_45001_45888 290
762 3300049570 Ga0501033_0320178 Ga0501033_0320178_87_959 290
763 3300049823 Ga0501044_0154343 Ga0501044_0154343_826_1698 290
764 3300053125 Ga0500618_019426 Ga0500618_019426_328_1200 290
765 iso_pu_bacteria 2508501128 2509150580 291
766 iso_pu_bacteria 2513237087 2513590216 291
767 iso_pu_bacteria 2513237096 2513658051 291
768 iso_pu_bacteria 2513237101 2513692684 291
769 iso_pu_bacteria 2513237137 2513855755 291
770 iso_pu_bacteria 2513237145 2513919855 291
771 iso_pu_bacteria 2517572143 2517892293 291
772 iso_pu_bacteria 2524023228 2524540272 291
773 iso_pu_bacteria 2602042107 2603859559 291
774 iso_pu_bacteria 2667528175 2671120459 291
775 iso_pu_bacteria 2721755755 2723844937 291
776 iso_pu_bacteria 2728368998 2728747352 291
777 iso_pu_bacteria 2791355197 2793072364 291
778 iso_pu_bacteria 2791355199 2793082191 291
779 iso_pu_bacteria 2857524615 2857529033 291
780 iso_pu_bacteria 2874604998 2874605345 291
781 iso_pu_bacteria 2879110137 2879111326 291
782 iso_pu_bacteria 2885374607 2885379525 291
783 iso_pu_bacteria 2889033259 2889039704 291
784 iso_pu_bacteria 2893066018 2893070481 291
785 iso_pu_bacteria 2903748898 2903757527 291
786 iso_pu_bacteria 2904690495 2904694571 291
787 iso_pu_bacteria 2904699407 2904702465 291
788 iso_pu_bacteria 2906610324 2906618733 291
789 iso_pu_bacteria 2906635258 2906637437 291
790 iso_pu_bacteria 2906660503 2906666268 291
791 iso_pu_bacteria 2908739725 2908742581 291
792 iso_pu_bacteria 2908756301 2908760126 291
793 iso_pu_bacteria 2919073203 2919076433 291
794 iso_pu_bacteria 2922386360 2922391111 291
795 iso_pu_bacteria 2922425934 2922430394 291
796 iso_pu_bacteria 2935630451 2935631565 291
797 iso_pu_bacteria 2941507105 2941511359 291
798 iso_pu_bacteria 2941515067 2941519060 291
799 iso_pu_bacteria 2941523033 2941526360 291
800 iso_pu_bacteria 3005474847 3005480312 291
801 iso_pu_bacteria 8006933436 8006940568 291
802 iso_pu_bacteria 8006964411 8006967190 291
803 iso_pu_bacteria 8006973647 8006980256 291
804 iso_pu_bacteria 8006984368 8006986531 291
805 iso_pu_bacteria 8006994254 8006995884 291
806 iso_pu_bacteria 8019565922 8019568676 291
807 iso_pu_bacteria 8056673599 8056673724 291
808 iso_pu_bacteria 8056681323 8056686748 291
809 iso_pu_bacteria 8056689827 8056691400 291
810 3300001979 JGI24740J21852_10008223 JGI24740J21852_100082232 295
811 3300003203 JGI25406J46586_10000152 JGI25406J46586_100001528 295
812 3300003203 JGI25406J46586_10018257 JGI25406J46586_100182573 295
813 3300005327 Ga0070658_10117643 Ga0070658_101176432 295
814 3300005353 Ga0070669_100088284 Ga0070669_1000882842 295
815 3300005356 Ga0070674_100296878 Ga0070674_1002968781 295
816 3300005434 Ga0070709_10017837 Ga0070709_100178373 295
817 3300005435 Ga0070714_100002869 Ga0070714_1000028699 295
818 3300005436 Ga0070713_100006492 Ga0070713_1000064926 295
819 3300005436 Ga0070713_100181081 Ga0070713_1001810812 295
820 3300005437 Ga0070710_10001067 Ga0070710_100010674 295
821 3300005437 Ga0070710_10008800 Ga0070710_100088003 295
822 3300005437 Ga0070710_10037408 Ga0070710_100374082 295
823 3300005439 Ga0070711_100007374 Ga0070711_1000073746 295
824 3300005439 Ga0070711_100017125 Ga0070711_1000171254 295
825 3300005455 Ga0070663_100116293 Ga0070663_1001162932 295
826 3300005548 Ga0070665_100214785 Ga0070665_1002147852 295
