F487582
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 989 | 468 | 938 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10037408|Ga0070710_100374082 |
| Length | 308 |
| Sequence | LNESHPSCQKVFAMVLSSMTGFARSHGASGPYTFEWELKSVNAKGFDLRFRVPQGWDELEAFAKKRAGEVLSRGTVYANLNVKRSNAASAVRINEDVLASIVKVAGTLAQRIDAVAPSIDGLLGIKGVIEVVEPESDXXXDKAAMDAAAKAFEEALDHLVEMRRREGAALGQILQQRMDQIERLAKKAEAAPGRKPEAIRARLAEQIAALLETSDRFDPDRLTQEAILIATKADIREELDRIASHIAQAREMIGKGGPVGRRLDFLAQEFNREVNTCCSKSNDIELTNTGLEMKNVVEQFREQVQNLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 13 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 14 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2791355199 | |||
| 17 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 18 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 19 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 20 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 21 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 22 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 23 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 24 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 25 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 26 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 27 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 28 | 2904699407 | |||
| 29 | 2906610324 | |||
| 30 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 31 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 32 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 33 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 34 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 35 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 36 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 37 | 2922425934 | |||
| 38 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 39 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 40 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 41 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 42 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 116 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 251 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 421 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 422 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 423 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 424 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 427 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 429 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 430 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 432 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 433 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 434 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 436 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 437 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 438 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 439 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 442 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 445 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 452 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 456 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 459 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 461 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 462 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 463 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 464 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 465 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 466 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 467 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 468 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.03 |
| Metatranscriptomes | 0.2 |
| Isolates | 4.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.74 |
| Nodule | 3.94 |
| Rhizoplane | 7.28 |
| Rhizosphere | 68.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008223 | 3300001979 | Bacteria | 4176 |
| 2 | JGI24735J21928_10025237 | 3300002067 | Bacteria | 1794 |
| 3 | JGI25406J46586_10000152 | 3300003203 | Bacteria | 30382 |
| 4 | JGI25406J46586_10003672 | 3300003203 | Bacteria | 7190 |
| 5 | JGI25406J46586_10018257 | 3300003203 | Bacteria | 2885 |
| 6 | Ga0065165_1001750 | 3300005262 | Bacteria | 21614 |
| 7 | Ga0065165_1008548 | 3300005262 | Bacteria | 4763 |
| 8 | Ga0070658_10062966 | 3300005327 | Bacteria | 3023 |
| 9 | Ga0070658_10117643 | 3300005327 | Bacteria | 2207 |
| 10 | Ga0070676_10045828 | 3300005328 | Bacteria | 2548 |
| 11 | Ga0070683_100235899 | 3300005329 | Bacteria | 1739 |
| 12 | Ga0070683_100370811 | 3300005329 | Bacteria | 1364 |
| 13 | Ga0070680_100123971 | 3300005336 | Bacteria | 2158 |
| 14 | Ga0070682_100116438 | 3300005337 | Bacteria | 1788 |
| 15 | Ga0068868_100043717 | 3300005338 | Bacteria | 3500 |
| 16 | Ga0068868_100156056 | 3300005338 | Bacteria | 1882 |
| 17 | Ga0068868_100248107 | 3300005338 | Bacteria | 1498 |
| 18 | Ga0070660_100010407 | 3300005339 | Bacteria | 6575 |
| 19 | Ga0070689_100007115 | 3300005340 | Bacteria | 7795 |
| 20 | Ga0070661_100113258 | 3300005344 | Bacteria | 2027 |
| 21 | Ga0070661_100131994 | 3300005344 | Bacteria | 1877 |
| 22 | Ga0070668_100012922 | 3300005347 | Bacteria | 6218 |
| 23 | Ga0070669_100055043 | 3300005353 | Bacteria | 2915 |
| 24 | Ga0070669_100088284 | 3300005353 | Bacteria | 2321 |
| 25 | Ga0070675_100299770 | 3300005354 | Bacteria | 1416 |
| 26 | Ga0070671_100045468 | 3300005355 | Bacteria | 3650 |
| 27 | Ga0070671_100168389 | 3300005355 | Bacteria | 1853 |
| 28 | Ga0070671_100308084 | 3300005355 | Bacteria | 1348 |
| 29 | Ga0070671_100313382 | 3300005355 | Bacteria | 1337 |
| 30 | Ga0070674_100296878 | 3300005356 | Bacteria | 1287 |
| 31 | Ga0070709_10001793 | 3300005434 | Bacteria | 11659 |
| 32 | Ga0070709_10017837 | 3300005434 | Bacteria | 4078 |
| 33 | Ga0070709_10249165 | 3300005434 | Bacteria | 1279 |
| 34 | Ga0070714_100002869 | 3300005435 | Bacteria | 12748 |
| 35 | Ga0070714_100060983 | 3300005435 | Bacteria | 3238 |
| 36 | Ga0070714_100299368 | 3300005435 | Bacteria | 1499 |
| 37 | Ga0070713_100006492 | 3300005436 | Bacteria | 8113 |
| 38 | Ga0070713_100181081 | 3300005436 | Bacteria | 1894 |
| 39 | Ga0070710_10001067 | 3300005437 | Bacteria | 12984 |
| 40 | Ga0070710_10008800 | 3300005437 | Bacteria | 4924 |
| 41 | Ga0070710_10037408 | 3300005437 | Bacteria | 2659 |
| 42 | Ga0070711_100007374 | 3300005439 | Bacteria | 6690 |
| 43 | Ga0070711_100017125 | 3300005439 | Bacteria | 4610 |
| 44 | Ga0070711_100082054 | 3300005439 | Bacteria | 2300 |
| 45 | Ga0070700_100081308 | 3300005441 | Bacteria | 2093 |
| 46 | Ga0070700_100087884 | 3300005441 | Bacteria | 2021 |
| 47 | Ga0070663_100004362 | 3300005455 | Bacteria | 8299 |
| 48 | Ga0070663_100052418 | 3300005455 | Bacteria | 2909 |
| 49 | Ga0070663_100066326 | 3300005455 | Bacteria | 2615 |
| 50 | Ga0070663_100116293 | 3300005455 | Bacteria | 2015 |
| 51 | Ga0070678_100024234 | 3300005456 | Bacteria | 4059 |
| 52 | Ga0070678_100040180 | 3300005456 | Bacteria | 3307 |
| 53 | Ga0070678_100169920 | 3300005456 | Bacteria | 1775 |
| 54 | Ga0070662_100103498 | 3300005457 | Bacteria | 2159 |
| 55 | Ga0070662_100120984 | 3300005457 | Bacteria | 2006 |
| 56 | Ga0070681_10056806 | 3300005458 | Bacteria | 3895 |
| 57 | Ga0070681_10217928 | 3300005458 | Bacteria | 1824 |
| 58 | Ga0068867_100202463 | 3300005459 | Bacteria | 1590 |
| 59 | Ga0070698_100249872 | 3300005471 | Bacteria | 1706 |
| 60 | Ga0070679_100031881 | 3300005530 | Bacteria | 5210 |
| 61 | Ga0070684_100364541 | 3300005535 | Bacteria | 1330 |
| 62 | Ga0068853_100005075 | 3300005539 | Bacteria | 10272 |
| 63 | Ga0068853_100031569 | 3300005539 | Bacteria | 4481 |
| 64 | Ga0068853_100061828 | 3300005539 | Bacteria | 3239 |
| 65 | Ga0070672_100170980 | 3300005543 | Bacteria | 1807 |
| 66 | Ga0070686_100153504 | 3300005544 | Bacteria | 1615 |
| 67 | Ga0070665_100050963 | 3300005548 | Bacteria | 4153 |
| 68 | Ga0070665_100092227 | 3300005548 | Bacteria | 3034 |
| 69 | Ga0070665_100184796 | 3300005548 | Bacteria | 2085 |
| 70 | Ga0070665_100214785 | 3300005548 | Bacteria | 1924 |
| 71 | Ga0070704_100109564 | 3300005549 | Bacteria | 2098 |
| 72 | Ga0068855_100019340 | 3300005563 | Bacteria | 8183 |
| 73 | Ga0068855_100028482 | 3300005563 | Bacteria | 6682 |
| 74 | Ga0068855_100042552 | 3300005563 | Bacteria | 5381 |
| 75 | Ga0068855_100055064 | 3300005563 | Bacteria | 4673 |
| 76 | Ga0068855_100500802 | 3300005563 | Bacteria | 1320 |
| 77 | Ga0070664_100055529 | 3300005564 | Bacteria | 3363 |
| 78 | Ga0068857_100022108 | 3300005577 | Bacteria | 5595 |
| 79 | Ga0068857_100068632 | 3300005577 | Bacteria | 3155 |
| 80 | Ga0068857_100143704 | 3300005577 | Bacteria | 2158 |
| 81 | Ga0068857_100158294 | 3300005577 | Bacteria | 2054 |
| 82 | Ga0068854_100005468 | 3300005578 | Bacteria | 8025 |
| 83 | Ga0068854_100028453 | 3300005578 | Bacteria | 3862 |
| 84 | Ga0068854_100054844 | 3300005578 | Bacteria | 2868 |
| 85 | Ga0068854_100208609 | 3300005578 | Bacteria | 1540 |
| 86 | Ga0068856_100000205 | 3300005614 | Bacteria | 63226 |
| 87 | Ga0068856_100004002 | 3300005614 | Bacteria | 14756 |
| 88 | Ga0068856_100071140 | 3300005614 | Bacteria | 3443 |
| 89 | Ga0068856_100434550 | 3300005614 | Bacteria | 1333 |
| 90 | Ga0070702_100154258 | 3300005615 | Bacteria | 1478 |
| 91 | Ga0068852_100006605 | 3300005616 | Bacteria | 8399 |
| 92 | Ga0068852_100046472 | 3300005616 | Bacteria | 3700 |
| 93 | Ga0068852_100100140 | 3300005616 | Bacteria | 2614 |
| 94 | Ga0068852_100322161 | 3300005616 | Bacteria | 1501 |
| 95 | Ga0068852_100353653 | 3300005616 | Bacteria | 1435 |
| 96 | Ga0068859_100133789 | 3300005617 | Bacteria | 2551 |
| 97 | Ga0068864_100027748 | 3300005618 | Bacteria | 4784 |
| 98 | Ga0068864_100090642 | 3300005618 | Bacteria | 2695 |
| 99 | Ga0068864_100135901 | 3300005618 | Bacteria | 2214 |
| 100 | Ga0068866_10152513 | 3300005718 | Bacteria | 1339 |
| 101 | Ga0068851_10001483 | 3300005834 | Bacteria | 10294 |
| 102 | Ga0068851_10064950 | 3300005834 | Bacteria | 1877 |
| 103 | Ga0068863_100141926 | 3300005841 | Bacteria | 2296 |
| 104 | Ga0068863_100458343 | 3300005841 | Bacteria | 1252 |
| 105 | Ga0068858_100083289 | 3300005842 | Bacteria | 2974 |
| 106 | Ga0068860_100000316 | 3300005843 | Bacteria | 65709 |
| 107 | Ga0068860_100026198 | 3300005843 | Bacteria | 5622 |
| 108 | Ga0068862_100106293 | 3300005844 | Bacteria | 2460 |
| 109 | Ga0068862_100258420 | 3300005844 | Bacteria | 1589 |
| 110 | Ga0081455_10003466 | 3300005937 | Bacteria | 18131 |
| 111 | Ga0081455_10003832 | 3300005937 | Bacteria | 17150 |
| 112 | Ga0081455_10008528 | 3300005937 | Bacteria | 10640 |
| 113 | Ga0081455_10008869 | 3300005937 | Bacteria | 10399 |
| 114 | Ga0081455_10038535 | 3300005937 | Bacteria | 4232 |
| 115 | Ga0081538_10110897 | 3300005981 | Bacteria | 1347 |
| 116 | Ga0081540_1000913 | 3300005983 | Bacteria | 26625 |
| 117 | Ga0081540_1003736 | 3300005983 | Bacteria | 11927 |
| 118 | Ga0081540_1003874 | 3300005983 | Bacteria | 11677 |
| 119 | Ga0081540_1005905 | 3300005983 | Bacteria | 9036 |
| 120 | Ga0081540_1010410 | 3300005983 | Bacteria | 6304 |
| 121 | Ga0081540_1010937 | 3300005983 | Bacteria | 6095 |
| 122 | Ga0081540_1017125 | 3300005983 | Bacteria | 4499 |
| 123 | Ga0081540_1030043 | 3300005983 | Bacteria | 3016 |
| 124 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 125 | Ga0081539_10000735 | 3300005985 | Bacteria | 65597 |
| 126 | Ga0081539_10001242 | 3300005985 | Bacteria | 45360 |
| 127 | Ga0081539_10013306 | 3300005985 | Bacteria | 6210 |
| 128 | Ga0070717_10027316 | 3300006028 | Bacteria | 4561 |
| 129 | Ga0075365_10000141 | 3300006038 | Bacteria | 22527 |
| 130 | Ga0075365_10004501 | 3300006038 | Bacteria | 7397 |
| 131 | Ga0075365_10020048 | 3300006038 | Bacteria | 4138 |
| 132 | Ga0075365_10061671 | 3300006038 | Bacteria | 2505 |
| 133 | Ga0075363_100007043 | 3300006048 | Bacteria | 5140 |
| 134 | Ga0075363_100021765 | 3300006048 | Bacteria | 3235 |
| 135 | Ga0075363_100032594 | 3300006048 | Bacteria | 2708 |
| 136 | Ga0075364_10033462 | 3300006051 | Bacteria | 3310 |
| 137 | Ga0075364_10038689 | 3300006051 | Bacteria | 3090 |
| 138 | Ga0075364_10205542 | 3300006051 | Bacteria | 1335 |
| 139 | Ga0070715_10000178 | 3300006163 | Bacteria | 14781 |
| 140 | Ga0070716_100016704 | 3300006173 | Bacteria | 3793 |
| 141 | Ga0070716_100035837 | 3300006173 | Bacteria | 2730 |
| 142 | Ga0070712_100003228 | 3300006175 | Bacteria | 10049 |
| 143 | Ga0070712_100030867 | 3300006175 | Bacteria | 3606 |
| 144 | Ga0070712_100034527 | 3300006175 | Bacteria | 3428 |
| 145 | Ga0070712_100043122 | 3300006175 | Bacteria | 3104 |
| 146 | Ga0075362_10041433 | 3300006177 | Bacteria | 2031 |
| 147 | Ga0075367_10046962 | 3300006178 | Bacteria | 2539 |
| 148 | Ga0075367_10113667 | 3300006178 | Bacteria | 1664 |
| 149 | Ga0075367_10123296 | 3300006178 | Bacteria | 1598 |
| 150 | Ga0075367_10218117 | 3300006178 | Bacteria | 1193 |
| 151 | Ga0075369_10023292 | 3300006186 | Bacteria | 2559 |
| 152 | Ga0075369_10029054 | 3300006186 | Bacteria | 2320 |
| 153 | Ga0075369_10053654 | 3300006186 | Bacteria | 1749 |
| 154 | Ga0075369_10082956 | 3300006186 | Bacteria | 1423 |
| 155 | Ga0075369_10083542 | 3300006186 | Bacteria | 1418 |
| 156 | Ga0075366_10208871 | 3300006195 | Bacteria | 1188 |
| 157 | Ga0097621_100192366 | 3300006237 | Bacteria | 1767 |
| 158 | Ga0075370_10033181 | 3300006353 | Bacteria | 2889 |
| 159 | Ga0075370_10087001 | 3300006353 | Bacteria | 1800 |
| 160 | Ga0075428_100074905 | 3300006844 | Bacteria | 3697 |
| 161 | Ga0075434_100112461 | 3300006871 | Bacteria | 2734 |
| 162 | Ga0097620_100133791 | 3300006931 | Bacteria | 2551 |
| 163 | Ga0099824_1004785 | 3300006942 | Bacteria | 19361 |
| 164 | Ga0099822_1002380 | 3300006943 | Bacteria | 23355 |
| 165 | Ga0099794_10062614 | 3300007265 | Bacteria | 1809 |
| 166 | Ga0099794_10062743 | 3300007265 | Bacteria | 1808 |
| 167 | Ga0099795_10001501 | 3300007788 | Bacteria | 5093 |
| 168 | Ga0105240_10012605 | 3300009093 | Bacteria | 11658 |
| 169 | Ga0105240_10020975 | 3300009093 | Bacteria | 8696 |
| 170 | Ga0105240_10035586 | 3300009093 | Bacteria | 6415 |
| 171 | Ga0111539_10394785 | 3300009094 | Bacteria | 1611 |
| 172 | Ga0105245_10109432 | 3300009098 | Bacteria | 2568 |
| 173 | Ga0105245_10240174 | 3300009098 | Bacteria | 1756 |
| 174 | Ga0105245_10248483 | 3300009098 | Bacteria | 1727 |
| 175 | Ga0105245_10310952 | 3300009098 | Bacteria | 1549 |
| 176 | Ga0105247_10041793 | 3300009101 | Bacteria | 2806 |
| 177 | Ga0105247_10094353 | 3300009101 | Bacteria | 1903 |
| 178 | Ga0114129_10166595 | 3300009147 | Bacteria | 3007 |
| 179 | Ga0105243_10017871 | 3300009148 | Bacteria | 5365 |
| 180 | Ga0105243_10353430 | 3300009148 | Bacteria | 1350 |
| 181 | Ga0105241_10003781 | 3300009174 | Bacteria | 11223 |
| 182 | Ga0105242_10120948 | 3300009176 | Bacteria | 2247 |
| 183 | Ga0105242_10457612 | 3300009176 | Bacteria | 1204 |
| 184 | Ga0105248_10374482 | 3300009177 | Bacteria | 1603 |
| 185 | Ga0105248_10500391 | 3300009177 | Bacteria | 1370 |
| 186 | Ga0105237_10011938 | 3300009545 | Bacteria | 9181 |
| 187 | Ga0105237_10012243 | 3300009545 | Bacteria | 9042 |
| 188 | Ga0105237_10159612 | 3300009545 | Bacteria | 2253 |
| 189 | Ga0105237_10345618 | 3300009545 | Bacteria | 1492 |
| 190 | Ga0105237_10395226 | 3300009545 | Bacteria | 1387 |
| 191 | Ga0105238_10001429 | 3300009551 | Bacteria | 23949 |
| 192 | Ga0105238_10002798 | 3300009551 | Bacteria | 17414 |
| 193 | Ga0105238_10112048 | 3300009551 | Bacteria | 2708 |
| 194 | Ga0105238_10112321 | 3300009551 | Bacteria | 2704 |
| 195 | Ga0105238_10210001 | 3300009551 | Bacteria | 1923 |
| 196 | Ga0105238_10294232 | 3300009551 | Bacteria | 1606 |
| 197 | Ga0099796_10003434 | 3300010159 | Bacteria | 3675 |
| 198 | Ga0099796_10004964 | 3300010159 | Bacteria | 3277 |
| 199 | Ga0099796_10013619 | 3300010159 | Bacteria | 2327 |
| 200 | Ga0105239_10002676 | 3300010375 | Bacteria | 22436 |
| 201 | Ga0105239_10017902 | 3300010375 | Bacteria | 7836 |
| 202 | Ga0105239_10033786 | 3300010375 | Bacteria | 5615 |
| 203 | Ga0105239_10059881 | 3300010375 | Bacteria | 4178 |
| 204 | Ga0105239_10158066 | 3300010375 | Bacteria | 2532 |
| 205 | Ga0105239_10384386 | 3300010375 | Bacteria | 1587 |
| 206 | Ga0105239_10591676 | 3300010375 | Bacteria | 1265 |
| 207 | Ga0105246_10093444 | 3300011119 | Bacteria | 2173 |
| 208 | Ga0157373_10144467 | 3300013100 | Bacteria | 1673 |
| 209 | Ga0157370_10015624 | 3300013104 | Bacteria | 7711 |
| 210 | Ga0157370_10052947 | 3300013104 | Bacteria | 3872 |
| 211 | Ga0157370_10237211 | 3300013104 | Bacteria | 1688 |
| 212 | Ga0157369_10000996 | 3300013105 | Bacteria | 35806 |
| 213 | Ga0157369_10007824 | 3300013105 | Bacteria | 12302 |