827 3300005563 Ga0068855_100019340 Ga0068855_1000193406 295
828 3300005563 Ga0068855_100042552 Ga0068855_1000425523 295
829 3300005563 Ga0068855_100500802 Ga0068855_1005008022 295
830 3300005577 Ga0068857_100158294 Ga0068857_1001582942 295
831 3300005614 Ga0068856_100004002 Ga0068856_10000400213 295
832 3300005615 Ga0070702_100154258 Ga0070702_1001542582 295
833 3300005616 Ga0068852_100322161 Ga0068852_1003221612 295
834 3300005718 Ga0068866_10152513 Ga0068866_101525132 295
835 3300005843 Ga0068860_100026198 Ga0068860_1000261983 295
836 3300005844 Ga0068862_100106293 Ga0068862_1001062932 295
837 3300005937 Ga0081455_10008869 Ga0081455_100088698 295
838 3300005985 Ga0081539_10000273 Ga0081539_1000027371 295
839 3300005985 Ga0081539_10000735 Ga0081539_1000073531 295
840 3300006028 Ga0070717_10027316 Ga0070717_100273164 295
841 3300006038 Ga0075365_10000141 Ga0075365_1000014120 295
842 3300006051 Ga0075364_10038689 Ga0075364_100386892 295
843 3300006163 Ga0070715_10000178 Ga0070715_100001783 295
844 3300006173 Ga0070716_100016704 Ga0070716_1000167043 295
845 3300006175 Ga0070712_100003228 Ga0070712_1000032284 295
846 3300006175 Ga0070712_100030867 Ga0070712_1000308673 295
847 3300006175 Ga0070712_100043122 Ga0070712_1000431222 295
848 3300006177 Ga0075362_10041433 Ga0075362_100414332 295
849 3300006178 Ga0075367_10046962 Ga0075367_100469622 295
850 3300006178 Ga0075367_10218117 Ga0075367_102181172 295
851 3300006195 Ga0075366_10208871 Ga0075366_102088711 295
852 3300006844 Ga0075428_100074905 Ga0075428_1000749051 295
853 3300006942 Ga0099824_1004785 Ga0099824_10047854 295
854 3300006943 Ga0099822_1002380 Ga0099822_100238017 295
855 3300009098 Ga0105245_10240174 Ga0105245_102401742 295
856 3300009147 Ga0114129_10166595 Ga0114129_101665952 295
857 3300009148 Ga0105243_10017871 Ga0105243_100178714 295
858 3300009174 Ga0105241_10003781 Ga0105241_100037818 295
859 3300009176 Ga0105242_10120948 Ga0105242_101209481 295
860 3300009545 Ga0105237_10345618 Ga0105237_103456182 295
861 3300009551 Ga0105238_10001429 Ga0105238_100014294 295
862 3300009551 Ga0105238_10210001 Ga0105238_102100012 295
863 3300010375 Ga0105239_10033786 Ga0105239_100337863 295
864 3300010375 Ga0105239_10384386 Ga0105239_103843862 295
865 3300010375 Ga0105239_10591676 Ga0105239_105916761 295
866 3300013100 Ga0157373_10144467 Ga0157373_101444672 295
867 3300013104 Ga0157370_10237211 Ga0157370_102372112 295
868 3300013297 Ga0157378_10006214 Ga0157378_100062147 295
869 3300013306 Ga0163162_10147576 Ga0163162_101475762 295
870 3300013308 Ga0157375_10249811 Ga0157375_102498112 295
871 3300014326 Ga0157380_10145885 Ga0157380_101458852 295
872 3300017792 Ga0163161_10095861 Ga0163161_100958612 295
873 3300025321 Ga0207656_10011620 Ga0207656_100116202 295
874 3300025898 Ga0207692_10000694 Ga0207692_100006943 295
875 3300025898 Ga0207692_10006740 Ga0207692_100067403 295
876 3300025898 Ga0207692_10040745 Ga0207692_100407453 295
877 3300025899 Ga0207642_10209410 Ga0207642_102094101 295
878 3300025901 Ga0207688_10177806 Ga0207688_101778061 295
879 3300025905 Ga0207685_10000188 Ga0207685_100001883 295
880 3300025906 Ga0207699_10003013 Ga0207699_100030132 295
881 3300025907 Ga0207645_10092911 Ga0207645_100929112 295
882 3300025909 Ga0207705_10060763 Ga0207705_100607632 295
883 3300025910 Ga0207684_10197212 Ga0207684_101972122 295