| 214 | Ga0157369_10173167 | 3300013105 | Bacteria | 2273 |
| 215 | Ga0157369_10225938 | 3300013105 | Bacteria | 1958 |
| 216 | Ga0157374_10437459 | 3300013296 | Bacteria | 1308 |
| 217 | Ga0157374_10694633 | 3300013296 | Bacteria | 1030 |
| 218 | Ga0157378_10006214 | 3300013297 | Bacteria | 10456 |
| 219 | Ga0157378_10273428 | 3300013297 | Bacteria | 1626 |
| 220 | Ga0163162_10037734 | 3300013306 | Bacteria | 4822 |
| 221 | Ga0163162_10147576 | 3300013306 | Bacteria | 2469 |
| 222 | Ga0157372_10086103 | 3300013307 | Bacteria | 3565 |
| 223 | Ga0157372_10179791 | 3300013307 | Bacteria | 2448 |
| 224 | Ga0157375_10249811 | 3300013308 | Bacteria | 1934 |
| 225 | Ga0163163_10006000 | 3300014325 | Bacteria | 10568 |
| 226 | Ga0163163_10014928 | 3300014325 | Bacteria | 7157 |
| 227 | Ga0163163_10048230 | 3300014325 | Bacteria | 4188 |
| 228 | Ga0163163_10246170 | 3300014325 | Bacteria | 1838 |
| 229 | Ga0163163_10382651 | 3300014325 | Bacteria | 1465 |
| 230 | Ga0157380_10145885 | 3300014326 | Bacteria | 2040 |
| 231 | Ga0157380_10152136 | 3300014326 | Bacteria | 2001 |
| 232 | Ga0157380_10267482 | 3300014326 | Bacteria | 1556 |
| 233 | Ga0157379_10100460 | 3300014968 | Bacteria | 2596 |
| 234 | Ga0157379_10124348 | 3300014968 | Bacteria | 2321 |
| 235 | Ga0157379_10276709 | 3300014968 | Bacteria | 1527 |
| 236 | Ga0157376_10046977 | 3300014969 | Bacteria | 3563 |
| 237 | Ga0157376_10055961 | 3300014969 | Bacteria | 3293 |
| 238 | Ga0157376_10218760 | 3300014969 | Bacteria | 1763 |
| 239 | Ga0157376_10532900 | 3300014969 | Bacteria | 1159 |
| 240 | Ga0163161_10095861 | 3300017792 | Bacteria | 2201 |
| 241 | Ga0213874_10012710 | 3300021377 | Bacteria | 2165 |
| 242 | Ga0213876_10040414 | 3300021384 | Bacteria | 2464 |
| 243 | Ga0213876_10128096 | 3300021384 | Bacteria | 1349 |
| 244 | Ga0209564_1017177 | 3300025295 | Bacteria | 2836 |
| 245 | Ga0209758_1003772 | 3300025297 | Bacteria | 13381 |
| 246 | Ga0209758_1005082 | 3300025297 | Bacteria | 10418 |
| 247 | Ga0209758_1017949 | 3300025297 | Bacteria | 3494 |
| 248 | Ga0207656_10011620 | 3300025321 | Bacteria | 3332 |
| 249 | Ga0207692_10000694 | 3300025898 | Bacteria | 11852 |
| 250 | Ga0207692_10006740 | 3300025898 | Bacteria | 4670 |
| 251 | Ga0207692_10040745 | 3300025898 | Bacteria | 2294 |
| 252 | Ga0207642_10209410 | 3300025899 | Bacteria | 1082 |
| 253 | Ga0207710_10010831 | 3300025900 | Bacteria | 3840 |
| 254 | Ga0207688_10030797 | 3300025901 | Bacteria | 2960 |
| 255 | Ga0207688_10177806 | 3300025901 | Bacteria | 1268 |
| 256 | Ga0207647_10040791 | 3300025904 | Bacteria | 2921 |
| 257 | Ga0207647_10211031 | 3300025904 | Bacteria | 1121 |
| 258 | Ga0207685_10000188 | 3300025905 | Bacteria | 9423 |
| 259 | Ga0207699_10003013 | 3300025906 | Bacteria | 8006 |
| 260 | Ga0207699_10005980 | 3300025906 | Bacteria | 5857 |
| 261 | Ga0207699_10185649 | 3300025906 | Bacteria | 1400 |
| 262 | Ga0207699_10196897 | 3300025906 | Bacteria | 1363 |
| 263 | Ga0207645_10092911 | 3300025907 | Bacteria | 1941 |
| 264 | Ga0207705_10060763 | 3300025909 | Bacteria | 2730 |
| 265 | Ga0207684_10197212 | 3300025910 | Bacteria | 1737 |
| 266 | Ga0207654_10000308 | 3300025911 | Bacteria | 29561 |
| 267 | Ga0207654_10008665 | 3300025911 | Bacteria | 5155 |
| 268 | Ga0207654_10075082 | 3300025911 | Bacteria | 2019 |
| 269 | Ga0207707_10000713 | 3300025912 | Bacteria | 32997 |
| 270 | Ga0207707_10120412 | 3300025912 | Bacteria | 2294 |
| 271 | Ga0207707_10252335 | 3300025912 | Bacteria | 1532 |
| 272 | Ga0207695_10001719 | 3300025913 | Bacteria | 35011 |
| 273 | Ga0207695_10001812 | 3300025913 | Bacteria | 33654 |
| 274 | Ga0207695_10015101 | 3300025913 | Bacteria | 9111 |
| 275 | Ga0207695_10019186 | 3300025913 | Bacteria | 7878 |
| 276 | Ga0207695_10125342 | 3300025913 | Bacteria | 2531 |
| 277 | Ga0207671_10008038 | 3300025914 | Bacteria | 9019 |
| 278 | Ga0207671_10012301 | 3300025914 | Bacteria | 6888 |
| 279 | Ga0207671_10045012 | 3300025914 | Bacteria | 3263 |
| 280 | Ga0207693_10013902 | 3300025915 | Bacteria | 6482 |
| 281 | Ga0207693_10036094 | 3300025915 | Bacteria | 3896 |
| 282 | Ga0207693_10039343 | 3300025915 | Bacteria | 3724 |
| 283 | Ga0207693_10054711 | 3300025915 | Bacteria | 3130 |
| 284 | Ga0207693_10085133 | 3300025915 | Bacteria | 2477 |
| 285 | Ga0207663_10019519 | 3300025916 | Bacteria | 3821 |
| 286 | Ga0207663_10130835 | 3300025916 | Bacteria | 1733 |
| 287 | Ga0207663_10192280 | 3300025916 | Bacteria | 1466 |
| 288 | Ga0207660_10007065 | 3300025917 | Bacteria | 7274 |
| 289 | Ga0207657_10001786 | 3300025919 | Bacteria | 23206 |
| 290 | Ga0207657_10008840 | 3300025919 | Bacteria | 10189 |
| 291 | Ga0207649_10030165 | 3300025920 | Bacteria | 3208 |
| 292 | Ga0207649_10104861 | 3300025920 | Bacteria | 1878 |
| 293 | Ga0207649_10119751 | 3300025920 | Bacteria | 1773 |
| 294 | Ga0207652_10004315 | 3300025921 | Bacteria | 11591 |
| 295 | Ga0207652_10011414 | 3300025921 | Bacteria | 7162 |
| 296 | Ga0207652_10059661 | 3300025921 | Bacteria | 3289 |
| 297 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 298 | Ga0207694_10016368 | 3300025924 | Bacteria | 5599 |
| 299 | Ga0207650_10183898 | 3300025925 | Bacteria | 1667 |
| 300 | Ga0207700_10006113 | 3300025928 | Bacteria | 7250 |
| 301 | Ga0207700_10015910 | 3300025928 | Bacteria | 4980 |
| 302 | Ga0207700_10293584 | 3300025928 | Bacteria | 1402 |
| 303 | Ga0207664_10026024 | 3300025929 | Bacteria | 4417 |
| 304 | Ga0207664_10036839 | 3300025929 | Bacteria | 3782 |
| 305 | Ga0207664_10360527 | 3300025929 | Bacteria | 1288 |
| 306 | Ga0207644_10041067 | 3300025931 | Bacteria | 3271 |
| 307 | Ga0207644_10366948 | 3300025931 | Bacteria | 1172 |
| 308 | Ga0207690_10122168 | 3300025932 | Bacteria | 1893 |
| 309 | Ga0207690_10218022 | 3300025932 | Bacteria | 1458 |
| 310 | Ga0207706_10080399 | 3300025933 | Bacteria | 2866 |
| 311 | Ga0207709_10003187 | 3300025935 | Bacteria | 9854 |
| 312 | Ga0207709_10050919 | 3300025935 | Bacteria | 2535 |
| 313 | Ga0207670_10001178 | 3300025936 | Bacteria | 13805 |
| 314 | Ga0207669_10114878 | 3300025937 | Bacteria | 1813 |
| 315 | Ga0207669_10149850 | 3300025937 | Bacteria | 1632 |
| 316 | Ga0207704_10048856 | 3300025938 | Bacteria | 2540 |
| 317 | Ga0207704_10245142 | 3300025938 | Bacteria | 1341 |
| 318 | Ga0207665_10000133 | 3300025939 | Bacteria | 49199 |
| 319 | Ga0207665_10092774 | 3300025939 | Bacteria | 2095 |
| 320 | Ga0207665_10166733 | 3300025939 | Bacteria | 1588 |
| 321 | Ga0207691_10192860 | 3300025940 | Bacteria | 1776 |
| 322 | Ga0207691_10519729 | 3300025940 | Bacteria | 1010 |
| 323 | Ga0207711_10123431 | 3300025941 | Bacteria | 2314 |
| 324 | Ga0207689_10446716 | 3300025942 | Bacteria | 1080 |
| 325 | Ga0207661_10032141 | 3300025944 | Bacteria | 4063 |
| 326 | Ga0207661_10466767 | 3300025944 | Bacteria | 1151 |
| 327 | Ga0207667_10008867 | 3300025949 | Bacteria | 11906 |
| 328 | Ga0207667_10021446 | 3300025949 | Bacteria | 7158 |
| 329 | Ga0207667_10036579 | 3300025949 | Bacteria | 5260 |
| 330 | Ga0207667_10080065 | 3300025949 | Bacteria | 3385 |
| 331 | Ga0207667_10151566 | 3300025949 | Bacteria | 2386 |
| 332 | Ga0207667_10165755 | 3300025949 | Bacteria | 2272 |
| 333 | Ga0207651_10322340 | 3300025960 | Bacteria | 1292 |
| 334 | Ga0207668_10022787 | 3300025972 | Bacteria | 4014 |
| 335 | Ga0207668_10109860 | 3300025972 | Bacteria | 2066 |
| 336 | Ga0207640_10004396 | 3300025981 | Bacteria | 7641 |
| 337 | Ga0207640_10161197 | 3300025981 | Bacteria | 1660 |
| 338 | Ga0207640_10296866 | 3300025981 | Bacteria | 1276 |
| 339 | Ga0207703_10206134 | 3300026035 | Bacteria | 1750 |
| 340 | Ga0207639_10000967 | 3300026041 | Bacteria | 19506 |
| 341 | Ga0207639_10009512 | 3300026041 | Bacteria | 6711 |
| 342 | Ga0207639_10148257 | 3300026041 | Bacteria | 1962 |
| 343 | Ga0207678_10014057 | 3300026067 | Bacteria | 7039 |
| 344 | Ga0207678_10015103 | 3300026067 | Bacteria | 6793 |
| 345 | Ga0207678_10022191 | 3300026067 | Bacteria | 5562 |
| 346 | Ga0207678_10031827 | 3300026067 | Bacteria | 4600 |
| 347 | Ga0207678_10065751 | 3300026067 | Bacteria | 3113 |
| 348 | Ga0207678_10106075 | 3300026067 | Bacteria | 2397 |
| 349 | Ga0207708_10049108 | 3300026075 | Bacteria | 3212 |
| 350 | Ga0207708_10067621 | 3300026075 | Bacteria | 2733 |
| 351 | Ga0207708_10118703 | 3300026075 | Bacteria | 2060 |
| 352 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 353 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 354 | Ga0207702_10009353 | 3300026078 | Bacteria | 8233 |
| 355 | Ga0207702_10085355 | 3300026078 | Bacteria | 2751 |
| 356 | Ga0207702_10413493 | 3300026078 | Bacteria | 1303 |
| 357 | Ga0207641_10040916 | 3300026088 | Bacteria | 3883 |
| 358 | Ga0207676_10018918 | 3300026095 | Bacteria | 5016 |
| 359 | Ga0207676_10034159 | 3300026095 | Bacteria | 3849 |
| 360 | Ga0207676_10128245 | 3300026095 | Bacteria | 2152 |
| 361 | Ga0207674_10009623 | 3300026116 | Bacteria | 11024 |
| 362 | Ga0207674_10012246 | 3300026116 | Bacteria | 9591 |
| 363 | Ga0207674_10016714 | 3300026116 | Bacteria | 8018 |
| 364 | Ga0207674_10021165 | 3300026116 | Bacteria | 7011 |
| 365 | Ga0207674_10165583 | 3300026116 | Bacteria | 2165 |
| 366 | Ga0207675_100009319 | 3300026118 | Bacteria | 9206 |
| 367 | Ga0207675_100193732 | 3300026118 | Bacteria | 1950 |
| 368 | Ga0207675_100730166 | 3300026118 | Bacteria | 1001 |
| 369 | Ga0207683_10018675 | 3300026121 | Bacteria | 5915 |
| 370 | Ga0207683_10089152 | 3300026121 | Bacteria | 2745 |
| 371 | Ga0207683_10145291 | 3300026121 | Bacteria | 2139 |
| 372 | Ga0207683_10146025 | 3300026121 | Bacteria | 2133 |
| 373 | Ga0207683_10176699 | 3300026121 | Bacteria | 1935 |
| 374 | Ga0207698_10104185 | 3300026142 | Bacteria | 2360 |
| 375 | Ga0207698_10211229 | 3300026142 | Bacteria | 1746 |
| 376 | Ga0207698_10318380 | 3300026142 | Bacteria | 1456 |
| 377 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 378 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 379 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 380 | Ga0209179_1005890 | 3300027512 | Bacteria | 1945 |
| 381 | Ga0209588_1009775 | 3300027671 | Bacteria | 2872 |
| 382 | Ga0209588_1062838 | 3300027671 | Bacteria | 1200 |
| 383 | Ga0209813_10003784 | 3300027866 | Bacteria | 3570 |
| 384 | Ga0207428_10072008 | 3300027907 | Bacteria | 2714 |
| 385 | Ga0268266_10008946 | 3300028379 | Bacteria | 8862 |
| 386 | Ga0268266_10014631 | 3300028379 | Bacteria | 6742 |
| 387 | Ga0268266_10104493 | 3300028379 | Bacteria | 2501 |
| 388 | Ga0268266_10219088 | 3300028379 | Bacteria | 1748 |
| 389 | Ga0268266_10458810 | 3300028379 | Bacteria | 1212 |
| 390 | Ga0268265_10369309 | 3300028380 | Bacteria | 1316 |
| 391 | Ga0268265_10463385 | 3300028380 | Bacteria | 1186 |
| 392 | Ga0268264_10000430 | 3300028381 | Bacteria | 58144 |
| 393 | Ga0268264_10333220 | 3300028381 | Bacteria | 1439 |
| 394 | Ga0268264_10465060 | 3300028381 | Bacteria | 1228 |
| 395 | Ga0307517_10000772 | 3300028786 | Bacteria | 55020 |
| 396 | Ga0265330_10010655 | 3300031235 | Bacteria | 4327 |
| 397 | Ga0265330_10051587 | 3300031235 | Bacteria | 1803 |
| 398 | Ga0265332_10023963 | 3300031238 | Bacteria | 2689 |
| 399 | Ga0265332_10079482 | 3300031238 | Bacteria | 1391 |
| 400 | Ga0265325_10035454 | 3300031241 | Bacteria | 2650 |
| 401 | Ga0265329_10055044 | 3300031242 | Bacteria | 1263 |
| 402 | Ga0265340_10003545 | 3300031247 | Bacteria | 8783 |
| 403 | Ga0307509_10080753 | 3300031507 | Bacteria | 3362 |
| 404 | Ga0307408_100101901 | 3300031548 | Bacteria | 2189 |
| 405 | Ga0307408_100141225 | 3300031548 | Bacteria | 1891 |
| 406 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 407 | Ga0307508_10016890 | 3300031616 | Bacteria | 6642 |
| 408 | Ga0307508_10029626 | 3300031616 | Bacteria | 4947 |
| 409 | Ga0307508_10070541 | 3300031616 | Bacteria | 3067 |
| 410 | Ga0265314_10021549 | 3300031711 | Bacteria | 4950 |
| 411 | Ga0265314_10060303 | 3300031711 | Bacteria | 2590 |
| 412 | Ga0265342_10023489 | 3300031712 | Bacteria | 3902 |
| 413 | Ga0265342_10025587 | 3300031712 | Bacteria | 3708 |
| 414 | Ga0265342_10029712 | 3300031712 | Bacteria | 3391 |
| 415 | Ga0307516_10017411 | 3300031730 | Bacteria | 7493 |
| 416 | Ga0307516_10125734 | 3300031730 | Bacteria | 2349 |
| 417 | Ga0307405_10183430 | 3300031731 | Bacteria | 1505 |
| 418 | Ga0307410_10253269 | 3300031852 | Bacteria | 1370 |
| 419 | Ga0307412_10252472 | 3300031911 | Bacteria | 1370 |
| 420 | Ga0307409_100079363 | 3300031995 | Bacteria | 2644 |
| 421 | Ga0307414_10259134 | 3300032004 | Bacteria | 1450 |
| 422 | Ga0307415_100318737 | 3300032126 | Bacteria | 1295 |
| 423 | Ga0307510_10061898 | 3300033180 | Bacteria | 3830 |
| 424 | Ga0307510_10212961 | 3300033180 | Bacteria | 1452 |
| 425 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 426 | Ga0373934_0029660 | 3300035086 | Bacteria | 2137 |
| 427 | Ga0373949_0009711 | 3300035090 | Bacteria | 2107 |
| 428 | Ga0373923_0011853 | 3300035111 | Bacteria | 3209 |
| 429 | Ga0373936_0005011 | 3300035113 | Bacteria | 4989 |
| 430 | Ga0373936_0115641 | 3300035113 | Bacteria | 1142 |
| 431 | Ga0373945_0007341 | 3300035116 | Bacteria | 3573 |
| 432 | Ga0373953_0001976 | 3300035117 | Bacteria | 6102 |
| 433 | Ga0373954_0000070 | 3300035118 | Bacteria | 36271 |
| 434 | Ga0373954_0019610 | 3300035118 | Bacteria | 3052 |
| 435 | Ga0373956_0001764 | 3300035119 | Bacteria | 8915 |
| 436 | Ga0373956_0004017 | 3300035119 | Bacteria | 5910 |
| 437 | Ga0373957_0079219 | 3300035120 | Bacteria | 1295 |
| 438 | Ga0373943_0057054 | 3300035170 | Bacteria | 1939 |
| 439 | Ga0373946_0002945 | 3300035171 | Bacteria | 6034 |
| 440 | Ga0373955_0000771 | 3300035172 | Bacteria | 13748 |
| 441 | Ga0373931_0138254 | 3300035691 | Bacteria | 1408 |
| 442 | Ga0373935_0001652 | 3300035692 | Bacteria | 12461 |
| 443 | Ga0373935_0043241 | 3300035692 | Bacteria | 2835 |
| 444 | Ga0373927_0009182 | 3300035695 | Bacteria | 6635 |
| 445 | Ga0373927_0012054 | 3300035695 | Bacteria | 5751 |
| 446 | Ga0373927_0031720 | 3300035695 | Bacteria | 3443 |
| 447 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 448 | Ga0373933_0088427 | 3300035724 | Bacteria | 1909 |
| 449 | Ga0373947_0000308 | 3300035725 | Bacteria | 27609 |
| 450 | Ga0373947_0001951 | 3300035725 | Bacteria | 12629 |
| 451 | Ga0373947_0098617 | 3300035725 | Bacteria | 1833 |
| 452 | Ga0373947_0178507 | 3300035725 | Bacteria | 1381 |
| 453 | Ga0373937_0014091 | 3300036401 | Bacteria | 7051 |
| 454 | Ga0372808_002089 | 3300036459 | Bacteria | 2235 |
| 455 | Ga0310109_014758 | 3300036534 | Bacteria | 1059 |
| 456 | Ga0373925_0004951 | 3300037068 | Bacteria | 10010 |
| 457 | Ga0373925_0008222 | 3300037068 | Bacteria | 7595 |
| 458 | Ga0373925_0044281 | 3300037068 | Bacteria | 3305 |
| 459 | Ga0373925_0049086 | 3300037068 | Bacteria | 3146 |
| 460 | Ga0373925_0123554 | 3300037068 | Bacteria | 2012 |
| 461 | Ga0395900_0048752 | 3300037418 | Bacteria | 4363 |
| 462 | Ga0395900_0100154 | 3300037418 | Bacteria | 2976 |
| 463 | Ga0395900_0145687 | 3300037418 | Bacteria | 2422 |
| 464 | Ga0395900_0345164 | 3300037418 | Bacteria | 1463 |
| 465 | Ga0395898_0137190 | 3300037466 | Bacteria | 2342 |
| 466 | Ga0395898_0467698 | 3300037466 | Bacteria | 1200 |
| 467 | Ga0395905_0003894 | 3300037471 | Bacteria | 15744 |
| 468 | Ga0395905_0564628 | 3300037471 | Bacteria | 1039 |
| 469 | Ga0395905_0627455 | 3300037471 | Bacteria | 977 |
| 470 | Ga0436364_1178281 | 3300037853 | Bacteria | 3164 |
| 471 | Ga0395901_0058368 | 3300038443 | Bacteria | 4014 |
| 472 | Ga0395901_0349449 | 3300038443 | Bacteria | 1526 |
| 473 | Ga0436365_0028265 | 3300039437 | Bacteria | 4288 |
| 474 | Ga0436365_0888504 | 3300039437 | Bacteria | 1225 |
| 475 | Ga0436365_1664592 | 3300039437 | Bacteria | 1567 |
| 476 | Ga0436363_0776803 | 3300039450 | Bacteria | 2295 |
| 477 | Ga0439465_0079979 | 3300041413 | Bacteria | 1107 |
| 478 | Ga0451793_0284192 | 3300041452 | Bacteria | 1064 |
| 479 | Ga0451802_1938471 | 3300041460 | Bacteria | 1168 |
| 480 | Ga0451841_0283415 | 3300041498 | Bacteria | 1163 |
| 481 | Ga0451853_1007175 | 3300041512 | Bacteria | 1085 |
| 482 | Ga0439432_033545 | 3300042006 | Bacteria | 1651 |
| 483 | Ga0466969_0137691 | 3300044656 | Bacteria | 1129 |
| 484 | Ga0466966_0146856 | 3300044684 | Bacteria | 1439 |
| 485 | Ga0466963_0004339 | 3300044694 | Bacteria | 8230 |
| 486 | Ga0466964_0010990 | 3300044706 | Bacteria | 3420 |
| 487 | Ga0466957_0363188 | 3300044842 | Bacteria | 984 |
| 488 | Ga0466959_0009642 | 3300045049 | Bacteria | 6870 |
| 489 | Ga0466967_0144048 | 3300045976 | Bacteria | 2222 |
| 490 | Ga0466967_0210837 | 3300045976 | Bacteria | 1842 |
| 491 | Ga0466967_0308244 | 3300045976 | Bacteria | 1524 |
| 492 | Ga0495617_035725 | 3300046452 | Bacteria | 1668 |
| 493 | Ga0495627_038315 | 3300046453 | Bacteria | 1483 |
| 494 | Ga0495592_0006603 | 3300046454 | Bacteria | 8646 |
| 495 | Ga0495592_0010901 | 3300046454 | Bacteria | 6857 |
| 496 | Ga0495603_0011228 | 3300046455 | Bacteria | 5425 |
| 497 | Ga0495603_0031835 | 3300046455 | Bacteria | 3175 |
| 498 | Ga0495603_0060342 | 3300046455 | Bacteria | 2241 |
| 499 | Ga0495603_0096848 | 3300046455 | Bacteria | 1724 |
| 500 | Ga0495603_0119488 | 3300046455 | Bacteria | 1536 |
| 501 | Ga0495629_0001384 | 3300046459 | Bacteria | 19124 |
| 502 | Ga0495629_0006304 | 3300046459 | Bacteria | 8802 |
| 503 | Ga0495629_0060310 | 3300046459 | Bacteria | 2652 |
| 504 | Ga0495638_0019065 | 3300046460 | Bacteria | 4542 |
| 505 | Ga0495641_0008805 | 3300046461 | Bacteria | 6085 |
| 506 | Ga0495651_0022001 | 3300046462 | Bacteria | 4958 |
| 507 | Ga0495653_0003677 | 3300046463 | Bacteria | 12388 |
| 508 | Ga0495653_0023789 | 3300046463 | Bacteria | 4945 |
| 509 | Ga0495580_0048298 | 3300046472 | Bacteria | 3014 |
| 510 | Ga0495580_0290458 | 3300046472 | Bacteria | 1115 |
| 511 | Ga0495582_0000130 | 3300046473 | Bacteria | 40201 |
| 512 | Ga0495582_0013157 | 3300046473 | Bacteria | 4554 |
| 513 | Ga0495639_0000061 | 3300046475 | Bacteria | 48670 |
| 514 | Ga0495639_0099122 | 3300046475 | Bacteria | 1374 |
| 515 | Ga0495662_0000308 | 3300046476 | Bacteria | 21273 |
| 516 | Ga0495662_0080056 | 3300046476 | Bacteria | 1589 |
| 517 | Ga0495664_0006016 | 3300046477 | Bacteria | 6688 |
| 518 | Ga0495664_0040115 | 3300046477 | Bacteria | 2767 |
| 519 | Ga0495664_0045709 | 3300046477 | Bacteria | 2597 |
| 520 | Ga0495584_0045246 | 3300046491 | Bacteria | 2220 |
| 521 | Ga0495584_0108235 | 3300046491 | Bacteria | 1406 |
| 522 | Ga0495585_0077971 | 3300046492 | Bacteria | 1798 |
| 523 | Ga0495594_0001934 | 3300046499 | Bacteria | 10812 |
| 524 | Ga0495594_0097894 | 3300046499 | Bacteria | 1649 |
| 525 | Ga0495583_0015129 | 3300046506 | Bacteria | 4211 |
| 526 | Ga0495606_0095009 | 3300046507 | Bacteria | 1826 |
| 527 | Ga0495608_0016884 | 3300046511 | Bacteria | 5052 |
| 528 | Ga0495608_0045497 | 3300046511 | Bacteria | 2925 |
| 529 | Ga0495608_0151047 | 3300046511 | Bacteria | 1480 |
| 530 | Ga0495610_0030503 | 3300046512 | Bacteria | 2825 |
| 531 | Ga0495610_0034617 | 3300046512 | Bacteria | 2600 |
| 532 | Ga0495618_0009298 | 3300046514 | Bacteria | 5932 |
| 533 | Ga0495618_0030396 | 3300046514 | Bacteria | 3373 |
| 534 | Ga0495628_0002643 | 3300046516 | Bacteria | 16072 |
| 535 | Ga0495628_0009941 | 3300046516 | Bacteria | 8097 |
| 536 | Ga0495628_0061986 | 3300046516 | Bacteria | 2932 |
| 537 | Ga0495628_0062313 | 3300046516 | Bacteria | 2923 |
| 538 | Ga0495631_0065787 | 3300046518 | Bacteria | 1569 |
| 539 | Ga0495631_0095952 | 3300046518 | Bacteria | 1276 |
| 540 | Ga0495637_0024344 | 3300046520 | Bacteria | 2740 |
| 541 | Ga0495643_0056642 | 3300046522 | Bacteria | 2091 |
| 542 | Ga0495652_0000858 | 3300046529 | Bacteria | 35023 |
| 543 | Ga0495652_0016880 | 3300046529 | Bacteria | 6525 |
| 544 | Ga0495652_0033362 | 3300046529 | Bacteria | 4494 |
| 545 | Ga0495652_0113666 | 3300046529 | Bacteria | 2173 |
| 546 | Ga0495652_0344568 | 3300046529 | Bacteria | 1069 |
| 547 | Ga0495665_0002782 | 3300046531 | Bacteria | 9440 |
| 548 | Ga0495665_0076330 | 3300046531 | Bacteria | 1764 |
| 549 | Ga0495640_0003517 | 3300046533 | Bacteria | 12593 |
| 550 | Ga0495640_0006692 | 3300046533 | Bacteria | 9091 |
| 551 | Ga0495640_0018432 | 3300046533 | Bacteria | 5174 |
| 552 | Ga0495640_0214689 | 3300046533 | Bacteria | 1215 |
| 553 | Ga0495586_0009762 | 3300046535 | Bacteria | 5111 |
| 554 | Ga0495587_0010506 | 3300046536 | Bacteria | 5888 |
| 555 | Ga0495587_0060580 | 3300046536 | Bacteria | 2219 |
| 556 | Ga0495597_0081962 | 3300046542 | Bacteria | 1379 |
| 557 | Ga0495645_0003263 | 3300046543 | Bacteria | 11010 |
| 558 | Ga0495645_0016949 | 3300046543 | Bacteria | 5213 |
| 559 | Ga0495645_0030578 | 3300046543 | Bacteria | 3922 |
| 560 | Ga0495645_0058213 | 3300046543 | Bacteria | 2803 |
| 561 | Ga0495622_0012397 | 3300046557 | Bacteria | 3946 |
| 562 | Ga0495622_0039894 | 3300046557 | Bacteria | 2186 |
| 563 | Ga0495667_0066248 | 3300046559 | Bacteria | 2361 |
| 564 | Ga0495667_0101335 | 3300046559 | Bacteria | 1863 |
| 565 | Ga0495656_0021511 | 3300046615 | Bacteria | 2512 |
| 566 | Ga0495656_0134415 | 3300046615 | Bacteria | 1180 |
| 567 | Ga0495634_0000703 | 3300046642 | Bacteria | 32526 |
| 568 | Ga0495634_0007605 | 3300046642 | Bacteria | 8118 |
| 569 | Ga0495634_0013427 | 3300046642 | Bacteria | 5917 |
| 570 | Ga0495611_0175580 | 3300046648 | Bacteria | 1001 |
| 571 | Ga0495625_0295820 | 3300046660 | Bacteria | 1037 |
| 572 | Ga0495635_0000644 | 3300046663 | Bacteria | 22418 |
| 573 | Ga0495635_0004483 | 3300046663 | Bacteria | 9674 |
| 574 | Ga0495635_0025471 | 3300046663 | Bacteria | 4121 |
| 575 | Ga0495635_0207514 | 3300046663 | Bacteria | 1327 |
| 576 | Ga0495659_0015681 | 3300046664 | Bacteria | 2493 |
| 577 | Ga0495659_0023103 | 3300046664 | Bacteria | 2110 |
| 578 | Ga0495661_0016500 | 3300046665 | Bacteria | 4893 |
| 579 | Ga0495588_0003829 | 3300046674 | Bacteria | 6593 |
| 580 | Ga0495588_0028025 | 3300046674 | Bacteria | 2817 |
| 581 | Ga0495657_0001016 | 3300046675 | Bacteria | 24742 |
| 582 | Ga0495657_0064686 | 3300046675 | Bacteria | 2408 |
| 583 | Ga0495657_0171586 | 3300046675 | Bacteria | 1335 |
| 584 | Ga0495599_0000637 | 3300046678 | Bacteria | 19794 |
| 585 | Ga0495599_0018824 | 3300046678 | Bacteria | 4304 |
| 586 | Ga0495599_0060991 | 3300046678 | Bacteria | 2357 |
| 587 | Ga0495599_0224082 | 3300046678 | Bacteria | 1149 |
| 588 | Ga0495623_0003015 | 3300046679 | Bacteria | 11083 |
| 589 | Ga0495623_0005023 | 3300046679 | Bacteria | 8674 |
| 590 | Ga0495623_0035354 | 3300046679 | Bacteria | 3202 |
| 591 | Ga0495646_0001926 | 3300046680 | Bacteria | 12482 |
| 592 | Ga0495646_0033462 | 3300046680 | Bacteria | 3195 |
| 593 | Ga0495646_0047444 | 3300046680 | Bacteria | 2614 |
| 594 | Ga0495647_0006362 | 3300046681 | Bacteria | 3908 |
| 595 | Ga0495658_0002243 | 3300046683 | Bacteria | 9769 |
| 596 | Ga0495669_0025247 | 3300046684 | Bacteria | 2590 |
| 597 | Ga0495669_0185275 | 3300046684 | Bacteria | 992 |
| 598 | Ga0495613_0005726 | 3300046689 | Bacteria | 9309 |
| 599 | Ga0495613_0028892 | 3300046689 | Bacteria | 4124 |
| 600 | Ga0495624_0000188 | 3300046690 | Bacteria | 46706 |
| 601 | Ga0495624_0125215 | 3300046690 | Bacteria | 1577 |
| 602 | Ga0495671_0011981 | 3300046692 | Bacteria | 4749 |
| 603 | Ga0495649_0117823 | 3300046694 | Bacteria | 1405 |
| 604 | Ga0495589_0043465 | 3300046794 | Bacteria | 2236 |
| 605 | Ga0495589_0079223 | 3300046794 | Bacteria | 1599 |
| 606 | Ga0495589_0114205 | 3300046794 | Bacteria | 1302 |
| 607 | Ga0495600_0013271 | 3300046809 | Bacteria | 5172 |
| 608 | Ga0495600_0035513 | 3300046809 | Bacteria | 3238 |
| 609 | Ga0495600_0062033 | 3300046809 | Bacteria | 2442 |
| 610 | Ga0495581_0000152 | 3300047315 | Bacteria | 30800 |
| 611 | Ga0495604_0013258 | 3300047317 | Bacteria | 6565 |
| 612 | Ga0495604_0013887 | 3300047317 | Bacteria | 6423 |
| 613 | Ga0495604_0034842 | 3300047317 | Bacteria | 3979 |
| 614 | Ga0495636_0027918 | 3300047318 | Bacteria | 2299 |
| 615 | Ga0495674_0001256 | 3300047319 | Bacteria | 24623 |
| 616 | Ga0495674_0011842 | 3300047319 | Bacteria | 8222 |
| 617 | Ga0495674_0108330 | 3300047319 | Bacteria | 2357 |
| 618 | Ga0495674_0332124 | 3300047319 | Bacteria | 1237 |
| 619 | Ga0495672_0029963 | 3300047320 | Bacteria | 3420 |
| 620 | Ga0495676_0027751 | 3300047321 | Bacteria | 4850 |
| 621 | Ga0495676_0069382 | 3300047321 | Bacteria | 2720 |
| 622 | Ga0495680_0004188 | 3300047322 | Bacteria | 13854 |
| 623 | Ga0495680_0015409 | 3300047322 | Bacteria | 6597 |
| 624 | Ga0495680_0051945 | 3300047322 | Bacteria | 3197 |
| 625 | Ga0495680_0067800 | 3300047322 | Bacteria | 2727 |
| 626 | Ga0495673_0027275 | 3300047469 | Bacteria | 2721 |
| 627 | Ga0495681_0110453 | 3300047470 | Bacteria | 1191 |
| 628 | Ga0495684_0000380 | 3300047471 | Bacteria | 36351 |
| 629 | Ga0495684_0024464 | 3300047471 | Bacteria | 4648 |
| 630 | Ga0495684_0042078 | 3300047471 | Bacteria | 3500 |
| 631 | Ga0495686_0112569 | 3300047472 | Bacteria | 1630 |
| 632 | Ga0495593_0000144 | 3300047673 | Bacteria | 34869 |
| 633 | Ga0495593_0001866 | 3300047673 | Bacteria | 12550 |
| 634 | Ga0495593_0079361 | 3300047673 | Bacteria | 1699 |
| 635 | Ga0495602_0011077 | 3300048088 | Bacteria | 9336 |
| 636 | Ga0495602_0042204 | 3300048088 | Bacteria | 4158 |
| 637 | Ga0496100_0304251 | 3300048903 | Bacteria | 1194 |
| 638 | Ga0496101_0043088 | 3300048904 | Bacteria | 3224 |
| 639 | Ga0496101_0093294 | 3300048904 | Bacteria | 2242 |
| 640 | Ga0496101_0156226 | 3300048904 | Bacteria | 1747 |
| 641 | Ga0496102_0135422 | 3300048905 | Bacteria | 2308 |
| 642 | Ga0496102_0221157 | 3300048905 | Bacteria | 1785 |
| 643 | Ga0496102_0508312 | 3300048905 | Bacteria | 1127 |
| 644 | Ga0496102_0690670 | 3300048905 | Bacteria | 944 |
| 645 | Ga0496103_0002281 | 3300048906 | Bacteria | 12123 |
| 646 | Ga0496103_0041159 | 3300048906 | Bacteria | 2840 |
| 647 | Ga0496103_0158337 | 3300048906 | Bacteria | 1452 |
| 648 | Ga0496103_0189905 | 3300048906 | Bacteria | 1321 |
| 649 | Ga0496104_0004213 | 3300048907 | Bacteria | 12488 |
| 650 | Ga0496104_0034075 | 3300048907 | Bacteria | 4745 |
| 651 | Ga0496104_0040098 | 3300048907 | Bacteria | 4388 |
| 652 | Ga0496104_0076610 | 3300048907 | Bacteria | 3185 |
| 653 | Ga0496105_0008968 | 3300048908 | Bacteria | 7802 |
| 654 | Ga0496105_0034896 | 3300048908 | Bacteria | 4139 |
| 655 | Ga0496105_0075300 | 3300048908 | Bacteria | 2787 |
| 656 | Ga0496105_0078403 | 3300048908 | Bacteria | 2728 |
| 657 | Ga0496105_0087186 | 3300048908 | Bacteria | 2579 |
| 658 | Ga0496105_0343412 | 3300048908 | Bacteria | 1193 |
| 659 | Ga0496106_0000423 | 3300048909 | Bacteria | 30107 |
| 660 | Ga0496106_0101459 | 3300048909 | Bacteria | 2232 |
| 661 | Ga0496106_0275075 | 3300048909 | Bacteria | 1348 |
| 662 | Ga0496106_0389467 | 3300048909 | Bacteria | 1120 |
| 663 | Ga0496107_0000569 | 3300048910 | Bacteria | 20544 |
| 664 | Ga0496107_0065443 | 3300048910 | Bacteria | 2635 |
| 665 | Ga0496107_0346309 | 3300048910 | Bacteria | 1106 |
| 666 | Ga0496108_0013186 | 3300048911 | Bacteria | 6737 |
| 667 | Ga0496108_0057488 | 3300048911 | Bacteria | 3268 |
| 668 | Ga0496108_0098987 | 3300048911 | Bacteria | 2485 |
| 669 | Ga0496109_0000393 | 3300048912 | Bacteria | 39750 |
| 670 | Ga0496109_0021730 | 3300048912 | Bacteria | 5679 |
| 671 | Ga0496109_0245261 | 3300048912 | Bacteria | 1686 |
| 672 | Ga0496109_0252157 | 3300048912 | Bacteria | 1662 |
| 673 | Ga0496110_0019105 | 3300048913 | Bacteria | 5760 |
| 674 | Ga0496110_0019362 | 3300048913 | Bacteria | 5725 |
| 675 | Ga0496110_0029779 | 3300048913 | Bacteria | 4702 |
| 676 | Ga0496110_0173448 | 3300048913 | Bacteria | 1957 |
| 677 | Ga0496110_0198007 | 3300048913 | Bacteria | 1825 |
| 678 | Ga0496110_0385693 | 3300048913 | Bacteria | 1277 |
| 679 | Ga0496111_0031722 | 3300048914 | Bacteria | 3764 |
| 680 | Ga0496111_0118923 | 3300048914 | Bacteria | 1951 |
| 681 | Ga0496111_0124393 | 3300048914 | Bacteria | 1906 |
| 682 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 683 | Ga0496112_0002518 | 3300048915 | Bacteria | 14792 |
| 684 | Ga0496112_0031613 | 3300048915 | Bacteria | 5135 |
| 685 | Ga0496112_0037193 | 3300048915 | Bacteria | 4752 |
| 686 | Ga0496112_0045387 | 3300048915 | Bacteria | 4308 |
| 687 | Ga0496112_0105162 | 3300048915 | Bacteria | 2792 |
| 688 | Ga0496112_0331897 | 3300048915 | Bacteria | 1464 |
| 689 | Ga0496112_0548163 | 3300048915 | Bacteria | 1090 |
| 690 | Ga0496113_0053804 | 3300048916 | Bacteria | 3010 |
| 691 | Ga0496113_0085795 | 3300048916 | Bacteria | 2419 |
| 692 | Ga0496113_0088961 | 3300048916 | Bacteria | 2376 |
| 693 | Ga0496113_0154479 | 3300048916 | Bacteria | 1811 |
| 694 | Ga0496113_0179489 | 3300048916 | Bacteria | 1678 |
| 695 | Ga0496113_0401746 | 3300048916 | Bacteria | 1100 |
| 696 | Ga0496114_0033661 | 3300048917 | Bacteria | 4224 |
| 697 | Ga0496114_0044714 | 3300048917 | Bacteria | 3676 |
| 698 | Ga0496114_0046690 | 3300048917 | Bacteria | 3599 |
| 699 | Ga0496114_0056373 | 3300048917 | Bacteria | 3279 |
| 700 | Ga0496114_0164825 | 3300048917 | Bacteria | 1929 |
| 701 | Ga0496115_0001490 | 3300048918 | Bacteria | 16832 |
| 702 | Ga0496115_0024614 | 3300048918 | Bacteria | 4682 |
| 703 | Ga0496115_0055924 | 3300048918 | Bacteria | 3171 |
| 704 | Ga0496115_0193300 | 3300048918 | Bacteria | 1681 |
| 705 | Ga0496116_0004870 | 3300048919 | Bacteria | 12662 |
| 706 | Ga0496117_0136959 | 3300048920 | Bacteria | 1473 |
| 707 | Ga0496117_0233571 | 3300048920 | Bacteria | 1014 |
| 708 | Ga0496118_0075907 | 3300048921 | Bacteria | 2393 |
| 709 | Ga0496118_0177629 | 3300048921 | Bacteria | 1291 |
| 710 | Ga0496118_0237652 | 3300048921 | Bacteria | 1046 |
| 711 | Ga0496119_0013974 | 3300048922 | Bacteria | 6328 |
| 712 | Ga0496119_0075414 | 3300048922 | Bacteria | 1960 |
| 713 | Ga0496120_0016201 | 3300048923 | Bacteria | 4878 |
| 714 | Ga0496121_0000937 | 3300048924 | Bacteria | 52775 |
| 715 | Ga0496121_0012844 | 3300048924 | Bacteria | 9063 |
| 716 | Ga0496121_0021616 | 3300048924 | Bacteria | 6292 |
| 717 | Ga0496121_0022931 | 3300048924 | Bacteria | 6033 |
| 718 | Ga0496121_0057484 | 3300048924 | Bacteria | 3224 |
| 719 | Ga0496121_0063766 | 3300048924 | Bacteria | 3008 |
| 720 | Ga0496121_0117135 | 3300048924 | Bacteria | 2019 |
| 721 | Ga0496121_0231063 | 3300048924 | Bacteria | 1295 |
| 722 | Ga0496122_0017150 | 3300048925 | Bacteria | 6790 |
| 723 | Ga0496122_0078385 | 3300048925 | Bacteria | 2314 |
| 724 | Ga0496122_0079417 | 3300048925 | Bacteria | 2293 |
| 725 | Ga0496122_0116773 | 3300048925 | Bacteria | 1734 |
| 726 | Ga0496123_0013485 | 3300048926 | Bacteria | 6854 |
| 727 | Ga0496123_0029839 | 3300048926 | Bacteria | 4004 |
| 728 | Ga0496124_0101131 | 3300048927 | Bacteria | 2336 |
| 729 | Ga0496124_0101433 | 3300048927 | Bacteria | 2332 |
| 730 | Ga0496124_0161073 | 3300048927 | Bacteria | 1749 |
| 731 | Ga0496125_0000272 | 3300048928 | Bacteria | 105490 |
| 732 | Ga0496125_0035071 | 3300048928 | Bacteria | 4409 |
| 733 | Ga0496125_0094080 | 3300048928 | Bacteria | 2234 |
| 734 | Ga0496125_0099660 | 3300048928 | Bacteria | 2145 |
| 735 | Ga0496125_0114063 | 3300048928 | Bacteria | 1947 |
| 736 | Ga0496126_0005828 | 3300048929 | Bacteria | 13931 |
| 737 | Ga0496126_0006091 | 3300048929 | Bacteria | 13526 |
| 738 | Ga0496126_0006946 | 3300048929 | Bacteria | 12532 |
| 739 | Ga0496126_0014947 | 3300048929 | Bacteria | 7826 |
| 740 | Ga0496126_0032865 | 3300048929 | Bacteria | 4883 |
| 741 | Ga0496126_0033274 | 3300048929 | Bacteria | 4850 |
| 742 | Ga0496126_0057411 | 3300048929 | Bacteria | 3514 |
| 743 | Ga0496126_0220016 | 3300048929 | Bacteria | 1595 |
| 744 | Ga0496126_0224204 | 3300048929 | Bacteria | 1577 |
| 745 | Ga0496126_0467612 | 3300048929 | Bacteria | 1012 |
| 746 | Ga0495682_0045604 | 3300049460 | Bacteria | 1601 |
| 747 | Ga0495682_0071953 | 3300049460 | Bacteria | 1244 |
| 748 | Ga0501031_0009017 | 3300049568 | Bacteria | 6491 |
| 749 | Ga0501031_0110443 | 3300049568 | Bacteria | 1795 |
| 750 | Ga0501032_0000129 | 3300049569 | Bacteria | 62082 |
| 751 | Ga0501032_0019530 | 3300049569 | Bacteria | 4739 |
| 752 | Ga0501032_0120760 | 3300049569 | Bacteria | 1732 |
| 753 | Ga0501033_0000113 | 3300049570 | Bacteria | 78028 |
| 754 | Ga0501033_0000983 | 3300049570 | Bacteria | 25917 |
| 755 | Ga0501033_0012970 | 3300049570 | Bacteria | 6355 |
| 756 | Ga0501033_0320178 | 3300049570 | Bacteria | 1089 |
| 757 | Ga0501034_0001074 | 3300049571 | Bacteria | 38708 |
| 758 | Ga0501034_0052026 | 3300049571 | Bacteria | 4128 |
| 759 | Ga0501034_0065055 | 3300049571 | Bacteria | 3659 |
| 760 | Ga0501034_0067787 | 3300049571 | Bacteria | 3580 |
| 761 | Ga0501034_0199925 | 3300049571 | Bacteria | 1957 |
| 762 | Ga0501036_0000112 | 3300049572 | Bacteria | 50437 |
| 763 | Ga0501036_0000232 | 3300049572 | Bacteria | 37236 |
| 764 | Ga0501036_0054565 | 3300049572 | Bacteria | 3385 |
| 765 | Ga0501037_0000106 | 3300049573 | Bacteria | 79430 |
| 766 | Ga0501037_0000406 | 3300049573 | Bacteria | 36029 |
| 767 | Ga0501037_0012572 | 3300049573 | Bacteria | 6237 |
| 768 | Ga0501038_0000108 | 3300049574 | Bacteria | 70323 |
| 769 | Ga0501038_0010003 | 3300049574 | Bacteria | 8684 |
| 770 | Ga0501038_0021786 | 3300049574 | Bacteria | 5750 |
| 771 | Ga0501038_0022220 | 3300049574 | Bacteria | 5685 |
| 772 | Ga0501038_0037201 | 3300049574 | Bacteria | 4268 |
| 773 | Ga0501038_0050435 | 3300049574 | Bacteria | 3595 |
| 774 | Ga0501039_0000097 | 3300049575 | Bacteria | 60744 |
| 775 | Ga0501039_0000460 | 3300049575 | Bacteria | 29614 |
| 776 | Ga0501039_0003144 | 3300049575 | Bacteria | 12349 |