884 3300025911 Ga0207654_10000308 Ga0207654_1000030824 295
885 3300025912 Ga0207707_10120412 Ga0207707_101204122 295
886 3300025913 Ga0207695_10001719 Ga0207695_1000171911 295
887 3300025913 Ga0207695_10125342 Ga0207695_101253422 295
888 3300025915 Ga0207693_10013902 Ga0207693_100139024 295
889 3300025915 Ga0207693_10036094 Ga0207693_100360943 295
890 3300025915 Ga0207693_10054711 Ga0207693_100547113 295
891 3300025916 Ga0207663_10019519 Ga0207663_100195192 295
892 3300025916 Ga0207663_10130835 Ga0207663_101308351 295
893 3300025919 Ga0207657_10008840 Ga0207657_100088406 295
894 3300025921 Ga0207652_10011414 Ga0207652_100114144 295
895 3300025924 Ga0207694_10000157 Ga0207694_1000015748 295
896 3300025928 Ga0207700_10015910 Ga0207700_100159102 295
897 3300025929 Ga0207664_10036839 Ga0207664_100368394 295
898 3300025933 Ga0207706_10080399 Ga0207706_100803992 295
899 3300025935 Ga0207709_10003187 Ga0207709_1000318710 295
900 3300025938 Ga0207704_10048856 Ga0207704_100488562 295
901 3300025939 Ga0207665_10000133 Ga0207665_1000013345 295
902 3300025939 Ga0207665_10092774 Ga0207665_100927742 295
903 3300025949 Ga0207667_10036579 Ga0207667_100365792 295
904 3300025949 Ga0207667_10151566 Ga0207667_101515663 295
905 3300025972 Ga0207668_10022787 Ga0207668_100227872 295
906 3300026041 Ga0207639_10000967 Ga0207639_1000096718 295
907 3300026067 Ga0207678_10014057 Ga0207678_100140572 295
908 3300026067 Ga0207678_10022191 Ga0207678_100221913 295
909 3300026075 Ga0207708_10067621 Ga0207708_100676212 295
910 3300026078 Ga0207702_10000002 Ga0207702_10000002304 295
911 3300026116 Ga0207674_10016714 Ga0207674_100167147 295
912 3300026118 Ga0207675_100009319 Ga0207675_1000093192 295
913 3300026118 Ga0207675_100193732 Ga0207675_1001937322 295
914 3300026121 Ga0207683_10089152 Ga0207683_100891522 295
915 3300026142 Ga0207698_10104185 Ga0207698_101041853 295
916 3300027357 Ga0209589_1000001 Ga0209589_100000138 295
917 3300027361 Ga0209489_100001 Ga0209489_10000138 295
918 3300027363 Ga0209700_100001 Ga0209700_10000138 295
919 3300028379 Ga0268266_10219088 Ga0268266_102190882 295
920 3300028380 Ga0268265_10463385 Ga0268265_104633852 295
921 3300031616 Ga0307508_10029626 Ga0307508_100296263 295
922 3300031711 Ga0265314_10060303 Ga0265314_100603032 295
923 3300031712 Ga0265342_10025587 Ga0265342_100255871 295
924 3300031995 Ga0307409_100079363 Ga0307409_1000793632 295
925 3300032004 Ga0307414_10259134 Ga0307414_102591341 295
926 3300033180 Ga0307510_10061898 Ga0307510_100618982 295
927 3300033180 Ga0307510_10212961 Ga0307510_102129611 295
928 3300033442 Ga0315911_1000001 Ga0315911_100000139 295
929 3300037068 Ga0373925_0049086 Ga0373925_0049086_1816_2703 295
930 3300046455 Ga0495603_0119488 Ga0495603_0119488_406_1293 295
931 3300046492 Ga0495585_0077971 Ga0495585_0077971_44_931 295
932 3300046499 Ga0495594_0097894 Ga0495594_0097894_610_1497 295
933 3300046518 Ga0495631_0065787 Ga0495631_0065787_573_1460 295
934 3300046559 Ga0495667_0101335 Ga0495667_0101335_308_1195 295
935 3300046648 Ga0495611_0175580 Ga0495611_0175580_71_958 295
936 3300046684 Ga0495669_0025247 Ga0495669_0025247_1375_2262 295
937 3300046794 Ga0495589_0114205 Ga0495589_0114205_82_969 295
938 3300046809 Ga0495600_0035513 Ga0495600_0035513_913_1800 295
939 3300048904 Ga0496101_0156226 Ga0496101_0156226_652_1539 295