| 777 | Ga0501039_0086334 | 3300049575 | Bacteria | 2443 |
| 778 | Ga0501041_0117608 | 3300049577 | Bacteria | 1651 |
| 779 | Ga0501042_0008165 | 3300049578 | Bacteria | 6897 |
| 780 | Ga0501042_0038574 | 3300049578 | Bacteria | 3392 |
| 781 | Ga0501042_0074035 | 3300049578 | Bacteria | 2437 |
| 782 | Ga0501042_0243903 | 3300049578 | Bacteria | 1296 |
| 783 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 784 | Ga0501043_0014172 | 3300049579 | Bacteria | 6237 |
| 785 | Ga0501043_0044795 | 3300049579 | Bacteria | 3479 |
| 786 | Ga0501043_0125520 | 3300049579 | Bacteria | 2012 |
| 787 | Ga0501046_0000944 | 3300049580 | Bacteria | 28515 |
| 788 | Ga0501046_0001554 | 3300049580 | Bacteria | 21923 |
| 789 | Ga0501047_0000792 | 3300049581 | Bacteria | 33063 |
| 790 | Ga0501047_0006122 | 3300049581 | Bacteria | 11306 |
| 791 | Ga0501047_0093423 | 3300049581 | Bacteria | 2887 |
| 792 | Ga0501048_0000116 | 3300049582 | Bacteria | 45512 |
| 793 | Ga0501067_0001402 | 3300049583 | Bacteria | 13081 |
| 794 | Ga0501068_0000014 | 3300049584 | Bacteria | 62762 |
| 795 | Ga0501068_0003479 | 3300049584 | Bacteria | 8485 |
| 796 | Ga0501069_0010536 | 3300049585 | Bacteria | 4896 |
| 797 | Ga0501069_0168111 | 3300049585 | Bacteria | 1264 |
| 798 | Ga0501070_0001063 | 3300049586 | Bacteria | 24697 |
| 799 | Ga0501070_0009144 | 3300049586 | Bacteria | 8379 |
| 800 | Ga0501070_0282108 | 3300049586 | Bacteria | 1355 |
| 801 | Ga0501070_0383002 | 3300049586 | Bacteria | 1139 |
| 802 | Ga0501071_0046687 | 3300049587 | Bacteria | 3111 |
| 803 | Ga0501071_0275525 | 3300049587 | Bacteria | 1273 |
| 804 | Ga0501072_0000367 | 3300049588 | Bacteria | 32192 |
| 805 | Ga0501073_0000368 | 3300049589 | Bacteria | 30350 |
| 806 | Ga0501073_0151518 | 3300049589 | Bacteria | 1607 |
| 807 | Ga0501074_0001037 | 3300049590 | Bacteria | 18048 |
| 808 | Ga0501079_0011719 | 3300049741 | Bacteria | 6696 |
| 809 | Ga0501079_0134260 | 3300049741 | Bacteria | 1926 |
| 810 | Ga0501080_0000143 | 3300049742 | Bacteria | 50337 |
| 811 | Ga0501080_0000332 | 3300049742 | Bacteria | 36151 |
| 812 | Ga0501083_0141601 | 3300049744 | Bacteria | 1575 |
| 813 | Ga0501035_0000250 | 3300049822 | Bacteria | 64768 |
| 814 | Ga0501035_0000632 | 3300049822 | Bacteria | 38776 |
| 815 | Ga0501035_0003056 | 3300049822 | Bacteria | 16047 |
| 816 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 817 | Ga0501044_0015386 | 3300049823 | Bacteria | 8239 |
| 818 | Ga0501044_0051243 | 3300049823 | Bacteria | 4256 |
| 819 | Ga0501044_0125764 | 3300049823 | Bacteria | 2561 |
| 820 | Ga0501044_0154343 | 3300049823 | Bacteria | 2276 |
| 821 | Ga0501044_0204060 | 3300049823 | Bacteria | 1934 |
| 822 | Ga0501044_0235820 | 3300049823 | Bacteria | 1775 |
| 823 | Ga0501044_0643955 | 3300049823 | Bacteria | 949 |
| 824 | Ga0501045_0002440 | 3300049824 | Bacteria | 12638 |
| 825 | nmdc:mga03683_24010_c1 | 3300050489 | Bacteria | 2382 |
| 826 | nmdc:mga03n38_10965_c1 | 3300050490 | Bacteria | 3359 |
| 827 | nmdc:mga03n38_8163_c1 | 3300050490 | Bacteria | 3743 |
| 828 | nmdc:mga00v17_143039_c1 | 3300050491 | Bacteria | 1534 |
| 829 | nmdc:mga00v17_15215_c1 | 3300050491 | Bacteria | 4313 |
| 830 | nmdc:mga00v17_4283_c1 | 3300050491 | Bacteria | 7409 |
| 831 | nmdc:mga00v17_55938_c1 | 3300050491 | Bacteria | 2411 |
| 832 | nmdc:mga0yw44_104794_c1 | 3300050492 | Bacteria | 1806 |
| 833 | nmdc:mga0yw44_157331_c1 | 3300050492 | Bacteria | 1486 |
| 834 | nmdc:mga0yw44_18088_c1 | 3300050492 | Bacteria | 3853 |
| 835 | nmdc:mga0yw44_19594_c1 | 3300050492 | Bacteria | 3734 |
| 836 | nmdc:mga0yw44_27309_c1 | 3300050492 | Bacteria | 3268 |
| 837 | nmdc:mga0yw44_387812_c1 | 3300050492 | Bacteria | 943 |
| 838 | nmdc:mga0yw44_42642_c1 | 3300050492 | Bacteria | 2706 |
| 839 | nmdc:mga0yw44_47797_c1 | 3300050492 | Bacteria | 2577 |
| 840 | nmdc:mga0yw44_59641_c1 | 3300050492 | Bacteria | 2335 |
| 841 | nmdc:mga0k408_261600_c1 | 3300050493 | Bacteria | 1033 |
| 842 | nmdc:mga06z11_170062_c1 | 3300050494 | Bacteria | 1251 |
| 843 | nmdc:mga06z11_29523_c1 | 3300050494 | Bacteria | 2642 |
| 844 | nmdc:mga06z11_439333_c1 | 3300050494 | Bacteria | 788 |
| 845 | nmdc:mga06z11_9916_c1 | 3300050494 | Bacteria | 4035 |
| 846 | nmdc:mga04h51_4173_c1 | 3300050495 | Bacteria | 3570 |
| 847 | nmdc:mga07m45_3431_c1 | 3300050496 | Bacteria | 2786 |
| 848 | nmdc:mga07m45_45116_c1 | 3300050496 | Bacteria | 2475 |
| 849 | nmdc:mga07m45_98420_c1 | 3300050496 | Bacteria | 1679 |
| 850 | nmdc:mga07m45_99442_c1 | 3300050496 | Bacteria | 1670 |
| 851 | nmdc:mga05p37_80160_c1 | 3300050507 | Bacteria | 4021 |
| 852 | nmdc:mga08y16_125241_c1 | 3300050511 | Bacteria | 2673 |
| 853 | nmdc:mga0a205_180925_c1 | 3300050515 | Bacteria | 2002 |
| 854 | nmdc:mga0sz30_24232_c1 | 3300050516 | Bacteria | 2475 |
| 855 | Ga0495601_0025742 | 3300053077 | Bacteria | 3629 |
| 856 | Ga0495601_0051392 | 3300053077 | Bacteria | 2601 |
| 857 | Ga0495601_0063896 | 3300053077 | Bacteria | 2339 |
| 858 | Ga0495601_0152026 | 3300053077 | Bacteria | 1511 |
| 859 | Ga0495601_0259741 | 3300053077 | Bacteria | 1134 |
| 860 | Ga0495612_0018341 | 3300053078 | Bacteria | 2803 |
| 861 | Ga0495612_0070953 | 3300053078 | Bacteria | 1452 |
| 862 | Ga0500635_0000782 | 3300053080 | Bacteria | 7900 |
| 863 | Ga0495655_0001518 | 3300053083 | Bacteria | 3564 |
| 864 | Ga0495595_0002657 | 3300053084 | Bacteria | 7012 |
| 865 | Ga0495595_0047080 | 3300053084 | Bacteria | 1988 |
| 866 | Ga0495595_0070386 | 3300053084 | Bacteria | 1652 |
| 867 | Ga0495619_0000355 | 3300053085 | Bacteria | 32054 |
| 868 | Ga0495619_0051093 | 3300053085 | Bacteria | 2731 |
| 869 | Ga0500643_015597 | 3300053087 | Bacteria | 2601 |
| 870 | Ga0500643_018233 | 3300053087 | Bacteria | 2333 |
| 871 | Ga0500646_0074163 | 3300053090 | Bacteria | 1026 |
| 872 | Ga0500651_0008492 | 3300053093 | Bacteria | 6048 |
| 873 | Ga0500651_0110382 | 3300053093 | Bacteria | 1679 |
| 874 | Ga0500566_0000026 | 3300053094 | Bacteria | 77138 |
| 875 | Ga0500566_0000892 | 3300053094 | Bacteria | 17037 |
| 876 | Ga0500566_0050239 | 3300053094 | Bacteria | 2388 |
| 877 | Ga0500640_011912 | 3300053095 | Bacteria | 3557 |
| 878 | Ga0500641_0008858 | 3300053096 | Bacteria | 3604 |
| 879 | Ga0500641_0036182 | 3300053096 | Bacteria | 1974 |
| 880 | Ga0500641_0062982 | 3300053096 | Bacteria | 1547 |
| 881 | Ga0500650_0001357 | 3300053098 | Bacteria | 7329 |
| 882 | Ga0500554_015264 | 3300053102 | Bacteria | 2002 |
| 883 | Ga0500555_004038 | 3300053103 | Bacteria | 4171 |
| 884 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 885 | Ga0500557_000015 | 3300053105 | Bacteria | 106282 |
| 886 | Ga0500572_000565 | 3300053111 | Bacteria | 12619 |
| 887 | Ga0500572_002560 | 3300053111 | Bacteria | 4337 |
| 888 | Ga0500591_080606 | 3300053115 | Bacteria | 1448 |
| 889 | Ga0500592_000324 | 3300053116 | Bacteria | 8167 |
| 890 | Ga0500594_0001178 | 3300053118 | Bacteria | 5649 |
| 891 | Ga0500595_002432 | 3300053119 | Bacteria | 9278 |
| 892 | Ga0500595_002514 | 3300053119 | Bacteria | 9049 |
| 893 | Ga0500595_003082 | 3300053119 | Bacteria | 7912 |
| 894 | Ga0500595_004867 | 3300053119 | Bacteria | 5944 |
| 895 | Ga0500595_056519 | 3300053119 | Bacteria | 1198 |
| 896 | Ga0500608_007506 | 3300053122 | Bacteria | 4518 |
| 897 | Ga0500608_113277 | 3300053122 | Bacteria | 1240 |
| 898 | Ga0500614_000135 | 3300053123 | Bacteria | 18032 |
| 899 | Ga0500618_019426 | 3300053125 | Bacteria | 1673 |
| 900 | Ga0500621_028739 | 3300053126 | Bacteria | 2199 |
| 901 | Ga0500642_0000037 | 3300053130 | Bacteria | 98684 |
| 902 | Ga0500652_000355 | 3300053131 | Bacteria | 16420 |
| 903 | Ga0500655_011412 | 3300053133 | Bacteria | 1610 |
| 904 | Ga0500559_0000081 | 3300053136 | Bacteria | 75262 |
| 905 | Ga0500559_0000859 | 3300053136 | Bacteria | 19515 |
| 906 | Ga0500559_0004957 | 3300053136 | Bacteria | 6188 |
| 907 | Ga0500559_0169954 | 3300053136 | Bacteria | 1025 |
| 908 | Ga0500568_0000621 | 3300053139 | Bacteria | 25541 |
| 909 | Ga0500568_0037225 | 3300053139 | Bacteria | 1975 |
| 910 | Ga0500590_123554 | 3300053148 | Bacteria | 1209 |
| 911 | Ga0500603_001715 | 3300053150 | Bacteria | 4938 |
| 912 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 913 | Ga0500616_0000372 | 3300053153 | Bacteria | 62890 |
| 914 | Ga0500616_0137726 | 3300053153 | Bacteria | 1145 |
| 915 | Ga0500622_0101586 | 3300053156 | Bacteria | 1415 |
| 916 | Ga0500622_0137361 | 3300053156 | Bacteria | 1169 |
| 917 | Ga0500627_0039582 | 3300053158 | Bacteria | 2019 |
| 918 | Ga0500627_0041152 | 3300053158 | Bacteria | 1985 |
| 919 | Ga0500627_0097165 | 3300053158 | Bacteria | 1321 |
| 920 | Ga0500630_000207 | 3300053159 | Bacteria | 22769 |
| 921 | Ga0500634_0055047 | 3300053161 | Bacteria | 2130 |
| 922 | Ga0500638_119689 | 3300053162 | Bacteria | 1206 |
| 923 | Ga0500638_141260 | 3300053162 | Bacteria | 1081 |
| 924 | Ga0500639_000939 | 3300053163 | Bacteria | 14837 |
| 925 | Ga0500639_048783 | 3300053163 | Bacteria | 2210 |
| 926 | Ga0500636_0075049 | 3300053177 | Bacteria | 1956 |
| 927 | Ga0500637_0000122 | 3300053178 | Bacteria | 28103 |
| 928 | Ga0500637_0012501 | 3300053178 | Bacteria | 4425 |
| 929 | Ga0500637_0013976 | 3300053178 | Bacteria | 4223 |
| 930 | Ga0500576_015404 | 3300053725 | Bacteria | 3457 |
| 931 | Ga0500625_003216 | 3300053729 | Bacteria | 6393 |
| 932 | Ga0500645_016064 | 3300053730 | Bacteria | 2363 |
| 933 | Ga0500609_009589 | 3300053731 | Bacteria | 1305 |
| 934 | Ga0500596_000101 | 3300053735 | Bacteria | 11781 |
| 935 | Ga0500596_000408 | 3300053735 | Bacteria | 7848 |
| 936 | Ga0501084_0000773 | 3300054114 | Bacteria | 24332 |
| 937 | Ga0500661_000317 | 3300055283 | Bacteria | 8830 |
| 938 | Ga0501082_0000396 | 3300060353 | Bacteria | 38652 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050494 | nmdc:mga06z11_439333_c1 | nmdc:mga06z11_439333_c1_22_774 | 223 |
| 2 | 3300048915 | Ga0496112_0548163 | Ga0496112_0548163_222_1037 | 225 |
| 3 | 3300035171 | Ga0373946_0002945 | Ga0373946_0002945_5190_6005 | 243 |
| 4 | 3300046529 | Ga0495652_0344568 | Ga0495652_0344568_211_1026 | 243 |
| 5 | 3300005355 | Ga0070671_100168389 | Ga0070671_1001683891 | 247 |
| 6 | 3300005535 | Ga0070684_100364541 | Ga0070684_1003645411 | 247 |
| 7 | 3300025920 | Ga0207649_10119751 | Ga0207649_101197511 | 249 |
| 8 | 3300005616 | Ga0068852_100100140 | Ga0068852_1001001403 | 250 |
| 9 | 3300037471 | Ga0395905_0627455 | Ga0395905_0627455_55_942 | 250 |
| 10 | 3300005329 | Ga0070683_100235899 | Ga0070683_1002358992 | 251 |
| 11 | 3300005336 | Ga0070680_100123971 | Ga0070680_1001239712 | 251 |
| 12 | 3300005339 | Ga0070660_100010407 | Ga0070660_1000104074 | 251 |
| 13 | 3300005458 | Ga0070681_10217928 | Ga0070681_102179282 | 251 |
| 14 | 3300005530 | Ga0070679_100031881 | Ga0070679_1000318815 | 251 |
| 15 | 3300005539 | Ga0068853_100005075 | Ga0068853_1000050755 | 251 |
| 16 | 3300005577 | Ga0068857_100143704 | Ga0068857_1001437042 | 251 |
| 17 | 3300005616 | Ga0068852_100046472 | Ga0068852_1000464723 | 251 |
| 18 | 3300005834 | Ga0068851_10001483 | Ga0068851_100014833 | 251 |
| 19 | 3300009093 | Ga0105240_10020975 | Ga0105240_100209756 | 251 |
| 20 | 3300009545 | Ga0105237_10011938 | Ga0105237_100119385 | 251 |
| 21 | 3300009551 | Ga0105238_10002798 | Ga0105238_100027985 | 251 |
| 22 | 3300010375 | Ga0105239_10017902 | Ga0105239_100179025 | 251 |
| 23 | 3300011119 | Ga0105246_10093444 | Ga0105246_100934442 | 251 |
| 24 | 3300013104 | Ga0157370_10015624 | Ga0157370_100156243 | 251 |
| 25 | 3300013105 | Ga0157369_10000996 | Ga0157369_1000099626 | 251 |
| 26 | 3300025912 | Ga0207707_10000713 | Ga0207707_1000071321 | 251 |
| 27 | 3300025914 | Ga0207671_10012301 | Ga0207671_100123017 | 251 |
| 28 | 3300025917 | Ga0207660_10007065 | Ga0207660_100070653 | 251 |
| 29 | 3300025919 | Ga0207657_10001786 | Ga0207657_1000178613 | 251 |
| 30 | 3300025920 | Ga0207649_10030165 | Ga0207649_100301652 | 251 |
| 31 | 3300025921 | Ga0207652_10004315 | Ga0207652_1000431512 | 251 |
| 32 | 3300025924 | Ga0207694_10016368 | Ga0207694_100163683 | 251 |
| 33 | 3300025944 | Ga0207661_10032141 | Ga0207661_100321414 | 251 |
| 34 | 3300025949 | Ga0207667_10008867 | Ga0207667_100088673 | 251 |
| 35 | 3300026041 | Ga0207639_10009512 | Ga0207639_100095122 | 251 |
| 36 | 3300026116 | Ga0207674_10012246 | Ga0207674_100122469 | 251 |
| 37 | 3300026142 | Ga0207698_10211229 | Ga0207698_102112292 | 251 |
| 38 | 3300047319 | Ga0495674_0332124 | Ga0495674_0332124_318_1205 | 251 |
| 39 | 3300009101 | Ga0105247_10094353 | Ga0105247_100943533 | 252 |
| 40 | 3300010375 | Ga0105239_10158066 | Ga0105239_101580663 | 252 |
| 41 | 3300028381 | Ga0268264_10333220 | Ga0268264_103332201 | 252 |
| 42 | 3300048905 | Ga0496102_0135422 | Ga0496102_0135422_569_1456 | 252 |
| 43 | 3300048906 | Ga0496103_0041159 | Ga0496103_0041159_652_1539 | 252 |
| 44 | 3300048908 | Ga0496105_0075300 | Ga0496105_0075300_1766_2653 | 252 |
| 45 | 3300048913 | Ga0496110_0019105 | Ga0496110_0019105_3616_4503 | 252 |
| 46 | 3300048915 | Ga0496112_0031613 | Ga0496112_0031613_4027_4914 | 252 |
| 47 | 3300048916 | Ga0496113_0053804 | Ga0496113_0053804_41_928 | 252 |
| 48 | 3300048917 | Ga0496114_0046690 | Ga0496114_0046690_2392_3279 | 252 |
| 49 | 3300049823 | Ga0501044_0235820 | Ga0501044_0235820_366_1253 | 252 |
| 50 | 3300053122 | Ga0500608_113277 | Ga0500608_113277_393_1223 | 253 |
| 51 | 3300014968 | Ga0157379_10276709 | Ga0157379_102767092 | 254 |
| 52 | 3300048907 | Ga0496104_0040098 | Ga0496104_0040098_362_1279 | 254 |
| 53 | 3300048909 | Ga0496106_0000423 | Ga0496106_0000423_19038_19955 | 254 |
| 54 | 3300048910 | Ga0496107_0000569 | Ga0496107_0000569_19196_20113 | 254 |
| 55 | 3300048911 | Ga0496108_0013186 | Ga0496108_0013186_3707_4624 | 254 |
| 56 | 3300048912 | Ga0496109_0000393 | Ga0496109_0000393_25632_26549 | 254 |
| 57 | 3300048916 | Ga0496113_0088961 | Ga0496113_0088961_1153_2070 | 254 |
| 58 | 3300005937 | Ga0081455_10038535 | Ga0081455_100385353 | 256 |
| 59 | 3300009545 | Ga0105237_10012243 | Ga0105237_100122438 | 256 |
| 60 | 3300025914 | Ga0207671_10045012 | Ga0207671_100450122 | 256 |
| 61 | 3300048916 | Ga0496113_0179489 | Ga0496113_0179489_52_867 | 256 |
| 62 | 3300035695 | Ga0373927_0031720 | Ga0373927_0031720_2639_3412 | 257 |
| 63 | 3300005328 | Ga0070676_10045828 | Ga0070676_100458284 | 259 |
| 64 | 3300005340 | Ga0070689_100007115 | Ga0070689_1000071153 | 259 |
| 65 | 3300005353 | Ga0070669_100055043 | Ga0070669_1000550432 | 259 |
| 66 | 3300005354 | Ga0070675_100299770 | Ga0070675_1002997702 | 259 |
| 67 | 3300005355 | Ga0070671_100045468 | Ga0070671_1000454682 | 259 |
| 68 | 3300005441 | Ga0070700_100081308 | Ga0070700_1000813082 | 259 |
| 69 | 3300005455 | Ga0070663_100066326 | Ga0070663_1000663263 | 259 |
| 70 | 3300005459 | Ga0068867_100202463 | Ga0068867_1002024632 | 259 |
| 71 | 3300014325 | Ga0163163_10014928 | Ga0163163_100149284 | 259 |
| 72 | 3300014326 | Ga0157380_10267482 | Ga0157380_102674822 | 259 |
| 73 | 3300025936 | Ga0207670_10001178 | Ga0207670_100011787 | 259 |
| 74 | 3300025937 | Ga0207669_10114878 | Ga0207669_101148782 | 259 |
| 75 | 3300026035 | Ga0207703_10206134 | Ga0207703_102061342 | 259 |
| 76 | 3300026067 | Ga0207678_10106075 | Ga0207678_101060752 | 259 |
| 77 | 3300026075 | Ga0207708_10049108 | Ga0207708_100491082 | 259 |
| 78 | 3300026078 | Ga0207702_10085355 | Ga0207702_100853552 | 259 |
| 79 | 3300026095 | Ga0207676_10128245 | Ga0207676_101282452 | 259 |
| 80 | 3300026118 | Ga0207675_100730166 | Ga0207675_1007301661 | 259 |
| 81 | 3300028380 | Ga0268265_10369309 | Ga0268265_103693092 | 259 |
| 82 | 3300028381 | Ga0268264_10465060 | Ga0268264_104650602 | 259 |
| 83 | 3300035090 | Ga0373949_0009711 | Ga0373949_0009711_1055_1942 | 259 |
| 84 | 3300035691 | Ga0373931_0138254 | Ga0373931_0138254_70_957 | 259 |
| 85 | 3300048904 | Ga0496101_0043088 | Ga0496101_0043088_177_1064 | 259 |
| 86 | 3300048906 | Ga0496103_0189905 | Ga0496103_0189905_338_1225 | 259 |
| 87 | 3300048907 | Ga0496104_0034075 | Ga0496104_0034075_1539_2426 | 259 |
| 88 | 3300048908 | Ga0496105_0008968 | Ga0496105_0008968_5685_6572 | 259 |
| 89 | 3300048911 | Ga0496108_0098987 | Ga0496108_0098987_1385_2272 | 259 |
| 90 | 3300048912 | Ga0496109_0021730 | Ga0496109_0021730_4162_5049 | 259 |
| 91 | 3300048912 | Ga0496109_0252157 | Ga0496109_0252157_195_1082 | 259 |
| 92 | 3300048915 | Ga0496112_0002518 | Ga0496112_0002518_6404_7291 | 259 |
| 93 | 3300048916 | Ga0496113_0085795 | Ga0496113_0085795_1452_2339 | 259 |
| 94 | 3300005983 | Ga0081540_1003736 | Ga0081540_10037362 | 260 |
| 95 | 3300006038 | Ga0075365_10061671 | Ga0075365_100616711 | 260 |
| 96 | 3300006051 | Ga0075364_10033462 | Ga0075364_100334622 | 260 |
| 97 | 3300006178 | Ga0075367_10113667 | Ga0075367_101136672 | 260 |
| 98 | 3300006186 | Ga0075369_10083542 | Ga0075369_100835421 | 260 |
| 99 | 3300048919 | Ga0496116_0004870 | Ga0496116_0004870_10104_10991 | 260 |
| 100 | 3300048925 | Ga0496122_0116773 | Ga0496122_0116773_835_1722 | 260 |
| 101 | 3300048927 | Ga0496124_0101131 | Ga0496124_0101131_556_1443 | 260 |
| 102 | 3300048928 | Ga0496125_0114063 | Ga0496125_0114063_628_1515 | 260 |
| 103 | 3300050491 | nmdc:mga00v17_15215_c1 | nmdc:mga00v17_15215_c1_1928_2815 | 260 |
| 104 | 3300050492 | nmdc:mga0yw44_157331_c1 | nmdc:mga0yw44_157331_c1_27_914 | 260 |
| 105 | 3300050496 | nmdc:mga07m45_98420_c1 | nmdc:mga07m45_98420_c1_780_1667 | 260 |
| 106 | 3300046460 | Ga0495638_0019065 | Ga0495638_0019065_391_1278 | 261 |
| 107 | 3300046507 | Ga0495606_0095009 | Ga0495606_0095009_664_1551 | 261 |
| 108 | 3300046542 | Ga0495597_0081962 | Ga0495597_0081962_195_1082 | 261 |
| 109 | 3300046665 | Ga0495661_0016500 | Ga0495661_0016500_3937_4824 | 261 |
| 110 | 3300047470 | Ga0495681_0110453 | Ga0495681_0110453_273_1160 | 261 |
| 111 | 3300048922 | Ga0496119_0075414 | Ga0496119_0075414_495_1382 | 261 |
| 112 | 3300048925 | Ga0496122_0017150 | Ga0496122_0017150_1915_2802 | 261 |
| 113 | 3300048929 | Ga0496126_0224204 | Ga0496126_0224204_552_1439 | 261 |
| 114 | 3300050492 | nmdc:mga0yw44_18088_c1 | nmdc:mga0yw44_18088_c1_577_1464 | 261 |
| 115 | 3300053087 | Ga0500643_018233 | Ga0500643_018233_799_1686 | 261 |
| 116 | 3300053090 | Ga0500646_0074163 | Ga0500646_0074163_14_901 | 261 |
| 117 | 3300053116 | Ga0500592_000324 | Ga0500592_000324_1224_2111 | 261 |
| 118 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_546509_547396 | 261 |
| 119 | 3300053156 | Ga0500622_0137361 | Ga0500622_0137361_182_1069 | 261 |
| 120 | 3300053161 | Ga0500634_0055047 | Ga0500634_0055047_768_1655 | 261 |
| 121 | 3300053731 | Ga0500609_009589 | Ga0500609_009589_338_1225 | 261 |
| 122 | 3300005338 | Ga0068868_100156056 | Ga0068868_1001560562 | 263 |
| 123 | 3300005841 | Ga0068863_100458343 | Ga0068863_1004583432 | 263 |
| 124 | 3300007265 | Ga0099794_10062614 | Ga0099794_100626142 | 263 |
| 125 | 3300031235 | Ga0265330_10051587 | Ga0265330_100515872 | 263 |
| 126 | 3300031238 | Ga0265332_10023963 | Ga0265332_100239632 | 263 |
| 127 | 3300031241 | Ga0265325_10035454 | Ga0265325_100354542 | 263 |
| 128 | 3300048921 | Ga0496118_0237652 | Ga0496118_0237652_52_939 | 263 |
| 129 | 3300048929 | Ga0496126_0006091 | Ga0496126_0006091_7543_8430 | 263 |
| 130 | 3300049573 | Ga0501037_0012572 | Ga0501037_0012572_4552_5439 | 263 |
| 131 | 3300049574 | Ga0501038_0021786 | Ga0501038_0021786_184_1071 | 263 |
| 132 | 3300049581 | Ga0501047_0093423 | Ga0501047_0093423_1585_2472 | 263 |
| 133 | 3300049586 | Ga0501070_0383002 | Ga0501070_0383002_217_1104 | 263 |
| 134 | 3300049823 | Ga0501044_0015386 | Ga0501044_0015386_4100_4987 | 263 |
| 135 | 3300010159 | Ga0099796_10013619 | Ga0099796_100136193 | 264 |
| 136 | 3300027671 | Ga0209588_1009775 | Ga0209588_10097752 | 264 |
| 137 | 3300035113 | Ga0373936_0115641 | Ga0373936_0115641_51_977 | 264 |
| 138 | 3300035118 | Ga0373954_0019610 | Ga0373954_0019610_37_924 | 264 |
| 139 | 3300035119 | Ga0373956_0004017 | Ga0373956_0004017_822_1709 | 264 |
| 140 | 3300035725 | Ga0373947_0001951 | Ga0373947_0001951_4357_5244 | 264 |
| 141 | 3300046454 | Ga0495592_0006603 | Ga0495592_0006603_3698_4585 | 264 |
| 142 | 3300046459 | Ga0495629_0060310 | Ga0495629_0060310_295_1182 | 264 |
| 143 | 3300046463 | Ga0495653_0023789 | Ga0495653_0023789_3782_4669 | 264 |
| 144 | 3300046476 | Ga0495662_0080056 | Ga0495662_0080056_366_1253 | 264 |
| 145 | 3300046477 | Ga0495664_0045709 | Ga0495664_0045709_1111_1998 | 264 |
| 146 | 3300046511 | Ga0495608_0016884 | Ga0495608_0016884_208_1095 | 264 |
| 147 | 3300046512 | Ga0495610_0034617 | Ga0495610_0034617_1295_2182 | 264 |
| 148 | 3300046514 | Ga0495618_0030396 | Ga0495618_0030396_2327_3214 | 264 |
| 149 | 3300046516 | Ga0495628_0009941 | Ga0495628_0009941_5474_6361 | 264 |
| 150 | 3300046520 | Ga0495637_0024344 | Ga0495637_0024344_546_1433 | 264 |
| 151 | 3300046522 | Ga0495643_0056642 | Ga0495643_0056642_546_1433 | 264 |
| 152 | 3300046529 | Ga0495652_0016880 | Ga0495652_0016880_5549_6436 | 264 |
| 153 | 3300046533 | Ga0495640_0006692 | Ga0495640_0006692_1614_2501 | 264 |
| 154 | 3300046535 | Ga0495586_0009762 | Ga0495586_0009762_3063_3950 | 264 |
| 155 | 3300046536 | Ga0495587_0010506 | Ga0495587_0010506_203_1090 | 264 |
| 156 | 3300046543 | Ga0495645_0030578 | Ga0495645_0030578_1737_2624 | 264 |
| 157 | 3300046559 | Ga0495667_0066248 | Ga0495667_0066248_846_1733 | 264 |
| 158 | 3300046642 | Ga0495634_0013427 | Ga0495634_0013427_892_1779 | 264 |
| 159 | 3300046663 | Ga0495635_0207514 | Ga0495635_0207514_221_1108 | 264 |
| 160 | 3300046675 | Ga0495657_0064686 | Ga0495657_0064686_1385_2272 | 264 |
| 161 | 3300046678 | Ga0495599_0224082 | Ga0495599_0224082_42_929 | 264 |
| 162 | 3300046679 | Ga0495623_0035354 | Ga0495623_0035354_2200_3087 | 264 |
| 163 | 3300046680 | Ga0495646_0047444 | Ga0495646_0047444_160_1047 | 264 |
| 164 | 3300046692 | Ga0495671_0011981 | Ga0495671_0011981_30_917 | 264 |
| 165 | 3300047317 | Ga0495604_0013887 | Ga0495604_0013887_371_1258 | 264 |
| 166 | 3300047322 | Ga0495680_0051945 | Ga0495680_0051945_2034_2921 | 264 |
| 167 | 3300047469 | Ga0495673_0027275 | Ga0495673_0027275_44_931 | 264 |
| 168 | 3300047471 | Ga0495684_0024464 | Ga0495684_0024464_3583_4470 | 264 |
| 169 | 3300048088 | Ga0495602_0011077 | Ga0495602_0011077_303_1190 | 264 |
| 170 | 3300048903 | Ga0496100_0304251 | Ga0496100_0304251_144_1031 | 264 |
| 171 | 3300048920 | Ga0496117_0233571 | Ga0496117_0233571_22_909 | 264 |
| 172 | 3300048924 | Ga0496121_0012844 | Ga0496121_0012844_5921_6808 | 264 |
| 173 | 3300048926 | Ga0496123_0013485 | Ga0496123_0013485_2126_3013 | 264 |
| 174 | 3300048928 | Ga0496125_0035071 | Ga0496125_0035071_2081_2968 | 264 |
| 175 | 3300053077 | Ga0495601_0063896 | Ga0495601_0063896_203_1090 | 264 |
| 176 | 3300053078 | Ga0495612_0070953 | Ga0495612_0070953_346_1233 | 264 |
| 177 | 3300053084 | Ga0495595_0070386 | Ga0495595_0070386_348_1235 | 264 |
| 178 | 3300053094 | Ga0500566_0000892 | Ga0500566_0000892_3212_4099 | 264 |
| 179 | 3300053098 | Ga0500650_0001357 | Ga0500650_0001357_6423_7310 | 264 |
| 180 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_574425_575312 | 264 |
| 181 | 3300053122 | Ga0500608_007506 | Ga0500608_007506_306_1193 | 264 |
| 182 | 3300053131 | Ga0500652_000355 | Ga0500652_000355_14102_14989 | 264 |
| 183 | 3300053136 | Ga0500559_0000859 | Ga0500559_0000859_6287_7174 | 264 |
| 184 | 3300053139 | Ga0500568_0000621 | Ga0500568_0000621_18393_19280 | 264 |
| 185 | 3300053158 | Ga0500627_0041152 | Ga0500627_0041152_198_1085 | 264 |
| 186 | 3300053730 | Ga0500645_016064 | Ga0500645_016064_1179_2066 | 264 |
| 187 | 3300005937 | Ga0081455_10008528 | Ga0081455_100085287 | 265 |
| 188 | 3300005983 | Ga0081540_1005905 | Ga0081540_10059054 | 265 |
| 189 | 3300005983 | Ga0081540_1017125 | Ga0081540_10171255 | 265 |
| 190 | 3300007788 | Ga0099795_10001501 | Ga0099795_100015013 | 265 |
| 191 | 3300031616 | Ga0307508_10070541 | Ga0307508_100705414 | 265 |
| 192 | 3300031711 | Ga0265314_10021549 | Ga0265314_100215493 | 265 |
| 193 | 3300031712 | Ga0265342_10023489 | Ga0265342_100234891 | 265 |
| 194 | 3300037068 | Ga0373925_0044281 | Ga0373925_0044281_826_1713 | 265 |
| 195 | 3300046472 | Ga0495580_0290458 | Ga0495580_0290458_73_960 | 265 |
| 196 | 3300046491 | Ga0495584_0108235 | Ga0495584_0108235_181_1068 | 265 |
| 197 | 3300048929 | Ga0496126_0005828 | Ga0496126_0005828_10135_11022 | 265 |
| 198 | 3300049571 | Ga0501034_0065055 | Ga0501034_0065055_842_1729 | 265 |
| 199 | 3300049579 | Ga0501043_0125520 | Ga0501043_0125520_615_1502 | 265 |
| 200 | 3300005355 | Ga0070671_100308084 | Ga0070671_1003080841 | 266 |
| 201 | 3300005435 | Ga0070714_100060983 | Ga0070714_1000609832 | 266 |
| 202 | 3300005439 | Ga0070711_100082054 | Ga0070711_1000820542 | 266 |
| 203 | 3300005614 | Ga0068856_100000205 | Ga0068856_10000020545 | 266 |
| 204 | 3300006871 | Ga0075434_100112461 | Ga0075434_1001124613 | 266 |
| 205 | 3300009177 | Ga0105248_10500391 | Ga0105248_105003911 | 266 |
| 206 | 3300013105 | Ga0157369_10225938 | Ga0157369_102259383 | 266 |
| 207 | 3300013296 | Ga0157374_10437459 | Ga0157374_104374591 | 266 |
| 208 | 3300013296 | Ga0157374_10694633 | Ga0157374_106946332 | 266 |
| 209 | 3300021384 | Ga0213876_10128096 | Ga0213876_101280961 | 266 |
| 210 | 3300025912 | Ga0207707_10252335 | Ga0207707_102523352 | 266 |
| 211 | 3300025916 | Ga0207663_10192280 | Ga0207663_101922802 | 266 |
| 212 | 3300025928 | Ga0207700_10006113 | Ga0207700_100061131 | 266 |
| 213 | 3300025929 | Ga0207664_10026024 | Ga0207664_100260244 | 266 |
| 214 | 3300025931 | Ga0207644_10366948 | Ga0207644_103669482 | 266 |
| 215 | 3300025949 | Ga0207667_10080065 | Ga0207667_100800651 | 266 |
| 216 | 3300026078 | Ga0207702_10000048 | Ga0207702_10000048112 | 266 |
| 217 | 3300037418 | Ga0395900_0100154 | Ga0395900_0100154_982_1869 | 266 |
| 218 | 3300037418 | Ga0395900_0345164 | Ga0395900_0345164_361_1248 | 266 |
| 219 | 3300037466 | Ga0395898_0137190 | Ga0395898_0137190_510_1397 | 266 |
| 220 | 3300037466 | Ga0395898_0467698 | Ga0395898_0467698_52_939 | 266 |
| 221 | 3300039437 | Ga0436365_0888504 | Ga0436365_0888504_96_983 | 266 |
| 222 | 3300047320 | Ga0495672_0029963 | Ga0495672_0029963_393_1280 | 266 |
| 223 | 3300048913 | Ga0496110_0385693 | Ga0496110_0385693_92_979 | 266 |
| 224 | 3300048918 | Ga0496115_0024614 | Ga0496115_0024614_1225_2112 | 266 |
| 225 | 3300048924 | Ga0496121_0022931 | Ga0496121_0022931_1089_1976 | 266 |
| 226 | 3300048929 | Ga0496126_0220016 | Ga0496126_0220016_184_1056 | 266 |
| 227 | 3300049568 | Ga0501031_0110443 | Ga0501031_0110443_540_1427 | 266 |
| 228 | 3300049569 | Ga0501032_0019530 | Ga0501032_0019530_2942_3829 | 266 |
| 229 | 3300049571 | Ga0501034_0067787 | Ga0501034_0067787_288_1175 | 266 |
| 230 | 3300049574 | Ga0501038_0022220 | Ga0501038_0022220_4582_5469 | 266 |
| 231 | 3300049575 | Ga0501039_0086334 | Ga0501039_0086334_701_1588 | 266 |
| 232 | 3300049586 | Ga0501070_0282108 | Ga0501070_0282108_12_899 | 266 |
| 233 | 3300049823 | Ga0501044_0204060 | Ga0501044_0204060_274_1161 | 266 |
| 234 | 3300053139 | Ga0500568_0037225 | Ga0500568_0037225_1077_1964 | 266 |
| 235 | 3300053153 | Ga0500616_0137726 | Ga0500616_0137726_105_992 | 266 |
| 236 | 3300053158 | Ga0500627_0097165 | Ga0500627_0097165_57_944 | 266 |
| 237 | 3300053177 | Ga0500636_0075049 | Ga0500636_0075049_226_1113 | 266 |
| 238 | 3300005441 | Ga0070700_100087884 | Ga0070700_1000878842 | 267 |
| 239 | 3300005458 | Ga0070681_10056806 | Ga0070681_100568063 | 267 |
| 240 | 3300005471 | Ga0070698_100249872 | Ga0070698_1002498722 | 267 |
| 241 | 3300005549 | Ga0070704_100109564 | Ga0070704_1001095642 | 267 |
| 242 | 3300005578 | Ga0068854_100005468 | Ga0068854_1000054683 | 267 |
| 243 | 3300005844 | Ga0068862_100258420 | Ga0068862_1002584202 | 267 |
| 244 | 3300005985 | Ga0081539_10013306 | Ga0081539_100133066 | 267 |
| 245 | 3300006186 | Ga0075369_10029054 | Ga0075369_100290541 | 267 |
| 246 | 3300013307 | Ga0157372_10179791 | Ga0157372_101797912 | 267 |
| 247 | 3300025935 | Ga0207709_10050919 | Ga0207709_100509192 | 267 |
| 248 | 3300025972 | Ga0207668_10109860 | Ga0207668_101098602 | 267 |
| 249 | 3300025981 | Ga0207640_10004396 | Ga0207640_100043966 | 267 |
| 250 | 3300031235 | Ga0265330_10010655 | Ga0265330_100106552 | 267 |
| 251 | 3300031247 | Ga0265340_10003545 | Ga0265340_100035457 | 267 |
| 252 | 3300031712 | Ga0265342_10029712 | Ga0265342_100297123 | 267 |
| 253 | 3300031730 | Ga0307516_10017411 | Ga0307516_100174112 | 267 |
| 254 | 3300035113 | Ga0373936_0005011 | Ga0373936_0005011_3798_4685 | 267 |
| 255 | 3300035116 | Ga0373945_0007341 | Ga0373945_0007341_1981_2868 | 267 |
| 256 | 3300035120 | Ga0373957_0079219 | Ga0373957_0079219_386_1273 | 267 |
| 257 | 3300035170 | Ga0373943_0057054 | Ga0373943_0057054_600_1487 | 267 |
| 258 | 3300035692 | Ga0373935_0001652 | Ga0373935_0001652_10956_11843 | 267 |
| 259 | 3300035695 | Ga0373927_0012054 | Ga0373927_0012054_3734_4621 | 267 |
| 260 | 3300035724 | Ga0373933_0088427 | Ga0373933_0088427_708_1595 | 267 |
| 261 | 3300035725 | Ga0373947_0000308 | Ga0373947_0000308_5659_6546 | 267 |
| 262 | 3300035725 | Ga0373947_0098617 | Ga0373947_0098617_805_1692 | 267 |
| 263 | 3300036401 | Ga0373937_0014091 | Ga0373937_0014091_3031_3918 | 267 |
| 264 | 3300037068 | Ga0373925_0004951 | Ga0373925_0004951_1964_2851 | 267 |
| 265 | 3300046454 | Ga0495592_0010901 | Ga0495592_0010901_5252_6139 | 267 |
| 266 | 3300046455 | Ga0495603_0011228 | Ga0495603_0011228_2158_3045 | 267 |
| 267 | 3300046459 | Ga0495629_0001384 | Ga0495629_0001384_16928_17815 | 267 |
| 268 | 3300046461 | Ga0495641_0008805 | Ga0495641_0008805_476_1363 | 267 |
| 269 | 3300046472 | Ga0495580_0048298 | Ga0495580_0048298_1977_2864 | 267 |
| 270 | 3300046473 | Ga0495582_0000130 | Ga0495582_0000130_22177_23064 | 267 |
| 271 | 3300046473 | Ga0495582_0013157 | Ga0495582_0013157_510_1397 | 267 |
| 272 | 3300046475 | Ga0495639_0000061 | Ga0495639_0000061_40751_41638 | 267 |
| 273 | 3300046476 | Ga0495662_0000308 | Ga0495662_0000308_9863_10750 | 267 |
| 274 | 3300046477 | Ga0495664_0040115 | Ga0495664_0040115_433_1320 | 267 |
| 275 | 3300046499 | Ga0495594_0001934 | Ga0495594_0001934_2893_3780 | 267 |
| 276 | 3300046511 | Ga0495608_0151047 | Ga0495608_0151047_63_950 | 267 |
| 277 | 3300046516 | Ga0495628_0061986 | Ga0495628_0061986_1492_2379 | 267 |
| 278 | 3300046531 | Ga0495665_0002782 | Ga0495665_0002782_6183_7070 | 267 |
| 279 | 3300046533 | Ga0495640_0003517 | Ga0495640_0003517_8763_9650 | 267 |
| 280 | 3300046557 | Ga0495622_0012397 | Ga0495622_0012397_516_1403 | 267 |
| 281 | 3300046642 | Ga0495634_0000703 | Ga0495634_0000703_9340_10227 | 267 |
| 282 | 3300046674 | Ga0495588_0003829 | Ga0495588_0003829_5278_6165 | 267 |
| 283 | 3300046681 | Ga0495647_0006362 | Ga0495647_0006362_743_1630 | 267 |
| 284 | 3300046683 | Ga0495658_0002243 | Ga0495658_0002243_3140_4027 | 267 |
| 285 | 3300046689 | Ga0495613_0005726 | Ga0495613_0005726_1643_2530 | 267 |
| 286 | 3300046690 | Ga0495624_0000188 | Ga0495624_0000188_4303_5190 | 267 |
| 287 | 3300047315 | Ga0495581_0000152 | Ga0495581_0000152_7161_8048 | 267 |
| 288 | 3300047319 | Ga0495674_0001256 | Ga0495674_0001256_14177_15064 | 267 |
| 289 | 3300047321 | Ga0495676_0027751 | Ga0495676_0027751_745_1632 | 267 |
| 290 | 3300047322 | Ga0495680_0067800 | Ga0495680_0067800_415_1302 | 267 |
| 291 | 3300047471 | Ga0495684_0042078 | Ga0495684_0042078_181_1068 | 267 |
| 292 | 3300047673 | Ga0495593_0000144 | Ga0495593_0000144_12666_13553 | 267 |
| 293 | 3300053077 | Ga0495601_0152026 | Ga0495601_0152026_367_1254 | 267 |
| 294 | 3300053077 | Ga0495601_0259741 | Ga0495601_0259741_222_1109 | 267 |
| 295 | 3300053084 | Ga0495595_0047080 | Ga0495595_0047080_664_1551 | 267 |
| 296 | 3300053085 | Ga0495619_0051093 | Ga0495619_0051093_827_1714 | 267 |
| 297 | 3300005338 | Ga0068868_100248107 | Ga0068868_1002481072 | 268 |
| 298 | 3300005344 | Ga0070661_100113258 | Ga0070661_1001132582 | 268 |
| 299 | 3300005347 | Ga0070668_100012922 | Ga0070668_1000129222 | 268 |
| 300 | 3300005355 | Ga0070671_100313382 | Ga0070671_1003133822 | 268 |
| 301 | 3300005456 | Ga0070678_100040180 | Ga0070678_1000401802 | 268 |
| 302 | 3300005457 | Ga0070662_100120984 | Ga0070662_1001209842 | 268 |
| 303 | 3300005544 | Ga0070686_100153504 | Ga0070686_1001535042 | 268 |
| 304 | 3300005548 | Ga0070665_100050963 | Ga0070665_1000509632 | 268 |
| 305 | 3300005563 | Ga0068855_100055064 | Ga0068855_1000550645 | 268 |
| 306 | 3300005616 | Ga0068852_100353653 | Ga0068852_1003536532 | 268 |
| 307 | 3300005617 | Ga0068859_100133789 | Ga0068859_1001337892 | 268 |
| 308 | 3300005618 | Ga0068864_100090642 | Ga0068864_1000906423 | 268 |
| 309 | 3300005842 | Ga0068858_100083289 | Ga0068858_1000832892 | 268 |
| 310 | 3300005983 | Ga0081540_1003874 | Ga0081540_10038743 | 268 |
| 311 | 3300006038 | Ga0075365_10004501 | Ga0075365_100045012 | 268 |
| 312 | 3300006038 | Ga0075365_10020048 | Ga0075365_100200485 | 268 |
| 313 | 3300006048 | Ga0075363_100007043 | Ga0075363_1000070432 | 268 |
| 314 | 3300006048 | Ga0075363_100021765 | Ga0075363_1000217654 | 268 |
| 315 | 3300006051 | Ga0075364_10205542 | Ga0075364_102055421 | 268 |
| 316 | 3300006237 | Ga0097621_100192366 | Ga0097621_1001923662 | 268 |
| 317 | 3300006353 | Ga0075370_10033181 | Ga0075370_100331812 | 268 |
| 318 | 3300006931 | Ga0097620_100133791 | Ga0097620_1001337913 | 268 |
| 319 | 3300009093 | Ga0105240_10035586 | Ga0105240_100355864 | 268 |
| 320 | 3300009098 | Ga0105245_10310952 | Ga0105245_103109522 | 268 |
| 321 | 3300009177 | Ga0105248_10374482 | Ga0105248_103744822 | 268 |
| 322 | 3300013104 | Ga0157370_10052947 | Ga0157370_100529473 | 268 |
| 323 | 3300013105 | Ga0157369_10007824 | Ga0157369_100078247 | 268 |