940 3300048905 Ga0496102_0221157 Ga0496102_0221157_361_1248 295
941 3300048905 Ga0496102_0508312 Ga0496102_0508312_84_971 295
942 3300048909 Ga0496106_0101459 Ga0496106_0101459_69_956 295
943 3300048909 Ga0496106_0275075 Ga0496106_0275075_343_1230 295
944 3300048909 Ga0496106_0389467 Ga0496106_0389467_105_992 295
945 3300048910 Ga0496107_0346309 Ga0496107_0346309_53_940 295
946 3300048913 Ga0496110_0198007 Ga0496110_0198007_829_1716 295
947 3300048914 Ga0496111_0118923 Ga0496111_0118923_864_1751 295
948 3300048915 Ga0496112_0000021 Ga0496112_0000021_60359_61246 295
949 3300048915 Ga0496112_0037193 Ga0496112_0037193_841_1728 295
950 3300048916 Ga0496113_0401746 Ga0496113_0401746_88_975 295
951 3300048917 Ga0496114_0033661 Ga0496114_0033661_1044_1931 295
952 3300048917 Ga0496114_0164825 Ga0496114_0164825_749_1636 295
953 3300048924 Ga0496121_0021616 Ga0496121_0021616_1404_2291 295
954 3300048924 Ga0496121_0057484 Ga0496121_0057484_541_1428 295
955 3300048924 Ga0496121_0117135 Ga0496121_0117135_908_1795 295
956 3300048926 Ga0496123_0029839 Ga0496123_0029839_512_1399 295
957 3300048929 Ga0496126_0032865 Ga0496126_0032865_1654_2541 295
958 3300048929 Ga0496126_0057411 Ga0496126_0057411_911_1798 295
959 3300049568 Ga0501031_0009017 Ga0501031_0009017_35_922 295
960 3300049569 Ga0501032_0120760 Ga0501032_0120760_30_917 295
961 3300049570 Ga0501033_0000113 Ga0501033_0000113_13062_13949 295
962 3300049571 Ga0501034_0199925 Ga0501034_0199925_374_1261 295
963 3300049572 Ga0501036_0054565 Ga0501036_0054565_833_1720 295
964 3300049574 Ga0501038_0037201 Ga0501038_0037201_2542_3429 295
965 3300049574 Ga0501038_0050435 Ga0501038_0050435_999_1886 295
966 3300049575 Ga0501039_0003144 Ga0501039_0003144_9918_10805 295
967 3300049577 Ga0501041_0117608 Ga0501041_0117608_16_903 295
968 3300049578 Ga0501042_0008165 Ga0501042_0008165_3458_4345 295
969 3300049578 Ga0501042_0243903 Ga0501042_0243903_355_1242 295
970 3300049822 Ga0501035_0003056 Ga0501035_0003056_13616_14503 295
971 3300049823 Ga0501044_0051243 Ga0501044_0051243_1165_2052 295
972 3300049823 Ga0501044_0643955 Ga0501044_0643955_30_917 295
973 3300050489 nmdc:mga03683_24010_c1 nmdc:mga03683_24010_c1_581_1468 295
974 3300050490 nmdc:mga03n38_10965_c1 nmdc:mga03n38_10965_c1_663_1550 295
975 3300050491 nmdc:mga00v17_4283_c1 nmdc:mga00v17_4283_c1_1890_2777 295
976 3300050491 nmdc:mga00v17_55938_c1 nmdc:mga00v17_55938_c1_914_1801 295
977 3300050492 nmdc:mga0yw44_19594_c1 nmdc:mga0yw44_19594_c1_2805_3692 295
978 3300050492 nmdc:mga0yw44_387812_c1 nmdc:mga0yw44_387812_c1_14_901 295
979 3300050492 nmdc:mga0yw44_47797_c1 nmdc:mga0yw44_47797_c1_1558_2445 295
980 3300050492 nmdc:mga0yw44_59641_c1 nmdc:mga0yw44_59641_c1_551_1438 295
981 3300050494 nmdc:mga06z11_170062_c1 nmdc:mga06z11_170062_c1_222_1109 295
982 3300050494 nmdc:mga06z11_29523_c1 nmdc:mga06z11_29523_c1_1112_1999 295
983 3300050507 nmdc:mga05p37_80160_c1 nmdc:mga05p37_80160_c1_392_1279 295
984 3300053078 Ga0495612_0018341 Ga0495612_0018341_490_1377 295
985 3300053087 Ga0500643_015597 Ga0500643_015597_352_1239 295
986 3300053096 Ga0500641_0036182 Ga0500641_0036182_718_1605 295
987 3300053096 Ga0500641_0062982 Ga0500641_0062982_233_1120 295
988 3300053153 Ga0500616_0000372 Ga0500616_0000372_38500_39387 295
989 iso_pu_bacteria 2828305725 2828308125 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08340

YicC-like_C

Endoribonuclease YicC-like, C-terminal

187

308

0.96

PF03755

YicC-like_N

Endoribonuclease YicC-like, N-terminal region

16

172

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.8366 222 295
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.799 222 295
8hvj-assembly1.cif.gz_B-2 the structure of the e. coli mrna endoonuclease yicc 0.786 11 295
8hvj-assembly1.cif.gz_A-2 the structure of the e. coli mrna endoonuclease yicc 0.7846 9 293
8hvj-assembly1.cif.gz_B-2 the structure of the e. coli mrna endoonuclease yicc 0.7811 11 295
ID Description Score Start End Superfamily
af_P23839_203_287_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9086 212 295 1.20.58.220
af_Q57950_59_179_2.60.120.1040 Mainly Beta;Sandwich;Jelly Rolls;ZPR1, A/B domain 0.9035 250 290 2.60.120.1040
af_P23839_203_287_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.8884 212 295 1.20.58.220
2w2uA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8366 222 295 1.20.58.80
2w2uA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.799 222 295 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A6P1YGT8-F1-model_v4 YicC family protein 0.9133 1 293 GO:0004521
AF-A0A7C3X576-F1-model_v4 Endoribonuclease YicC-like N-terminal domain-containing protein 0.9114 6 73
AF-A0A3C1NGB9-F1-model_v4 Endoribonuclease YicC-like N-terminal domain-containing protein 0.907 1 188 GO:0004521
AF-A0A0Q7TXA4-F1-model_v4 YicC family protein 0.9018 1 293 GO:0004521
AF-A0A519PGU2-F1-model_v4 YicC family protein 0.9005 1 177 GO:0004521

Feature Viewer

pLDDT pTM Quality
87.99 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map