| 324 | 3300013297 | Ga0157378_10273428 | Ga0157378_102734282 | 268 |
| 325 | 3300013307 | Ga0157372_10086103 | Ga0157372_100861034 | 268 |
| 326 | 3300014325 | Ga0163163_10048230 | Ga0163163_100482302 | 268 |
| 327 | 3300014969 | Ga0157376_10218760 | Ga0157376_102187602 | 268 |
| 328 | 3300025901 | Ga0207688_10030797 | Ga0207688_100307973 | 268 |
| 329 | 3300025904 | Ga0207647_10211031 | Ga0207647_102110311 | 268 |
| 330 | 3300025911 | Ga0207654_10008665 | Ga0207654_100086653 | 268 |
| 331 | 3300025913 | Ga0207695_10019186 | Ga0207695_100191863 | 268 |
| 332 | 3300025931 | Ga0207644_10041067 | Ga0207644_100410673 | 268 |
| 333 | 3300025932 | Ga0207690_10122168 | Ga0207690_101221682 | 268 |
| 334 | 3300025942 | Ga0207689_10446716 | Ga0207689_104467161 | 268 |
| 335 | 3300025949 | Ga0207667_10165755 | Ga0207667_101657552 | 268 |
| 336 | 3300025960 | Ga0207651_10322340 | Ga0207651_103223402 | 268 |
| 337 | 3300026067 | Ga0207678_10065751 | Ga0207678_100657512 | 268 |
| 338 | 3300026088 | Ga0207641_10040916 | Ga0207641_100409164 | 268 |
| 339 | 3300026095 | Ga0207676_10034159 | Ga0207676_100341592 | 268 |
| 340 | 3300026116 | Ga0207674_10165583 | Ga0207674_101655833 | 268 |
| 341 | 3300026121 | Ga0207683_10145291 | Ga0207683_101452912 | 268 |
| 342 | 3300026142 | Ga0207698_10318380 | Ga0207698_103183801 | 268 |
| 343 | 3300027866 | Ga0209813_10003784 | Ga0209813_100037843 | 268 |
| 344 | 3300028379 | Ga0268266_10008946 | Ga0268266_100089468 | 268 |
| 345 | 3300028379 | Ga0268266_10014631 | Ga0268266_100146313 | 268 |
| 346 | 3300031731 | Ga0307405_10183430 | Ga0307405_101834302 | 268 |
| 347 | 3300037418 | Ga0395900_0048752 | Ga0395900_0048752_43_930 | 268 |
| 348 | 3300038443 | Ga0395901_0349449 | Ga0395901_0349449_111_998 | 268 |
| 349 | 3300042006 | Ga0439432_033545 | Ga0439432_033545_722_1609 | 268 |
| 350 | 3300046455 | Ga0495603_0031835 | Ga0495603_0031835_745_1632 | 268 |
| 351 | 3300048905 | Ga0496102_0690670 | Ga0496102_0690670_20_907 | 268 |
| 352 | 3300048906 | Ga0496103_0158337 | Ga0496103_0158337_67_954 | 268 |
| 353 | 3300048908 | Ga0496105_0078403 | Ga0496105_0078403_981_1868 | 268 |
| 354 | 3300048913 | Ga0496110_0173448 | Ga0496110_0173448_419_1306 | 268 |
| 355 | 3300048914 | Ga0496111_0124393 | Ga0496111_0124393_821_1708 | 268 |
| 356 | 3300048915 | Ga0496112_0045387 | Ga0496112_0045387_2360_3247 | 268 |
| 357 | 3300048917 | Ga0496114_0044714 | Ga0496114_0044714_622_1509 | 268 |
| 358 | 3300048918 | Ga0496115_0055924 | Ga0496115_0055924_822_1709 | 268 |
| 359 | 3300048924 | Ga0496121_0231063 | Ga0496121_0231063_14_901 | 268 |
| 360 | 3300048927 | Ga0496124_0161073 | Ga0496124_0161073_631_1518 | 268 |
| 361 | 3300048929 | Ga0496126_0006946 | Ga0496126_0006946_2460_3347 | 268 |
| 362 | 3300050492 | nmdc:mga0yw44_27309_c1 | nmdc:mga0yw44_27309_c1_1900_2787 | 268 |
| 363 | 3300050492 | nmdc:mga0yw44_42642_c1 | nmdc:mga0yw44_42642_c1_1622_2509 | 268 |
| 364 | 3300050495 | nmdc:mga04h51_4173_c1 | nmdc:mga04h51_4173_c1_227_1114 | 268 |
| 365 | 3300050496 | nmdc:mga07m45_3431_c1 | nmdc:mga07m45_3431_c1_199_1086 | 268 |
| 366 | 3300050496 | nmdc:mga07m45_45116_c1 | nmdc:mga07m45_45116_c1_716_1603 | 268 |
| 367 | 3300050515 | nmdc:mga0a205_180925_c1 | nmdc:mga0a205_180925_c1_14_901 | 268 |
| 368 | 3300053080 | Ga0500635_0000782 | Ga0500635_0000782_5620_6507 | 268 |
| 369 | 3300053093 | Ga0500651_0110382 | Ga0500651_0110382_733_1620 | 268 |
| 370 | 3300053119 | Ga0500595_004867 | Ga0500595_004867_4914_5801 | 268 |
| 371 | 3300053162 | Ga0500638_141260 | Ga0500638_141260_62_949 | 268 |
| 372 | 3300053178 | Ga0500637_0012501 | Ga0500637_0012501_3079_3966 | 268 |
| 373 | 3300005981 | Ga0081538_10110897 | Ga0081538_101108972 | 269 |
| 374 | 3300014968 | Ga0157379_10100460 | Ga0157379_101004602 | 269 |
| 375 | 3300025295 | Ga0209564_1017177 | Ga0209564_10171773 | 269 |
| 376 | 3300028379 | Ga0268266_10458810 | Ga0268266_104588102 | 269 |
| 377 | 3300031852 | Ga0307410_10253269 | Ga0307410_102532692 | 269 |
| 378 | 3300044656 | Ga0466969_0137691 | Ga0466969_0137691_47_934 | 269 |
| 379 | 3300045049 | Ga0466959_0009642 | Ga0466959_0009642_4030_4917 | 269 |
| 380 | 3300048925 | Ga0496122_0078385 | Ga0496122_0078385_1247_2119 | 269 |
| 381 | 3300048929 | Ga0496126_0014947 | Ga0496126_0014947_3488_4360 | 269 |
| 382 | 3300049587 | Ga0501071_0275525 | Ga0501071_0275525_41_928 | 269 |
| 383 | 3300005543 | Ga0070672_100170980 | Ga0070672_1001709802 | 270 |
| 384 | 3300026121 | Ga0207683_10018675 | Ga0207683_100186752 | 270 |
| 385 | 3300031548 | Ga0307408_100141225 | Ga0307408_1001412252 | 270 |
| 386 | 3300031911 | Ga0307412_10252472 | Ga0307412_102524722 | 270 |
| 387 | 3300036534 | Ga0310109_014758 | Ga0310109_014758_84_971 | 270 |
| 388 | 3300048929 | Ga0496126_0467612 | Ga0496126_0467612_35_907 | 270 |
| 389 | 3300049570 | Ga0501033_0012970 | Ga0501033_0012970_556_1443 | 270 |
| 390 | 3300049571 | Ga0501034_0052026 | Ga0501034_0052026_474_1361 | 270 |
| 391 | 3300049572 | Ga0501036_0000112 | Ga0501036_0000112_3019_3906 | 270 |
| 392 | 3300049573 | Ga0501037_0000406 | Ga0501037_0000406_8250_9137 | 270 |
| 393 | 3300049574 | Ga0501038_0010003 | Ga0501038_0010003_5434_6321 | 270 |
| 394 | 3300049575 | Ga0501039_0000097 | Ga0501039_0000097_59620_60507 | 270 |
| 395 | 3300049578 | Ga0501042_0074035 | Ga0501042_0074035_25_912 | 270 |
| 396 | 3300049579 | Ga0501043_0014172 | Ga0501043_0014172_2987_3874 | 270 |
| 397 | 3300049580 | Ga0501046_0001554 | Ga0501046_0001554_8018_8905 | 270 |
| 398 | 3300049581 | Ga0501047_0006122 | Ga0501047_0006122_3019_3906 | 270 |
| 399 | 3300049584 | Ga0501068_0003479 | Ga0501068_0003479_1724_2611 | 270 |
| 400 | 3300049585 | Ga0501069_0010536 | Ga0501069_0010536_1856_2743 | 270 |
| 401 | 3300049586 | Ga0501070_0001063 | Ga0501070_0001063_3146_4033 | 270 |
| 402 | 3300049589 | Ga0501073_0151518 | Ga0501073_0151518_555_1442 | 270 |
| 403 | 3300049741 | Ga0501079_0134260 | Ga0501079_0134260_533_1420 | 270 |
| 404 | 3300049742 | Ga0501080_0000143 | Ga0501080_0000143_47522_48409 | 270 |
| 405 | 3300049822 | Ga0501035_0000250 | Ga0501035_0000250_58969_59856 | 270 |
| 406 | 3300049823 | Ga0501044_0125764 | Ga0501044_0125764_1119_2006 | 270 |
| 407 | 3300050493 | nmdc:mga0k408_261600_c1 | nmdc:mga0k408_261600_c1_126_1013 | 270 |
| 408 | 3300005456 | Ga0070678_100169920 | Ga0070678_1001699202 | 271 |
| 409 | 3300005843 | Ga0068860_100000316 | Ga0068860_10000031635 | 271 |
| 410 | 3300009101 | Ga0105247_10041793 | Ga0105247_100417932 | 271 |
| 411 | 3300014325 | Ga0163163_10382651 | Ga0163163_103826512 | 271 |
| 412 | 3300014326 | Ga0157380_10152136 | Ga0157380_101521361 | 271 |
| 413 | 3300014969 | Ga0157376_10055961 | Ga0157376_100559612 | 271 |
| 414 | 3300025297 | Ga0209758_1003772 | Ga0209758_10037728 | 271 |
| 415 | 3300025900 | Ga0207710_10010831 | Ga0207710_100108312 | 271 |
| 416 | 3300025906 | Ga0207699_10196897 | Ga0207699_101968971 | 271 |
| 417 | 3300025929 | Ga0207664_10360527 | Ga0207664_103605272 | 271 |
| 418 | 3300025932 | Ga0207690_10218022 | Ga0207690_102180222 | 271 |
| 419 | 3300025937 | Ga0207669_10149850 | Ga0207669_101498502 | 271 |
| 420 | 3300025938 | Ga0207704_10245142 | Ga0207704_102451421 | 271 |
| 421 | 3300026121 | Ga0207683_10176699 | Ga0207683_101766992 | 271 |
| 422 | 3300028381 | Ga0268264_10000430 | Ga0268264_1000043035 | 271 |
| 423 | 3300028786 | Ga0307517_10000772 | Ga0307517_100007726 | 271 |
| 424 | 3300031507 | Ga0307509_10080753 | Ga0307509_100807532 | 271 |
| 425 | 3300036459 | Ga0372808_002089 | Ga0372808_002089_343_1230 | 271 |
| 426 | 3300037471 | Ga0395905_0564628 | Ga0395905_0564628_37_909 | 271 |
| 427 | 3300046615 | Ga0495656_0134415 | Ga0495656_0134415_41_928 | 271 |
| 428 | 3300049579 | Ga0501043_0044795 | Ga0501043_0044795_29_844 | 271 |
| 429 | 3300005983 | Ga0081540_1010410 | Ga0081540_10104102 | 272 |
| 430 | 3300010159 | Ga0099796_10004964 | Ga0099796_100049642 | 272 |
| 431 | 3300027512 | Ga0209179_1005890 | Ga0209179_10058902 | 272 |
| 432 | 3300046794 | Ga0495589_0043465 | Ga0495589_0043465_10_882 | 272 |
| 433 | 3300053094 | Ga0500566_0000026 | Ga0500566_0000026_66524_67411 | 272 |
| 434 | 3300053095 | Ga0500640_011912 | Ga0500640_011912_2497_3384 | 272 |
| 435 | 3300053111 | Ga0500572_002560 | Ga0500572_002560_2113_3000 | 272 |
| 436 | 3300053115 | Ga0500591_080606 | Ga0500591_080606_76_963 | 272 |
| 437 | 3300053123 | Ga0500614_000135 | Ga0500614_000135_6218_7105 | 272 |
| 438 | 3300053136 | Ga0500559_0004957 | Ga0500559_0004957_3144_4031 | 272 |
| 439 | 3300053148 | Ga0500590_123554 | Ga0500590_123554_227_1114 | 272 |
| 440 | 3300053150 | Ga0500603_001715 | Ga0500603_001715_2455_3342 | 272 |
| 441 | 3300053159 | Ga0500630_000207 | Ga0500630_000207_20148_21035 | 272 |
| 442 | 3300053162 | Ga0500638_119689 | Ga0500638_119689_227_1114 | 272 |
| 443 | 3300053163 | Ga0500639_000939 | Ga0500639_000939_5116_6003 | 272 |
| 444 | 3300053735 | Ga0500596_000101 | Ga0500596_000101_10508_11395 | 272 |
| 445 | 3300009094 | Ga0111539_10394785 | Ga0111539_103947852 | 273 |
| 446 | 3300025925 | Ga0207650_10183898 | Ga0207650_101838982 | 273 |
| 447 | 3300026121 | Ga0207683_10146025 | Ga0207683_101460253 | 273 |
| 448 | 3300027907 | Ga0207428_10072008 | Ga0207428_100720083 | 273 |
| 449 | 3300035086 | Ga0373934_0029660 | Ga0373934_0029660_276_1163 | 273 |
| 450 | 3300035111 | Ga0373923_0011853 | Ga0373923_0011853_203_1090 | 273 |
| 451 | 3300035117 | Ga0373953_0001976 | Ga0373953_0001976_3986_4873 | 273 |
| 452 | 3300035118 | Ga0373954_0000070 | Ga0373954_0000070_9304_10191 | 273 |
| 453 | 3300035119 | Ga0373956_0001764 | Ga0373956_0001764_5526_6413 | 273 |
| 454 | 3300035172 | Ga0373955_0000771 | Ga0373955_0000771_3890_4777 | 273 |
| 455 | 3300046462 | Ga0495651_0022001 | Ga0495651_0022001_204_1091 | 273 |
| 456 | 3300046463 | Ga0495653_0003677 | Ga0495653_0003677_10920_11807 | 273 |
| 457 | 3300046477 | Ga0495664_0006016 | Ga0495664_0006016_641_1528 | 273 |
| 458 | 3300046514 | Ga0495618_0009298 | Ga0495618_0009298_1900_2787 | 273 |
| 459 | 3300046516 | Ga0495628_0002643 | Ga0495628_0002643_5645_6532 | 273 |
| 460 | 3300046529 | Ga0495652_0000858 | Ga0495652_0000858_31455_32342 | 273 |
| 461 | 3300046533 | Ga0495640_0018432 | Ga0495640_0018432_2759_3646 | 273 |
| 462 | 3300046543 | Ga0495645_0003263 | Ga0495645_0003263_821_1708 | 273 |
| 463 | 3300046543 | Ga0495645_0058213 | Ga0495645_0058213_740_1627 | 273 |
| 464 | 3300046642 | Ga0495634_0007605 | Ga0495634_0007605_4883_5770 | 273 |
| 465 | 3300046663 | Ga0495635_0000644 | Ga0495635_0000644_19505_20392 | 273 |
| 466 | 3300046675 | Ga0495657_0001016 | Ga0495657_0001016_21013_21900 | 273 |
| 467 | 3300046678 | Ga0495599_0000637 | Ga0495599_0000637_582_1469 | 273 |
| 468 | 3300046678 | Ga0495599_0018824 | Ga0495599_0018824_515_1402 | 273 |
| 469 | 3300046679 | Ga0495623_0003015 | Ga0495623_0003015_5997_6884 | 273 |
| 470 | 3300046680 | Ga0495646_0001926 | Ga0495646_0001926_5395_6282 | 273 |
| 471 | 3300046689 | Ga0495613_0028892 | Ga0495613_0028892_96_983 | 273 |
| 472 | 3300047319 | Ga0495674_0108330 | Ga0495674_0108330_450_1337 | 273 |
| 473 | 3300047322 | Ga0495680_0004188 | Ga0495680_0004188_8972_9859 | 273 |
| 474 | 3300047471 | Ga0495684_0000380 | Ga0495684_0000380_19159_20046 | 273 |
| 475 | 3300047673 | Ga0495593_0001866 | Ga0495593_0001866_3898_4785 | 273 |
| 476 | 3300048088 | Ga0495602_0042204 | Ga0495602_0042204_557_1444 | 273 |
| 477 | 3300049744 | Ga0501083_0141601 | Ga0501083_0141601_50_937 | 273 |
| 478 | 3300050511 | nmdc:mga08y16_125241_c1 | nmdc:mga08y16_125241_c1_180_1067 | 273 |
| 479 | 3300053077 | Ga0495601_0025742 | Ga0495601_0025742_2487_3374 | 273 |
| 480 | 3300053077 | Ga0495601_0051392 | Ga0495601_0051392_269_1156 | 273 |
| 481 | 3300053084 | Ga0495595_0002657 | Ga0495595_0002657_3152_4039 | 273 |
| 482 | 3300053085 | Ga0495619_0000355 | Ga0495619_0000355_15758_16645 | 273 |
| 483 | 3300053094 | Ga0500566_0050239 | Ga0500566_0050239_1289_2176 | 273 |
| 484 | 3300053102 | Ga0500554_015264 | Ga0500554_015264_520_1407 | 273 |
| 485 | 3300053119 | Ga0500595_002514 | Ga0500595_002514_1329_2216 | 273 |
| 486 | 3300053130 | Ga0500642_0000037 | Ga0500642_0000037_45879_46766 | 273 |
| 487 | 3300053136 | Ga0500559_0169954 | Ga0500559_0169954_90_977 | 273 |
| 488 | 3300053178 | Ga0500637_0000122 | Ga0500637_0000122_9011_9898 | 273 |
| 489 | 3300053178 | Ga0500637_0013976 | Ga0500637_0013976_2871_3758 | 273 |
| 490 | 3300055283 | Ga0500661_000317 | Ga0500661_000317_4442_5329 | 273 |
| 491 | 3300031616 | Ga0307508_10000009 | Ga0307508_10000009120 | 274 |
| 492 | 3300035692 | Ga0373935_0043241 | Ga0373935_0043241_1249_2136 | 274 |
| 493 | 3300048907 | Ga0496104_0076610 | Ga0496104_0076610_1828_2715 | 274 |
| 494 | 3300048908 | Ga0496105_0343412 | Ga0496105_0343412_253_1140 | 274 |
| 495 | 3300048911 | Ga0496108_0057488 | Ga0496108_0057488_1377_2264 | 274 |
| 496 | 3300048912 | Ga0496109_0245261 | Ga0496109_0245261_165_1052 | 274 |
| 497 | 3300048913 | Ga0496110_0019362 | Ga0496110_0019362_4418_5305 | 274 |
| 498 | 3300048914 | Ga0496111_0031722 | Ga0496111_0031722_1145_2032 | 274 |
| 499 | 3300048915 | Ga0496112_0105162 | Ga0496112_0105162_508_1395 | 274 |
| 500 | 3300048916 | Ga0496113_0154479 | Ga0496113_0154479_174_1061 | 274 |
| 501 | 3300005337 | Ga0070682_100116438 | Ga0070682_1001164382 | 275 |
| 502 | 3300005338 | Ga0068868_100043717 | Ga0068868_1000437174 | 275 |
| 503 | 3300005344 | Ga0070661_100131994 | Ga0070661_1001319942 | 275 |
| 504 | 3300005455 | Ga0070663_100004362 | Ga0070663_1000043622 | 275 |
| 505 | 3300005456 | Ga0070678_100024234 | Ga0070678_1000242343 | 275 |
| 506 | 3300005548 | Ga0070665_100092227 | Ga0070665_1000922273 | 275 |
| 507 | 3300005564 | Ga0070664_100055529 | Ga0070664_1000555292 | 275 |
| 508 | 3300005578 | Ga0068854_100208609 | Ga0068854_1002086092 | 275 |
| 509 | 3300005618 | Ga0068864_100027748 | Ga0068864_1000277485 | 275 |
| 510 | 3300005834 | Ga0068851_10064950 | Ga0068851_100649502 | 275 |
| 511 | 3300005841 | Ga0068863_100141926 | Ga0068863_1001419262 | 275 |
| 512 | 3300009098 | Ga0105245_10109432 | Ga0105245_101094322 | 275 |
| 513 | 3300009176 | Ga0105242_10457612 | Ga0105242_104576122 | 275 |
| 514 | 3300013306 | Ga0163162_10037734 | Ga0163162_100377343 | 275 |
| 515 | 3300014325 | Ga0163163_10006000 | Ga0163163_100060005 | 275 |
| 516 | 3300014968 | Ga0157379_10124348 | Ga0157379_101243482 | 275 |
| 517 | 3300014969 | Ga0157376_10046977 | Ga0157376_100469774 | 275 |
| 518 | 3300021377 | Ga0213874_10012710 | Ga0213874_100127102 | 275 |
| 519 | 3300021384 | Ga0213876_10040414 | Ga0213876_100404142 | 275 |
| 520 | 3300025920 | Ga0207649_10104861 | Ga0207649_101048613 | 275 |
| 521 | 3300025940 | Ga0207691_10519729 | Ga0207691_105197291 | 275 |
| 522 | 3300025944 | Ga0207661_10466767 | Ga0207661_104667672 | 275 |
| 523 | 3300025981 | Ga0207640_10296866 | Ga0207640_102968661 | 275 |
| 524 | 3300026067 | Ga0207678_10015103 | Ga0207678_100151036 | 275 |
| 525 | 3300026095 | Ga0207676_10018918 | Ga0207676_100189185 | 275 |
| 526 | 3300028379 | Ga0268266_10104493 | Ga0268266_101044932 | 275 |
| 527 | 3300031238 | Ga0265332_10079482 | Ga0265332_100794822 | 275 |
| 528 | 3300039437 | Ga0436365_0028265 | Ga0436365_0028265_2715_3602 | 275 |
| 529 | 3300039450 | Ga0436363_0776803 | Ga0436363_0776803_259_1146 | 275 |
| 530 | 3300046511 | Ga0495608_0045497 | Ga0495608_0045497_1609_2481 | 275 |
| 531 | 3300048904 | Ga0496101_0093294 | Ga0496101_0093294_15_902 | 275 |
| 532 | 3300048906 | Ga0496103_0002281 | Ga0496103_0002281_6584_7471 | 275 |
| 533 | 3300048908 | Ga0496105_0087186 | Ga0496105_0087186_300_1268 | 275 |
| 534 | 3300048910 | Ga0496107_0065443 | Ga0496107_0065443_268_1155 | 275 |
| 535 | 3300048913 | Ga0496110_0029779 | Ga0496110_0029779_3313_4200 | 275 |
| 536 | 3300048915 | Ga0496112_0331897 | Ga0496112_0331897_564_1451 | 275 |
| 537 | 3300048917 | Ga0496114_0056373 | Ga0496114_0056373_2265_3233 | 275 |
| 538 | 3300048918 | Ga0496115_0001490 | Ga0496115_0001490_12571_13458 | 275 |
| 539 | 3300049569 | Ga0501032_0000129 | Ga0501032_0000129_5649_6536 | 275 |
| 540 | 3300049570 | Ga0501033_0000983 | Ga0501033_0000983_24247_25134 | 275 |
| 541 | 3300049571 | Ga0501034_0001074 | Ga0501034_0001074_1328_2215 | 275 |
| 542 | 3300049572 | Ga0501036_0000232 | Ga0501036_0000232_34260_35147 | 275 |
| 543 | 3300049573 | Ga0501037_0000106 | Ga0501037_0000106_22308_23195 | 275 |
| 544 | 3300049574 | Ga0501038_0000108 | Ga0501038_0000108_36828_37715 | 275 |
| 545 | 3300049575 | Ga0501039_0000460 | Ga0501039_0000460_14615_15502 | 275 |
| 546 | 3300049578 | Ga0501042_0038574 | Ga0501042_0038574_77_964 | 275 |
| 547 | 3300049579 | Ga0501043_0000035 | Ga0501043_0000035_92522_93409 | 275 |
| 548 | 3300049580 | Ga0501046_0000944 | Ga0501046_0000944_24769_25656 | 275 |
| 549 | 3300049581 | Ga0501047_0000792 | Ga0501047_0000792_18938_19825 | 275 |
| 550 | 3300049582 | Ga0501048_0000116 | Ga0501048_0000116_12988_13875 | 275 |
| 551 | 3300049583 | Ga0501067_0001402 | Ga0501067_0001402_6178_7065 | 275 |
| 552 | 3300049584 | Ga0501068_0000014 | Ga0501068_0000014_49556_50443 | 275 |
| 553 | 3300049585 | Ga0501069_0168111 | Ga0501069_0168111_40_927 | 275 |
| 554 | 3300049586 | Ga0501070_0009144 | Ga0501070_0009144_1200_2087 | 275 |
| 555 | 3300049587 | Ga0501071_0046687 | Ga0501071_0046687_1143_2030 | 275 |
| 556 | 3300049588 | Ga0501072_0000367 | Ga0501072_0000367_14053_14940 | 275 |
| 557 | 3300049589 | Ga0501073_0000368 | Ga0501073_0000368_13612_14499 | 275 |
| 558 | 3300049590 | Ga0501074_0001037 | Ga0501074_0001037_2466_3353 | 275 |
| 559 | 3300049741 | Ga0501079_0011719 | Ga0501079_0011719_648_1535 | 275 |
| 560 | 3300049742 | Ga0501080_0000332 | Ga0501080_0000332_23075_23962 | 275 |
| 561 | 3300049822 | Ga0501035_0000632 | Ga0501035_0000632_1725_2612 | 275 |
| 562 | 3300049823 | Ga0501044_0000051 | Ga0501044_0000051_86406_87293 | 275 |
| 563 | 3300049824 | Ga0501045_0002440 | Ga0501045_0002440_11185_12072 | 275 |
| 564 | 3300054114 | Ga0501084_0000773 | Ga0501084_0000773_14357_15244 | 275 |
| 565 | 3300060353 | Ga0501082_0000396 | Ga0501082_0000396_37235_38122 | 275 |
| 566 | 3300005327 | Ga0070658_10062966 | Ga0070658_100629663 | 276 |
| 567 | 3300005455 | Ga0070663_100052418 | Ga0070663_1000524182 | 276 |
| 568 | 3300005618 | Ga0068864_100135901 | Ga0068864_1001359012 | 276 |
| 569 | 3300005937 | Ga0081455_10003832 | Ga0081455_1000383211 | 276 |
| 570 | 3300005983 | Ga0081540_1010937 | Ga0081540_10109373 | 276 |
| 571 | 3300025297 | Ga0209758_1017949 | Ga0209758_10179492 | 276 |
| 572 | 3300031548 | Ga0307408_100101901 | Ga0307408_1001019013 | 276 |
| 573 | 3300035724 | Ga0373933_0000041 | Ga0373933_0000041_70576_71463 | 276 |
| 574 | 3300041413 | Ga0439465_0079979 | Ga0439465_0079979_150_1037 | 276 |
| 575 | 3300044684 | Ga0466966_0146856 | Ga0466966_0146856_389_1276 | 276 |
| 576 | 3300053158 | Ga0500627_0039582 | Ga0500627_0039582_340_1227 | 276 |
| 577 | 3300005262 | Ga0065165_1001750 | Ga0065165_100175020 | 277 |
| 578 | 3300005548 | Ga0070665_100184796 | Ga0070665_1001847961 | 277 |
| 579 | 3300009551 | Ga0105238_10294232 | Ga0105238_102942322 | 277 |
| 580 | 3300025941 | Ga0207711_10123431 | Ga0207711_101234313 | 277 |
| 581 | 3300031242 | Ga0265329_10055044 | Ga0265329_100550442 | 277 |
| 582 | 3300031730 | Ga0307516_10125734 | Ga0307516_101257341 | 277 |
| 583 | 3300035695 | Ga0373927_0009182 | Ga0373927_0009182_5560_6447 | 277 |
| 584 | 3300035725 | Ga0373947_0178507 | Ga0373947_0178507_421_1308 | 277 |
| 585 | 3300045976 | Ga0466967_0308244 | Ga0466967_0308244_50_937 | 277 |
| 586 | 3300046453 | Ga0495627_038315 | Ga0495627_038315_163_1050 | 277 |
| 587 | 3300046455 | Ga0495603_0096848 | Ga0495603_0096848_679_1566 | 277 |
| 588 | 3300046475 | Ga0495639_0099122 | Ga0495639_0099122_13_900 | 277 |
| 589 | 3300046491 | Ga0495584_0045246 | Ga0495584_0045246_590_1477 | 277 |
| 590 | 3300046512 | Ga0495610_0030503 | Ga0495610_0030503_1033_1920 | 277 |
| 591 | 3300046518 | Ga0495631_0095952 | Ga0495631_0095952_195_1082 | 277 |
| 592 | 3300046557 | Ga0495622_0039894 | Ga0495622_0039894_44_931 | 277 |
| 593 | 3300046615 | Ga0495656_0021511 | Ga0495656_0021511_1349_2236 | 277 |
| 594 | 3300046660 | Ga0495625_0295820 | Ga0495625_0295820_19_906 | 277 |
| 595 | 3300046664 | Ga0495659_0015681 | Ga0495659_0015681_907_1794 | 277 |
| 596 | 3300046674 | Ga0495588_0028025 | Ga0495588_0028025_1359_2246 | 277 |
| 597 | 3300046694 | Ga0495649_0117823 | Ga0495649_0117823_97_984 | 277 |
| 598 | 3300047318 | Ga0495636_0027918 | Ga0495636_0027918_1046_1933 | 277 |
| 599 | 3300047321 | Ga0495676_0069382 | Ga0495676_0069382_1073_1960 | 277 |
| 600 | 3300048927 | Ga0496124_0101433 | Ga0496124_0101433_117_1004 | 277 |
| 601 | 3300049460 | Ga0495682_0045604 | Ga0495682_0045604_486_1373 | 277 |
| 602 | 3300053119 | Ga0500595_003082 | Ga0500595_003082_2526_3413 | 277 |
| 603 | 3300005983 | Ga0081540_1000913 | Ga0081540_100091329 | 278 |
| 604 | 3300025297 | Ga0209758_1005082 | Ga0209758_10050826 | 278 |
| 605 | 3300032126 | Ga0307415_100318737 | Ga0307415_1003187372 | 278 |
| 606 | 3300045976 | Ga0466967_0210837 | Ga0466967_0210837_374_1261 | 278 |
| 607 | 3300006186 | Ga0075369_10082956 | Ga0075369_100829562 | 279 |
| 608 | 3300037853 | Ga0436364_1178281 | Ga0436364_1178281_2267_3154 | 279 |
| 609 | 3300041452 | Ga0451793_0284192 | Ga0451793_0284192_131_1018 | 279 |
| 610 | 3300041460 | Ga0451802_1938471 | Ga0451802_1938471_100_987 | 279 |
| 611 | 3300046455 | Ga0495603_0060342 | Ga0495603_0060342_1159_2046 | 279 |
| 612 | 3300046794 | Ga0495589_0079223 | Ga0495589_0079223_675_1562 | 279 |
| 613 | 3300047472 | Ga0495686_0112569 | Ga0495686_0112569_607_1494 | 279 |
| 614 | 3300050492 | nmdc:mga0yw44_104794_c1 | nmdc:mga0yw44_104794_c1_175_1062 | 279 |
| 615 | 3300053105 | Ga0500557_000015 | Ga0500557_000015_104008_104895 | 279 |
| 616 | 3300006173 | Ga0070716_100035837 | Ga0070716_1000358372 | 280 |
| 617 | 3300007265 | Ga0099794_10062743 | Ga0099794_100627432 | 280 |
| 618 | 3300009098 | Ga0105245_10248483 | Ga0105245_102484832 | 280 |
| 619 | 3300010159 | Ga0099796_10003434 | Ga0099796_100034342 | 280 |
| 620 | 3300010375 | Ga0105239_10059881 | Ga0105239_100598814 | 280 |
| 621 | 3300025915 | Ga0207693_10085133 | Ga0207693_100851333 | 280 |
| 622 | 3300025921 | Ga0207652_10059661 | Ga0207652_100596612 | 280 |
| 623 | 3300025928 | Ga0207700_10293584 | Ga0207700_102935842 | 280 |
| 624 | 3300026075 | Ga0207708_10118703 | Ga0207708_101187032 | 280 |
| 625 | 3300027671 | Ga0209588_1062838 | Ga0209588_10628382 | 280 |
| 626 | 3300037068 | Ga0373925_0123554 | Ga0373925_0123554_648_1535 | 280 |
| 627 | 3300041512 | Ga0451853_1007175 | Ga0451853_1007175_100_987 | 280 |
| 628 | 3300046459 | Ga0495629_0006304 | Ga0495629_0006304_7454_8341 | 280 |
| 629 | 3300046506 | Ga0495583_0015129 | Ga0495583_0015129_3220_4107 | 280 |
| 630 | 3300046516 | Ga0495628_0062313 | Ga0495628_0062313_27_914 | 280 |
| 631 | 3300046529 | Ga0495652_0033362 | Ga0495652_0033362_1752_2639 | 280 |
| 632 | 3300046529 | Ga0495652_0113666 | Ga0495652_0113666_1273_2160 | 280 |
| 633 | 3300046533 | Ga0495640_0214689 | Ga0495640_0214689_24_911 | 280 |
| 634 | 3300046536 | Ga0495587_0060580 | Ga0495587_0060580_668_1555 | 280 |
| 635 | 3300046543 | Ga0495645_0016949 | Ga0495645_0016949_3907_4794 | 280 |
| 636 | 3300046663 | Ga0495635_0004483 | Ga0495635_0004483_661_1548 | 280 |
| 637 | 3300046663 | Ga0495635_0025471 | Ga0495635_0025471_1751_2638 | 280 |
| 638 | 3300046675 | Ga0495657_0171586 | Ga0495657_0171586_211_1098 | 280 |
| 639 | 3300046678 | Ga0495599_0060991 | Ga0495599_0060991_1448_2335 | 280 |
| 640 | 3300046679 | Ga0495623_0005023 | Ga0495623_0005023_3459_4346 | 280 |
| 641 | 3300046680 | Ga0495646_0033462 | Ga0495646_0033462_1398_2285 | 280 |
| 642 | 3300046690 | Ga0495624_0125215 | Ga0495624_0125215_371_1258 | 280 |
| 643 | 3300046809 | Ga0495600_0013271 | Ga0495600_0013271_2411_3298 | 280 |
| 644 | 3300046809 | Ga0495600_0062033 | Ga0495600_0062033_550_1437 | 280 |
| 645 | 3300047317 | Ga0495604_0013258 | Ga0495604_0013258_4541_5428 | 280 |
| 646 | 3300047317 | Ga0495604_0034842 | Ga0495604_0034842_183_1070 | 280 |
| 647 | 3300047319 | Ga0495674_0011842 | Ga0495674_0011842_4386_5273 | 280 |
| 648 | 3300047322 | Ga0495680_0015409 | Ga0495680_0015409_2569_3456 | 280 |
| 649 | 3300047673 | Ga0495593_0079361 | Ga0495593_0079361_477_1364 | 280 |
| 650 | 3300048907 | Ga0496104_0004213 | Ga0496104_0004213_2208_3095 | 280 |
| 651 | 3300048908 | Ga0496105_0034896 | Ga0496105_0034896_72_959 | 280 |
| 652 | 3300048918 | Ga0496115_0193300 | Ga0496115_0193300_139_1026 | 280 |
| 653 | 3300048921 | Ga0496118_0177629 | Ga0496118_0177629_198_1085 | 280 |
| 654 | 3300048922 | Ga0496119_0013974 | Ga0496119_0013974_4364_5251 | 280 |
| 655 | 3300048923 | Ga0496120_0016201 | Ga0496120_0016201_942_1829 | 280 |
| 656 | 3300048924 | Ga0496121_0063766 | Ga0496121_0063766_492_1379 | 280 |
| 657 | 3300048925 | Ga0496122_0079417 | Ga0496122_0079417_899_1786 | 280 |
| 658 | 3300048928 | Ga0496125_0099660 | Ga0496125_0099660_1222_2109 | 280 |
| 659 | 3300048929 | Ga0496126_0033274 | Ga0496126_0033274_533_1420 | 280 |
| 660 | 3300053083 | Ga0495655_0001518 | Ga0495655_0001518_451_1338 | 280 |
| 661 | 3300053111 | Ga0500572_000565 | Ga0500572_000565_10875_11762 | 280 |
| 662 | 3300053136 | Ga0500559_0000081 | Ga0500559_0000081_20150_21037 | 280 |
| 663 | 3300053163 | Ga0500639_048783 | Ga0500639_048783_546_1433 | 280 |
| 664 | 3300053725 | Ga0500576_015404 | Ga0500576_015404_1732_2619 | 280 |
| 665 | 3300053729 | Ga0500625_003216 | Ga0500625_003216_4282_5169 | 280 |
| 666 | 3300053735 | Ga0500596_000408 | Ga0500596_000408_858_1745 | 280 |
| 667 | 3300005434 | Ga0070709_10249165 | Ga0070709_102491651 | 281 |
| 668 | 3300005435 | Ga0070714_100299368 | Ga0070714_1002993682 | 281 |
| 669 | 3300006048 | Ga0075363_100032594 | Ga0075363_1000325942 | 281 |
| 670 | 3300006178 | Ga0075367_10123296 | Ga0075367_101232962 | 281 |
| 671 | 3300025906 | Ga0207699_10185649 | Ga0207699_101856492 | 281 |
| 672 | 3300046452 | Ga0495617_035725 | Ga0495617_035725_475_1362 | 281 |
| 673 | 3300046664 | Ga0495659_0023103 | Ga0495659_0023103_361_1248 | 281 |
| 674 | 3300046684 | Ga0495669_0185275 | Ga0495669_0185275_93_980 | 281 |
| 675 | 3300048921 | Ga0496118_0075907 | Ga0496118_0075907_91_978 | 281 |
| 676 | 3300048924 | Ga0496121_0000937 | Ga0496121_0000937_20784_21671 | 281 |
| 677 | 3300049460 | Ga0495682_0071953 | Ga0495682_0071953_201_1088 | 281 |
| 678 | 3300050490 | nmdc:mga03n38_8163_c1 | nmdc:mga03n38_8163_c1_415_1302 | 281 |
| 679 | 3300050494 | nmdc:mga06z11_9916_c1 | nmdc:mga06z11_9916_c1_369_1256 | 281 |
| 680 | 3300053103 | Ga0500555_004038 | Ga0500555_004038_1655_2542 | 281 |
| 681 | 3300053119 | Ga0500595_056519 | Ga0500595_056519_192_1079 | 281 |
| 682 | 3300053133 | Ga0500655_011412 | Ga0500655_011412_197_1084 | 281 |
| 683 | 3300005329 | Ga0070683_100370811 | Ga0070683_1003708112 | 282 |
| 684 | 3300005577 | Ga0068857_100068632 | Ga0068857_1000686322 | 282 |
| 685 | 3300005614 | Ga0068856_100434550 | Ga0068856_1004345502 | 282 |
| 686 | 3300006175 | Ga0070712_100034527 | Ga0070712_1000345272 | 282 |
| 687 | 3300006186 | Ga0075369_10023292 | Ga0075369_100232922 | 282 |
| 688 | 3300006186 | Ga0075369_10053654 | Ga0075369_100536542 | 282 |
| 689 | 3300006353 | Ga0075370_10087001 | Ga0075370_100870012 | 282 |
| 690 | 3300009148 | Ga0105243_10353430 | Ga0105243_103534302 | 282 |
| 691 | 3300009545 | Ga0105237_10395226 | Ga0105237_103952261 | 282 |
| 692 | 3300009551 | Ga0105238_10112321 | Ga0105238_101123212 | 282 |
| 693 | 3300013105 | Ga0157369_10173167 | Ga0157369_101731672 | 282 |
| 694 | 3300014325 | Ga0163163_10246170 | Ga0163163_102461702 | 282 |
| 695 | 3300025915 | Ga0207693_10039343 | Ga0207693_100393433 | 282 |
| 696 | 3300026078 | Ga0207702_10413493 | Ga0207702_104134932 | 282 |
| 697 | 3300026116 | Ga0207674_10021165 | Ga0207674_100211652 | 282 |
| 698 | 3300037471 | Ga0395905_0003894 | Ga0395905_0003894_229_1116 | 282 |
| 699 | 3300039437 | Ga0436365_1664592 | Ga0436365_1664592_631_1503 | 282 |
| 700 | 3300041498 | Ga0451841_0283415 | Ga0451841_0283415_46_933 | 282 |
| 701 | 3300044694 | Ga0466963_0004339 | Ga0466963_0004339_970_1857 | 282 |
| 702 | 3300044706 | Ga0466964_0010990 | Ga0466964_0010990_1493_2380 | 282 |
| 703 | 3300044842 | Ga0466957_0363188 | Ga0466957_0363188_79_966 | 282 |
| 704 | 3300048928 | Ga0496125_0094080 | Ga0496125_0094080_998_1885 | 282 |
| 705 | 3300050491 | nmdc:mga00v17_143039_c1 | nmdc:mga00v17_143039_c1_356_1243 | 282 |
| 706 | 3300050496 | nmdc:mga07m45_99442_c1 | nmdc:mga07m45_99442_c1_472_1359 | 282 |
| 707 | 3300050516 | nmdc:mga0sz30_24232_c1 | nmdc:mga0sz30_24232_c1_1180_2067 | 282 |
| 708 | 3300053093 | Ga0500651_0008492 | Ga0500651_0008492_1023_1910 | 282 |
| 709 | 3300053118 | Ga0500594_0001178 | Ga0500594_0001178_1273_2160 | 282 |
| 710 | 3300053156 | Ga0500622_0101586 | Ga0500622_0101586_164_1051 | 282 |
| 711 | 3300002067 | JGI24735J21928_10025237 | JGI24735J21928_100252372 | 283 |
| 712 | 3300005262 | Ga0065165_1008548 | Ga0065165_10085483 | 283 |
| 713 | 3300005457 | Ga0070662_100103498 | Ga0070662_1001034981 | 283 |
| 714 | 3300005539 | Ga0068853_100031569 | Ga0068853_1000315691 | 283 |
| 715 | 3300005563 | Ga0068855_100028482 | Ga0068855_1000284822 | 283 |
| 716 | 3300005577 | Ga0068857_100022108 | Ga0068857_1000221087 | 283 |
| 717 | 3300005578 | Ga0068854_100028453 | Ga0068854_1000284532 | 283 |
| 718 | 3300005578 | Ga0068854_100054844 | Ga0068854_1000548442 | 283 |
| 719 | 3300005614 | Ga0068856_100071140 | Ga0068856_1000711402 | 283 |
| 720 | 3300005616 | Ga0068852_100006605 | Ga0068852_1000066052 | 283 |
| 721 | 3300009093 | Ga0105240_10012605 | Ga0105240_100126058 | 283 |
| 722 | 3300009545 | Ga0105237_10159612 | Ga0105237_101596122 | 283 |
| 723 | 3300009551 | Ga0105238_10112048 | Ga0105238_101120482 | 283 |
| 724 | 3300010375 | Ga0105239_10002676 | Ga0105239_100026764 | 283 |
| 725 | 3300014969 | Ga0157376_10532900 | Ga0157376_105329002 | 283 |
| 726 | 3300025904 | Ga0207647_10040791 | Ga0207647_100407912 | 283 |
| 727 | 3300025911 | Ga0207654_10075082 | Ga0207654_100750822 | 283 |
| 728 | 3300025913 | Ga0207695_10001812 | Ga0207695_1000181224 | 283 |
| 729 | 3300025913 | Ga0207695_10015101 | Ga0207695_100151016 | 283 |
| 730 | 3300025914 | Ga0207671_10008038 | Ga0207671_100080389 | 283 |
| 731 | 3300025949 | Ga0207667_10021446 | Ga0207667_100214462 | 283 |
| 732 | 3300025981 | Ga0207640_10161197 | Ga0207640_101611971 | 283 |
| 733 | 3300026078 | Ga0207702_10009353 | Ga0207702_100093536 | 283 |
| 734 | 3300026116 | Ga0207674_10009623 | Ga0207674_100096237 | 283 |
| 735 | 3300037068 | Ga0373925_0008222 | Ga0373925_0008222_773_1681 | 283 |
| 736 | 3300053096 | Ga0500641_0008858 | Ga0500641_0008858_1293_2180 | 283 |
| 737 | 3300053126 | Ga0500621_028739 | Ga0500621_028739_303_1190 | 283 |
| 738 | 3300031616 | Ga0307508_10016890 | Ga0307508_100168904 | 284 |
| 739 | 3300037418 | Ga0395900_0145687 | Ga0395900_0145687_1540_2412 | 284 |
| 740 | 3300003203 | JGI25406J46586_10003672 | JGI25406J46586_100036725 | 286 |
| 741 | 3300005985 | Ga0081539_10001242 | Ga0081539_1000124216 | 286 |
| 742 | 3300025939 | Ga0207665_10166733 | Ga0207665_101667332 | 286 |
| 743 | 3300048920 | Ga0496117_0136959 | Ga0496117_0136959_129_1016 | 286 |
| 744 | iso_pu_bacteria | 2513237098 | 2513674920 | 286 |
| 745 | iso_pu_bacteria | 2524023210 | 2524470620 | 286 |
| 746 | iso_pu_bacteria | 2885383462 | 2885388347 | 286 |
| 747 | iso_pu_bacteria | 2903768456 | 2903776484 | 286 |
| 748 | iso_pu_bacteria | 2922361189 | 2922365488 | 286 |
| 749 | 3300025940 | Ga0207691_10192860 | Ga0207691_101928603 | 287 |
| 750 | 3300045976 | Ga0466967_0144048 | Ga0466967_0144048_428_1315 | 287 |
| 751 | 3300046531 | Ga0495665_0076330 | Ga0495665_0076330_40_927 | 287 |
| 752 | 3300053119 | Ga0500595_002432 | Ga0500595_002432_1442_2329 | 287 |
| 753 | 3300005937 | Ga0081455_10003466 | Ga0081455_1000346618 | 288 |
| 754 | 3300026041 | Ga0207639_10148257 | Ga0207639_101482572 | 288 |
| 755 | 3300026067 | Ga0207678_10031827 | Ga0207678_100318273 | 288 |
| 756 | 3300005434 | Ga0070709_10001793 | Ga0070709_100017938 | 289 |
| 757 | 3300025906 | Ga0207699_10005980 | Ga0207699_100059802 | 289 |
| 758 | 3300038443 | Ga0395901_0058368 | Ga0395901_0058368_2228_3115 | 289 |
| 759 | 3300005539 | Ga0068853_100061828 | Ga0068853_1000618282 | 290 |
| 760 | 3300005983 | Ga0081540_1030043 | Ga0081540_10300434 | 290 |
| 761 | 3300048928 | Ga0496125_0000272 | Ga0496125_0000272_45001_45888 | 290 |
| 762 | 3300049570 | Ga0501033_0320178 | Ga0501033_0320178_87_959 | 290 |
| 763 | 3300049823 | Ga0501044_0154343 | Ga0501044_0154343_826_1698 | 290 |
| 764 | 3300053125 | Ga0500618_019426 | Ga0500618_019426_328_1200 | 290 |
| 765 | iso_pu_bacteria | 2508501128 | 2509150580 | 291 |
| 766 | iso_pu_bacteria | 2513237087 | 2513590216 | 291 |
| 767 | iso_pu_bacteria | 2513237096 | 2513658051 | 291 |
| 768 | iso_pu_bacteria | 2513237101 | 2513692684 | 291 |
| 769 | iso_pu_bacteria | 2513237137 | 2513855755 | 291 |
| 770 | iso_pu_bacteria | 2513237145 | 2513919855 | 291 |
| 771 | iso_pu_bacteria | 2517572143 | 2517892293 | 291 |
| 772 | iso_pu_bacteria | 2524023228 | 2524540272 | 291 |
| 773 | iso_pu_bacteria | 2602042107 | 2603859559 | 291 |
| 774 | iso_pu_bacteria | 2667528175 | 2671120459 | 291 |
| 775 | iso_pu_bacteria | 2721755755 | 2723844937 | 291 |
| 776 | iso_pu_bacteria | 2728368998 | 2728747352 | 291 |
| 777 | iso_pu_bacteria | 2791355197 | 2793072364 | 291 |
| 778 | iso_pu_bacteria | 2791355199 | 2793082191 | 291 |
| 779 | iso_pu_bacteria | 2857524615 | 2857529033 | 291 |
| 780 | iso_pu_bacteria | 2874604998 | 2874605345 | 291 |
| 781 | iso_pu_bacteria | 2879110137 | 2879111326 | 291 |
| 782 | iso_pu_bacteria | 2885374607 | 2885379525 | 291 |
| 783 | iso_pu_bacteria | 2889033259 | 2889039704 | 291 |
| 784 | iso_pu_bacteria | 2893066018 | 2893070481 | 291 |
| 785 | iso_pu_bacteria | 2903748898 | 2903757527 | 291 |
| 786 | iso_pu_bacteria | 2904690495 | 2904694571 | 291 |
| 787 | iso_pu_bacteria | 2904699407 | 2904702465 | 291 |
| 788 | iso_pu_bacteria | 2906610324 | 2906618733 | 291 |
| 789 | iso_pu_bacteria | 2906635258 | 2906637437 | 291 |
| 790 | iso_pu_bacteria | 2906660503 | 2906666268 | 291 |
| 791 | iso_pu_bacteria | 2908739725 | 2908742581 | 291 |
| 792 | iso_pu_bacteria | 2908756301 | 2908760126 | 291 |
| 793 | iso_pu_bacteria | 2919073203 | 2919076433 | 291 |
| 794 | iso_pu_bacteria | 2922386360 | 2922391111 | 291 |
| 795 | iso_pu_bacteria | 2922425934 | 2922430394 | 291 |
| 796 | iso_pu_bacteria | 2935630451 | 2935631565 | 291 |
| 797 | iso_pu_bacteria | 2941507105 | 2941511359 | 291 |
| 798 | iso_pu_bacteria | 2941515067 | 2941519060 | 291 |
| 799 | iso_pu_bacteria | 2941523033 | 2941526360 | 291 |
| 800 | iso_pu_bacteria | 3005474847 | 3005480312 | 291 |
| 801 | iso_pu_bacteria | 8006933436 | 8006940568 | 291 |
| 802 | iso_pu_bacteria | 8006964411 | 8006967190 | 291 |
| 803 | iso_pu_bacteria | 8006973647 | 8006980256 | 291 |
| 804 | iso_pu_bacteria | 8006984368 | 8006986531 | 291 |
| 805 | iso_pu_bacteria | 8006994254 | 8006995884 | 291 |
| 806 | iso_pu_bacteria | 8019565922 | 8019568676 | 291 |
| 807 | iso_pu_bacteria | 8056673599 | 8056673724 | 291 |
| 808 | iso_pu_bacteria | 8056681323 | 8056686748 | 291 |
| 809 | iso_pu_bacteria | 8056689827 | 8056691400 | 291 |
| 810 | 3300001979 | JGI24740J21852_10008223 | JGI24740J21852_100082232 | 295 |
| 811 | 3300003203 | JGI25406J46586_10000152 | JGI25406J46586_100001528 | 295 |
| 812 | 3300003203 | JGI25406J46586_10018257 | JGI25406J46586_100182573 | 295 |
| 813 | 3300005327 | Ga0070658_10117643 | Ga0070658_101176432 | 295 |
| 814 | 3300005353 | Ga0070669_100088284 | Ga0070669_1000882842 | 295 |
| 815 | 3300005356 | Ga0070674_100296878 | Ga0070674_1002968781 | 295 |
| 816 | 3300005434 | Ga0070709_10017837 | Ga0070709_100178373 | 295 |
| 817 | 3300005435 | Ga0070714_100002869 | Ga0070714_1000028699 | 295 |
| 818 | 3300005436 | Ga0070713_100006492 | Ga0070713_1000064926 | 295 |
| 819 | 3300005436 | Ga0070713_100181081 | Ga0070713_1001810812 | 295 |
| 820 | 3300005437 | Ga0070710_10001067 | Ga0070710_100010674 | 295 |
| 821 | 3300005437 | Ga0070710_10008800 | Ga0070710_100088003 | 295 |
| 822 | 3300005437 | Ga0070710_10037408 | Ga0070710_100374082 | 295 |
| 823 | 3300005439 | Ga0070711_100007374 | Ga0070711_1000073746 | 295 |
| 824 | 3300005439 | Ga0070711_100017125 | Ga0070711_1000171254 | 295 |
| 825 | 3300005455 | Ga0070663_100116293 | Ga0070663_1001162932 | 295 |
| 826 | 3300005548 | Ga0070665_100214785 | Ga0070665_1002147852 | 295 |
| 827 | 3300005563 | Ga0068855_100019340 | Ga0068855_1000193406 | 295 |
| 828 | 3300005563 | Ga0068855_100042552 | Ga0068855_1000425523 | 295 |
| 829 | 3300005563 | Ga0068855_100500802 | Ga0068855_1005008022 | 295 |
| 830 | 3300005577 | Ga0068857_100158294 | Ga0068857_1001582942 | 295 |
| 831 | 3300005614 | Ga0068856_100004002 | Ga0068856_10000400213 | 295 |
| 832 | 3300005615 | Ga0070702_100154258 | Ga0070702_1001542582 | 295 |
| 833 | 3300005616 | Ga0068852_100322161 | Ga0068852_1003221612 | 295 |
| 834 | 3300005718 | Ga0068866_10152513 | Ga0068866_101525132 | 295 |
| 835 | 3300005843 | Ga0068860_100026198 | Ga0068860_1000261983 | 295 |
| 836 | 3300005844 | Ga0068862_100106293 | Ga0068862_1001062932 | 295 |
| 837 | 3300005937 | Ga0081455_10008869 | Ga0081455_100088698 | 295 |
| 838 | 3300005985 | Ga0081539_10000273 | Ga0081539_1000027371 | 295 |
| 839 | 3300005985 | Ga0081539_10000735 | Ga0081539_1000073531 | 295 |
| 840 | 3300006028 | Ga0070717_10027316 | Ga0070717_100273164 | 295 |
| 841 | 3300006038 | Ga0075365_10000141 | Ga0075365_1000014120 | 295 |
| 842 | 3300006051 | Ga0075364_10038689 | Ga0075364_100386892 | 295 |
| 843 | 3300006163 | Ga0070715_10000178 | Ga0070715_100001783 | 295 |
| 844 | 3300006173 | Ga0070716_100016704 | Ga0070716_1000167043 | 295 |
| 845 | 3300006175 | Ga0070712_100003228 | Ga0070712_1000032284 | 295 |
| 846 | 3300006175 | Ga0070712_100030867 | Ga0070712_1000308673 | 295 |
| 847 | 3300006175 | Ga0070712_100043122 | Ga0070712_1000431222 | 295 |
| 848 | 3300006177 | Ga0075362_10041433 | Ga0075362_100414332 | 295 |
| 849 | 3300006178 | Ga0075367_10046962 | Ga0075367_100469622 | 295 |
| 850 | 3300006178 | Ga0075367_10218117 | Ga0075367_102181172 | 295 |
| 851 | 3300006195 | Ga0075366_10208871 | Ga0075366_102088711 | 295 |
| 852 | 3300006844 | Ga0075428_100074905 | Ga0075428_1000749051 | 295 |
| 853 | 3300006942 | Ga0099824_1004785 | Ga0099824_10047854 | 295 |
| 854 | 3300006943 | Ga0099822_1002380 | Ga0099822_100238017 | 295 |
| 855 | 3300009098 | Ga0105245_10240174 | Ga0105245_102401742 | 295 |
| 856 | 3300009147 | Ga0114129_10166595 | Ga0114129_101665952 | 295 |
| 857 | 3300009148 | Ga0105243_10017871 | Ga0105243_100178714 | 295 |
| 858 | 3300009174 | Ga0105241_10003781 | Ga0105241_100037818 | 295 |
| 859 | 3300009176 | Ga0105242_10120948 | Ga0105242_101209481 | 295 |
| 860 | 3300009545 | Ga0105237_10345618 | Ga0105237_103456182 | 295 |
| 861 | 3300009551 | Ga0105238_10001429 | Ga0105238_100014294 | 295 |
| 862 | 3300009551 | Ga0105238_10210001 | Ga0105238_102100012 | 295 |
| 863 | 3300010375 | Ga0105239_10033786 | Ga0105239_100337863 | 295 |
| 864 | 3300010375 | Ga0105239_10384386 | Ga0105239_103843862 | 295 |
| 865 | 3300010375 | Ga0105239_10591676 | Ga0105239_105916761 | 295 |
| 866 | 3300013100 | Ga0157373_10144467 | Ga0157373_101444672 | 295 |
| 867 | 3300013104 | Ga0157370_10237211 | Ga0157370_102372112 | 295 |
| 868 | 3300013297 | Ga0157378_10006214 | Ga0157378_100062147 | 295 |
| 869 | 3300013306 | Ga0163162_10147576 | Ga0163162_101475762 | 295 |
| 870 | 3300013308 | Ga0157375_10249811 | Ga0157375_102498112 | 295 |
| 871 | 3300014326 | Ga0157380_10145885 | Ga0157380_101458852 | 295 |
| 872 | 3300017792 | Ga0163161_10095861 | Ga0163161_100958612 | 295 |
| 873 | 3300025321 | Ga0207656_10011620 | Ga0207656_100116202 | 295 |
| 874 | 3300025898 | Ga0207692_10000694 | Ga0207692_100006943 | 295 |
| 875 | 3300025898 | Ga0207692_10006740 | Ga0207692_100067403 | 295 |
| 876 | 3300025898 | Ga0207692_10040745 | Ga0207692_100407453 | 295 |
| 877 | 3300025899 | Ga0207642_10209410 | Ga0207642_102094101 | 295 |
| 878 | 3300025901 | Ga0207688_10177806 | Ga0207688_101778061 | 295 |
| 879 | 3300025905 | Ga0207685_10000188 | Ga0207685_100001883 | 295 |
| 880 | 3300025906 | Ga0207699_10003013 | Ga0207699_100030132 | 295 |
| 881 | 3300025907 | Ga0207645_10092911 | Ga0207645_100929112 | 295 |
| 882 | 3300025909 | Ga0207705_10060763 | Ga0207705_100607632 | 295 |
| 883 | 3300025910 | Ga0207684_10197212 | Ga0207684_101972122 | 295 |
| 884 | 3300025911 | Ga0207654_10000308 | Ga0207654_1000030824 | 295 |
| 885 | 3300025912 | Ga0207707_10120412 | Ga0207707_101204122 | 295 |
| 886 | 3300025913 | Ga0207695_10001719 | Ga0207695_1000171911 | 295 |
| 887 | 3300025913 | Ga0207695_10125342 | Ga0207695_101253422 | 295 |
| 888 | 3300025915 | Ga0207693_10013902 | Ga0207693_100139024 | 295 |
| 889 | 3300025915 | Ga0207693_10036094 | Ga0207693_100360943 | 295 |
| 890 | 3300025915 | Ga0207693_10054711 | Ga0207693_100547113 | 295 |
| 891 | 3300025916 | Ga0207663_10019519 | Ga0207663_100195192 | 295 |
| 892 | 3300025916 | Ga0207663_10130835 | Ga0207663_101308351 | 295 |
| 893 | 3300025919 | Ga0207657_10008840 | Ga0207657_100088406 | 295 |
| 894 | 3300025921 | Ga0207652_10011414 | Ga0207652_100114144 | 295 |
| 895 | 3300025924 | Ga0207694_10000157 | Ga0207694_1000015748 | 295 |
| 896 | 3300025928 | Ga0207700_10015910 | Ga0207700_100159102 | 295 |
| 897 | 3300025929 | Ga0207664_10036839 | Ga0207664_100368394 | 295 |
| 898 | 3300025933 | Ga0207706_10080399 | Ga0207706_100803992 | 295 |
| 899 | 3300025935 | Ga0207709_10003187 | Ga0207709_1000318710 | 295 |
| 900 | 3300025938 | Ga0207704_10048856 | Ga0207704_100488562 | 295 |
| 901 | 3300025939 | Ga0207665_10000133 | Ga0207665_1000013345 | 295 |
| 902 | 3300025939 | Ga0207665_10092774 | Ga0207665_100927742 | 295 |
| 903 | 3300025949 | Ga0207667_10036579 | Ga0207667_100365792 | 295 |
| 904 | 3300025949 | Ga0207667_10151566 | Ga0207667_101515663 | 295 |
| 905 | 3300025972 | Ga0207668_10022787 | Ga0207668_100227872 | 295 |
| 906 | 3300026041 | Ga0207639_10000967 | Ga0207639_1000096718 | 295 |
| 907 | 3300026067 | Ga0207678_10014057 | Ga0207678_100140572 | 295 |
| 908 | 3300026067 | Ga0207678_10022191 | Ga0207678_100221913 | 295 |
| 909 | 3300026075 | Ga0207708_10067621 | Ga0207708_100676212 | 295 |
| 910 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002304 | 295 |
| 911 | 3300026116 | Ga0207674_10016714 | Ga0207674_100167147 | 295 |
| 912 | 3300026118 | Ga0207675_100009319 | Ga0207675_1000093192 | 295 |
| 913 | 3300026118 | Ga0207675_100193732 | Ga0207675_1001937322 | 295 |
| 914 | 3300026121 | Ga0207683_10089152 | Ga0207683_100891522 | 295 |
| 915 | 3300026142 | Ga0207698_10104185 | Ga0207698_101041853 | 295 |
| 916 | 3300027357 | Ga0209589_1000001 | Ga0209589_100000138 | 295 |
| 917 | 3300027361 | Ga0209489_100001 | Ga0209489_10000138 | 295 |
| 918 | 3300027363 | Ga0209700_100001 | Ga0209700_10000138 | 295 |
| 919 | 3300028379 | Ga0268266_10219088 | Ga0268266_102190882 | 295 |
| 920 | 3300028380 | Ga0268265_10463385 | Ga0268265_104633852 | 295 |
| 921 | 3300031616 | Ga0307508_10029626 | Ga0307508_100296263 | 295 |
| 922 | 3300031711 | Ga0265314_10060303 | Ga0265314_100603032 | 295 |
| 923 | 3300031712 | Ga0265342_10025587 | Ga0265342_100255871 | 295 |
| 924 | 3300031995 | Ga0307409_100079363 | Ga0307409_1000793632 | 295 |
| 925 | 3300032004 | Ga0307414_10259134 | Ga0307414_102591341 | 295 |
| 926 | 3300033180 | Ga0307510_10061898 | Ga0307510_100618982 | 295 |
| 927 | 3300033180 | Ga0307510_10212961 | Ga0307510_102129611 | 295 |
| 928 | 3300033442 | Ga0315911_1000001 | Ga0315911_100000139 | 295 |
| 929 | 3300037068 | Ga0373925_0049086 | Ga0373925_0049086_1816_2703 | 295 |
| 930 | 3300046455 | Ga0495603_0119488 | Ga0495603_0119488_406_1293 | 295 |
| 931 | 3300046492 | Ga0495585_0077971 | Ga0495585_0077971_44_931 | 295 |
| 932 | 3300046499 | Ga0495594_0097894 | Ga0495594_0097894_610_1497 | 295 |
| 933 | 3300046518 | Ga0495631_0065787 | Ga0495631_0065787_573_1460 | 295 |
| 934 | 3300046559 | Ga0495667_0101335 | Ga0495667_0101335_308_1195 | 295 |
| 935 | 3300046648 | Ga0495611_0175580 | Ga0495611_0175580_71_958 | 295 |
| 936 | 3300046684 | Ga0495669_0025247 | Ga0495669_0025247_1375_2262 | 295 |
| 937 | 3300046794 | Ga0495589_0114205 | Ga0495589_0114205_82_969 | 295 |
| 938 | 3300046809 | Ga0495600_0035513 | Ga0495600_0035513_913_1800 | 295 |
| 939 | 3300048904 | Ga0496101_0156226 | Ga0496101_0156226_652_1539 | 295 |
| 940 | 3300048905 | Ga0496102_0221157 | Ga0496102_0221157_361_1248 | 295 |
| 941 | 3300048905 | Ga0496102_0508312 | Ga0496102_0508312_84_971 | 295 |
| 942 | 3300048909 | Ga0496106_0101459 | Ga0496106_0101459_69_956 | 295 |
| 943 | 3300048909 | Ga0496106_0275075 | Ga0496106_0275075_343_1230 | 295 |
| 944 | 3300048909 | Ga0496106_0389467 | Ga0496106_0389467_105_992 | 295 |
| 945 | 3300048910 | Ga0496107_0346309 | Ga0496107_0346309_53_940 | 295 |
| 946 | 3300048913 | Ga0496110_0198007 | Ga0496110_0198007_829_1716 | 295 |
| 947 | 3300048914 | Ga0496111_0118923 | Ga0496111_0118923_864_1751 | 295 |
| 948 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_60359_61246 | 295 |
| 949 | 3300048915 | Ga0496112_0037193 | Ga0496112_0037193_841_1728 | 295 |
| 950 | 3300048916 | Ga0496113_0401746 | Ga0496113_0401746_88_975 | 295 |
| 951 | 3300048917 | Ga0496114_0033661 | Ga0496114_0033661_1044_1931 | 295 |
| 952 | 3300048917 | Ga0496114_0164825 | Ga0496114_0164825_749_1636 | 295 |
| 953 | 3300048924 | Ga0496121_0021616 | Ga0496121_0021616_1404_2291 | 295 |
| 954 | 3300048924 | Ga0496121_0057484 | Ga0496121_0057484_541_1428 | 295 |
| 955 | 3300048924 | Ga0496121_0117135 | Ga0496121_0117135_908_1795 | 295 |
| 956 | 3300048926 | Ga0496123_0029839 | Ga0496123_0029839_512_1399 | 295 |
| 957 | 3300048929 | Ga0496126_0032865 | Ga0496126_0032865_1654_2541 | 295 |
| 958 | 3300048929 | Ga0496126_0057411 | Ga0496126_0057411_911_1798 | 295 |
| 959 | 3300049568 | Ga0501031_0009017 | Ga0501031_0009017_35_922 | 295 |
| 960 | 3300049569 | Ga0501032_0120760 | Ga0501032_0120760_30_917 | 295 |
| 961 | 3300049570 | Ga0501033_0000113 | Ga0501033_0000113_13062_13949 | 295 |
| 962 | 3300049571 | Ga0501034_0199925 | Ga0501034_0199925_374_1261 | 295 |
| 963 | 3300049572 | Ga0501036_0054565 | Ga0501036_0054565_833_1720 | 295 |
| 964 | 3300049574 | Ga0501038_0037201 | Ga0501038_0037201_2542_3429 | 295 |
| 965 | 3300049574 | Ga0501038_0050435 | Ga0501038_0050435_999_1886 | 295 |
| 966 | 3300049575 | Ga0501039_0003144 | Ga0501039_0003144_9918_10805 | 295 |
| 967 | 3300049577 | Ga0501041_0117608 | Ga0501041_0117608_16_903 | 295 |
| 968 | 3300049578 | Ga0501042_0008165 | Ga0501042_0008165_3458_4345 | 295 |
| 969 | 3300049578 | Ga0501042_0243903 | Ga0501042_0243903_355_1242 | 295 |
| 970 | 3300049822 | Ga0501035_0003056 | Ga0501035_0003056_13616_14503 | 295 |
| 971 | 3300049823 | Ga0501044_0051243 | Ga0501044_0051243_1165_2052 | 295 |
| 972 | 3300049823 | Ga0501044_0643955 | Ga0501044_0643955_30_917 | 295 |
| 973 | 3300050489 | nmdc:mga03683_24010_c1 | nmdc:mga03683_24010_c1_581_1468 | 295 |
| 974 | 3300050490 | nmdc:mga03n38_10965_c1 | nmdc:mga03n38_10965_c1_663_1550 | 295 |
| 975 | 3300050491 | nmdc:mga00v17_4283_c1 | nmdc:mga00v17_4283_c1_1890_2777 | 295 |
| 976 | 3300050491 | nmdc:mga00v17_55938_c1 | nmdc:mga00v17_55938_c1_914_1801 | 295 |
| 977 | 3300050492 | nmdc:mga0yw44_19594_c1 | nmdc:mga0yw44_19594_c1_2805_3692 | 295 |
| 978 | 3300050492 | nmdc:mga0yw44_387812_c1 | nmdc:mga0yw44_387812_c1_14_901 | 295 |
| 979 | 3300050492 | nmdc:mga0yw44_47797_c1 | nmdc:mga0yw44_47797_c1_1558_2445 | 295 |
| 980 | 3300050492 | nmdc:mga0yw44_59641_c1 | nmdc:mga0yw44_59641_c1_551_1438 | 295 |
| 981 | 3300050494 | nmdc:mga06z11_170062_c1 | nmdc:mga06z11_170062_c1_222_1109 | 295 |
| 982 | 3300050494 | nmdc:mga06z11_29523_c1 | nmdc:mga06z11_29523_c1_1112_1999 | 295 |
| 983 | 3300050507 | nmdc:mga05p37_80160_c1 | nmdc:mga05p37_80160_c1_392_1279 | 295 |
| 984 | 3300053078 | Ga0495612_0018341 | Ga0495612_0018341_490_1377 | 295 |
| 985 | 3300053087 | Ga0500643_015597 | Ga0500643_015597_352_1239 | 295 |
| 986 | 3300053096 | Ga0500641_0036182 | Ga0500641_0036182_718_1605 | 295 |
| 987 | 3300053096 | Ga0500641_0062982 | Ga0500641_0062982_233_1120 | 295 |
| 988 | 3300053153 | Ga0500616_0000372 | Ga0500616_0000372_38500_39387 | 295 |
| 989 | iso_pu_bacteria | 2828305725 | 2828308125 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2w2u-assembly1.cif.gz_A | structural insight into the interaction between archaeal escrt-iii and aaa-atpase | 0.8366 | 222 | 295 |
| 2w2u-assembly1.cif.gz_A | structural insight into the interaction between archaeal escrt-iii and aaa-atpase | 0.799 | 222 | 295 |
| 8hvj-assembly1.cif.gz_B-2 | the structure of the e. coli mrna endoonuclease yicc | 0.786 | 11 | 295 |
| 8hvj-assembly1.cif.gz_A-2 | the structure of the e. coli mrna endoonuclease yicc | 0.7846 | 9 | 293 |
| 8hvj-assembly1.cif.gz_B-2 | the structure of the e. coli mrna endoonuclease yicc | 0.7811 | 11 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23839_203_287_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9086 | 212 | 295 | 1.20.58.220 |
| af_Q57950_59_179_2.60.120.1040 | Mainly Beta;Sandwich;Jelly Rolls;ZPR1, A/B domain | 0.9035 | 250 | 290 | 2.60.120.1040 |
| af_P23839_203_287_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.8884 | 212 | 295 | 1.20.58.220 |
| 2w2uA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8366 | 222 | 295 | 1.20.58.80 |
| 2w2uA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.799 | 222 | 295 | 1.20.58.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1YGT8-F1-model_v4 | YicC family protein | 0.9133 | 1 | 293 |
GO:0004521
|
| AF-A0A7C3X576-F1-model_v4 | Endoribonuclease YicC-like N-terminal domain-containing protein | 0.9114 | 6 | 73 |
|
| AF-A0A3C1NGB9-F1-model_v4 | Endoribonuclease YicC-like N-terminal domain-containing protein | 0.907 | 1 | 188 |
GO:0004521
|
| AF-A0A0Q7TXA4-F1-model_v4 | YicC family protein | 0.9018 | 1 | 293 |
GO:0004521
|
| AF-A0A519PGU2-F1-model_v4 | YicC family protein | 0.9005 | 1 | 177 |
GO:0004521
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar