F487569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 988 | 557 | 837 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0178657|Ga0395900_0178657_100_1206 |
| Length | 368 |
| Sequence | MPKEYRPRTSQGRRVPILFGHDKRDRAAADFASRGPQQTRTQGRIVVKAFKYFAAALVVLLTPALAAAQKFPERNIRLIVPFPAGGPNDIIARVVSQKMSEILKQTIIVDNRGGQGGVIGTDLVAKAKPDGYTIAVTSAGALAISPSMEKVAYDTLKDLQPVTLVAKVPEMLVVAENVPAKNMKELVALAKKEPGKLNFASSGPGSLPHLAGELFKLTAHIDAVHVPYRGAAPAVNDLLGGQVQMVFLDLPVLLPHVKAGKLRPIAVGAEKRVATLPDVPTTAEVGYPTLLTENWYGMVAPAGTPKDIVATLNKAAVEAMKDPAVVSKLSSLGAILVGNSPDEFRTFIASEKAKWAKVIKDAGVPTQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 10 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 11 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 12 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 13 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 14 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 15 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 16 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2791355199 | |||
| 20 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 21 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 22 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 23 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 24 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 25 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 26 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 27 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 28 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 29 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 30 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 31 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 32 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 33 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 34 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 35 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 36 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 37 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 38 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 39 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 40 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 41 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 42 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 43 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 44 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 45 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 46 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 47 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 48 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 49 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 50 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 51 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 52 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 53 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 54 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 55 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 56 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 57 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 58 | 2922368715 | |||
| 59 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 60 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 61 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 62 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 63 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 64 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 65 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 66 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 67 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 68 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 69 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 70 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 71 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 72 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 73 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 74 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 75 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 76 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 77 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 78 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 79 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 80 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 81 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 82 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 83 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 84 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 85 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 86 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 87 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 88 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 89 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 90 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 91 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 92 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 93 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 94 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 95 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 96 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 97 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 98 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 99 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 100 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 101 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 102 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 103 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 104 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 105 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 106 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 107 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 108 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 109 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 110 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 111 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 112 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 113 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 114 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 115 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 116 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 117 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 118 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 119 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 120 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 121 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 122 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 124 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 125 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 126 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 128 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 129 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 133 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 134 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 136 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 138 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 139 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 149 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 153 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 154 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 155 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 158 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 159 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 160 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 161 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 162 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 163 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 164 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 165 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 166 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 167 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 168 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 169 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 170 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 171 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 172 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 174 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 175 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 176 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 177 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 178 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 180 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 182 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 183 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 184 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 185 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 187 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 188 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 189 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 190 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 191 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 192 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 193 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 194 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 195 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 197 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 198 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 199 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 200 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 222 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 281 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 282 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 286 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 289 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 290 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 292 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 293 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 294 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 295 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 296 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 297 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 298 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 300 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 301 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 302 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 303 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 304 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 307 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 308 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 313 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 314 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 316 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 320 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 333 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 334 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 335 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 336 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 337 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 338 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 339 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 340 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 341 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 342 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 343 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 430 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 446 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 476 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 479 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 480 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 481 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 482 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 495 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 499 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 502 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 503 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 506 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 507 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 509 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 511 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 514 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 516 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 520 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 524 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 526 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 528 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 529 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 530 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 531 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 532 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 533 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 534 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 535 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 536 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 537 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 538 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 539 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 540 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 541 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 542 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 543 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 544 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 545 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 546 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 547 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 548 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 549 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 550 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 551 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 552 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 553 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 554 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 555 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 556 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 557 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.89 |
| Metatranscriptomes | 0 |
| Isolates | 15.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.84 |
| Nodule | 13.06 |
| Rhizoplane | 4.66 |
| Rhizosphere | 65.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000359 | 3300003203 | Bacteria | 20746 |
| 2 | JGI25406J46586_10006073 | 3300003203 | Bacteria | 5580 |
| 3 | JGI25153J46596_10004803 | 3300003215 | Bacteria | 7199 |
| 4 | JGI25153J46596_10005279 | 3300003215 | Bacteria | 6793 |
| 5 | JGI25153J46596_10005848 | 3300003215 | Bacteria | 6374 |
| 6 | JGI25153J46596_10007756 | 3300003215 | Bacteria | 5222 |
| 7 | rootH2_10062151 | 3300003320 | Bacteria | 1641 |
| 8 | JGI25160J50197_1008171 | 3300003354 | Bacteria | 4013 |
| 9 | JGI25160J50197_1031104 | 3300003354 | Bacteria | 1380 |
| 10 | JGI25404J52841_10030037 | 3300003659 | Bacteria | 1165 |
| 11 | Ga0055543_1011624 | 3300004625 | Bacteria | 1795 |
| 12 | Ga0065165_1000919 | 3300005262 | Bacteria | 37849 |
| 13 | Ga0065165_1002792 | 3300005262 | Bacteria | 13765 |
| 14 | Ga0065165_1005273 | 3300005262 | Bacteria | 7373 |
| 15 | Ga0070658_10045234 | 3300005327 | Bacteria | 3559 |
| 16 | Ga0070658_10093766 | 3300005327 | Bacteria | 2476 |
| 17 | Ga0070658_10293588 | 3300005327 | Bacteria | 1385 |
| 18 | Ga0070676_10044708 | 3300005328 | Bacteria | 2578 |
| 19 | Ga0070676_10136276 | 3300005328 | Bacteria | 1558 |
| 20 | Ga0070683_100149805 | 3300005329 | Bacteria | 2212 |
| 21 | Ga0070690_100059558 | 3300005330 | Bacteria | 2455 |
| 22 | Ga0070690_100078710 | 3300005330 | Bacteria | 2154 |
| 23 | Ga0070680_100077218 | 3300005336 | Bacteria | 2743 |
| 24 | Ga0070680_100131705 | 3300005336 | Bacteria | 2093 |
| 25 | Ga0070682_100190506 | 3300005337 | Bacteria | 1440 |
| 26 | Ga0068868_100030792 | 3300005338 | Bacteria | 4115 |
| 27 | Ga0070660_100151829 | 3300005339 | Bacteria | 1863 |
| 28 | Ga0070660_100220170 | 3300005339 | Bacteria | 1542 |
| 29 | Ga0070689_100219789 | 3300005340 | Bacteria | 1558 |
| 30 | Ga0070687_100055331 | 3300005343 | Bacteria | 2072 |
| 31 | Ga0070661_100271496 | 3300005344 | Bacteria | 1313 |
| 32 | Ga0070668_100076521 | 3300005347 | Bacteria | 2614 |
| 33 | Ga0070668_100133095 | 3300005347 | Bacteria | 1997 |
| 34 | Ga0070668_100217989 | 3300005347 | Bacteria | 1572 |
| 35 | Ga0070675_100118178 | 3300005354 | Bacteria | 2251 |
| 36 | Ga0070671_100055275 | 3300005355 | Bacteria | 3302 |
| 37 | Ga0070674_100386901 | 3300005356 | Bacteria | 1139 |
| 38 | Ga0070673_100069800 | 3300005364 | Bacteria | 2817 |
| 39 | Ga0070709_10007358 | 3300005434 | Bacteria | 6032 |
| 40 | Ga0070709_10024332 | 3300005434 | Bacteria | 3563 |
| 41 | Ga0070709_10078062 | 3300005434 | Bacteria | 2154 |
| 42 | Ga0070709_10141936 | 3300005434 | Bacteria | 1651 |
| 43 | Ga0070714_100024637 | 3300005435 | Bacteria | 4957 |
| 44 | Ga0070713_100007733 | 3300005436 | Bacteria | 7568 |
| 45 | Ga0070713_100039241 | 3300005436 | Bacteria | 3842 |
| 46 | Ga0070710_10002417 | 3300005437 | Bacteria | 8854 |
| 47 | Ga0070710_10038634 | 3300005437 | Bacteria | 2623 |
| 48 | Ga0070711_100006676 | 3300005439 | Bacteria | 6977 |
| 49 | Ga0070663_100069526 | 3300005455 | Bacteria | 2558 |
| 50 | Ga0070663_100300982 | 3300005455 | Bacteria | 1284 |
| 51 | Ga0070662_100351488 | 3300005457 | Bacteria | 1208 |
| 52 | Ga0070681_10050857 | 3300005458 | Bacteria | 4134 |
| 53 | Ga0070681_10074250 | 3300005458 | Bacteria | 3362 |
| 54 | Ga0070681_10223614 | 3300005458 | Bacteria | 1797 |
| 55 | Ga0068853_100042910 | 3300005539 | Bacteria | 3869 |
| 56 | Ga0068853_100449012 | 3300005539 | Bacteria | 1212 |
| 57 | Ga0070686_100008070 | 3300005544 | Bacteria | 5881 |
| 58 | Ga0070696_100048131 | 3300005546 | Bacteria | 2959 |
| 59 | Ga0070696_100107754 | 3300005546 | Bacteria | 2004 |
| 60 | Ga0070665_100015092 | 3300005548 | Bacteria | 7756 |
| 61 | Ga0070665_100099359 | 3300005548 | Bacteria | 2914 |
| 62 | Ga0070665_100405452 | 3300005548 | Bacteria | 1371 |
| 63 | Ga0068855_100001526 | 3300005563 | Bacteria | 29026 |
| 64 | Ga0068855_100037526 | 3300005563 | Bacteria | 5761 |
| 65 | Ga0068855_100076692 | 3300005563 | Bacteria | 3878 |
| 66 | Ga0068857_100266693 | 3300005577 | Bacteria | 1573 |
| 67 | Ga0068856_100365997 | 3300005614 | Bacteria | 1460 |
| 68 | Ga0068856_100392745 | 3300005614 | Bacteria | 1407 |
| 69 | Ga0068852_100141999 | 3300005616 | Bacteria | 2223 |
| 70 | Ga0068852_100216491 | 3300005616 | Bacteria | 1820 |
| 71 | Ga0068859_100092180 | 3300005617 | Bacteria | 3081 |
| 72 | Ga0068866_10080273 | 3300005718 | Bacteria | 1750 |
| 73 | Ga0068851_10141729 | 3300005834 | Bacteria | 1308 |
| 74 | Ga0068863_100036014 | 3300005841 | Bacteria | 4713 |
| 75 | Ga0068863_100116459 | 3300005841 | Bacteria | 2546 |
| 76 | Ga0068863_100151155 | 3300005841 | Bacteria | 2221 |
| 77 | Ga0068863_100445265 | 3300005841 | Bacteria | 1271 |
| 78 | Ga0068863_100455047 | 3300005841 | Bacteria | 1256 |
| 79 | Ga0068858_100029243 | 3300005842 | Bacteria | 5116 |
| 80 | Ga0068858_100091077 | 3300005842 | Bacteria | 2838 |
| 81 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 82 | Ga0068862_100662443 | 3300005844 | Bacteria | 1008 |
| 83 | Ga0081455_10001479 | 3300005937 | Bacteria | 29079 |
| 84 | Ga0081455_10003833 | 3300005937 | Bacteria | 17148 |
| 85 | Ga0081455_10053122 | 3300005937 | Bacteria | 3464 |
| 86 | Ga0081455_10085161 | 3300005937 | Bacteria | 2578 |
| 87 | Ga0081538_10025304 | 3300005981 | Bacteria | 4190 |
| 88 | Ga0081538_10120242 | 3300005981 | Bacteria | 1264 |
| 89 | Ga0081540_1004960 | 3300005983 | Bacteria | 10007 |
| 90 | Ga0081540_1006444 | 3300005983 | Bacteria | 8542 |
| 91 | Ga0081540_1021674 | 3300005983 | Bacteria | 3816 |
| 92 | Ga0081540_1025036 | 3300005983 | Bacteria | 3447 |
| 93 | Ga0081540_1026089 | 3300005983 | Bacteria | 3345 |
| 94 | Ga0081540_1026760 | 3300005983 | Bacteria | 3284 |
| 95 | Ga0081540_1026892 | 3300005983 | Bacteria | 3273 |
| 96 | Ga0081539_10001114 | 3300005985 | Bacteria | 48756 |
| 97 | Ga0081539_10001128 | 3300005985 | Bacteria | 48441 |
| 98 | Ga0070717_10051443 | 3300006028 | Bacteria | 3390 |
| 99 | Ga0070717_10057816 | 3300006028 | Bacteria | 3206 |
| 100 | Ga0075365_10016412 | 3300006038 | Bacteria | 4505 |
| 101 | Ga0075365_10078393 | 3300006038 | Bacteria | 2234 |
| 102 | Ga0075365_10224578 | 3300006038 | Bacteria | 1318 |
| 103 | Ga0075365_10240526 | 3300006038 | Bacteria | 1271 |
| 104 | Ga0075368_10002709 | 3300006042 | Bacteria | 5837 |
| 105 | Ga0075368_10032382 | 3300006042 | Bacteria | 2030 |
| 106 | Ga0075363_100012045 | 3300006048 | Bacteria | 4157 |
| 107 | Ga0075363_100016422 | 3300006048 | Bacteria | 3656 |
| 108 | Ga0075364_10034512 | 3300006051 | Bacteria | 3264 |
| 109 | Ga0075364_10062765 | 3300006051 | Bacteria | 2438 |
| 110 | Ga0075364_10184785 | 3300006051 | Bacteria | 1411 |
| 111 | Ga0075432_10017317 | 3300006058 | Bacteria | 2458 |
| 112 | Ga0070715_10005346 | 3300006163 | Bacteria | 4276 |
| 113 | Ga0070715_10022360 | 3300006163 | Bacteria | 2465 |
| 114 | Ga0070716_100001217 | 3300006173 | Bacteria | 11316 |
| 115 | Ga0070712_100102915 | 3300006175 | Bacteria | 2116 |
| 116 | Ga0070712_100177090 | 3300006175 | Bacteria | 1659 |
| 117 | Ga0070712_100449722 | 3300006175 | Bacteria | 1072 |
| 118 | Ga0075362_10004628 | 3300006177 | Bacteria | 4960 |
| 119 | Ga0075367_10024485 | 3300006178 | Bacteria | 3405 |
| 120 | Ga0075367_10041204 | 3300006178 | Bacteria | 2699 |
| 121 | Ga0075369_10080344 | 3300006186 | Bacteria | 1445 |
| 122 | Ga0075369_10102720 | 3300006186 | Bacteria | 1283 |
| 123 | Ga0075366_10019905 | 3300006195 | Bacteria | 3888 |
| 124 | Ga0075366_10023974 | 3300006195 | Bacteria | 3557 |
| 125 | Ga0075366_10073632 | 3300006195 | Bacteria | 2036 |
| 126 | Ga0075366_10134994 | 3300006195 | Bacteria | 1490 |
| 127 | Ga0097621_100010589 | 3300006237 | Bacteria | 6755 |
| 128 | Ga0075370_10029799 | 3300006353 | Bacteria | 3041 |
| 129 | Ga0075370_10032951 | 3300006353 | Bacteria | 2899 |
| 130 | Ga0068871_100036409 | 3300006358 | Bacteria | 3918 |
| 131 | Ga0075428_100000476 | 3300006844 | Bacteria | 40332 |
| 132 | Ga0075428_100001723 | 3300006844 | Bacteria | 23380 |
| 133 | Ga0075428_100274360 | 3300006844 | Bacteria | 1814 |
| 134 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 135 | Ga0075430_100000244 | 3300006846 | Bacteria | 37691 |
| 136 | Ga0075430_100136323 | 3300006846 | Bacteria | 2045 |
| 137 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 138 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 139 | Ga0075433_10127889 | 3300006852 | Bacteria | 2256 |
| 140 | Ga0075433_10196700 | 3300006852 | Bacteria | 1793 |
| 141 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 142 | Ga0075434_100034266 | 3300006871 | Bacteria | 5014 |
| 143 | Ga0075434_100110129 | 3300006871 | Bacteria | 2765 |
| 144 | Ga0075434_100210094 | 3300006871 | Bacteria | 1966 |
| 145 | Ga0075434_100276410 | 3300006871 | Bacteria | 1699 |
| 146 | Ga0075429_100001265 | 3300006880 | Bacteria | 20558 |
| 147 | Ga0075429_100063046 | 3300006880 | Bacteria | 3229 |
| 148 | Ga0068865_100115705 | 3300006881 | Bacteria | 1985 |
| 149 | Ga0068865_100121134 | 3300006881 | Bacteria | 1945 |
| 150 | Ga0097620_100092182 | 3300006931 | Bacteria | 3081 |
| 151 | Ga0099825_1020668 | 3300006941 | Bacteria | 4628 |
| 152 | Ga0099824_1018360 | 3300006942 | Bacteria | 5770 |
| 153 | Ga0075435_100003301 | 3300007076 | Bacteria | 10940 |
| 154 | Ga0075435_100011769 | 3300007076 | Bacteria | 6454 |
| 155 | Ga0075435_100312517 | 3300007076 | Bacteria | 1345 |
| 156 | Ga0099795_10017367 | 3300007788 | Bacteria | 2293 |
| 157 | Ga0105251_10119249 | 3300009011 | Bacteria | 1199 |
| 158 | Ga0105240_10014700 | 3300009093 | Bacteria | 10677 |
| 159 | Ga0111539_10001412 | 3300009094 | Bacteria | 31985 |
| 160 | Ga0111539_10071975 | 3300009094 | Bacteria | 4078 |
| 161 | Ga0111539_10569547 | 3300009094 | Bacteria | 1319 |
| 162 | Ga0105245_10145957 | 3300009098 | Bacteria | 2232 |
| 163 | Ga0105245_10221927 | 3300009098 | Bacteria | 1824 |
| 164 | Ga0105245_10249822 | 3300009098 | Bacteria | 1723 |
| 165 | Ga0114129_10002772 | 3300009147 | Bacteria | 24406 |
| 166 | Ga0114129_10007261 | 3300009147 | Bacteria | 15774 |
| 167 | Ga0114129_10071187 | 3300009147 | Bacteria | 4849 |
| 168 | Ga0105243_10125749 | 3300009148 | Bacteria | 2168 |
| 169 | Ga0105242_10004266 | 3300009176 | Bacteria | 11145 |
| 170 | Ga0105242_10353114 | 3300009176 | Bacteria | 1358 |
| 171 | Ga0105248_10047962 | 3300009177 | Bacteria | 4790 |
| 172 | Ga0105248_10145936 | 3300009177 | Bacteria | 2670 |
| 173 | Ga0105237_10023192 | 3300009545 | Bacteria | 6362 |
| 174 | Ga0105238_10064515 | 3300009551 | Bacteria | 3662 |
| 175 | Ga0105249_10083546 | 3300009553 | Bacteria | 2973 |
| 176 | Ga0105239_10141596 | 3300010375 | Bacteria | 2680 |
| 177 | Ga0105239_10166820 | 3300010375 | Bacteria | 2463 |
| 178 | Ga0105239_10219240 | 3300010375 | Bacteria | 2133 |
| 179 | Ga0105239_10253395 | 3300010375 | Bacteria | 1977 |
| 180 | Ga0105239_10275570 | 3300010375 | Bacteria | 1893 |
| 181 | Ga0105246_10034641 | 3300011119 | Bacteria | 3367 |
| 182 | Ga0105246_10076063 | 3300011119 | Bacteria | 2378 |
| 183 | Ga0105246_10126198 | 3300011119 | Bacteria | 1904 |
| 184 | Ga0157371_10163070 | 3300013102 | Bacteria | 1592 |
| 185 | Ga0157370_10232451 | 3300013104 | Bacteria | 1706 |
| 186 | Ga0163162_10278586 | 3300013306 | Bacteria | 1804 |
| 187 | Ga0163162_10311618 | 3300013306 | Bacteria | 1706 |
| 188 | Ga0157375_10053365 | 3300013308 | Bacteria | 3977 |
| 189 | Ga0163163_10006941 | 3300014325 | Bacteria | 9948 |
| 190 | Ga0163163_10313152 | 3300014325 | Bacteria | 1623 |
| 191 | Ga0157380_10347142 | 3300014326 | Bacteria | 1387 |
| 192 | Ga0157379_10012889 | 3300014968 | Bacteria | 7313 |
| 193 | Ga0157376_10288393 | 3300014969 | Bacteria | 1549 |
| 194 | Ga0213876_10097083 | 3300021384 | Bacteria | 1561 |
| 195 | Ga0209563_101090 | 3300025230 | Bacteria | 7793 |
| 196 | Ga0209677_102351 | 3300025253 | Bacteria | 7241 |
| 197 | Ga0209148_1000316 | 3300025254 | Bacteria | 68104 |
| 198 | Ga0209233_1004623 | 3300025261 | Bacteria | 4654 |
| 199 | Ga0209673_1025297 | 3300025273 | Bacteria | 1976 |
| 200 | Ga0209564_1037958 | 3300025295 | Bacteria | 1348 |
| 201 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 202 | Ga0209758_1001405 | 3300025297 | Bacteria | 28529 |
| 203 | Ga0209758_1002396 | 3300025297 | Bacteria | 19259 |
| 204 | Ga0209758_1005929 | 3300025297 | Bacteria | 9080 |
| 205 | Ga0209758_1006430 | 3300025297 | Bacteria | 8450 |
| 206 | Ga0209758_1011834 | 3300025297 | Bacteria | 4981 |
| 207 | Ga0209758_1024111 | 3300025297 | Bacteria | 2722 |
| 208 | Ga0209758_1045760 | 3300025297 | Bacteria | 1585 |
| 209 | Ga0209256_1002946 | 3300025299 | Bacteria | 12776 |
| 210 | Ga0207426_1000374 | 3300025302 | Bacteria | 78498 |
| 211 | Ga0207426_1001007 | 3300025302 | Bacteria | 27365 |
| 212 | Ga0207426_1003263 | 3300025302 | Bacteria | 9067 |
| 213 | Ga0207426_1008613 | 3300025302 | Bacteria | 4097 |
| 214 | Ga0207426_1055401 | 3300025302 | Bacteria | 1161 |
| 215 | Ga0209257_1001741 | 3300025304 | Bacteria | 24170 |
| 216 | Ga0207692_10015365 | 3300025898 | Bacteria | 3366 |
| 217 | Ga0207710_10007424 | 3300025900 | Bacteria | 4643 |
| 218 | Ga0207688_10048222 | 3300025901 | Bacteria | 2380 |
| 219 | Ga0207688_10079889 | 3300025901 | Bacteria | 1866 |
| 220 | Ga0207680_10063441 | 3300025903 | Bacteria | 2261 |
| 221 | Ga0207647_10152140 | 3300025904 | Bacteria | 1352 |
| 222 | Ga0207699_10001489 | 3300025906 | Bacteria | 11129 |
| 223 | Ga0207645_10021194 | 3300025907 | Bacteria | 4241 |
| 224 | Ga0207645_10133652 | 3300025907 | Bacteria | 1615 |
| 225 | Ga0207707_10122357 | 3300025912 | Bacteria | 2275 |
| 226 | Ga0207707_10204665 | 3300025912 | Bacteria | 1720 |
| 227 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 228 | Ga0207671_10003084 | 3300025914 | Bacteria | 17008 |
| 229 | Ga0207693_10005512 | 3300025915 | Bacteria | 10533 |
| 230 | Ga0207693_10008449 | 3300025915 | Bacteria | 8426 |
| 231 | Ga0207693_10027452 | 3300025915 | Bacteria | 4501 |
| 232 | Ga0207693_10107351 | 3300025915 | Bacteria | 2190 |
| 233 | Ga0207663_10000425 | 3300025916 | Bacteria | 18308 |
| 234 | Ga0207660_10190158 | 3300025917 | Bacteria | 1598 |
| 235 | Ga0207657_10130332 | 3300025919 | Bacteria | 2061 |
| 236 | Ga0207649_10051415 | 3300025920 | Bacteria | 2552 |
| 237 | Ga0207652_10166552 | 3300025921 | Bacteria | 1976 |
| 238 | Ga0207681_10276192 | 3300025923 | Bacteria | 1321 |
| 239 | Ga0207694_10114799 | 3300025924 | Bacteria | 2145 |
| 240 | Ga0207650_10263109 | 3300025925 | Bacteria | 1400 |
| 241 | Ga0207687_10029064 | 3300025927 | Bacteria | 3717 |
| 242 | Ga0207687_10118046 | 3300025927 | Bacteria | 1979 |
| 243 | Ga0207700_10005022 | 3300025928 | Bacteria | 7870 |
| 244 | Ga0207700_10200398 | 3300025928 | Bacteria | 1682 |
| 245 | Ga0207700_10321855 | 3300025928 | Bacteria | 1340 |
| 246 | Ga0207664_10070747 | 3300025929 | Bacteria | 2808 |
| 247 | Ga0207664_10146369 | 3300025929 | Bacteria | 2003 |
| 248 | Ga0207644_10041059 | 3300025931 | Bacteria | 3271 |
| 249 | Ga0207644_10048873 | 3300025931 | Bacteria | 3026 |
| 250 | Ga0207690_10061018 | 3300025932 | Bacteria | 2562 |
| 251 | Ga0207706_10057132 | 3300025933 | Bacteria | 3439 |
| 252 | Ga0207686_10026307 | 3300025934 | Bacteria | 3393 |
| 253 | Ga0207709_10018115 | 3300025935 | Bacteria | 3940 |
| 254 | Ga0207670_10156546 | 3300025936 | Bacteria | 1697 |
| 255 | Ga0207704_10163037 | 3300025938 | Bacteria | 1589 |
| 256 | Ga0207665_10003367 | 3300025939 | Bacteria | 10702 |
| 257 | Ga0207665_10021180 | 3300025939 | Bacteria | 4273 |
| 258 | Ga0207691_10154586 | 3300025940 | Bacteria | 2015 |
| 259 | Ga0207711_10009422 | 3300025941 | Bacteria | 8151 |
| 260 | Ga0207711_10087313 | 3300025941 | Bacteria | 2736 |
| 261 | Ga0207689_10058438 | 3300025942 | Bacteria | 3172 |
| 262 | Ga0207661_10091550 | 3300025944 | Bacteria | 2534 |
| 263 | Ga0207661_10302400 | 3300025944 | Bacteria | 1434 |
| 264 | Ga0207667_10017077 | 3300025949 | Bacteria | 8183 |
| 265 | Ga0207668_10036615 | 3300025972 | Bacteria | 3276 |
| 266 | Ga0207640_10148610 | 3300025981 | Bacteria | 1718 |
| 267 | Ga0207658_10164790 | 3300025986 | Bacteria | 1820 |
| 268 | Ga0207677_10111086 | 3300026023 | Bacteria | 2041 |
| 269 | Ga0207703_10106496 | 3300026035 | Bacteria | 2385 |
| 270 | Ga0207703_10363723 | 3300026035 | Bacteria | 1335 |
| 271 | Ga0207639_10197023 | 3300026041 | Bacteria | 1725 |
| 272 | Ga0207678_10017546 | 3300026067 | Bacteria | 6287 |
| 273 | Ga0207678_10035287 | 3300026067 | Bacteria | 4354 |
| 274 | Ga0207678_10082834 | 3300026067 | Bacteria | 2744 |
| 275 | Ga0207678_10124265 | 3300026067 | Bacteria | 2202 |
| 276 | Ga0207641_10029014 | 3300026088 | Bacteria | 4574 |
| 277 | Ga0207641_10260941 | 3300026088 | Bacteria | 1622 |
| 278 | Ga0207648_10228656 | 3300026089 | Bacteria | 1654 |
| 279 | Ga0207674_10066740 | 3300026116 | Bacteria | 3623 |
| 280 | Ga0207674_10247135 | 3300026116 | Bacteria | 1731 |
| 281 | Ga0207674_10295465 | 3300026116 | Bacteria | 1569 |
| 282 | Ga0207683_10012926 | 3300026121 | Bacteria | 7128 |
| 283 | Ga0207683_10111222 | 3300026121 | Bacteria | 2453 |
| 284 | Ga0207683_10341545 | 3300026121 | Bacteria | 1373 |
| 285 | Ga0207683_10393857 | 3300026121 | Bacteria | 1274 |
| 286 | Ga0207698_10011050 | 3300026142 | Bacteria | 5837 |
| 287 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 288 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 289 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 290 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 291 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 292 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 293 | Ga0209588_1003621 | 3300027671 | Bacteria | 4291 |
| 294 | Ga0209813_10003650 | 3300027866 | Bacteria | 3617 |
| 295 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 296 | Ga0207428_10005963 | 3300027907 | Bacteria | 11282 |
| 297 | Ga0207428_10105287 | 3300027907 | Bacteria | 2176 |
| 298 | Ga0268266_10063727 | 3300028379 | Bacteria | 3182 |
| 299 | Ga0268266_10072985 | 3300028379 | Bacteria | 2977 |
| 300 | Ga0268266_10079592 | 3300028379 | Bacteria | 2853 |
| 301 | Ga0268266_10243943 | 3300028379 | Bacteria | 1659 |
| 302 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 303 | Ga0268264_10196256 | 3300028381 | Bacteria | 1843 |
| 304 | Ga0268264_10242994 | 3300028381 | Bacteria | 1668 |
| 305 | Ga0268264_10363661 | 3300028381 | Bacteria | 1381 |
| 306 | Ga0265334_10029740 | 3300028573 | Bacteria | 2189 |
| 307 | Ga0307517_10092417 | 3300028786 | Bacteria | 2462 |
| 308 | Ga0307517_10156434 | 3300028786 | Bacteria | 1545 |
| 309 | Ga0265338_10100786 | 3300028800 | Bacteria | 2353 |
| 310 | Ga0307511_10123445 | 3300030521 | Bacteria | 1590 |
| 311 | Ga0265330_10006763 | 3300031235 | Bacteria | 5653 |
| 312 | Ga0265330_10008114 | 3300031235 | Bacteria | 5070 |
| 313 | Ga0265332_10002834 | 3300031238 | Bacteria | 8597 |
| 314 | Ga0265332_10012634 | 3300031238 | Bacteria | 3744 |
| 315 | Ga0265325_10000026 | 3300031241 | Bacteria | 109937 |
| 316 | Ga0265325_10008677 | 3300031241 | Bacteria | 5982 |
| 317 | Ga0265325_10008781 | 3300031241 | Bacteria | 5941 |
| 318 | Ga0265325_10013389 | 3300031241 | Bacteria | 4671 |
| 319 | Ga0265325_10051223 | 3300031241 | Bacteria | 2123 |
| 320 | Ga0265340_10001337 | 3300031247 | Bacteria | 14130 |
| 321 | Ga0265340_10003564 | 3300031247 | Bacteria | 8764 |
| 322 | Ga0265339_10003955 | 3300031249 | Bacteria | 10246 |
| 323 | Ga0265339_10028820 | 3300031249 | Bacteria | 3154 |
| 324 | Ga0265331_10006990 | 3300031250 | Bacteria | 6589 |
| 325 | Ga0265331_10059477 | 3300031250 | Bacteria | 1807 |
| 326 | Ga0265313_10013520 | 3300031595 | Bacteria | 4893 |
| 327 | Ga0265313_10027363 | 3300031595 | Bacteria | 2985 |
| 328 | Ga0265313_10027511 | 3300031595 | Bacteria | 2975 |
| 329 | Ga0265313_10049471 | 3300031595 | Bacteria | 2022 |
| 330 | Ga0265314_10002205 | 3300031711 | Bacteria | 20322 |
| 331 | Ga0265314_10008159 | 3300031711 | Bacteria | 9012 |
| 332 | Ga0265342_10000082 | 3300031712 | Bacteria | 102532 |
| 333 | Ga0265342_10000291 | 3300031712 | Bacteria | 56828 |
| 334 | Ga0265342_10005588 | 3300031712 | Bacteria | 9535 |
| 335 | Ga0265342_10010349 | 3300031712 | Bacteria | 6481 |
| 336 | Ga0265342_10014750 | 3300031712 | Bacteria | 5175 |
| 337 | Ga0307516_10094154 | 3300031730 | Bacteria | 2820 |
| 338 | Ga0307507_10021924 | 3300033179 | Bacteria | 7087 |
| 339 | Ga0307510_10026321 | 3300033180 | Bacteria | 6688 |
| 340 | Ga0307510_10230366 | 3300033180 | Bacteria | 1356 |
| 341 | Ga0373959_0008517 | 3300034820 | Bacteria | 1748 |
| 342 | Ga0373934_0047419 | 3300035086 | Bacteria | 1699 |
| 343 | Ga0373949_0033249 | 3300035090 | Bacteria | 1238 |
| 344 | Ga0373952_0016608 | 3300035092 | Bacteria | 1500 |
| 345 | Ga0373923_0001865 | 3300035111 | Bacteria | 6270 |
| 346 | Ga0373936_0006791 | 3300035113 | Bacteria | 4308 |
| 347 | Ga0373936_0030592 | 3300035113 | Bacteria | 2123 |
| 348 | Ga0373936_0049669 | 3300035113 | Bacteria | 1695 |
| 349 | Ga0373941_0021210 | 3300035115 | Bacteria | 1830 |
| 350 | Ga0373945_0000946 | 3300035116 | Bacteria | 8634 |
| 351 | Ga0373945_0039019 | 3300035116 | Bacteria | 1710 |
| 352 | Ga0373945_0124728 | 3300035116 | Bacteria | 1027 |
| 353 | Ga0373953_0000156 | 3300035117 | Bacteria | 17676 |
| 354 | Ga0373953_0062323 | 3300035117 | Bacteria | 1527 |
| 355 | Ga0373954_0011119 | 3300035118 | Bacteria | 3982 |
| 356 | Ga0373954_0013754 | 3300035118 | Bacteria | 3606 |
| 357 | Ga0373954_0053883 | 3300035118 | Bacteria | 1891 |
| 358 | Ga0373956_0004148 | 3300035119 | Bacteria | 5813 |
| 359 | Ga0373956_0011980 | 3300035119 | Bacteria | 3584 |
| 360 | Ga0373956_0118121 | 3300035119 | Bacteria | 1237 |
| 361 | Ga0373957_0001409 | 3300035120 | Bacteria | 6498 |
| 362 | Ga0373957_0006204 | 3300035120 | Bacteria | 3757 |
| 363 | Ga0373957_0022408 | 3300035120 | Bacteria | 2251 |
| 364 | Ga0373943_0001934 | 3300035170 | Bacteria | 9384 |
| 365 | Ga0373943_0019251 | 3300035170 | Bacteria | 3139 |
| 366 | Ga0373943_0086878 | 3300035170 | Bacteria | 1613 |
| 367 | Ga0373946_0007183 | 3300035171 | Bacteria | 4068 |
| 368 | Ga0373946_0024460 | 3300035171 | Bacteria | 2366 |
| 369 | Ga0373955_0000395 | 3300035172 | Bacteria | 18509 |
| 370 | Ga0373955_0002215 | 3300035172 | Bacteria | 8432 |
| 371 | Ga0373955_0009768 | 3300035172 | Bacteria | 4508 |
| 372 | Ga0373955_0050440 | 3300035172 | Bacteria | 2263 |
| 373 | Ga0373924_0007061 | 3300035410 | Bacteria | 4043 |
| 374 | Ga0373924_0011377 | 3300035410 | Bacteria | 3304 |
| 375 | Ga0373924_0043936 | 3300035410 | Bacteria | 1836 |
| 376 | Ga0373931_0013339 | 3300035691 | Bacteria | 3999 |
| 377 | Ga0373931_0029855 | 3300035691 | Bacteria | 2803 |
| 378 | Ga0373931_0094834 | 3300035691 | Bacteria | 1669 |
| 379 | Ga0373935_0001093 | 3300035692 | Bacteria | 14823 |
| 380 | Ga0373935_0029981 | 3300035692 | Bacteria | 3368 |
| 381 | Ga0373935_0033201 | 3300035692 | Bacteria | 3211 |
| 382 | Ga0373935_0034411 | 3300035692 | Bacteria | 3157 |
| 383 | Ga0373927_0004563 | 3300035695 | Bacteria | 9675 |
| 384 | Ga0373927_0021903 | 3300035695 | Bacteria | 4188 |
| 385 | Ga0373927_0052489 | 3300035695 | Bacteria | 2637 |
| 386 | Ga0373927_0175979 | 3300035695 | Bacteria | 1403 |
| 387 | Ga0373933_0004898 | 3300035724 | Bacteria | 7306 |
| 388 | Ga0373933_0007313 | 3300035724 | Bacteria | 6024 |
| 389 | Ga0373933_0032029 | 3300035724 | Bacteria | 3054 |
| 390 | Ga0373933_0102588 | 3300035724 | Bacteria | 1776 |
| 391 | Ga0373947_0000288 | 3300035725 | Bacteria | 28482 |
| 392 | Ga0373947_0024233 | 3300035725 | Bacteria | 3535 |
| 393 | Ga0373947_0031415 | 3300035725 | Bacteria | 3125 |
| 394 | Ga0373947_0056162 | 3300035725 | Bacteria | 2379 |
| 395 | Ga0373947_0163548 | 3300035725 | Bacteria | 1440 |
| 396 | Ga0373937_0000996 | 3300036401 | Bacteria | 24045 |
| 397 | Ga0373937_0012002 | 3300036401 | Bacteria | 7606 |
| 398 | Ga0373937_0147147 | 3300036401 | Bacteria | 2206 |
| 399 | Ga0373937_0300677 | 3300036401 | Bacteria | 1517 |
| 400 | Ga0373937_0566416 | 3300036401 | Bacteria | 1079 |
| 401 | Ga0373925_0002967 | 3300037068 | Bacteria | 13392 |
| 402 | Ga0373925_0018541 | 3300037068 | Bacteria | 5059 |
| 403 | Ga0373925_0018593 | 3300037068 | Bacteria | 5052 |
| 404 | Ga0373925_0021989 | 3300037068 | Bacteria | 4648 |
| 405 | Ga0373925_0027832 | 3300037068 | Bacteria | 4138 |
| 406 | Ga0373925_0277657 | 3300037068 | Bacteria | 1349 |
| 407 | Ga0395899_0009357 | 3300037312 | Bacteria | 7526 |
| 408 | Ga0395900_0119313 | 3300037418 | Bacteria | 2707 |
| 409 | Ga0395900_0178657 | 3300037418 | Bacteria | 2158 |
| 410 | Ga0395898_0014236 | 3300037466 | Bacteria | 8176 |
| 411 | Ga0395898_0073654 | 3300037466 | Bacteria | 3299 |
| 412 | Ga0395905_0028290 | 3300037471 | Bacteria | 5283 |
| 413 | Ga0395901_0078788 | 3300038443 | Bacteria | 3440 |
| 414 | Ga0395901_0127711 | 3300038443 | Bacteria | 2672 |
| 415 | Ga0395901_0366626 | 3300038443 | Bacteria | 1484 |
| 416 | Ga0436365_1106099 | 3300039437 | Bacteria | 4187 |
| 417 | Ga0436365_1584283 | 3300039437 | Bacteria | 16431 |
| 418 | Ga0436360_0575108 | 3300039438 | Bacteria | 1546 |
| 419 | Ga0436362_1127865 | 3300039453 | Bacteria | 2188 |
| 420 | Ga0451793_1689633 | 3300041452 | Bacteria | 4087 |
| 421 | Ga0439444_0004615 | 3300042437 | Bacteria | 2011 |
| 422 | Ga0466972_0000177 | 3300044658 | Bacteria | 49318 |
| 423 | Ga0466966_0000474 | 3300044684 | Bacteria | 25834 |
| 424 | Ga0466966_0259602 | 3300044684 | Bacteria | 1046 |
| 425 | Ga0466961_0000023 | 3300044693 | Bacteria | 97134 |
| 426 | Ga0466963_0113294 | 3300044694 | Bacteria | 1863 |
| 427 | Ga0466964_0036413 | 3300044706 | Bacteria | 1973 |
| 428 | Ga0466959_0000726 | 3300045049 | Bacteria | 19220 |
| 429 | Ga0466958_0050655 | 3300045836 | Bacteria | 2514 |
| 430 | Ga0466967_0351957 | 3300045976 | Bacteria | 1426 |
| 431 | Ga0495592_0016624 | 3300046454 | Bacteria | 5584 |
| 432 | Ga0495592_0025569 | 3300046454 | Bacteria | 4481 |
| 433 | Ga0495592_0041102 | 3300046454 | Bacteria | 3466 |
| 434 | Ga0495592_0067804 | 3300046454 | Bacteria | 2606 |
| 435 | Ga0495592_0181855 | 3300046454 | Bacteria | 1431 |
| 436 | Ga0495603_0008338 | 3300046455 | Bacteria | 6265 |
| 437 | Ga0495603_0026574 | 3300046455 | Bacteria | 3496 |
| 438 | Ga0495603_0027248 | 3300046455 | Bacteria | 3449 |
| 439 | Ga0495603_0067670 | 3300046455 | Bacteria | 2102 |
| 440 | Ga0495603_0074304 | 3300046455 | Bacteria | 1996 |
| 441 | Ga0495591_030268 | 3300046458 | Bacteria | 1636 |
| 442 | Ga0495591_051529 | 3300046458 | Bacteria | 1123 |
| 443 | Ga0495629_0000183 | 3300046459 | Bacteria | 56534 |
| 444 | Ga0495629_0000655 | 3300046459 | Bacteria | 27984 |
| 445 | Ga0495629_0064830 | 3300046459 | Bacteria | 2550 |
| 446 | Ga0495629_0337319 | 3300046459 | Bacteria | 1029 |
| 447 | Ga0495638_0009065 | 3300046460 | Bacteria | 7011 |
| 448 | Ga0495638_0051383 | 3300046460 | Bacteria | 2570 |
| 449 | Ga0495641_0054290 | 3300046461 | Bacteria | 1821 |
| 450 | Ga0495651_0005368 | 3300046462 | Bacteria | 9782 |
| 451 | Ga0495651_0007056 | 3300046462 | Bacteria | 8588 |
| 452 | Ga0495651_0008033 | 3300046462 | Bacteria | 8090 |
| 453 | Ga0495651_0010752 | 3300046462 | Bacteria | 7037 |
| 454 | Ga0495651_0077352 | 3300046462 | Bacteria | 2519 |
| 455 | Ga0495653_0004854 | 3300046463 | Bacteria | 10903 |
| 456 | Ga0495653_0025885 | 3300046463 | Bacteria | 4708 |
| 457 | Ga0495653_0035742 | 3300046463 | Bacteria | 3918 |
| 458 | Ga0495653_0142291 | 3300046463 | Bacteria | 1685 |
| 459 | Ga0495580_0106313 | 3300046472 | Bacteria | 1949 |
| 460 | Ga0495582_0001121 | 3300046473 | Bacteria | 15057 |
| 461 | Ga0495582_0097360 | 3300046473 | Bacteria | 1645 |
| 462 | Ga0495605_0041457 | 3300046474 | Bacteria | 2293 |
| 463 | Ga0495605_0069308 | 3300046474 | Bacteria | 1670 |
| 464 | Ga0495639_0009485 | 3300046475 | Bacteria | 4174 |
| 465 | Ga0495662_0072451 | 3300046476 | Bacteria | 1670 |
| 466 | Ga0495664_0018150 | 3300046477 | Bacteria | 4025 |
| 467 | Ga0495664_0032191 | 3300046477 | Bacteria | 3076 |
| 468 | Ga0495664_0102880 | 3300046477 | Bacteria | 1721 |
| 469 | Ga0495584_0067035 | 3300046491 | Bacteria | 1805 |
| 470 | Ga0495585_0003428 | 3300046492 | Bacteria | 10719 |
| 471 | Ga0495594_0017097 | 3300046499 | Bacteria | 3828 |
| 472 | Ga0495594_0155501 | 3300046499 | Bacteria | 1298 |
| 473 | Ga0495596_0000078 | 3300046500 | Bacteria | 67709 |
| 474 | Ga0495596_0103616 | 3300046500 | Bacteria | 1105 |
| 475 | Ga0495607_0009340 | 3300046501 | Bacteria | 6643 |
| 476 | Ga0495606_0010252 | 3300046507 | Bacteria | 7806 |
| 477 | Ga0495608_0002221 | 3300046511 | Bacteria | 14008 |
| 478 | Ga0495608_0009154 | 3300046511 | Bacteria | 6922 |
| 479 | Ga0495608_0015766 | 3300046511 | Bacteria | 5230 |
| 480 | Ga0495610_0057636 | 3300046512 | Bacteria | 1862 |
| 481 | Ga0495616_0093166 | 3300046513 | Bacteria | 1423 |
| 482 | Ga0495618_0013409 | 3300046514 | Bacteria | 4987 |
| 483 | Ga0495618_0049560 | 3300046514 | Bacteria | 2652 |
| 484 | Ga0495620_0014591 | 3300046515 | Bacteria | 3990 |
| 485 | Ga0495620_0052579 | 3300046515 | Bacteria | 1729 |
| 486 | Ga0495628_0000950 | 3300046516 | Bacteria | 26607 |
| 487 | Ga0495628_0008803 | 3300046516 | Bacteria | 8638 |
| 488 | Ga0495628_0049682 | 3300046516 | Bacteria | 3320 |
| 489 | Ga0495628_0207020 | 3300046516 | Bacteria | 1476 |
| 490 | Ga0495630_0069053 | 3300046517 | Bacteria | 2658 |
| 491 | Ga0495630_0127087 | 3300046517 | Bacteria | 1935 |
| 492 | Ga0495631_0000031 | 3300046518 | Bacteria | 85555 |
| 493 | Ga0495631_0060865 | 3300046518 | Bacteria | 1638 |
| 494 | Ga0495631_0081087 | 3300046518 | Bacteria | 1400 |
| 495 | Ga0495637_0000365 | 3300046520 | Bacteria | 34448 |
| 496 | Ga0495643_0104565 | 3300046522 | Bacteria | 1447 |
| 497 | Ga0495644_0000234 | 3300046523 | Bacteria | 26118 |
| 498 | Ga0495648_0017345 | 3300046524 | Bacteria | 5150 |
| 499 | Ga0495648_0023302 | 3300046524 | Bacteria | 4244 |
| 500 | Ga0495648_0163601 | 3300046524 | Bacteria | 1147 |
| 501 | Ga0495666_0046661 | 3300046526 | Bacteria | 2088 |
| 502 | Ga0495642_0017866 | 3300046528 | Bacteria | 2772 |
| 503 | Ga0495652_0002257 | 3300046529 | Bacteria | 20113 |
| 504 | Ga0495652_0026522 | 3300046529 | Bacteria | 5118 |
| 505 | Ga0495652_0030285 | 3300046529 | Bacteria | 4747 |
| 506 | Ga0495652_0038700 | 3300046529 | Bacteria | 4129 |
| 507 | Ga0495652_0056866 | 3300046529 | Bacteria | 3320 |
| 508 | Ga0495652_0106339 | 3300046529 | Bacteria | 2266 |
| 509 | Ga0495652_0136539 | 3300046529 | Bacteria | 1934 |
| 510 | Ga0495652_0278038 | 3300046529 | Bacteria | 1227 |
| 511 | Ga0495665_0028743 | 3300046531 | Bacteria | 2979 |
| 512 | Ga0495640_0009446 | 3300046533 | Bacteria | 7597 |
| 513 | Ga0495640_0011385 | 3300046533 | Bacteria | 6843 |
| 514 | Ga0495640_0012912 | 3300046533 | Bacteria | 6368 |
| 515 | Ga0495640_0018366 | 3300046533 | Bacteria | 5190 |
| 516 | Ga0495640_0042700 | 3300046533 | Bacteria | 3161 |
| 517 | Ga0495640_0068492 | 3300046533 | Bacteria | 2388 |
| 518 | Ga0495587_0002956 | 3300046536 | Bacteria | 11364 |
| 519 | Ga0495587_0007940 | 3300046536 | Bacteria | 6854 |
| 520 | Ga0495587_0018590 | 3300046536 | Bacteria | 4309 |
| 521 | Ga0495587_0029301 | 3300046536 | Bacteria | 3342 |
| 522 | Ga0495587_0029645 | 3300046536 | Bacteria | 3321 |
| 523 | Ga0495621_0000357 | 3300046539 | Bacteria | 11123 |
| 524 | Ga0495645_0001487 | 3300046543 | Bacteria | 15879 |
| 525 | Ga0495645_0002475 | 3300046543 | Bacteria | 12548 |
| 526 | Ga0495645_0002973 | 3300046543 | Bacteria | 11471 |
| 527 | Ga0495645_0014710 | 3300046543 | Bacteria | 5557 |
| 528 | Ga0495645_0042082 | 3300046543 | Bacteria | 3330 |
| 529 | Ga0495622_0008747 | 3300046557 | Bacteria | 4691 |
| 530 | Ga0495622_0015742 | 3300046557 | Bacteria | 3517 |
| 531 | Ga0495622_0064788 | 3300046557 | Bacteria | 1690 |
| 532 | Ga0495633_0002692 | 3300046558 | Bacteria | 12335 |
| 533 | Ga0495667_0008800 | 3300046559 | Bacteria | 6864 |
| 534 | Ga0495667_0034771 | 3300046559 | Bacteria | 3369 |
| 535 | Ga0495667_0230581 | 3300046559 | Bacteria | 1180 |
| 536 | Ga0495667_0250542 | 3300046559 | Bacteria | 1127 |
| 537 | Ga0495656_0000174 | 3300046615 | Bacteria | 22784 |
| 538 | Ga0495668_0012879 | 3300046616 | Bacteria | 4952 |
| 539 | Ga0495668_0156697 | 3300046616 | Bacteria | 1247 |
| 540 | Ga0495668_0212793 | 3300046616 | Bacteria | 1058 |
| 541 | Ga0495634_0011443 | 3300046642 | Bacteria | 6457 |
| 542 | Ga0495634_0025684 | 3300046642 | Bacteria | 4115 |
| 543 | Ga0495634_0028246 | 3300046642 | Bacteria | 3895 |
| 544 | Ga0495634_0030566 | 3300046642 | Bacteria | 3719 |
| 545 | Ga0495634_0038590 | 3300046642 | Bacteria | 3255 |
| 546 | Ga0495611_0054934 | 3300046648 | Bacteria | 1801 |
| 547 | Ga0495625_0005608 | 3300046660 | Bacteria | 11377 |
| 548 | Ga0495635_0000380 | 3300046663 | Bacteria | 28177 |
| 549 | Ga0495635_0006494 | 3300046663 | Bacteria | 8155 |
| 550 | Ga0495635_0036420 | 3300046663 | Bacteria | 3411 |
| 551 | Ga0495635_0102821 | 3300046663 | Bacteria | 1952 |
| 552 | Ga0495635_0257140 | 3300046663 | Bacteria | 1176 |
| 553 | Ga0495659_0000220 | 3300046664 | Bacteria | 24427 |
| 554 | Ga0495661_0147563 | 3300046665 | Bacteria | 1273 |
| 555 | Ga0495588_0011399 | 3300046674 | Bacteria | 4170 |
| 556 | Ga0495588_0017305 | 3300046674 | Bacteria | 3497 |
| 557 | Ga0495588_0096356 | 3300046674 | Bacteria | 1552 |
| 558 | Ga0495588_0134287 | 3300046674 | Bacteria | 1306 |
| 559 | Ga0495657_0001852 | 3300046675 | Bacteria | 18026 |
| 560 | Ga0495657_0004929 | 3300046675 | Bacteria | 10619 |
| 561 | Ga0495657_0005248 | 3300046675 | Bacteria | 10255 |
| 562 | Ga0495657_0021999 | 3300046675 | Bacteria | 4571 |
| 563 | Ga0495657_0098633 | 3300046675 | Bacteria | 1864 |
| 564 | Ga0495657_0187104 | 3300046675 | Bacteria | 1267 |
| 565 | Ga0495599_0004515 | 3300046678 | Bacteria | 8252 |
| 566 | Ga0495599_0027283 | 3300046678 | Bacteria | 3579 |
| 567 | Ga0495599_0068007 | 3300046678 | Bacteria | 2224 |
| 568 | Ga0495623_0001484 | 3300046679 | Bacteria | 15894 |
| 569 | Ga0495623_0002235 | 3300046679 | Bacteria | 12884 |
| 570 | Ga0495623_0004582 | 3300046679 | Bacteria | 9082 |
| 571 | Ga0495646_0006953 | 3300046680 | Bacteria | 7181 |
| 572 | Ga0495646_0055279 | 3300046680 | Bacteria | 2384 |
| 573 | Ga0495647_0029945 | 3300046681 | Bacteria | 2016 |
| 574 | Ga0495647_0055145 | 3300046681 | Bacteria | 1555 |
| 575 | Ga0495658_0000357 | 3300046683 | Bacteria | 25736 |
| 576 | Ga0495658_0040718 | 3300046683 | Bacteria | 2584 |
| 577 | Ga0495669_0015903 | 3300046684 | Bacteria | 3221 |
| 578 | Ga0495613_0009346 | 3300046689 | Bacteria | 7273 |
| 579 | Ga0495613_0013096 | 3300046689 | Bacteria | 6163 |
| 580 | Ga0495613_0030108 | 3300046689 | Bacteria | 4033 |
| 581 | Ga0495613_0086422 | 3300046689 | Bacteria | 2274 |
| 582 | Ga0495613_0153263 | 3300046689 | Bacteria | 1642 |
| 583 | Ga0495624_0100338 | 3300046690 | Bacteria | 1782 |
| 584 | Ga0495624_0151959 | 3300046690 | Bacteria | 1416 |
| 585 | Ga0495670_0000414 | 3300046691 | Bacteria | 20494 |
| 586 | Ga0495671_0061704 | 3300046692 | Bacteria | 1849 |
| 587 | Ga0495649_0018372 | 3300046694 | Bacteria | 3934 |
| 588 | Ga0495600_0007486 | 3300046809 | Bacteria | 6681 |
| 589 | Ga0495600_0014864 | 3300046809 | Bacteria | 4911 |
| 590 | Ga0495600_0067298 | 3300046809 | Bacteria | 2341 |
| 591 | Ga0495600_0215515 | 3300046809 | Bacteria | 1229 |
| 592 | Ga0495660_0050315 | 3300046810 | Bacteria | 2271 |
| 593 | Ga0495581_0010000 | 3300047315 | Bacteria | 5486 |
| 594 | Ga0495581_0103688 | 3300047315 | Bacteria | 1653 |
| 595 | Ga0495604_0008886 | 3300047317 | Bacteria | 7941 |
| 596 | Ga0495604_0017648 | 3300047317 | Bacteria | 5712 |
| 597 | Ga0495604_0038454 | 3300047317 | Bacteria | 3764 |
| 598 | Ga0495604_0050016 | 3300047317 | Bacteria | 3246 |
| 599 | Ga0495604_0071653 | 3300047317 | Bacteria | 2620 |
| 600 | Ga0495604_0138503 | 3300047317 | Bacteria | 1741 |
| 601 | Ga0495636_0002324 | 3300047318 | Bacteria | 7303 |
| 602 | Ga0495674_0024907 | 3300047319 | Bacteria | 5492 |
| 603 | Ga0495674_0044316 | 3300047319 | Bacteria | 3955 |
| 604 | Ga0495674_0055217 | 3300047319 | Bacteria | 3484 |
| 605 | Ga0495674_0083157 | 3300047319 | Bacteria | 2744 |
| 606 | Ga0495674_0168794 | 3300047319 | Bacteria | 1827 |
| 607 | Ga0495676_0014158 | 3300047321 | Bacteria | 7141 |
| 608 | Ga0495680_0001462 | 3300047322 | Bacteria | 25495 |
| 609 | Ga0495680_0002016 | 3300047322 | Bacteria | 21294 |
| 610 | Ga0495680_0012241 | 3300047322 | Bacteria | 7561 |
| 611 | Ga0495680_0081922 | 3300047322 | Bacteria | 2435 |
| 612 | Ga0495680_0281194 | 3300047322 | Bacteria | 1173 |
| 613 | Ga0495675_0001856 | 3300047444 | Bacteria | 12578 |
| 614 | Ga0495675_0014120 | 3300047444 | Bacteria | 5049 |
| 615 | Ga0495675_0060074 | 3300047444 | Bacteria | 2409 |
| 616 | Ga0495677_0081228 | 3300047445 | Bacteria | 1215 |
| 617 | Ga0495685_018416 | 3300047447 | Bacteria | 2397 |
| 618 | Ga0495673_0074730 | 3300047469 | Bacteria | 1417 |
| 619 | Ga0495684_0000294 | 3300047471 | Bacteria | 40596 |
| 620 | Ga0495684_0001528 | 3300047471 | Bacteria | 18538 |
| 621 | Ga0495684_0048992 | 3300047471 | Bacteria | 3230 |
| 622 | Ga0495684_0066991 | 3300047471 | Bacteria | 2730 |
| 623 | Ga0495684_0103985 | 3300047471 | Bacteria | 2146 |
| 624 | Ga0495686_0052087 | 3300047472 | Bacteria | 2567 |
| 625 | Ga0495593_0000744 | 3300047673 | Bacteria | 18938 |
| 626 | Ga0495593_0010818 | 3300047673 | Bacteria | 5260 |
| 627 | Ga0495593_0036316 | 3300047673 | Bacteria | 2672 |
| 628 | Ga0495602_0001368 | 3300048088 | Bacteria | 24064 |
| 629 | Ga0495602_0004084 | 3300048088 | Bacteria | 15203 |
| 630 | Ga0495614_0005613 | 3300048089 | Bacteria | 5658 |
| 631 | Ga0495614_0093364 | 3300048089 | Bacteria | 1310 |
| 632 | Ga0495614_0114140 | 3300048089 | Bacteria | 1187 |
| 633 | Ga0496100_0002106 | 3300048903 | Bacteria | 10022 |
| 634 | Ga0496100_0111181 | 3300048903 | Bacteria | 1903 |
| 635 | Ga0496100_0152266 | 3300048903 | Bacteria | 1651 |
| 636 | Ga0496101_0015113 | 3300048904 | Bacteria | 5195 |
| 637 | Ga0496101_0028676 | 3300048904 | Bacteria | 3888 |
| 638 | Ga0496102_0005062 | 3300048905 | Bacteria | 11158 |
| 639 | Ga0496104_0001363 | 3300048907 | Bacteria | 21131 |
| 640 | Ga0496104_0002005 | 3300048907 | Bacteria | 17670 |
| 641 | Ga0496104_0023320 | 3300048907 | Bacteria | 5689 |
| 642 | Ga0496104_0158815 | 3300048907 | Bacteria | 2169 |
| 643 | Ga0496104_0210555 | 3300048907 | Bacteria | 1855 |
| 644 | Ga0496104_0513471 | 3300048907 | Bacteria | 1109 |
| 645 | Ga0496105_0033897 | 3300048908 | Bacteria | 4197 |
| 646 | Ga0496105_0045632 | 3300048908 | Bacteria | 3616 |
| 647 | Ga0496105_0124238 | 3300048908 | Bacteria | 2127 |
| 648 | Ga0496105_0133756 | 3300048908 | Bacteria | 2043 |
| 649 | Ga0496106_0014884 | 3300048909 | Bacteria | 5755 |
| 650 | Ga0496107_0001189 | 3300048910 | Bacteria | 15840 |
| 651 | Ga0496107_0054251 | 3300048910 | Bacteria | 2892 |
| 652 | Ga0496107_0111890 | 3300048910 | Bacteria | 2007 |
| 653 | Ga0496108_0010537 | 3300048911 | Bacteria | 7512 |
| 654 | Ga0496108_0050304 | 3300048911 | Bacteria | 3488 |
| 655 | Ga0496109_0000700 | 3300048912 | Bacteria | 27897 |
| 656 | Ga0496109_0171908 | 3300048912 | Bacteria | 2033 |
| 657 | Ga0496109_0208827 | 3300048912 | Bacteria | 1836 |
| 658 | Ga0496110_0073990 | 3300048913 | Bacteria | 3024 |
| 659 | Ga0496110_0150513 | 3300048913 | Bacteria | 2107 |
| 660 | Ga0496110_0197818 | 3300048913 | Bacteria | 1826 |
| 661 | Ga0496110_0217372 | 3300048913 | Bacteria | 1738 |
| 662 | Ga0496111_0002128 | 3300048914 | Bacteria | 11829 |
| 663 | Ga0496111_0030278 | 3300048914 | Bacteria | 3849 |
| 664 | Ga0496111_0075974 | 3300048914 | Bacteria | 2448 |
| 665 | Ga0496111_0199970 | 3300048914 | Bacteria | 1486 |
| 666 | Ga0496112_0006626 | 3300048915 | Bacteria | 10196 |
| 667 | Ga0496112_0043988 | 3300048915 | Bacteria | 4373 |
| 668 | Ga0496112_0140196 | 3300048915 | Bacteria | 2387 |
| 669 | Ga0496113_0001279 | 3300048916 | Bacteria | 13876 |
| 670 | Ga0496113_0064157 | 3300048916 | Bacteria | 2776 |
| 671 | Ga0496113_0153261 | 3300048916 | Bacteria | 1819 |
| 672 | Ga0496113_0292007 | 3300048916 | Bacteria | 1304 |
| 673 | Ga0496114_0155999 | 3300048917 | Bacteria | 1982 |
| 674 | Ga0496114_0354705 | 3300048917 | Bacteria | 1297 |
| 675 | Ga0496115_0024926 | 3300048918 | Bacteria | 4652 |
| 676 | Ga0496115_0050932 | 3300048918 | Bacteria | 3320 |
| 677 | Ga0496115_0109328 | 3300048918 | Bacteria | 2270 |
| 678 | Ga0496116_0182671 | 3300048919 | Bacteria | 1120 |
| 679 | Ga0496117_0081359 | 3300048920 | Bacteria | 2126 |
| 680 | Ga0496118_0107467 | 3300048921 | Bacteria | 1863 |
| 681 | Ga0496118_0183053 | 3300048921 | Bacteria | 1263 |
| 682 | Ga0496119_0012670 | 3300048922 | Bacteria | 6823 |
| 683 | Ga0496119_0058223 | 3300048922 | Bacteria | 2330 |
| 684 | Ga0496121_0031768 | 3300048924 | Bacteria | 4816 |
| 685 | Ga0496121_0050990 | 3300048924 | Bacteria | 3489 |
| 686 | Ga0496121_0298115 | 3300048924 | Bacteria | 1095 |
| 687 | Ga0496124_0061180 | 3300048927 | Bacteria | 3157 |
| 688 | Ga0496126_0044707 | 3300048929 | Bacteria | 4076 |
| 689 | Ga0496126_0053837 | 3300048929 | Bacteria | 3648 |
| 690 | Ga0496126_0195743 | 3300048929 | Bacteria | 1709 |
| 691 | Ga0501032_0095172 | 3300049569 | Bacteria | 1974 |
| 692 | Ga0501033_0232716 | 3300049570 | Bacteria | 1308 |
| 693 | Ga0501034_0064750 | 3300049571 | Bacteria | 3669 |
| 694 | Ga0501034_0264153 | 3300049571 | Bacteria | 1663 |
| 695 | Ga0501036_0005977 | 3300049572 | Bacteria | 9869 |
| 696 | Ga0501037_0003231 | 3300049573 | Bacteria | 11812 |
| 697 | Ga0501037_0031825 | 3300049573 | Bacteria | 3895 |
| 698 | Ga0501038_0020838 | 3300049574 | Bacteria | 5891 |
| 699 | Ga0501038_0058873 | 3300049574 | Bacteria | 3292 |
| 700 | Ga0501038_0089706 | 3300049574 | Bacteria | 2578 |
| 701 | Ga0501039_0001869 | 3300049575 | Bacteria | 15563 |
| 702 | Ga0501043_0134930 | 3300049579 | Bacteria | 1934 |
| 703 | Ga0501047_0008244 | 3300049581 | Bacteria | 9834 |
| 704 | Ga0501047_0011033 | 3300049581 | Bacteria | 8549 |
| 705 | Ga0501047_0045692 | 3300049581 | Bacteria | 4234 |
| 706 | Ga0501047_0128370 | 3300049581 | Bacteria | 2415 |
| 707 | Ga0501048_0034771 | 3300049582 | Bacteria | 3632 |
| 708 | Ga0501067_0172555 | 3300049583 | Bacteria | 1204 |
| 709 | Ga0501068_0014174 | 3300049584 | Bacteria | 4553 |
| 710 | Ga0501069_0000929 | 3300049585 | Bacteria | 13961 |
| 711 | Ga0501070_0038726 | 3300049586 | Bacteria | 3978 |
| 712 | Ga0501071_0079370 | 3300049587 | Bacteria | 2399 |
| 713 | Ga0501072_0177907 | 3300049588 | Bacteria | 1697 |
| 714 | Ga0501072_0186968 | 3300049588 | Bacteria | 1652 |
| 715 | Ga0501073_0017185 | 3300049589 | Bacteria | 5239 |
| 716 | Ga0501074_0022225 | 3300049590 | Bacteria | 4609 |
| 717 | Ga0501074_0089456 | 3300049590 | Bacteria | 2205 |
| 718 | Ga0501076_0362473 | 3300049592 | Bacteria | 1191 |
| 719 | Ga0501079_0064503 | 3300049741 | Bacteria | 2825 |
| 720 | Ga0501079_0099173 | 3300049741 | Bacteria | 2258 |
| 721 | Ga0501079_0210187 | 3300049741 | Bacteria | 1520 |
| 722 | Ga0501080_0031235 | 3300049742 | Bacteria | 4963 |
| 723 | Ga0501081_0168148 | 3300049743 | Bacteria | 1582 |
| 724 | Ga0501083_0010731 | 3300049744 | Bacteria | 6442 |
| 725 | Ga0501083_0047864 | 3300049744 | Bacteria | 2887 |
| 726 | Ga0501035_0014209 | 3300049822 | Bacteria | 7348 |
| 727 | Ga0501035_0060738 | 3300049822 | Bacteria | 3365 |
| 728 | Ga0501035_0340851 | 3300049822 | Bacteria | 1256 |
| 729 | Ga0501044_0000286 | 3300049823 | Bacteria | 64389 |
| 730 | Ga0501044_0003023 | 3300049823 | Bacteria | 19032 |
| 731 | Ga0501044_0034776 | 3300049823 | Bacteria | 5282 |
| 732 | Ga0501044_0093844 | 3300049823 | Bacteria | 3025 |
| 733 | Ga0501045_0114802 | 3300049824 | Bacteria | 1997 |
| 734 | nmdc:mga03683_4316_c1 | 3300050489 | Bacteria | 4700 |
| 735 | nmdc:mga03n38_13494_c2 | 3300050490 | Bacteria | 2796 |
| 736 | nmdc:mga00v17_80108_c1 | 3300050491 | Bacteria | 2038 |
| 737 | nmdc:mga0yw44_18826_c1 | 3300050492 | Bacteria | 3792 |
| 738 | nmdc:mga0yw44_40147_c1 | 3300050492 | Bacteria | 2779 |
| 739 | nmdc:mga0k408_6246_c1 | 3300050493 | Bacteria | 6358 |
| 740 | nmdc:mga0k408_8333_c1 | 3300050493 | Bacteria | 5562 |
| 741 | nmdc:mga0k408_94704_c1 | 3300050493 | Bacteria | 1756 |
| 742 | nmdc:mga06z11_112871_c1 | 3300050494 | Bacteria | 1507 |
| 743 | nmdc:mga06z11_43584_c1 | 3300050494 | Bacteria | 2259 |
| 744 | nmdc:mga04h51_4263_c1 | 3300050495 | Bacteria | 3542 |
| 745 | nmdc:mga04h51_6786_c1 | 3300050495 | Bacteria | 2990 |
| 746 | nmdc:mga07m45_126220_c1 | 3300050496 | Bacteria | 1479 |
| 747 | nmdc:mga07m45_177281_c1 | 3300050496 | Bacteria | 1239 |
| 748 | nmdc:mga07m45_5888_c1 | 3300050496 | Bacteria | 6153 |
| 749 | nmdc:mga07m45_81446_c1 | 3300050496 | Bacteria | 1848 |
| 750 | nmdc:mga07m45_8967_c1 | 3300050496 | Bacteria | 5164 |
| 751 | nmdc:mga05p37_2742_c1 | 3300050507 | Bacteria | 20456 |
| 752 | nmdc:mga05p37_828_c1 | 3300050507 | Bacteria | 34679 |
| 753 | nmdc:mga09592_103801_c1 | 3300050508 | Bacteria | 2436 |
| 754 | nmdc:mga09592_21763_c1 | 3300050508 | Bacteria | 5287 |
| 755 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 756 | nmdc:mga0qj67_64106_c1 | 3300050509 | Bacteria | 2922 |
| 757 | nmdc:mga06r32_253385_c1 | 3300050510 | Bacteria | 1748 |
| 758 | nmdc:mga06r32_513_c1 | 3300050510 | Bacteria | 33328 |
| 759 | nmdc:mga08y16_228014_c1 | 3300050511 | Bacteria | 1927 |
| 760 | nmdc:mga08y16_3986_c1 | 3300050511 | Bacteria | 15398 |
| 761 | nmdc:mga08y16_4405_c1 | 3300050511 | Bacteria | 14718 |
| 762 | nmdc:mga0n895_18031_c1 | 3300050512 | Bacteria | 6525 |
| 763 | nmdc:mga0n895_385578_c1 | 3300050512 | Bacteria | 1418 |
| 764 | nmdc:mga0n895_4431_c1 | 3300050512 | Bacteria | 11539 |
| 765 | nmdc:mga0n895_94685_c1 | 3300050512 | Bacteria | 2991 |
| 766 | nmdc:mga0rr50_4443_c1 | 3300050513 | Bacteria | 8252 |
| 767 | nmdc:mga0a205_12519_c1 | 3300050515 | Bacteria | 7852 |
| 768 | nmdc:mga0a205_75792_c2 | 3300050515 | Bacteria | 2296 |
| 769 | nmdc:mga0sz30_17557_c1 | 3300050516 | Bacteria | 2855 |
| 770 | nmdc:mga0sz30_20084_c1 | 3300050516 | Bacteria | 2692 |
| 771 | Ga0495601_0000075 | 3300053077 | Bacteria | 54434 |
| 772 | Ga0495601_0003475 | 3300053077 | Bacteria | 9043 |
| 773 | Ga0495601_0007907 | 3300053077 | Bacteria | 6263 |
| 774 | Ga0495601_0028022 | 3300053077 | Bacteria | 3486 |
| 775 | Ga0495612_0002526 | 3300053078 | Bacteria | 7556 |
| 776 | Ga0495612_0008861 | 3300053078 | Bacteria | 4076 |
| 777 | Ga0495612_0011526 | 3300053078 | Bacteria | 3564 |
| 778 | Ga0495612_0017374 | 3300053078 | Bacteria | 2881 |
| 779 | Ga0495612_0077915 | 3300053078 | Bacteria | 1389 |
| 780 | Ga0500610_0015285 | 3300053079 | Bacteria | 3631 |
| 781 | Ga0500635_0004404 | 3300053080 | Bacteria | 3627 |
| 782 | Ga0495595_0000253 | 3300053084 | Bacteria | 21240 |
| 783 | Ga0495595_0000311 | 3300053084 | Bacteria | 18978 |
| 784 | Ga0495595_0000670 | 3300053084 | Bacteria | 13076 |
| 785 | Ga0495595_0002803 | 3300053084 | Bacteria | 6859 |
| 786 | Ga0495595_0009800 | 3300053084 | Bacteria | 3971 |
| 787 | Ga0495619_0000301 | 3300053085 | Bacteria | 34829 |
| 788 | Ga0495619_0000315 | 3300053085 | Bacteria | 33904 |
| 789 | Ga0495619_0000645 | 3300053085 | Bacteria | 22971 |
| 790 | Ga0495619_0003855 | 3300053085 | Bacteria | 9655 |
| 791 | Ga0495619_0036799 | 3300053085 | Bacteria | 3188 |
| 792 | Ga0495619_0065853 | 3300053085 | Bacteria | 2418 |
| 793 | Ga0495619_0191487 | 3300053085 | Bacteria | 1415 |
| 794 | Ga0495619_0223462 | 3300053085 | Bacteria | 1304 |
| 795 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 796 | Ga0500643_004518 | 3300053087 | Bacteria | 6255 |
| 797 | Ga0500651_0004830 | 3300053093 | Bacteria | 7608 |
| 798 | Ga0500566_0002512 | 3300053094 | Bacteria | 10894 |
| 799 | Ga0500641_0007654 | 3300053096 | Bacteria | 3851 |
| 800 | Ga0500648_136430 | 3300053097 | Bacteria | 1324 |
| 801 | Ga0500650_0131108 | 3300053098 | Bacteria | 1165 |
| 802 | Ga0500555_039695 | 3300053103 | Bacteria | 1313 |
| 803 | Ga0500556_0008815 | 3300053104 | Bacteria | 2916 |
| 804 | Ga0500557_000057 | 3300053105 | Bacteria | 47849 |
| 805 | Ga0500569_004458 | 3300053109 | Bacteria | 2944 |
| 806 | Ga0500593_003210 | 3300053117 | Bacteria | 6136 |
| 807 | Ga0500594_0000589 | 3300053118 | Bacteria | 7788 |
| 808 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 809 | Ga0500595_000558 | 3300053119 | Bacteria | 22207 |
| 810 | Ga0500595_002578 | 3300053119 | Bacteria | 8853 |
| 811 | Ga0500607_103185 | 3300053121 | Bacteria | 1412 |
| 812 | Ga0500642_0000263 | 3300053130 | Bacteria | 19627 |
| 813 | Ga0500642_0016379 | 3300053130 | Bacteria | 2814 |
| 814 | Ga0500658_0099854 | 3300053134 | Bacteria | 1265 |
| 815 | Ga0500559_0025253 | 3300053136 | Bacteria | 2528 |
| 816 | Ga0500564_093204 | 3300053138 | Bacteria | 1339 |
| 817 | Ga0500568_0010868 | 3300053139 | Bacteria | 4245 |
| 818 | Ga0500568_0038089 | 3300053139 | Bacteria | 1948 |
| 819 | Ga0500568_0095310 | 3300053139 | Bacteria | 1120 |
| 820 | Ga0500590_059797 | 3300053148 | Bacteria | 1917 |
| 821 | Ga0500590_150761 | 3300053148 | Bacteria | 1049 |
| 822 | Ga0500604_0040168 | 3300053151 | Bacteria | 1409 |
| 823 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 824 | Ga0500616_0013214 | 3300053153 | Bacteria | 4804 |
| 825 | Ga0500622_0004797 | 3300053156 | Bacteria | 8308 |
| 826 | Ga0500622_0103055 | 3300053156 | Bacteria | 1403 |
| 827 | Ga0500627_0085024 | 3300053158 | Bacteria | 1412 |
| 828 | Ga0500638_152727 | 3300053162 | Bacteria | 1025 |
| 829 | Ga0500636_0001378 | 3300053177 | Bacteria | 13188 |
| 830 | Ga0500636_0002410 | 3300053177 | Bacteria | 10348 |
| 831 | Ga0500636_0020617 | 3300053177 | Bacteria | 3902 |
| 832 | Ga0500636_0037056 | 3300053177 | Bacteria | 2885 |
| 833 | Ga0500625_003219 | 3300053729 | Bacteria | 6391 |
| 834 | Ga0500596_003341 | 3300053735 | Bacteria | 3065 |
| 835 | Ga0500599_009231 | 3300053736 | Bacteria | 1289 |
| 836 | Ga0501084_0035333 | 3300054114 | Bacteria | 4178 |
| 837 | Ga0500661_022306 | 3300055283 | Bacteria | 1122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0177907 | Ga0501072_0177907_861_1676 | 248 |
| 2 | 3300047318 | Ga0495636_0002324 | Ga0495636_0002324_1128_1994 | 265 |
| 3 | 3300047447 | Ga0495685_018416 | Ga0495685_018416_274_1140 | 265 |
| 4 | 3300050496 | nmdc:mga07m45_5888_c1 | nmdc:mga07m45_5888_c1_4739_5722 | 265 |
| 5 | 3300039437 | Ga0436365_1106099 | Ga0436365_1106099_2217_3134 | 266 |
| 6 | 3300042437 | Ga0439444_0004615 | Ga0439444_0004615_19_897 | 269 |
| 7 | 3300005338 | Ga0068868_100030792 | Ga0068868_1000307924 | 270 |
| 8 | 3300005347 | Ga0070668_100133095 | Ga0070668_1001330951 | 270 |
| 9 | 3300005539 | Ga0068853_100042910 | Ga0068853_1000429103 | 270 |
| 10 | 3300005548 | Ga0070665_100015092 | Ga0070665_1000150927 | 270 |
| 11 | 3300005841 | Ga0068863_100455047 | Ga0068863_1004550471 | 270 |
| 12 | 3300005842 | Ga0068858_100091077 | Ga0068858_1000910773 | 270 |
| 13 | 3300009098 | Ga0105245_10145957 | Ga0105245_101459572 | 270 |
| 14 | 3300011119 | Ga0105246_10034641 | Ga0105246_100346413 | 270 |
| 15 | 3300014326 | Ga0157380_10347142 | Ga0157380_103471421 | 270 |
| 16 | 3300025907 | Ga0207645_10021194 | Ga0207645_100211944 | 270 |
| 17 | 3300025942 | Ga0207689_10058438 | Ga0207689_100584383 | 270 |
| 18 | 3300025972 | Ga0207668_10036615 | Ga0207668_100366152 | 270 |
| 19 | 3300026023 | Ga0207677_10111086 | Ga0207677_101110862 | 270 |
| 20 | 3300026035 | Ga0207703_10363723 | Ga0207703_103637231 | 270 |
| 21 | 3300026116 | Ga0207674_10066740 | Ga0207674_100667403 | 270 |
| 22 | 3300006353 | Ga0075370_10029799 | Ga0075370_100297993 | 273 |
| 23 | 3300006195 | Ga0075366_10073632 | Ga0075366_100736322 | 274 |
| 24 | 3300006871 | Ga0075434_100110129 | Ga0075434_1001101292 | 274 |
| 25 | 3300026067 | Ga0207678_10035287 | Ga0207678_100352873 | 274 |
| 26 | 3300025297 | Ga0209758_1001405 | Ga0209758_10014056 | 275 |
| 27 | iso_pu_bacteria | 8016622563 | 8016630208 | 275 |
| 28 | 3300034820 | Ga0373959_0008517 | Ga0373959_0008517_405_1319 | 279 |
| 29 | 3300036401 | Ga0373937_0147147 | Ga0373937_0147147_171_1079 | 279 |
| 30 | 3300035692 | Ga0373935_0029981 | Ga0373935_0029981_2278_3240 | 280 |
| 31 | 3300046810 | Ga0495660_0050315 | Ga0495660_0050315_1294_2217 | 280 |
| 32 | 3300049741 | Ga0501079_0210187 | Ga0501079_0210187_401_1366 | 280 |
| 33 | 3300049743 | Ga0501081_0168148 | Ga0501081_0168148_358_1323 | 280 |
| 34 | 3300050493 | nmdc:mga0k408_8333_c1 | nmdc:mga0k408_8333_c1_1190_2191 | 280 |
| 35 | 3300053177 | Ga0500636_0037056 | Ga0500636_0037056_1663_2625 | 280 |
| 36 | 3300035120 | Ga0373957_0022408 | Ga0373957_0022408_14_928 | 281 |
| 37 | 3300046459 | Ga0495629_0337319 | Ga0495629_0337319_10_924 | 281 |
| 38 | 3300049574 | Ga0501038_0089706 | Ga0501038_0089706_1441_2361 | 281 |
| 39 | 3300049581 | Ga0501047_0011033 | Ga0501047_0011033_6636_7556 | 281 |
| 40 | 3300049586 | Ga0501070_0038726 | Ga0501070_0038726_470_1390 | 281 |
| 41 | 3300049742 | Ga0501080_0031235 | Ga0501080_0031235_49_969 | 281 |
| 42 | 3300049823 | Ga0501044_0003023 | Ga0501044_0003023_12634_13554 | 281 |
| 43 | 3300028381 | Ga0268264_10242994 | Ga0268264_102429943 | 282 |
| 44 | 3300033179 | Ga0307507_10021924 | Ga0307507_100219246 | 282 |
| 45 | 3300033180 | Ga0307510_10230366 | Ga0307510_102303661 | 282 |
| 46 | 3300035410 | Ga0373924_0011377 | Ga0373924_0011377_1086_2015 | 285 |
| 47 | 3300053139 | Ga0500568_0095310 | Ga0500568_0095310_88_1071 | 285 |
| 48 | 3300053153 | Ga0500616_0013214 | Ga0500616_0013214_1549_2499 | 285 |
| 49 | iso_pu_bacteria | 2888419890 | 2888426842 | 285 |
| 50 | 3300005356 | Ga0070674_100386901 | Ga0070674_1003869011 | 286 |
| 51 | 3300006186 | Ga0075369_10102720 | Ga0075369_101027202 | 286 |
| 52 | 3300009011 | Ga0105251_10119249 | Ga0105251_101192492 | 287 |
| 53 | 3300013306 | Ga0163162_10278586 | Ga0163162_102785862 | 287 |
| 54 | 3300035092 | Ga0373952_0016608 | Ga0373952_0016608_422_1399 | 287 |
| 55 | 3300036401 | Ga0373937_0012002 | Ga0373937_0012002_395_1330 | 287 |
| 56 | 3300046462 | Ga0495651_0077352 | Ga0495651_0077352_66_1001 | 287 |
| 57 | 3300046463 | Ga0495653_0025885 | Ga0495653_0025885_158_1093 | 287 |
| 58 | 3300046531 | Ga0495665_0028743 | Ga0495665_0028743_71_1012 | 287 |
| 59 | 3300046663 | Ga0495635_0036420 | Ga0495635_0036420_2127_3062 | 287 |
| 60 | 3300046675 | Ga0495657_0098633 | Ga0495657_0098633_187_1122 | 287 |
| 61 | 3300046683 | Ga0495658_0040718 | Ga0495658_0040718_567_1502 | 287 |
| 62 | 3300047322 | Ga0495680_0012241 | Ga0495680_0012241_675_1610 | 287 |
| 63 | 3300048904 | Ga0496101_0015113 | Ga0496101_0015113_1542_2483 | 287 |
| 64 | 3300048910 | Ga0496107_0054251 | Ga0496107_0054251_673_1614 | 287 |
| 65 | 3300048914 | Ga0496111_0002128 | Ga0496111_0002128_1000_1941 | 287 |
| 66 | 3300053077 | Ga0495601_0007907 | Ga0495601_0007907_4745_5680 | 287 |
| 67 | 3300053078 | Ga0495612_0077915 | Ga0495612_0077915_229_1164 | 287 |
| 68 | 3300053084 | Ga0495595_0002803 | Ga0495595_0002803_119_1054 | 287 |
| 69 | 3300053085 | Ga0495619_0000315 | Ga0495619_0000315_25352_26287 | 287 |
| 70 | 3300005330 | Ga0070690_100078710 | Ga0070690_1000787102 | 288 |
| 71 | 3300005339 | Ga0070660_100151829 | Ga0070660_1001518292 | 288 |
| 72 | 3300005340 | Ga0070689_100219789 | Ga0070689_1002197891 | 288 |
| 73 | 3300005841 | Ga0068863_100151155 | Ga0068863_1001511552 | 288 |
| 74 | 3300014325 | Ga0163163_10006941 | Ga0163163_100069419 | 288 |
| 75 | 3300025936 | Ga0207670_10156546 | Ga0207670_101565461 | 288 |
| 76 | 3300025941 | Ga0207711_10087313 | Ga0207711_100873133 | 288 |
| 77 | 3300026088 | Ga0207641_10260941 | Ga0207641_102609412 | 288 |
| 78 | 3300048911 | Ga0496108_0010537 | Ga0496108_0010537_4515_5498 | 288 |
| 79 | 3300048912 | Ga0496109_0000700 | Ga0496109_0000700_26696_27679 | 288 |
| 80 | 3300048913 | Ga0496110_0150513 | Ga0496110_0150513_574_1557 | 288 |
| 81 | 3300048914 | Ga0496111_0030278 | Ga0496111_0030278_2744_3727 | 288 |
| 82 | 3300048915 | Ga0496112_0006626 | Ga0496112_0006626_2360_3343 | 288 |
| 83 | 3300048916 | Ga0496113_0001279 | Ga0496113_0001279_12567_13550 | 288 |
| 84 | 3300048922 | Ga0496119_0058223 | Ga0496119_0058223_20_979 | 288 |
| 85 | 3300050496 | nmdc:mga07m45_177281_c1 | nmdc:mga07m45_177281_c1_102_1067 | 288 |
| 86 | 3300053162 | Ga0500638_152727 | Ga0500638_152727_47_1006 | 288 |
| 87 | iso_pu_bacteria | 2847930680 | 2847932081 | 288 |
| 88 | iso_pu_bacteria | 2904479285 | 2904483567 | 288 |
| 89 | iso_pu_bacteria | 2824600985 | 2824604431 | 289 |
| 90 | iso_pu_bacteria | 2824609381 | 2824615028 | 289 |
| 91 | iso_pu_bacteria | 2824653114 | 2824659188 | 289 |
| 92 | 3300005937 | Ga0081455_10001479 | Ga0081455_1000147928 | 290 |
| 93 | 3300006195 | Ga0075366_10019905 | Ga0075366_100199053 | 290 |
| 94 | 3300009094 | Ga0111539_10001412 | Ga0111539_1000141220 | 290 |
| 95 | 3300009147 | Ga0114129_10002772 | Ga0114129_1000277224 | 290 |
| 96 | 3300025981 | Ga0207640_10148610 | Ga0207640_101486102 | 290 |
| 97 | 3300046500 | Ga0495596_0000078 | Ga0495596_0000078_4867_5835 | 290 |
| 98 | 3300046515 | Ga0495620_0014591 | Ga0495620_0014591_1455_2417 | 290 |
| 99 | 3300046518 | Ga0495631_0000031 | Ga0495631_0000031_40775_41737 | 290 |
| 100 | 3300046520 | Ga0495637_0000365 | Ga0495637_0000365_15983_16945 | 290 |
| 101 | 3300046526 | Ga0495666_0046661 | Ga0495666_0046661_725_1669 | 290 |
| 102 | 3300046539 | Ga0495621_0000357 | Ga0495621_0000357_4143_5105 | 290 |
| 103 | 3300046660 | Ga0495625_0005608 | Ga0495625_0005608_6287_7249 | 290 |
| 104 | 3300047469 | Ga0495673_0074730 | Ga0495673_0074730_52_999 | 290 |
| 105 | 3300050507 | nmdc:mga05p37_828_c1 | nmdc:mga05p37_828_c1_10272_11222 | 290 |
| 106 | 3300050508 | nmdc:mga09592_21763_c1 | nmdc:mga09592_21763_c1_3282_4232 | 290 |
| 107 | 3300050509 | nmdc:mga0qj67_165_c1 | nmdc:mga0qj67_165_c1_15295_16245 | 290 |
| 108 | 3300050510 | nmdc:mga06r32_513_c1 | nmdc:mga06r32_513_c1_15222_16172 | 290 |
| 109 | 3300050511 | nmdc:mga08y16_4405_c1 | nmdc:mga08y16_4405_c1_10272_11222 | 290 |
| 110 | 3300050512 | nmdc:mga0n895_94685_c1 | nmdc:mga0n895_94685_c1_1055_2005 | 290 |
| 111 | 3300050515 | nmdc:mga0a205_12519_c1 | nmdc:mga0a205_12519_c1_3278_4228 | 290 |
| 112 | 3300053079 | Ga0500610_0015285 | Ga0500610_0015285_38_1000 | 290 |
| 113 | 3300053118 | Ga0500594_0000589 | Ga0500594_0000589_4656_5618 | 290 |
| 114 | 3300055283 | Ga0500661_022306 | Ga0500661_022306_165_1112 | 290 |
| 115 | 3300009094 | Ga0111539_10569547 | Ga0111539_105695471 | 291 |
| 116 | 3300025901 | Ga0207688_10048222 | Ga0207688_100482222 | 291 |
| 117 | 3300028381 | Ga0268264_10363661 | Ga0268264_103636611 | 291 |
| 118 | 3300035724 | Ga0373933_0102588 | Ga0373933_0102588_14_967 | 291 |
| 119 | 3300050511 | nmdc:mga08y16_228014_c1 | nmdc:mga08y16_228014_c1_84_1061 | 291 |
| 120 | iso_pu_bacteria | 2508501009 | 2508545757 | 292 |
| 121 | iso_pu_bacteria | 2508501042 | 2508694582 | 292 |
| 122 | iso_pu_bacteria | 2511231028 | 2511398413 | 292 |
| 123 | iso_pu_bacteria | 2513237092 | 2513624505 | 292 |
| 124 | iso_pu_bacteria | 2513237094 | 2513638631 | 292 |
| 125 | iso_pu_bacteria | 2513237095 | 2513649981 | 292 |
| 126 | iso_pu_bacteria | 2513237104 | 2513716826 | 292 |
| 127 | iso_pu_bacteria | 2513237139 | 2513874273 | 292 |
| 128 | iso_pu_bacteria | 2515154112 | 2515624489 | 292 |
| 129 | iso_pu_bacteria | 2517093001 | 2517104581 | 292 |
| 130 | iso_pu_bacteria | 2617270735 | 2617354178 | 292 |
| 131 | iso_pu_bacteria | 2643221547 | 2643757459 | 292 |
| 132 | iso_pu_bacteria | 2744054633 | 2745077237 | 292 |
| 133 | iso_pu_bacteria | 2791355196 | 2793059409 | 292 |
| 134 | iso_pu_bacteria | 2802429603 | 2805916039 | 292 |
| 135 | iso_pu_bacteria | 2816332527 | 2818240981 | 292 |
| 136 | iso_pu_bacteria | 2824661429 | 2824665218 | 292 |
| 137 | iso_pu_bacteria | 2824696289 | 2824701854 | 292 |
| 138 | iso_pu_bacteria | 2824773399 | 2824778256 | 292 |
| 139 | iso_pu_bacteria | 2841957949 | 2841960688 | 292 |
| 140 | iso_pu_bacteria | 2842038055 | 2842041788 | 292 |
| 141 | iso_pu_bacteria | 2842045827 | 2842049830 | 292 |
| 142 | iso_pu_bacteria | 2844315083 | 2844321329 | 292 |
| 143 | iso_pu_bacteria | 2847939898 | 2847943318 | 292 |
| 144 | iso_pu_bacteria | 2849076700 | 2849077046 | 292 |
| 145 | iso_pu_bacteria | 2874590934 | 2874595720 | 292 |
| 146 | iso_pu_bacteria | 2874620515 | 2874624216 | 292 |
| 147 | iso_pu_bacteria | 2874628541 | 2874630313 | 292 |
| 148 | iso_pu_bacteria | 2874645413 | 2874651648 | 292 |
| 149 | iso_pu_bacteria | 2876761206 | 2876767655 | 292 |
| 150 | iso_pu_bacteria | 2876771140 | 2876775915 | 292 |
| 151 | iso_pu_bacteria | 2876818435 | 2876821543 | 292 |
| 152 | iso_pu_bacteria | 2879074833 | 2879080006 | 292 |
| 153 | iso_pu_bacteria | 2879099564 | 2879100589 | 292 |
| 154 | iso_pu_bacteria | 2879127579 | 2879134089 | 292 |
| 155 | iso_pu_bacteria | 2879142872 | 2879148574 | 292 |
| 156 | iso_pu_bacteria | 2881665667 | 2881669308 | 292 |
| 157 | iso_pu_bacteria | 2885409591 | 2885412175 | 292 |
| 158 | iso_pu_bacteria | 2888378607 | 2888387626 | 292 |
| 159 | iso_pu_bacteria | 2888388044 | 2888391536 | 292 |
| 160 | iso_pu_bacteria | 2903727486 | 2903731481 | 292 |
| 161 | iso_pu_bacteria | 2904666416 | 2904670927 | 292 |
| 162 | iso_pu_bacteria | 2906602504 | 2906607943 | 292 |
| 163 | iso_pu_bacteria | 2906643746 | 2906650121 | 292 |
| 164 | iso_pu_bacteria | 2922368715 | 2922376610 | 292 |
| 165 | iso_pu_bacteria | 2929615660 | 2929619886 | 292 |
| 166 | iso_pu_bacteria | 2929624759 | 2929629198 | 292 |
| 167 | iso_pu_bacteria | 2932794094 | 2932796661 | 292 |
| 168 | iso_pu_bacteria | 2932801729 | 2932802559 | 292 |
| 169 | iso_pu_bacteria | 2935608549 | 2935613262 | 292 |
| 170 | iso_pu_bacteria | 2935648319 | 2935656624 | 292 |
| 171 | iso_pu_bacteria | 2935656913 | 2935665452 | 292 |
| 172 | iso_pu_bacteria | 2935769743 | 2935775201 | 292 |
| 173 | iso_pu_bacteria | 2935777560 | 2935780103 | 292 |
| 174 | iso_pu_bacteria | 2935785616 | 2935790225 | 292 |
| 175 | iso_pu_bacteria | 2935793552 | 2935798733 | 292 |
| 176 | iso_pu_bacteria | 2935819856 | 2935824884 | 292 |
| 177 | iso_pu_bacteria | 2935847175 | 2935852104 | 292 |
| 178 | iso_pu_bacteria | 2935883170 | 2935887001 | 292 |
| 179 | iso_pu_bacteria | 2935908558 | 2935911451 | 292 |
| 180 | iso_pu_bacteria | 2935916978 | 2935920986 | 292 |
| 181 | iso_pu_bacteria | 2935926038 | 2935928480 | 292 |
| 182 | iso_pu_bacteria | 2935934488 | 2935938125 | 292 |
| 183 | iso_pu_bacteria | 2935942939 | 2935945407 | 292 |
| 184 | iso_pu_bacteria | 2935951376 | 2935954087 | 292 |
| 185 | iso_pu_bacteria | 2935959822 | 2935965466 | 292 |
| 186 | iso_pu_bacteria | 2935967501 | 2935971645 | 292 |
| 187 | iso_pu_bacteria | 2935975950 | 2935980049 | 292 |
| 188 | iso_pu_bacteria | 2935984226 | 2935989477 | 292 |
| 189 | iso_pu_bacteria | 2936011229 | 2936019487 | 292 |
| 190 | iso_pu_bacteria | 2936019824 | 2936028103 | 292 |
| 191 | iso_pu_bacteria | 2936028420 | 2936036937 | 292 |
| 192 | iso_pu_bacteria | 2936046547 | 2936054960 | 292 |
| 193 | iso_pu_bacteria | 2936055302 | 2936060733 | 292 |
| 194 | iso_pu_bacteria | 3005594810 | 3005601681 | 292 |
| 195 | iso_pu_bacteria | 8016522445 | 8016525096 | 292 |
| 196 | iso_pu_bacteria | 8016530956 | 8016538672 | 292 |
| 197 | iso_pu_bacteria | 8016539877 | 8016542959 | 292 |
| 198 | iso_pu_bacteria | 8016557553 | 8016558739 | 292 |
| 199 | iso_pu_bacteria | 8016575299 | 8016581015 | 292 |
| 200 | iso_pu_bacteria | 8016595262 | 8016596715 | 292 |
| 201 | iso_pu_bacteria | 8016630954 | 8016636942 | 292 |
| 202 | iso_pu_bacteria | 8019530166 | 8019538344 | 292 |
| 203 | iso_pu_bacteria | 8019538911 | 8019541478 | 292 |
| 204 | iso_pu_bacteria | 8019547302 | 8019549149 | 292 |
| 205 | iso_pu_bacteria | 8019619141 | 8019623901 | 292 |
| 206 | iso_pu_bacteria | 8019629233 | 8019638139 | 292 |
| 207 | iso_pu_bacteria | 8019638758 | 8019641497 | 292 |
| 208 | iso_pu_bacteria | 8019648815 | 8019651545 | 292 |
| 209 | iso_pu_bacteria | 8019659431 | 8019666053 | 292 |
| 210 | iso_pu_bacteria | 8019668869 | 8019675572 | 292 |
| 211 | iso_pu_bacteria | 8019678201 | 8019680527 | 292 |
| 212 | iso_pu_bacteria | 8019687851 | 8019695226 | 292 |
| 213 | iso_pu_bacteria | 8056967851 | 8056976133 | 292 |
| 214 | 3300025297 | Ga0209758_1045760 | Ga0209758_10457601 | 293 |
| 215 | iso_pu_bacteria | 2513237141 | 2513892373 | 293 |
| 216 | iso_pu_bacteria | 2524023205 | 2524438538 | 293 |
| 217 | iso_pu_bacteria | 2721755755 | 2723842586 | 293 |
| 218 | iso_pu_bacteria | 2791355199 | 2793078542 | 293 |
| 219 | iso_pu_bacteria | 2857509624 | 2857514669 | 293 |
| 220 | iso_pu_bacteria | 2874604998 | 2874606729 | 293 |
| 221 | iso_pu_bacteria | 3005718088 | 3005724363 | 293 |
| 222 | iso_pu_bacteria | 8006994254 | 8006999137 | 293 |
| 223 | iso_pu_bacteria | 8056673599 | 8056678856 | 293 |
| 224 | 3300006844 | Ga0075428_100000476 | Ga0075428_10000047638 | 294 |
| 225 | 3300006880 | Ga0075429_100063046 | Ga0075429_1000630461 | 294 |
| 226 | 3300010375 | Ga0105239_10275570 | Ga0105239_102755702 | 294 |
| 227 | 3300014968 | Ga0157379_10012889 | Ga0157379_100128894 | 294 |
| 228 | 3300025921 | Ga0207652_10166552 | Ga0207652_101665521 | 294 |
| 229 | 3300027907 | Ga0207428_10005963 | Ga0207428_100059635 | 294 |
| 230 | 3300035691 | Ga0373931_0029855 | Ga0373931_0029855_77_1045 | 294 |
| 231 | 3300044694 | Ga0466963_0113294 | Ga0466963_0113294_490_1449 | 294 |
| 232 | 3300045976 | Ga0466967_0351957 | Ga0466967_0351957_67_1026 | 294 |
| 233 | 3300046529 | Ga0495652_0030285 | Ga0495652_0030285_1686_2699 | 294 |
| 234 | 3300046663 | Ga0495635_0257140 | Ga0495635_0257140_28_1041 | 294 |
| 235 | 3300046689 | Ga0495613_0086422 | Ga0495613_0086422_287_1324 | 294 |
| 236 | 3300046809 | Ga0495600_0215515 | Ga0495600_0215515_106_1107 | 294 |
| 237 | 3300048903 | Ga0496100_0152266 | Ga0496100_0152266_369_1337 | 294 |
| 238 | 3300048907 | Ga0496104_0002005 | Ga0496104_0002005_3954_4955 | 294 |
| 239 | 3300048907 | Ga0496104_0023320 | Ga0496104_0023320_3088_4056 | 294 |
| 240 | 3300048908 | Ga0496105_0045632 | Ga0496105_0045632_2182_3150 | 294 |
| 241 | 3300048909 | Ga0496106_0014884 | Ga0496106_0014884_1630_2598 | 294 |
| 242 | 3300048911 | Ga0496108_0050304 | Ga0496108_0050304_1140_2108 | 294 |
| 243 | 3300048912 | Ga0496109_0208827 | Ga0496109_0208827_78_1046 | 294 |
| 244 | 3300048913 | Ga0496110_0073990 | Ga0496110_0073990_1144_2112 | 294 |
| 245 | 3300048915 | Ga0496112_0043988 | Ga0496112_0043988_2280_3248 | 294 |
| 246 | 3300048916 | Ga0496113_0153261 | Ga0496113_0153261_30_998 | 294 |
| 247 | 3300048916 | Ga0496113_0292007 | Ga0496113_0292007_60_1061 | 294 |
| 248 | 3300048918 | Ga0496115_0050932 | Ga0496115_0050932_961_1929 | 294 |
| 249 | 3300049822 | Ga0501035_0060738 | Ga0501035_0060738_2337_3308 | 294 |
| 250 | 3300050508 | nmdc:mga09592_103801_c1 | nmdc:mga09592_103801_c1_1078_2046 | 294 |
| 251 | 3300050511 | nmdc:mga08y16_3986_c1 | nmdc:mga08y16_3986_c1_4094_5062 | 294 |
| 252 | 3300006028 | Ga0070717_10057816 | Ga0070717_100578163 | 295 |
| 253 | 3300006038 | Ga0075365_10016412 | Ga0075365_100164124 | 295 |
| 254 | 3300006042 | Ga0075368_10002709 | Ga0075368_100027095 | 295 |
| 255 | 3300006048 | Ga0075363_100016422 | Ga0075363_1000164224 | 295 |
| 256 | 3300006051 | Ga0075364_10034512 | Ga0075364_100345122 | 295 |
| 257 | 3300006177 | Ga0075362_10004628 | Ga0075362_100046286 | 295 |
| 258 | 3300006195 | Ga0075366_10023974 | Ga0075366_100239743 | 295 |
| 259 | 3300007788 | Ga0099795_10017367 | Ga0099795_100173672 | 295 |
| 260 | 3300035113 | Ga0373936_0030592 | Ga0373936_0030592_127_1095 | 295 |
| 261 | 3300035170 | Ga0373943_0086878 | Ga0373943_0086878_10_972 | 295 |
| 262 | 3300035725 | Ga0373947_0163548 | Ga0373947_0163548_97_1065 | 295 |
| 263 | 3300037068 | Ga0373925_0018593 | Ga0373925_0018593_2018_2986 | 295 |
| 264 | 3300046529 | Ga0495652_0106339 | Ga0495652_0106339_384_1373 | 295 |
| 265 | 3300046557 | Ga0495622_0008747 | Ga0495622_0008747_1731_2693 | 295 |
| 266 | 3300047322 | Ga0495680_0281194 | Ga0495680_0281194_40_1002 | 295 |
| 267 | 3300048907 | Ga0496104_0158815 | Ga0496104_0158815_705_1673 | 295 |
| 268 | 3300048908 | Ga0496105_0033897 | Ga0496105_0033897_2810_3778 | 295 |
| 269 | 3300048913 | Ga0496110_0217372 | Ga0496110_0217372_329_1297 | 295 |
| 270 | 3300048914 | Ga0496111_0199970 | Ga0496111_0199970_419_1387 | 295 |
| 271 | 3300048917 | Ga0496114_0155999 | Ga0496114_0155999_588_1556 | 295 |
| 272 | 3300048918 | Ga0496115_0109328 | Ga0496115_0109328_254_1222 | 295 |
| 273 | 3300048924 | Ga0496121_0298115 | Ga0496121_0298115_76_1038 | 295 |
| 274 | 3300048929 | Ga0496126_0044707 | Ga0496126_0044707_1267_2229 | 295 |
| 275 | 3300050489 | nmdc:mga03683_4316_c1 | nmdc:mga03683_4316_c1_2476_3459 | 295 |
| 276 | 3300050491 | nmdc:mga00v17_80108_c1 | nmdc:mga00v17_80108_c1_263_1246 | 295 |
| 277 | 3300050492 | nmdc:mga0yw44_40147_c1 | nmdc:mga0yw44_40147_c1_1754_2737 | 295 |
| 278 | 3300050493 | nmdc:mga0k408_6246_c1 | nmdc:mga0k408_6246_c1_61_1044 | 295 |
| 279 | 3300050494 | nmdc:mga06z11_43584_c1 | nmdc:mga06z11_43584_c1_236_1219 | 295 |
| 280 | 3300050495 | nmdc:mga04h51_6786_c1 | nmdc:mga04h51_6786_c1_1658_2641 | 295 |
| 281 | 3300050516 | nmdc:mga0sz30_20084_c1 | nmdc:mga0sz30_20084_c1_187_1170 | 295 |
| 282 | 3300053080 | Ga0500635_0004404 | Ga0500635_0004404_1882_2844 | 295 |
| 283 | 3300053087 | Ga0500643_004518 | Ga0500643_004518_5245_6228 | 295 |
| 284 | 3300053097 | Ga0500648_136430 | Ga0500648_136430_104_1066 | 295 |
| 285 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_732200_733183 | 295 |
| 286 | 3300053136 | Ga0500559_0025253 | Ga0500559_0025253_12_974 | 295 |
| 287 | 3300053148 | Ga0500590_059797 | Ga0500590_059797_586_1548 | 295 |
| 288 | 3300053177 | Ga0500636_0020617 | Ga0500636_0020617_2603_3565 | 295 |
| 289 | 3300053735 | Ga0500596_003341 | Ga0500596_003341_769_1731 | 295 |
| 290 | iso_pu_bacteria | 2941531003 | 2941531902 | 295 |
| 291 | 3300003215 | JGI25153J46596_10005279 | JGI25153J46596_100052792 | 296 |
| 292 | 3300003215 | JGI25153J46596_10005848 | JGI25153J46596_100058486 | 296 |
| 293 | 3300003215 | JGI25153J46596_10007756 | JGI25153J46596_100077562 | 296 |
| 294 | 3300003320 | rootH2_10062151 | rootH2_100621511 | 296 |
| 295 | 3300003354 | JGI25160J50197_1031104 | JGI25160J50197_10311041 | 296 |
| 296 | 3300004625 | Ga0055543_1011624 | Ga0055543_10116241 | 296 |
| 297 | 3300005262 | Ga0065165_1000919 | Ga0065165_100091939 | 296 |
| 298 | 3300005262 | Ga0065165_1002792 | Ga0065165_10027923 | 296 |
| 299 | 3300005262 | Ga0065165_1005273 | Ga0065165_10052733 | 296 |
| 300 | 3300005327 | Ga0070658_10045234 | Ga0070658_100452342 | 296 |
| 301 | 3300005337 | Ga0070682_100190506 | Ga0070682_1001905062 | 296 |
| 302 | 3300005339 | Ga0070660_100220170 | Ga0070660_1002201701 | 296 |
| 303 | 3300005347 | Ga0070668_100076521 | Ga0070668_1000765212 | 296 |
| 304 | 3300005355 | Ga0070671_100055275 | Ga0070671_1000552753 | 296 |
| 305 | 3300005434 | Ga0070709_10007358 | Ga0070709_100073582 | 296 |
| 306 | 3300005435 | Ga0070714_100024637 | Ga0070714_1000246374 | 296 |
| 307 | 3300005436 | Ga0070713_100007733 | Ga0070713_1000077334 | 296 |
| 308 | 3300005439 | Ga0070711_100006676 | Ga0070711_1000066764 | 296 |
| 309 | 3300005455 | Ga0070663_100300982 | Ga0070663_1003009821 | 296 |
| 310 | 3300005457 | Ga0070662_100351488 | Ga0070662_1003514882 | 296 |
| 311 | 3300005539 | Ga0068853_100449012 | Ga0068853_1004490122 | 296 |
| 312 | 3300005548 | Ga0070665_100099359 | Ga0070665_1000993593 | 296 |
| 313 | 3300005548 | Ga0070665_100405452 | Ga0070665_1004054521 | 296 |
| 314 | 3300005616 | Ga0068852_100141999 | Ga0068852_1001419992 | 296 |
| 315 | 3300005841 | Ga0068863_100445265 | Ga0068863_1004452651 | 296 |
| 316 | 3300005844 | Ga0068862_100662443 | Ga0068862_1006624431 | 296 |
| 317 | 3300005981 | Ga0081538_10025304 | Ga0081538_100253044 | 296 |
| 318 | 3300006038 | Ga0075365_10240526 | Ga0075365_102405262 | 296 |
| 319 | 3300006042 | Ga0075368_10032382 | Ga0075368_100323822 | 296 |
| 320 | 3300006048 | Ga0075363_100012045 | Ga0075363_1000120454 | 296 |
| 321 | 3300006051 | Ga0075364_10062765 | Ga0075364_100627652 | 296 |
| 322 | 3300006163 | Ga0070715_10022360 | Ga0070715_100223602 | 296 |
| 323 | 3300006175 | Ga0070712_100102915 | Ga0070712_1001029152 | 296 |
| 324 | 3300006178 | Ga0075367_10041204 | Ga0075367_100412041 | 296 |
| 325 | 3300006195 | Ga0075366_10134994 | Ga0075366_101349942 | 296 |
| 326 | 3300006353 | Ga0075370_10032951 | Ga0075370_100329514 | 296 |
| 327 | 3300006941 | Ga0099825_1020668 | Ga0099825_10206684 | 296 |
| 328 | 3300006942 | Ga0099824_1018360 | Ga0099824_10183603 | 296 |
| 329 | 3300009147 | Ga0114129_10071187 | Ga0114129_100711872 | 296 |
| 330 | 3300009177 | Ga0105248_10145936 | Ga0105248_101459361 | 296 |
| 331 | 3300009545 | Ga0105237_10023192 | Ga0105237_100231923 | 296 |
| 332 | 3300010375 | Ga0105239_10141596 | Ga0105239_101415963 | 296 |
| 333 | 3300010375 | Ga0105239_10166820 | Ga0105239_101668203 | 296 |
| 334 | 3300010375 | Ga0105239_10219240 | Ga0105239_102192401 | 296 |
| 335 | 3300011119 | Ga0105246_10076063 | Ga0105246_100760631 | 296 |
| 336 | 3300013104 | Ga0157370_10232451 | Ga0157370_102324512 | 296 |
| 337 | 3300013306 | Ga0163162_10311618 | Ga0163162_103116181 | 296 |
| 338 | 3300013308 | Ga0157375_10053365 | Ga0157375_100533653 | 296 |
| 339 | 3300014325 | Ga0163163_10313152 | Ga0163163_103131521 | 296 |
| 340 | 3300014969 | Ga0157376_10288393 | Ga0157376_102883932 | 296 |
| 341 | 3300021384 | Ga0213876_10097083 | Ga0213876_100970831 | 296 |
| 342 | 3300025230 | Ga0209563_101090 | Ga0209563_1010902 | 296 |
| 343 | 3300025253 | Ga0209677_102351 | Ga0209677_1023512 | 296 |
| 344 | 3300025254 | Ga0209148_1000316 | Ga0209148_100031655 | 296 |
| 345 | 3300025261 | Ga0209233_1004623 | Ga0209233_10046236 | 296 |
| 346 | 3300025273 | Ga0209673_1025297 | Ga0209673_10252972 | 296 |
| 347 | 3300025295 | Ga0209564_1037958 | Ga0209564_10379581 | 296 |
| 348 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106122 | 296 |
| 349 | 3300025297 | Ga0209758_1002396 | Ga0209758_10023963 | 296 |
| 350 | 3300025297 | Ga0209758_1024111 | Ga0209758_10241112 | 296 |
| 351 | 3300025299 | Ga0209256_1002946 | Ga0209256_10029469 | 296 |
| 352 | 3300025302 | Ga0207426_1001007 | Ga0207426_100100711 | 296 |
| 353 | 3300025302 | Ga0207426_1003263 | Ga0207426_100326310 | 296 |
| 354 | 3300025302 | Ga0207426_1008613 | Ga0207426_10086134 | 296 |
| 355 | 3300025302 | Ga0207426_1055401 | Ga0207426_10554011 | 296 |
| 356 | 3300025304 | Ga0209257_1001741 | Ga0209257_100174113 | 296 |
| 357 | 3300025898 | Ga0207692_10015365 | Ga0207692_100153652 | 296 |
| 358 | 3300025901 | Ga0207688_10079889 | Ga0207688_100798892 | 296 |
| 359 | 3300025904 | Ga0207647_10152140 | Ga0207647_101521402 | 296 |
| 360 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047850 | 296 |
| 361 | 3300025914 | Ga0207671_10003084 | Ga0207671_100030849 | 296 |
| 362 | 3300025915 | Ga0207693_10005512 | Ga0207693_100055127 | 296 |
| 363 | 3300025916 | Ga0207663_10000425 | Ga0207663_1000042511 | 296 |
| 364 | 3300025923 | Ga0207681_10276192 | Ga0207681_102761921 | 296 |
| 365 | 3300025929 | Ga0207664_10070747 | Ga0207664_100707472 | 296 |
| 366 | 3300025931 | Ga0207644_10041059 | Ga0207644_100410591 | 296 |
| 367 | 3300025939 | Ga0207665_10003367 | Ga0207665_100033677 | 296 |
| 368 | 3300026116 | Ga0207674_10247135 | Ga0207674_102471352 | 296 |
| 369 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001681 | 296 |
| 370 | 3300027296 | Ga0209389_1000027 | Ga0209389_100002763 | 296 |
| 371 | 3300027357 | Ga0209589_1000031 | Ga0209589_100003175 | 296 |
| 372 | 3300027361 | Ga0209489_100057 | Ga0209489_10005772 | 296 |
| 373 | 3300027361 | Ga0209489_100063 | Ga0209489_10006339 | 296 |
| 374 | 3300027363 | Ga0209700_100012 | Ga0209700_10001282 | 296 |
| 375 | 3300027866 | Ga0209813_10003650 | Ga0209813_100036503 | 296 |
| 376 | 3300028379 | Ga0268266_10072985 | Ga0268266_100729853 | 296 |
| 377 | 3300028379 | Ga0268266_10243943 | Ga0268266_102439432 | 296 |
| 378 | 3300028786 | Ga0307517_10156434 | Ga0307517_101564341 | 296 |
| 379 | 3300031711 | Ga0265314_10008159 | Ga0265314_100081598 | 296 |
| 380 | 3300031712 | Ga0265342_10005588 | Ga0265342_100055883 | 296 |
| 381 | 3300033180 | Ga0307510_10026321 | Ga0307510_100263214 | 296 |
| 382 | 3300035086 | Ga0373934_0047419 | Ga0373934_0047419_107_1072 | 296 |
| 383 | 3300035119 | Ga0373956_0011980 | Ga0373956_0011980_209_1174 | 296 |
| 384 | 3300035120 | Ga0373957_0006204 | Ga0373957_0006204_1115_2080 | 296 |
| 385 | 3300035692 | Ga0373935_0033201 | Ga0373935_0033201_947_1912 | 296 |
| 386 | 3300035724 | Ga0373933_0007313 | Ga0373933_0007313_3395_4360 | 296 |
| 387 | 3300037471 | Ga0395905_0028290 | Ga0395905_0028290_895_1860 | 296 |
| 388 | 3300039437 | Ga0436365_1584283 | Ga0436365_1584283_11469_12434 | 296 |
| 389 | 3300041452 | Ga0451793_1689633 | Ga0451793_1689633_2110_3075 | 296 |
| 390 | 3300044684 | Ga0466966_0000474 | Ga0466966_0000474_7012_7989 | 296 |
| 391 | 3300044693 | Ga0466961_0000023 | Ga0466961_0000023_77044_78021 | 296 |
| 392 | 3300045049 | Ga0466959_0000726 | Ga0466959_0000726_5990_6967 | 296 |
| 393 | 3300045836 | Ga0466958_0050655 | Ga0466958_0050655_1523_2500 | 296 |
| 394 | 3300046454 | Ga0495592_0025569 | Ga0495592_0025569_977_1942 | 296 |
| 395 | 3300046454 | Ga0495592_0181855 | Ga0495592_0181855_75_1040 | 296 |
| 396 | 3300046455 | Ga0495603_0067670 | Ga0495603_0067670_726_1691 | 296 |
| 397 | 3300046459 | Ga0495629_0064830 | Ga0495629_0064830_369_1334 | 296 |
| 398 | 3300046460 | Ga0495638_0009065 | Ga0495638_0009065_1115_2080 | 296 |
| 399 | 3300046462 | Ga0495651_0010752 | Ga0495651_0010752_3113_4078 | 296 |
| 400 | 3300046474 | Ga0495605_0041457 | Ga0495605_0041457_81_1103 | 296 |
| 401 | 3300046477 | Ga0495664_0032191 | Ga0495664_0032191_1418_2383 | 296 |
| 402 | 3300046507 | Ga0495606_0010252 | Ga0495606_0010252_6311_7288 | 296 |
| 403 | 3300046514 | Ga0495618_0049560 | Ga0495618_0049560_304_1269 | 296 |
| 404 | 3300046516 | Ga0495628_0008803 | Ga0495628_0008803_532_1497 | 296 |
| 405 | 3300046522 | Ga0495643_0104565 | Ga0495643_0104565_299_1264 | 296 |
| 406 | 3300046524 | Ga0495648_0017345 | Ga0495648_0017345_421_1398 | 296 |
| 407 | 3300046524 | Ga0495648_0023302 | Ga0495648_0023302_801_1766 | 296 |
| 408 | 3300046524 | Ga0495648_0163601 | Ga0495648_0163601_159_1124 | 296 |
| 409 | 3300046529 | Ga0495652_0026522 | Ga0495652_0026522_1442_2407 | 296 |
| 410 | 3300046533 | Ga0495640_0011385 | Ga0495640_0011385_501_1466 | 296 |
| 411 | 3300046533 | Ga0495640_0042700 | Ga0495640_0042700_1335_2300 | 296 |
| 412 | 3300046536 | Ga0495587_0007940 | Ga0495587_0007940_2267_3232 | 296 |
| 413 | 3300046536 | Ga0495587_0029301 | Ga0495587_0029301_468_1433 | 296 |
| 414 | 3300046543 | Ga0495645_0014710 | Ga0495645_0014710_1298_2263 | 296 |
| 415 | 3300046543 | Ga0495645_0042082 | Ga0495645_0042082_1866_2831 | 296 |
| 416 | 3300046559 | Ga0495667_0250542 | Ga0495667_0250542_53_1018 | 296 |
| 417 | 3300046616 | Ga0495668_0156697 | Ga0495668_0156697_194_1159 | 296 |
| 418 | 3300046616 | Ga0495668_0212793 | Ga0495668_0212793_32_997 | 296 |
| 419 | 3300046642 | Ga0495634_0025684 | Ga0495634_0025684_977_1942 | 296 |
| 420 | 3300046642 | Ga0495634_0028246 | Ga0495634_0028246_2276_3241 | 296 |
| 421 | 3300046665 | Ga0495661_0147563 | Ga0495661_0147563_225_1190 | 296 |
| 422 | 3300046674 | Ga0495588_0017305 | Ga0495588_0017305_2340_3305 | 296 |
| 423 | 3300046675 | Ga0495657_0004929 | Ga0495657_0004929_949_1914 | 296 |
| 424 | 3300046678 | Ga0495599_0004515 | Ga0495599_0004515_2450_3415 | 296 |
| 425 | 3300046679 | Ga0495623_0002235 | Ga0495623_0002235_3677_4642 | 296 |
| 426 | 3300046689 | Ga0495613_0030108 | Ga0495613_0030108_1308_2273 | 296 |
| 427 | 3300046690 | Ga0495624_0151959 | Ga0495624_0151959_389_1354 | 296 |
| 428 | 3300046692 | Ga0495671_0061704 | Ga0495671_0061704_238_1203 | 296 |
| 429 | 3300046694 | Ga0495649_0018372 | Ga0495649_0018372_2785_3762 | 296 |
| 430 | 3300047317 | Ga0495604_0038454 | Ga0495604_0038454_184_1149 | 296 |
| 431 | 3300047317 | Ga0495604_0071653 | Ga0495604_0071653_257_1222 | 296 |
| 432 | 3300047319 | Ga0495674_0083157 | Ga0495674_0083157_780_1745 | 296 |
| 433 | 3300047322 | Ga0495680_0002016 | Ga0495680_0002016_6425_7390 | 296 |
| 434 | 3300047444 | Ga0495675_0001856 | Ga0495675_0001856_2437_3402 | 296 |
| 435 | 3300047444 | Ga0495675_0014120 | Ga0495675_0014120_1074_2039 | 296 |
| 436 | 3300047471 | Ga0495684_0048992 | Ga0495684_0048992_103_1068 | 296 |
| 437 | 3300047471 | Ga0495684_0066991 | Ga0495684_0066991_1382_2347 | 296 |
| 438 | 3300047472 | Ga0495686_0052087 | Ga0495686_0052087_513_1478 | 296 |
| 439 | 3300048907 | Ga0496104_0210555 | Ga0496104_0210555_787_1809 | 296 |
| 440 | 3300048910 | Ga0496107_0111890 | Ga0496107_0111890_814_1779 | 296 |
| 441 | 3300048914 | Ga0496111_0075974 | Ga0496111_0075974_1200_2222 | 296 |
| 442 | 3300048915 | Ga0496112_0140196 | Ga0496112_0140196_517_1482 | 296 |
| 443 | 3300048916 | Ga0496113_0064157 | Ga0496113_0064157_948_1970 | 296 |
| 444 | 3300048917 | Ga0496114_0354705 | Ga0496114_0354705_170_1135 | 296 |
| 445 | 3300048919 | Ga0496116_0182671 | Ga0496116_0182671_120_1085 | 296 |
| 446 | 3300048920 | Ga0496117_0081359 | Ga0496117_0081359_109_1074 | 296 |
| 447 | 3300048921 | Ga0496118_0107467 | Ga0496118_0107467_96_1061 | 296 |
| 448 | 3300048921 | Ga0496118_0183053 | Ga0496118_0183053_67_1089 | 296 |
| 449 | 3300048924 | Ga0496121_0031768 | Ga0496121_0031768_3408_4373 | 296 |
| 450 | 3300048924 | Ga0496121_0050990 | Ga0496121_0050990_1219_2184 | 296 |
| 451 | 3300048927 | Ga0496124_0061180 | Ga0496124_0061180_476_1438 | 296 |
| 452 | 3300048929 | Ga0496126_0053837 | Ga0496126_0053837_106_1074 | 296 |
| 453 | 3300050490 | nmdc:mga03n38_13494_c2 | nmdc:mga03n38_13494_c2_1502_2524 | 296 |
| 454 | 3300050492 | nmdc:mga0yw44_18826_c1 | nmdc:mga0yw44_18826_c1_610_1575 | 296 |
| 455 | 3300050493 | nmdc:mga0k408_94704_c1 | nmdc:mga0k408_94704_c1_467_1432 | 296 |
| 456 | 3300050495 | nmdc:mga04h51_4263_c1 | nmdc:mga04h51_4263_c1_1797_2819 | 296 |
| 457 | 3300050496 | nmdc:mga07m45_81446_c1 | nmdc:mga07m45_81446_c1_843_1820 | 296 |
| 458 | 3300050496 | nmdc:mga07m45_8967_c1 | nmdc:mga07m45_8967_c1_3356_4318 | 296 |
| 459 | 3300050516 | nmdc:mga0sz30_17557_c1 | nmdc:mga0sz30_17557_c1_341_1363 | 296 |
| 460 | 3300053085 | Ga0495619_0191487 | Ga0495619_0191487_78_1043 | 296 |
| 461 | 3300053087 | Ga0500643_000052 | Ga0500643_000052_47861_48826 | 296 |
| 462 | 3300053094 | Ga0500566_0002512 | Ga0500566_0002512_109_1074 | 296 |
| 463 | 3300053096 | Ga0500641_0007654 | Ga0500641_0007654_1243_2208 | 296 |
| 464 | 3300053103 | Ga0500555_039695 | Ga0500555_039695_126_1091 | 296 |
| 465 | 3300053104 | Ga0500556_0008815 | Ga0500556_0008815_1217_2182 | 296 |
| 466 | 3300053105 | Ga0500557_000057 | Ga0500557_000057_35947_36912 | 296 |
| 467 | 3300053109 | Ga0500569_004458 | Ga0500569_004458_1064_2086 | 296 |
| 468 | 3300053121 | Ga0500607_103185 | Ga0500607_103185_378_1343 | 296 |
| 469 | 3300053130 | Ga0500642_0000263 | Ga0500642_0000263_15970_16935 | 296 |
| 470 | 3300053130 | Ga0500642_0016379 | Ga0500642_0016379_112_1077 | 296 |
| 471 | 3300053134 | Ga0500658_0099854 | Ga0500658_0099854_222_1187 | 296 |
| 472 | 3300053138 | Ga0500564_093204 | Ga0500564_093204_90_1055 | 296 |
| 473 | 3300053139 | Ga0500568_0010868 | Ga0500568_0010868_2883_3848 | 296 |
| 474 | 3300053148 | Ga0500590_150761 | Ga0500590_150761_19_984 | 296 |
| 475 | 3300053151 | Ga0500604_0040168 | Ga0500604_0040168_333_1298 | 296 |
| 476 | 3300053156 | Ga0500622_0004797 | Ga0500622_0004797_4032_5054 | 296 |
| 477 | 3300053158 | Ga0500627_0085024 | Ga0500627_0085024_51_1016 | 296 |
| 478 | 3300053177 | Ga0500636_0001378 | Ga0500636_0001378_4983_5948 | 296 |
| 479 | 3300053729 | Ga0500625_003219 | Ga0500625_003219_348_1313 | 296 |
| 480 | 3300053736 | Ga0500599_009231 | Ga0500599_009231_199_1164 | 296 |
| 481 | iso_pu_bacteria | 2528768022 | 2528850385 | 296 |
| 482 | iso_pu_bacteria | 2932784394 | 2932789671 | 296 |
| 483 | iso_pu_bacteria | 2932809354 | 2932814823 | 296 |
| 484 | iso_pu_bacteria | 2932818245 | 2932824320 | 296 |
| 485 | iso_pu_bacteria | 2932828146 | 2932833952 | 296 |
| 486 | iso_pu_bacteria | 2933577622 | 2933581804 | 296 |
| 487 | iso_pu_bacteria | 2935616580 | 2935623658 | 296 |
| 488 | iso_pu_bacteria | 2935638405 | 2935645045 | 296 |
| 489 | iso_pu_bacteria | 2935665750 | 2935672094 | 296 |
| 490 | iso_pu_bacteria | 2935675223 | 2935684100 | 296 |
| 491 | iso_pu_bacteria | 2935684952 | 2935689149 | 296 |
| 492 | iso_pu_bacteria | 2935694250 | 2935697591 | 296 |
| 493 | iso_pu_bacteria | 2935703347 | 2935711383 | 296 |
| 494 | iso_pu_bacteria | 2935713505 | 2935720095 | 296 |
| 495 | iso_pu_bacteria | 2935722832 | 2935728288 | 296 |
| 496 | iso_pu_bacteria | 2935732158 | 2935737115 | 296 |
| 497 | iso_pu_bacteria | 2935741537 | 2935746824 | 296 |
| 498 | iso_pu_bacteria | 2935750917 | 2935757791 | 296 |
| 499 | iso_pu_bacteria | 2935760218 | 2935764171 | 296 |
| 500 | iso_pu_bacteria | 2935801545 | 2935808757 | 296 |
| 501 | iso_pu_bacteria | 2935810662 | 2935817554 | 296 |
| 502 | iso_pu_bacteria | 2935827899 | 2935834109 | 296 |
| 503 | iso_pu_bacteria | 2935837841 | 2935844711 | 296 |
| 504 | iso_pu_bacteria | 2935855204 | 2935861735 | 296 |
| 505 | iso_pu_bacteria | 2935864058 | 2935868629 | 296 |
| 506 | iso_pu_bacteria | 2935873716 | 2935879403 | 296 |
| 507 | iso_pu_bacteria | 2935992306 | 2935998429 | 296 |
| 508 | iso_pu_bacteria | 2936002035 | 2936009110 | 296 |
| 509 | iso_pu_bacteria | 2936037263 | 2936044351 | 296 |
| 510 | iso_pu_bacteria | 2940556831 | 2940563387 | 296 |
| 511 | iso_pu_bacteria | 2941538514 | 2941545394 | 296 |
| 512 | iso_pu_bacteria | 8017057580 | 8017066283 | 296 |
| 513 | iso_pu_bacteria | 8019576017 | 8019578340 | 296 |
| 514 | iso_pu_bacteria | 8019586578 | 8019596378 | 296 |
| 515 | iso_pu_bacteria | 8019597564 | 8019605323 | 296 |
| 516 | iso_pu_bacteria | 8019608314 | 8019613219 | 296 |
| 517 | iso_pu_bacteria | 8055225921 | 8055228655 | 296 |
| 518 | iso_pu_bacteria | 8055742211 | 8055750362 | 296 |
| 519 | 3300003203 | JGI25406J46586_10006073 | JGI25406J46586_100060736 | 297 |
| 520 | 3300003215 | JGI25153J46596_10004803 | JGI25153J46596_100048033 | 297 |
| 521 | 3300003354 | JGI25160J50197_1008171 | JGI25160J50197_10081713 | 297 |
| 522 | 3300003659 | JGI25404J52841_10030037 | JGI25404J52841_100300371 | 297 |
| 523 | 3300005327 | Ga0070658_10093766 | Ga0070658_100937662 | 297 |
| 524 | 3300005327 | Ga0070658_10293588 | Ga0070658_102935882 | 297 |
| 525 | 3300005328 | Ga0070676_10044708 | Ga0070676_100447082 | 297 |
| 526 | 3300005328 | Ga0070676_10136276 | Ga0070676_101362761 | 297 |
| 527 | 3300005329 | Ga0070683_100149805 | Ga0070683_1001498052 | 297 |
| 528 | 3300005330 | Ga0070690_100059558 | Ga0070690_1000595583 | 297 |
| 529 | 3300005336 | Ga0070680_100077218 | Ga0070680_1000772182 | 297 |
| 530 | 3300005336 | Ga0070680_100131705 | Ga0070680_1001317052 | 297 |
| 531 | 3300005343 | Ga0070687_100055331 | Ga0070687_1000553312 | 297 |
| 532 | 3300005344 | Ga0070661_100271496 | Ga0070661_1002714962 | 297 |
| 533 | 3300005347 | Ga0070668_100217989 | Ga0070668_1002179892 | 297 |
| 534 | 3300005354 | Ga0070675_100118178 | Ga0070675_1001181784 | 297 |
| 535 | 3300005364 | Ga0070673_100069800 | Ga0070673_1000698003 | 297 |
| 536 | 3300005434 | Ga0070709_10024332 | Ga0070709_100243322 | 297 |
| 537 | 3300005434 | Ga0070709_10078062 | Ga0070709_100780622 | 297 |
| 538 | 3300005434 | Ga0070709_10141936 | Ga0070709_101419362 | 297 |
| 539 | 3300005436 | Ga0070713_100039241 | Ga0070713_1000392412 | 297 |
| 540 | 3300005437 | Ga0070710_10002417 | Ga0070710_100024172 | 297 |
| 541 | 3300005437 | Ga0070710_10038634 | Ga0070710_100386342 | 297 |
| 542 | 3300005455 | Ga0070663_100069526 | Ga0070663_1000695262 | 297 |
| 543 | 3300005458 | Ga0070681_10050857 | Ga0070681_100508573 | 297 |
| 544 | 3300005458 | Ga0070681_10074250 | Ga0070681_100742504 | 297 |
| 545 | 3300005458 | Ga0070681_10223614 | Ga0070681_102236141 | 297 |
| 546 | 3300005544 | Ga0070686_100008070 | Ga0070686_1000080702 | 297 |
| 547 | 3300005546 | Ga0070696_100048131 | Ga0070696_1000481312 | 297 |
| 548 | 3300005546 | Ga0070696_100107754 | Ga0070696_1001077541 | 297 |
| 549 | 3300005563 | Ga0068855_100001526 | Ga0068855_10000152612 | 297 |
| 550 | 3300005563 | Ga0068855_100076692 | Ga0068855_1000766923 | 297 |
| 551 | 3300005577 | Ga0068857_100266693 | Ga0068857_1002666932 | 297 |
| 552 | 3300005614 | Ga0068856_100365997 | Ga0068856_1003659972 | 297 |
| 553 | 3300005614 | Ga0068856_100392745 | Ga0068856_1003927451 | 297 |
| 554 | 3300005616 | Ga0068852_100216491 | Ga0068852_1002164912 | 297 |
| 555 | 3300005617 | Ga0068859_100092180 | Ga0068859_1000921802 | 297 |
| 556 | 3300005718 | Ga0068866_10080273 | Ga0068866_100802732 | 297 |
| 557 | 3300005834 | Ga0068851_10141729 | Ga0068851_101417292 | 297 |
| 558 | 3300005841 | Ga0068863_100036014 | Ga0068863_1000360146 | 297 |
| 559 | 3300005841 | Ga0068863_100116459 | Ga0068863_1001164592 | 297 |
| 560 | 3300005842 | Ga0068858_100029243 | Ga0068858_1000292434 | 297 |
| 561 | 3300005843 | Ga0068860_100000441 | Ga0068860_10000044125 | 297 |
| 562 | 3300005937 | Ga0081455_10003833 | Ga0081455_1000383311 | 297 |
| 563 | 3300005937 | Ga0081455_10053122 | Ga0081455_100531223 | 297 |
| 564 | 3300005937 | Ga0081455_10085161 | Ga0081455_100851613 | 297 |
| 565 | 3300005981 | Ga0081538_10120242 | Ga0081538_101202421 | 297 |
| 566 | 3300005983 | Ga0081540_1004960 | Ga0081540_10049609 | 297 |
| 567 | 3300005983 | Ga0081540_1006444 | Ga0081540_10064446 | 297 |
| 568 | 3300005983 | Ga0081540_1021674 | Ga0081540_10216742 | 297 |
| 569 | 3300005983 | Ga0081540_1025036 | Ga0081540_10250364 | 297 |
| 570 | 3300005983 | Ga0081540_1026089 | Ga0081540_10260893 | 297 |
| 571 | 3300005983 | Ga0081540_1026760 | Ga0081540_10267602 | 297 |
| 572 | 3300005983 | Ga0081540_1026892 | Ga0081540_10268922 | 297 |
| 573 | 3300005985 | Ga0081539_10001114 | Ga0081539_1000111441 | 297 |
| 574 | 3300006028 | Ga0070717_10051443 | Ga0070717_100514432 | 297 |
| 575 | 3300006038 | Ga0075365_10078393 | Ga0075365_100783933 | 297 |
| 576 | 3300006038 | Ga0075365_10224578 | Ga0075365_102245782 | 297 |
| 577 | 3300006051 | Ga0075364_10184785 | Ga0075364_101847851 | 297 |
| 578 | 3300006058 | Ga0075432_10017317 | Ga0075432_100173171 | 297 |
| 579 | 3300006163 | Ga0070715_10005346 | Ga0070715_100053465 | 297 |
| 580 | 3300006173 | Ga0070716_100001217 | Ga0070716_10000121713 | 297 |
| 581 | 3300006175 | Ga0070712_100177090 | Ga0070712_1001770902 | 297 |
| 582 | 3300006175 | Ga0070712_100449722 | Ga0070712_1004497221 | 297 |
| 583 | 3300006178 | Ga0075367_10024485 | Ga0075367_100244853 | 297 |
| 584 | 3300006186 | Ga0075369_10080344 | Ga0075369_100803442 | 297 |
| 585 | 3300006237 | Ga0097621_100010589 | Ga0097621_1000105898 | 297 |
| 586 | 3300006358 | Ga0068871_100036409 | Ga0068871_1000364095 | 297 |
| 587 | 3300006844 | Ga0075428_100001723 | Ga0075428_10000172317 | 297 |
| 588 | 3300006844 | Ga0075428_100274360 | Ga0075428_1002743603 | 297 |
| 589 | 3300006846 | Ga0075430_100000201 | Ga0075430_10000020117 | 297 |
| 590 | 3300006847 | Ga0075431_100000260 | Ga0075431_10000026017 | 297 |
| 591 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000762 | 297 |
| 592 | 3300006852 | Ga0075433_10127889 | Ga0075433_101278892 | 297 |
| 593 | 3300006852 | Ga0075433_10196700 | Ga0075433_101967002 | 297 |
| 594 | 3300006871 | Ga0075434_100000091 | Ga0075434_10000009130 | 297 |
| 595 | 3300006871 | Ga0075434_100034266 | Ga0075434_1000342664 | 297 |
| 596 | 3300006871 | Ga0075434_100210094 | Ga0075434_1002100942 | 297 |
| 597 | 3300006871 | Ga0075434_100276410 | Ga0075434_1002764102 | 297 |
| 598 | 3300006880 | Ga0075429_100001265 | Ga0075429_10000126516 | 297 |
| 599 | 3300006881 | Ga0068865_100115705 | Ga0068865_1001157052 | 297 |
| 600 | 3300006881 | Ga0068865_100121134 | Ga0068865_1001211342 | 297 |
| 601 | 3300006931 | Ga0097620_100092182 | Ga0097620_1000921823 | 297 |
| 602 | 3300007076 | Ga0075435_100003301 | Ga0075435_1000033014 | 297 |
| 603 | 3300007076 | Ga0075435_100011769 | Ga0075435_1000117692 | 297 |
| 604 | 3300007076 | Ga0075435_100312517 | Ga0075435_1003125172 | 297 |
| 605 | 3300009093 | Ga0105240_10014700 | Ga0105240_100147006 | 297 |
| 606 | 3300009094 | Ga0111539_10071975 | Ga0111539_100719754 | 297 |
| 607 | 3300009098 | Ga0105245_10221927 | Ga0105245_102219272 | 297 |
| 608 | 3300009098 | Ga0105245_10249822 | Ga0105245_102498221 | 297 |
| 609 | 3300009147 | Ga0114129_10007261 | Ga0114129_1000726118 | 297 |
| 610 | 3300009148 | Ga0105243_10125749 | Ga0105243_101257492 | 297 |
| 611 | 3300009176 | Ga0105242_10004266 | Ga0105242_1000426612 | 297 |
| 612 | 3300009176 | Ga0105242_10353114 | Ga0105242_103531141 | 297 |
| 613 | 3300009177 | Ga0105248_10047962 | Ga0105248_100479626 | 297 |
| 614 | 3300009551 | Ga0105238_10064515 | Ga0105238_100645152 | 297 |
| 615 | 3300009553 | Ga0105249_10083546 | Ga0105249_100835464 | 297 |
| 616 | 3300010375 | Ga0105239_10253395 | Ga0105239_102533952 | 297 |
| 617 | 3300011119 | Ga0105246_10126198 | Ga0105246_101261981 | 297 |
| 618 | 3300013102 | Ga0157371_10163070 | Ga0157371_101630702 | 297 |
| 619 | 3300025297 | Ga0209758_1005929 | Ga0209758_10059294 | 297 |
| 620 | 3300025297 | Ga0209758_1006430 | Ga0209758_10064309 | 297 |
| 621 | 3300025297 | Ga0209758_1011834 | Ga0209758_10118345 | 297 |
| 622 | 3300025302 | Ga0207426_1000374 | Ga0207426_100037411 | 297 |
| 623 | 3300025900 | Ga0207710_10007424 | Ga0207710_100074243 | 297 |
| 624 | 3300025903 | Ga0207680_10063441 | Ga0207680_100634412 | 297 |
| 625 | 3300025906 | Ga0207699_10001489 | Ga0207699_1000148914 | 297 |
| 626 | 3300025907 | Ga0207645_10133652 | Ga0207645_101336522 | 297 |
| 627 | 3300025912 | Ga0207707_10122357 | Ga0207707_101223572 | 297 |
| 628 | 3300025912 | Ga0207707_10204665 | Ga0207707_102046652 | 297 |
| 629 | 3300025915 | Ga0207693_10008449 | Ga0207693_100084497 | 297 |
| 630 | 3300025915 | Ga0207693_10027452 | Ga0207693_100274523 | 297 |
| 631 | 3300025915 | Ga0207693_10107351 | Ga0207693_101073511 | 297 |
| 632 | 3300025917 | Ga0207660_10190158 | Ga0207660_101901582 | 297 |
| 633 | 3300025919 | Ga0207657_10130332 | Ga0207657_101303322 | 297 |
| 634 | 3300025920 | Ga0207649_10051415 | Ga0207649_100514153 | 297 |
| 635 | 3300025924 | Ga0207694_10114799 | Ga0207694_101147992 | 297 |
| 636 | 3300025925 | Ga0207650_10263109 | Ga0207650_102631092 | 297 |
| 637 | 3300025927 | Ga0207687_10029064 | Ga0207687_100290644 | 297 |
| 638 | 3300025927 | Ga0207687_10118046 | Ga0207687_101180462 | 297 |
| 639 | 3300025928 | Ga0207700_10005022 | Ga0207700_100050229 | 297 |
| 640 | 3300025928 | Ga0207700_10200398 | Ga0207700_102003982 | 297 |
| 641 | 3300025928 | Ga0207700_10321855 | Ga0207700_103218551 | 297 |
| 642 | 3300025929 | Ga0207664_10146369 | Ga0207664_101463693 | 297 |
| 643 | 3300025931 | Ga0207644_10048873 | Ga0207644_100488734 | 297 |
| 644 | 3300025932 | Ga0207690_10061018 | Ga0207690_100610182 | 297 |
| 645 | 3300025933 | Ga0207706_10057132 | Ga0207706_100571323 | 297 |
| 646 | 3300025934 | Ga0207686_10026307 | Ga0207686_100263072 | 297 |
| 647 | 3300025935 | Ga0207709_10018115 | Ga0207709_100181155 | 297 |
| 648 | 3300025938 | Ga0207704_10163037 | Ga0207704_101630372 | 297 |
| 649 | 3300025939 | Ga0207665_10021180 | Ga0207665_100211804 | 297 |
| 650 | 3300025940 | Ga0207691_10154586 | Ga0207691_101545862 | 297 |
| 651 | 3300025941 | Ga0207711_10009422 | Ga0207711_1000942211 | 297 |
| 652 | 3300025944 | Ga0207661_10091550 | Ga0207661_100915502 | 297 |
| 653 | 3300025944 | Ga0207661_10302400 | Ga0207661_103024001 | 297 |
| 654 | 3300025949 | Ga0207667_10017077 | Ga0207667_1001707712 | 297 |
| 655 | 3300025986 | Ga0207658_10164790 | Ga0207658_101647902 | 297 |
| 656 | 3300026035 | Ga0207703_10106496 | Ga0207703_101064962 | 297 |
| 657 | 3300026041 | Ga0207639_10197023 | Ga0207639_101970233 | 297 |
| 658 | 3300026067 | Ga0207678_10017546 | Ga0207678_100175468 | 297 |
| 659 | 3300026067 | Ga0207678_10082834 | Ga0207678_100828342 | 297 |
| 660 | 3300026067 | Ga0207678_10124265 | Ga0207678_101242652 | 297 |
| 661 | 3300026088 | Ga0207641_10029014 | Ga0207641_100290145 | 297 |
| 662 | 3300026089 | Ga0207648_10228656 | Ga0207648_102286562 | 297 |
| 663 | 3300026116 | Ga0207674_10295465 | Ga0207674_102954652 | 297 |
| 664 | 3300026121 | Ga0207683_10012926 | Ga0207683_100129263 | 297 |
| 665 | 3300026121 | Ga0207683_10111222 | Ga0207683_101112223 | 297 |
| 666 | 3300026121 | Ga0207683_10341545 | Ga0207683_103415452 | 297 |
| 667 | 3300026121 | Ga0207683_10393857 | Ga0207683_103938572 | 297 |
| 668 | 3300026142 | Ga0207698_10011050 | Ga0207698_100110508 | 297 |
| 669 | 3300027671 | Ga0209588_1003621 | Ga0209588_10036213 | 297 |
| 670 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011520 | 297 |
| 671 | 3300027907 | Ga0207428_10105287 | Ga0207428_101052873 | 297 |
| 672 | 3300028379 | Ga0268266_10063727 | Ga0268266_100637273 | 297 |
| 673 | 3300028379 | Ga0268266_10079592 | Ga0268266_100795922 | 297 |
| 674 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004274 | 297 |
| 675 | 3300028381 | Ga0268264_10196256 | Ga0268264_101962562 | 297 |
| 676 | 3300028573 | Ga0265334_10029740 | Ga0265334_100297402 | 297 |
| 677 | 3300028786 | Ga0307517_10092417 | Ga0307517_100924173 | 297 |
| 678 | 3300028800 | Ga0265338_10100786 | Ga0265338_101007862 | 297 |
| 679 | 3300030521 | Ga0307511_10123445 | Ga0307511_101234451 | 297 |
| 680 | 3300031235 | Ga0265330_10006763 | Ga0265330_100067638 | 297 |
| 681 | 3300031235 | Ga0265330_10008114 | Ga0265330_100081144 | 297 |
| 682 | 3300031238 | Ga0265332_10002834 | Ga0265332_100028344 | 297 |
| 683 | 3300031238 | Ga0265332_10012634 | Ga0265332_100126342 | 297 |
| 684 | 3300031241 | Ga0265325_10000026 | Ga0265325_100000261 | 297 |
| 685 | 3300031241 | Ga0265325_10008677 | Ga0265325_100086779 | 297 |
| 686 | 3300031241 | Ga0265325_10008781 | Ga0265325_100087812 | 297 |
| 687 | 3300031241 | Ga0265325_10051223 | Ga0265325_100512232 | 297 |
| 688 | 3300031247 | Ga0265340_10001337 | Ga0265340_100013373 | 297 |
| 689 | 3300031247 | Ga0265340_10003564 | Ga0265340_100035643 | 297 |
| 690 | 3300031249 | Ga0265339_10003955 | Ga0265339_100039559 | 297 |
| 691 | 3300031249 | Ga0265339_10028820 | Ga0265339_100288203 | 297 |
| 692 | 3300031250 | Ga0265331_10006990 | Ga0265331_100069903 | 297 |
| 693 | 3300031250 | Ga0265331_10059477 | Ga0265331_100594772 | 297 |
| 694 | 3300031595 | Ga0265313_10013520 | Ga0265313_100135203 | 297 |
| 695 | 3300031595 | Ga0265313_10027363 | Ga0265313_100273631 | 297 |
| 696 | 3300031595 | Ga0265313_10027511 | Ga0265313_100275113 | 297 |
| 697 | 3300031595 | Ga0265313_10049471 | Ga0265313_100494712 | 297 |
| 698 | 3300031712 | Ga0265342_10000082 | Ga0265342_1000008222 | 297 |
| 699 | 3300031712 | Ga0265342_10000291 | Ga0265342_1000029136 | 297 |
| 700 | 3300031712 | Ga0265342_10010349 | Ga0265342_100103494 | 297 |
| 701 | 3300031712 | Ga0265342_10014750 | Ga0265342_100147505 | 297 |
| 702 | 3300031730 | Ga0307516_10094154 | Ga0307516_100941543 | 297 |
| 703 | 3300035090 | Ga0373949_0033249 | Ga0373949_0033249_200_1186 | 297 |
| 704 | 3300035111 | Ga0373923_0001865 | Ga0373923_0001865_4004_5032 | 297 |
| 705 | 3300035113 | Ga0373936_0006791 | Ga0373936_0006791_1988_2959 | 297 |
| 706 | 3300035113 | Ga0373936_0049669 | Ga0373936_0049669_275_1270 | 297 |
| 707 | 3300035115 | Ga0373941_0021210 | Ga0373941_0021210_187_1173 | 297 |
| 708 | 3300035116 | Ga0373945_0000946 | Ga0373945_0000946_781_1809 | 297 |
| 709 | 3300035116 | Ga0373945_0039019 | Ga0373945_0039019_241_1236 | 297 |
| 710 | 3300035116 | Ga0373945_0124728 | Ga0373945_0124728_10_975 | 297 |
| 711 | 3300035117 | Ga0373953_0000156 | Ga0373953_0000156_16625_17593 | 297 |
| 712 | 3300035117 | Ga0373953_0062323 | Ga0373953_0062323_292_1320 | 297 |
| 713 | 3300035118 | Ga0373954_0011119 | Ga0373954_0011119_1917_2885 | 297 |
| 714 | 3300035118 | Ga0373954_0013754 | Ga0373954_0013754_1347_2312 | 297 |
| 715 | 3300035118 | Ga0373954_0053883 | Ga0373954_0053883_190_1161 | 297 |
| 716 | 3300035119 | Ga0373956_0004148 | Ga0373956_0004148_1714_2682 | 297 |
| 717 | 3300035119 | Ga0373956_0118121 | Ga0373956_0118121_180_1175 | 297 |
| 718 | 3300035120 | Ga0373957_0001409 | Ga0373957_0001409_2590_3558 | 297 |
| 719 | 3300035170 | Ga0373943_0001934 | Ga0373943_0001934_397_1425 | 297 |
| 720 | 3300035170 | Ga0373943_0019251 | Ga0373943_0019251_917_1903 | 297 |
| 721 | 3300035171 | Ga0373946_0024460 | Ga0373946_0024460_367_1395 | 297 |
| 722 | 3300035172 | Ga0373955_0000395 | Ga0373955_0000395_6852_7820 | 297 |
| 723 | 3300035172 | Ga0373955_0002215 | Ga0373955_0002215_1812_2777 | 297 |
| 724 | 3300035172 | Ga0373955_0009768 | Ga0373955_0009768_1001_1996 | 297 |
| 725 | 3300035172 | Ga0373955_0050440 | Ga0373955_0050440_150_1178 | 297 |
| 726 | 3300035410 | Ga0373924_0007061 | Ga0373924_0007061_113_1108 | 297 |
| 727 | 3300035410 | Ga0373924_0043936 | Ga0373924_0043936_112_1140 | 297 |
| 728 | 3300035691 | Ga0373931_0013339 | Ga0373931_0013339_1590_2576 | 297 |
| 729 | 3300035691 | Ga0373931_0094834 | Ga0373931_0094834_320_1285 | 297 |
| 730 | 3300035692 | Ga0373935_0001093 | Ga0373935_0001093_8917_9903 | 297 |
| 731 | 3300035692 | Ga0373935_0034411 | Ga0373935_0034411_1589_2617 | 297 |
| 732 | 3300035695 | Ga0373927_0004563 | Ga0373927_0004563_4203_5168 | 297 |
| 733 | 3300035695 | Ga0373927_0021903 | Ga0373927_0021903_2423_3409 | 297 |
| 734 | 3300035695 | Ga0373927_0052489 | Ga0373927_0052489_1157_2152 | 297 |
| 735 | 3300035724 | Ga0373933_0004898 | Ga0373933_0004898_5002_5970 | 297 |
| 736 | 3300035724 | Ga0373933_0032029 | Ga0373933_0032029_285_1280 | 297 |
| 737 | 3300035725 | Ga0373947_0000288 | Ga0373947_0000288_24067_25053 | 297 |
| 738 | 3300035725 | Ga0373947_0031415 | Ga0373947_0031415_14_1042 | 297 |
| 739 | 3300035725 | Ga0373947_0056162 | Ga0373947_0056162_366_1331 | 297 |
| 740 | 3300036401 | Ga0373937_0000996 | Ga0373937_0000996_18805_19770 | 297 |
| 741 | 3300036401 | Ga0373937_0300677 | Ga0373937_0300677_333_1298 | 297 |
| 742 | 3300036401 | Ga0373937_0566416 | Ga0373937_0566416_12_998 | 297 |
| 743 | 3300037068 | Ga0373925_0002967 | Ga0373925_0002967_1102_2073 | 297 |
| 744 | 3300037068 | Ga0373925_0018541 | Ga0373925_0018541_1787_2758 | 297 |
| 745 | 3300037068 | Ga0373925_0021989 | Ga0373925_0021989_273_1238 | 297 |
| 746 | 3300037068 | Ga0373925_0027832 | Ga0373925_0027832_445_1431 | 297 |
| 747 | 3300037068 | Ga0373925_0277657 | Ga0373925_0277657_332_1312 | 297 |
| 748 | 3300037312 | Ga0395899_0009357 | Ga0395899_0009357_1246_2214 | 297 |
| 749 | 3300037418 | Ga0395900_0119313 | Ga0395900_0119313_57_1025 | 297 |
| 750 | 3300037418 | Ga0395900_0178657 | Ga0395900_0178657_100_1206 | 297 |
| 751 | 3300037466 | Ga0395898_0014236 | Ga0395898_0014236_5641_6609 | 297 |
| 752 | 3300038443 | Ga0395901_0127711 | Ga0395901_0127711_572_1678 | 297 |
| 753 | 3300038443 | Ga0395901_0366626 | Ga0395901_0366626_27_995 | 297 |
| 754 | 3300039438 | Ga0436360_0575108 | Ga0436360_0575108_335_1303 | 297 |
| 755 | 3300039453 | Ga0436362_1127865 | Ga0436362_1127865_535_1503 | 297 |
| 756 | 3300044658 | Ga0466972_0000177 | Ga0466972_0000177_30211_31197 | 297 |
| 757 | 3300044684 | Ga0466966_0259602 | Ga0466966_0259602_38_1006 | 297 |
| 758 | 3300044706 | Ga0466964_0036413 | Ga0466964_0036413_891_1913 | 297 |
| 759 | 3300046454 | Ga0495592_0016624 | Ga0495592_0016624_1646_2611 | 297 |
| 760 | 3300046454 | Ga0495592_0041102 | Ga0495592_0041102_1399_2367 | 297 |
| 761 | 3300046454 | Ga0495592_0067804 | Ga0495592_0067804_1161_2189 | 297 |
| 762 | 3300046455 | Ga0495603_0008338 | Ga0495603_0008338_4009_4995 | 297 |
| 763 | 3300046455 | Ga0495603_0026574 | Ga0495603_0026574_1581_2609 | 297 |
| 764 | 3300046455 | Ga0495603_0027248 | Ga0495603_0027248_2266_3261 | 297 |
| 765 | 3300046455 | Ga0495603_0074304 | Ga0495603_0074304_850_1815 | 297 |
| 766 | 3300046458 | Ga0495591_030268 | Ga0495591_030268_258_1286 | 297 |
| 767 | 3300046458 | Ga0495591_051529 | Ga0495591_051529_107_1087 | 297 |
| 768 | 3300046459 | Ga0495629_0000183 | Ga0495629_0000183_27346_28332 | 297 |
| 769 | 3300046459 | Ga0495629_0000655 | Ga0495629_0000655_21891_22859 | 297 |
| 770 | 3300046460 | Ga0495638_0051383 | Ga0495638_0051383_826_1806 | 297 |
| 771 | 3300046461 | Ga0495641_0054290 | Ga0495641_0054290_15_980 | 297 |
| 772 | 3300046462 | Ga0495651_0005368 | Ga0495651_0005368_709_1674 | 297 |
| 773 | 3300046462 | Ga0495651_0007056 | Ga0495651_0007056_7300_8295 | 297 |
| 774 | 3300046462 | Ga0495651_0008033 | Ga0495651_0008033_1795_2763 | 297 |
| 775 | 3300046463 | Ga0495653_0004854 | Ga0495653_0004854_8934_9902 | 297 |
| 776 | 3300046463 | Ga0495653_0035742 | Ga0495653_0035742_1412_2407 | 297 |
| 777 | 3300046463 | Ga0495653_0142291 | Ga0495653_0142291_233_1261 | 297 |
| 778 | 3300046472 | Ga0495580_0106313 | Ga0495580_0106313_230_1258 | 297 |
| 779 | 3300046473 | Ga0495582_0001121 | Ga0495582_0001121_9817_10803 | 297 |
| 780 | 3300046473 | Ga0495582_0097360 | Ga0495582_0097360_126_1121 | 297 |
| 781 | 3300046474 | Ga0495605_0069308 | Ga0495605_0069308_160_1137 | 297 |
| 782 | 3300046475 | Ga0495639_0009485 | Ga0495639_0009485_3122_4150 | 297 |
| 783 | 3300046476 | Ga0495662_0072451 | Ga0495662_0072451_60_1088 | 297 |
| 784 | 3300046477 | Ga0495664_0018150 | Ga0495664_0018150_274_1302 | 297 |
| 785 | 3300046477 | Ga0495664_0102880 | Ga0495664_0102880_578_1573 | 297 |
| 786 | 3300046491 | Ga0495584_0067035 | Ga0495584_0067035_69_1097 | 297 |
| 787 | 3300046492 | Ga0495585_0003428 | Ga0495585_0003428_871_1899 | 297 |
| 788 | 3300046499 | Ga0495594_0017097 | Ga0495594_0017097_2472_3500 | 297 |
| 789 | 3300046499 | Ga0495594_0155501 | Ga0495594_0155501_102_1082 | 297 |
| 790 | 3300046500 | Ga0495596_0103616 | Ga0495596_0103616_64_1044 | 297 |
| 791 | 3300046501 | Ga0495607_0009340 | Ga0495607_0009340_5433_6461 | 297 |
| 792 | 3300046511 | Ga0495608_0002221 | Ga0495608_0002221_4643_5638 | 297 |
| 793 | 3300046511 | Ga0495608_0009154 | Ga0495608_0009154_1795_2763 | 297 |
| 794 | 3300046511 | Ga0495608_0015766 | Ga0495608_0015766_1533_2498 | 297 |
| 795 | 3300046512 | Ga0495610_0057636 | Ga0495610_0057636_82_1062 | 297 |
| 796 | 3300046513 | Ga0495616_0093166 | Ga0495616_0093166_35_1015 | 297 |
| 797 | 3300046514 | Ga0495618_0013409 | Ga0495618_0013409_2444_3439 | 297 |
| 798 | 3300046515 | Ga0495620_0052579 | Ga0495620_0052579_166_1134 | 297 |
| 799 | 3300046516 | Ga0495628_0000950 | Ga0495628_0000950_8197_9162 | 297 |
| 800 | 3300046516 | Ga0495628_0049682 | Ga0495628_0049682_1129_2097 | 297 |
| 801 | 3300046516 | Ga0495628_0207020 | Ga0495628_0207020_215_1186 | 297 |
| 802 | 3300046517 | Ga0495630_0069053 | Ga0495630_0069053_1192_2187 | 297 |
| 803 | 3300046517 | Ga0495630_0127087 | Ga0495630_0127087_933_1901 | 297 |
| 804 | 3300046518 | Ga0495631_0060865 | Ga0495631_0060865_637_1605 | 297 |
| 805 | 3300046518 | Ga0495631_0081087 | Ga0495631_0081087_212_1180 | 297 |
| 806 | 3300046523 | Ga0495644_0000234 | Ga0495644_0000234_3426_4454 | 297 |
| 807 | 3300046528 | Ga0495642_0017866 | Ga0495642_0017866_731_1711 | 297 |
| 808 | 3300046529 | Ga0495652_0002257 | Ga0495652_0002257_14277_15242 | 297 |
| 809 | 3300046529 | Ga0495652_0038700 | Ga0495652_0038700_2895_3890 | 297 |
| 810 | 3300046529 | Ga0495652_0056866 | Ga0495652_0056866_982_1977 | 297 |
| 811 | 3300046529 | Ga0495652_0136539 | Ga0495652_0136539_795_1763 | 297 |
| 812 | 3300046529 | Ga0495652_0278038 | Ga0495652_0278038_215_1195 | 297 |
| 813 | 3300046533 | Ga0495640_0012912 | Ga0495640_0012912_3421_4416 | 297 |
| 814 | 3300046533 | Ga0495640_0018366 | Ga0495640_0018366_229_1200 | 297 |
| 815 | 3300046533 | Ga0495640_0068492 | Ga0495640_0068492_1217_2182 | 297 |
| 816 | 3300046536 | Ga0495587_0002956 | Ga0495587_0002956_218_1213 | 297 |
| 817 | 3300046536 | Ga0495587_0018590 | Ga0495587_0018590_734_1699 | 297 |
| 818 | 3300046536 | Ga0495587_0029645 | Ga0495587_0029645_1130_2098 | 297 |
| 819 | 3300046543 | Ga0495645_0001487 | Ga0495645_0001487_4439_5404 | 297 |
| 820 | 3300046543 | Ga0495645_0002475 | Ga0495645_0002475_11483_12478 | 297 |
| 821 | 3300046543 | Ga0495645_0002973 | Ga0495645_0002973_7705_8673 | 297 |
| 822 | 3300046557 | Ga0495622_0015742 | Ga0495622_0015742_349_1377 | 297 |
| 823 | 3300046557 | Ga0495622_0064788 | Ga0495622_0064788_269_1255 | 297 |
| 824 | 3300046558 | Ga0495633_0002692 | Ga0495633_0002692_1252_2280 | 297 |
| 825 | 3300046559 | Ga0495667_0008800 | Ga0495667_0008800_1485_2513 | 297 |
| 826 | 3300046559 | Ga0495667_0034771 | Ga0495667_0034771_287_1252 | 297 |
| 827 | 3300046559 | Ga0495667_0230581 | Ga0495667_0230581_88_1083 | 297 |
| 828 | 3300046615 | Ga0495656_0000174 | Ga0495656_0000174_191_1219 | 297 |
| 829 | 3300046616 | Ga0495668_0012879 | Ga0495668_0012879_1969_2937 | 297 |
| 830 | 3300046642 | Ga0495634_0011443 | Ga0495634_0011443_1288_2256 | 297 |
| 831 | 3300046642 | Ga0495634_0030566 | Ga0495634_0030566_397_1392 | 297 |
| 832 | 3300046642 | Ga0495634_0038590 | Ga0495634_0038590_228_1256 | 297 |
| 833 | 3300046648 | Ga0495611_0054934 | Ga0495611_0054934_134_1162 | 297 |
| 834 | 3300046663 | Ga0495635_0000380 | Ga0495635_0000380_1130_2098 | 297 |
| 835 | 3300046663 | Ga0495635_0006494 | Ga0495635_0006494_3442_4407 | 297 |
| 836 | 3300046663 | Ga0495635_0102821 | Ga0495635_0102821_712_1707 | 297 |
| 837 | 3300046664 | Ga0495659_0000220 | Ga0495659_0000220_6193_7221 | 297 |
| 838 | 3300046674 | Ga0495588_0011399 | Ga0495588_0011399_1957_2985 | 297 |
| 839 | 3300046674 | Ga0495588_0096356 | Ga0495588_0096356_132_1118 | 297 |
| 840 | 3300046674 | Ga0495588_0134287 | Ga0495588_0134287_62_1027 | 297 |
| 841 | 3300046675 | Ga0495657_0001852 | Ga0495657_0001852_15343_16338 | 297 |
| 842 | 3300046675 | Ga0495657_0005248 | Ga0495657_0005248_2193_3161 | 297 |
| 843 | 3300046675 | Ga0495657_0021999 | Ga0495657_0021999_479_1444 | 297 |
| 844 | 3300046675 | Ga0495657_0187104 | Ga0495657_0187104_83_1111 | 297 |
| 845 | 3300046678 | Ga0495599_0027283 | Ga0495599_0027283_71_1066 | 297 |
| 846 | 3300046678 | Ga0495599_0068007 | Ga0495599_0068007_273_1244 | 297 |
| 847 | 3300046679 | Ga0495623_0001484 | Ga0495623_0001484_12947_13942 | 297 |
| 848 | 3300046679 | Ga0495623_0004582 | Ga0495623_0004582_5111_6076 | 297 |
| 849 | 3300046680 | Ga0495646_0006953 | Ga0495646_0006953_1680_2675 | 297 |
| 850 | 3300046680 | Ga0495646_0055279 | Ga0495646_0055279_634_1605 | 297 |
| 851 | 3300046681 | Ga0495647_0029945 | Ga0495647_0029945_95_1090 | 297 |
| 852 | 3300046681 | Ga0495647_0055145 | Ga0495647_0055145_189_1175 | 297 |
| 853 | 3300046683 | Ga0495658_0000357 | Ga0495658_0000357_6164_7150 | 297 |
| 854 | 3300046684 | Ga0495669_0015903 | Ga0495669_0015903_2155_3123 | 297 |
| 855 | 3300046689 | Ga0495613_0009346 | Ga0495613_0009346_5878_6864 | 297 |
| 856 | 3300046689 | Ga0495613_0013096 | Ga0495613_0013096_1965_2933 | 297 |
| 857 | 3300046689 | Ga0495613_0153263 | Ga0495613_0153263_548_1543 | 297 |
| 858 | 3300046690 | Ga0495624_0100338 | Ga0495624_0100338_223_1194 | 297 |
| 859 | 3300046691 | Ga0495670_0000414 | Ga0495670_0000414_2251_3279 | 297 |
| 860 | 3300046809 | Ga0495600_0007486 | Ga0495600_0007486_90_1118 | 297 |
| 861 | 3300046809 | Ga0495600_0014864 | Ga0495600_0014864_2510_3475 | 297 |
| 862 | 3300046809 | Ga0495600_0067298 | Ga0495600_0067298_402_1370 | 297 |
| 863 | 3300047315 | Ga0495581_0010000 | Ga0495581_0010000_1325_2311 | 297 |
| 864 | 3300047315 | Ga0495581_0103688 | Ga0495581_0103688_231_1211 | 297 |
| 865 | 3300047317 | Ga0495604_0008886 | Ga0495604_0008886_1130_2098 | 297 |
| 866 | 3300047317 | Ga0495604_0017648 | Ga0495604_0017648_1362_2357 | 297 |
| 867 | 3300047317 | Ga0495604_0050016 | Ga0495604_0050016_358_1323 | 297 |
| 868 | 3300047317 | Ga0495604_0138503 | Ga0495604_0138503_674_1702 | 297 |
| 869 | 3300047319 | Ga0495674_0024907 | Ga0495674_0024907_3117_4112 | 297 |
| 870 | 3300047319 | Ga0495674_0044316 | Ga0495674_0044316_904_1875 | 297 |
| 871 | 3300047319 | Ga0495674_0055217 | Ga0495674_0055217_1517_2512 | 297 |
| 872 | 3300047321 | Ga0495676_0014158 | Ga0495676_0014158_4480_5466 | 297 |
| 873 | 3300047322 | Ga0495680_0001462 | Ga0495680_0001462_5517_6545 | 297 |
| 874 | 3300047322 | Ga0495680_0081922 | Ga0495680_0081922_528_1523 | 297 |
| 875 | 3300047444 | Ga0495675_0060074 | Ga0495675_0060074_32_1027 | 297 |
| 876 | 3300047445 | Ga0495677_0081228 | Ga0495677_0081228_48_1016 | 297 |
| 877 | 3300047471 | Ga0495684_0000294 | Ga0495684_0000294_17177_18145 | 297 |
| 878 | 3300047471 | Ga0495684_0001528 | Ga0495684_0001528_4137_5165 | 297 |
| 879 | 3300047471 | Ga0495684_0103985 | Ga0495684_0103985_260_1255 | 297 |
| 880 | 3300047673 | Ga0495593_0000744 | Ga0495593_0000744_8898_9866 | 297 |
| 881 | 3300047673 | Ga0495593_0010818 | Ga0495593_0010818_1930_2916 | 297 |
| 882 | 3300047673 | Ga0495593_0036316 | Ga0495593_0036316_1480_2475 | 297 |
| 883 | 3300048088 | Ga0495602_0001368 | Ga0495602_0001368_712_1707 | 297 |
| 884 | 3300048088 | Ga0495602_0004084 | Ga0495602_0004084_8575_9540 | 297 |
| 885 | 3300048089 | Ga0495614_0005613 | Ga0495614_0005613_1555_2550 | 297 |
| 886 | 3300048089 | Ga0495614_0093364 | Ga0495614_0093364_66_1037 | 297 |
| 887 | 3300048089 | Ga0495614_0114140 | Ga0495614_0114140_129_1115 | 297 |
| 888 | 3300048903 | Ga0496100_0002106 | Ga0496100_0002106_610_1605 | 297 |
| 889 | 3300048903 | Ga0496100_0111181 | Ga0496100_0111181_495_1523 | 297 |
| 890 | 3300048904 | Ga0496101_0028676 | Ga0496101_0028676_100_1095 | 297 |
| 891 | 3300048905 | Ga0496102_0005062 | Ga0496102_0005062_9508_10503 | 297 |
| 892 | 3300048907 | Ga0496104_0001363 | Ga0496104_0001363_7177_8142 | 297 |
| 893 | 3300048907 | Ga0496104_0513471 | Ga0496104_0513471_87_1082 | 297 |
| 894 | 3300048908 | Ga0496105_0124238 | Ga0496105_0124238_587_1582 | 297 |
| 895 | 3300048908 | Ga0496105_0133756 | Ga0496105_0133756_835_1800 | 297 |
| 896 | 3300048910 | Ga0496107_0001189 | Ga0496107_0001189_627_1622 | 297 |
| 897 | 3300048912 | Ga0496109_0171908 | Ga0496109_0171908_512_1507 | 297 |
| 898 | 3300048913 | Ga0496110_0197818 | Ga0496110_0197818_710_1675 | 297 |
| 899 | 3300048918 | Ga0496115_0024926 | Ga0496115_0024926_549_1535 | 297 |
| 900 | 3300048922 | Ga0496119_0012670 | Ga0496119_0012670_4282_5250 | 297 |
| 901 | 3300048929 | Ga0496126_0195743 | Ga0496126_0195743_400_1368 | 297 |
| 902 | 3300049571 | Ga0501034_0064750 | Ga0501034_0064750_1954_2922 | 297 |
| 903 | 3300049571 | Ga0501034_0264153 | Ga0501034_0264153_574_1542 | 297 |
| 904 | 3300049573 | Ga0501037_0031825 | Ga0501037_0031825_2655_3623 | 297 |
| 905 | 3300049574 | Ga0501038_0058873 | Ga0501038_0058873_361_1329 | 297 |
| 906 | 3300049579 | Ga0501043_0134930 | Ga0501043_0134930_816_1784 | 297 |
| 907 | 3300049581 | Ga0501047_0008244 | Ga0501047_0008244_4481_5449 | 297 |
| 908 | 3300049581 | Ga0501047_0045692 | Ga0501047_0045692_1845_2813 | 297 |
| 909 | 3300049588 | Ga0501072_0186968 | Ga0501072_0186968_490_1458 | 297 |
| 910 | 3300049590 | Ga0501074_0089456 | Ga0501074_0089456_190_1158 | 297 |
| 911 | 3300049592 | Ga0501076_0362473 | Ga0501076_0362473_25_993 | 297 |
| 912 | 3300049741 | Ga0501079_0099173 | Ga0501079_0099173_1081_2049 | 297 |
| 913 | 3300049744 | Ga0501083_0047864 | Ga0501083_0047864_1097_2065 | 297 |
| 914 | 3300049822 | Ga0501035_0340851 | Ga0501035_0340851_93_1061 | 297 |
| 915 | 3300049823 | Ga0501044_0034776 | Ga0501044_0034776_3227_4195 | 297 |
| 916 | 3300050494 | nmdc:mga06z11_112871_c1 | nmdc:mga06z11_112871_c1_408_1379 | 297 |
| 917 | 3300050496 | nmdc:mga07m45_126220_c1 | nmdc:mga07m45_126220_c1_270_1244 | 297 |
| 918 | 3300050507 | nmdc:mga05p37_2742_c1 | nmdc:mga05p37_2742_c1_3600_4589 | 297 |
| 919 | 3300050512 | nmdc:mga0n895_18031_c1 | nmdc:mga0n895_18031_c1_3338_4309 | 297 |
| 920 | 3300050512 | nmdc:mga0n895_385578_c1 | nmdc:mga0n895_385578_c1_120_1106 | 297 |
| 921 | 3300050512 | nmdc:mga0n895_4431_c1 | nmdc:mga0n895_4431_c1_2648_3637 | 297 |
| 922 | 3300050513 | nmdc:mga0rr50_4443_c1 | nmdc:mga0rr50_4443_c1_4898_5887 | 297 |
| 923 | 3300050515 | nmdc:mga0a205_75792_c2 | nmdc:mga0a205_75792_c2_706_1695 | 297 |
| 924 | 3300053077 | Ga0495601_0000075 | Ga0495601_0000075_27467_28432 | 297 |
| 925 | 3300053077 | Ga0495601_0003475 | Ga0495601_0003475_4331_5326 | 297 |
| 926 | 3300053077 | Ga0495601_0028022 | Ga0495601_0028022_1080_2075 | 297 |
| 927 | 3300053078 | Ga0495612_0002526 | Ga0495612_0002526_5495_6460 | 297 |
| 928 | 3300053078 | Ga0495612_0008861 | Ga0495612_0008861_1412_2407 | 297 |
| 929 | 3300053078 | Ga0495612_0011526 | Ga0495612_0011526_2497_3492 | 297 |
| 930 | 3300053078 | Ga0495612_0017374 | Ga0495612_0017374_861_1832 | 297 |
| 931 | 3300053084 | Ga0495595_0000253 | Ga0495595_0000253_18232_19227 | 297 |
| 932 | 3300053084 | Ga0495595_0000311 | Ga0495595_0000311_15374_16339 | 297 |
| 933 | 3300053084 | Ga0495595_0000670 | Ga0495595_0000670_10442_11410 | 297 |
| 934 | 3300053084 | Ga0495595_0009800 | Ga0495595_0009800_2483_3511 | 297 |
| 935 | 3300053085 | Ga0495619_0000301 | Ga0495619_0000301_26576_27562 | 297 |
| 936 | 3300053085 | Ga0495619_0000645 | Ga0495619_0000645_15198_16163 | 297 |
| 937 | 3300053085 | Ga0495619_0003855 | Ga0495619_0003855_6852_7820 | 297 |
| 938 | 3300053085 | Ga0495619_0036799 | Ga0495619_0036799_832_1827 | 297 |
| 939 | 3300053085 | Ga0495619_0065853 | Ga0495619_0065853_1202_2167 | 297 |
| 940 | 3300053085 | Ga0495619_0223462 | Ga0495619_0223462_191_1186 | 297 |
| 941 | 3300053093 | Ga0500651_0004830 | Ga0500651_0004830_692_1660 | 297 |
| 942 | 3300053098 | Ga0500650_0131108 | Ga0500650_0131108_135_1100 | 297 |
| 943 | 3300053119 | Ga0500595_000558 | Ga0500595_000558_7887_8855 | 297 |
| 944 | 3300053119 | Ga0500595_002578 | Ga0500595_002578_5232_6200 | 297 |
| 945 | 3300053139 | Ga0500568_0038089 | Ga0500568_0038089_802_1770 | 297 |
| 946 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_783781_784770 | 297 |
| 947 | 3300053156 | Ga0500622_0103055 | Ga0500622_0103055_415_1383 | 297 |
| 948 | 3300053177 | Ga0500636_0002410 | Ga0500636_0002410_5203_6171 | 297 |
| 949 | 3300005563 | Ga0068855_100037526 | Ga0068855_1000375263 | 298 |
| 950 | 3300006846 | Ga0075430_100000244 | Ga0075430_10000024418 | 298 |
| 951 | 3300006846 | Ga0075430_100136323 | Ga0075430_1001363232 | 298 |
| 952 | 3300031241 | Ga0265325_10013389 | Ga0265325_100133894 | 298 |
| 953 | 3300031711 | Ga0265314_10002205 | Ga0265314_1000220514 | 298 |
| 954 | 3300035171 | Ga0373946_0007183 | Ga0373946_0007183_473_1453 | 298 |
| 955 | 3300035695 | Ga0373927_0175979 | Ga0373927_0175979_213_1193 | 298 |
| 956 | 3300035725 | Ga0373947_0024233 | Ga0373947_0024233_537_1517 | 298 |
| 957 | 3300037466 | Ga0395898_0073654 | Ga0395898_0073654_1585_2556 | 298 |
| 958 | 3300038443 | Ga0395901_0078788 | Ga0395901_0078788_19_990 | 298 |
| 959 | 3300046533 | Ga0495640_0009446 | Ga0495640_0009446_1918_2898 | 298 |
| 960 | 3300047319 | Ga0495674_0168794 | Ga0495674_0168794_396_1376 | 298 |
| 961 | 3300049569 | Ga0501032_0095172 | Ga0501032_0095172_811_1782 | 298 |
| 962 | 3300049570 | Ga0501033_0232716 | Ga0501033_0232716_222_1193 | 298 |
| 963 | 3300049572 | Ga0501036_0005977 | Ga0501036_0005977_4936_5907 | 298 |
| 964 | 3300049573 | Ga0501037_0003231 | Ga0501037_0003231_10699_11670 | 298 |
| 965 | 3300049574 | Ga0501038_0020838 | Ga0501038_0020838_1447_2418 | 298 |
| 966 | 3300049575 | Ga0501039_0001869 | Ga0501039_0001869_12620_13591 | 298 |
| 967 | 3300049581 | Ga0501047_0128370 | Ga0501047_0128370_1335_2306 | 298 |
| 968 | 3300049582 | Ga0501048_0034771 | Ga0501048_0034771_509_1480 | 298 |
| 969 | 3300049583 | Ga0501067_0172555 | Ga0501067_0172555_102_1073 | 298 |
| 970 | 3300049584 | Ga0501068_0014174 | Ga0501068_0014174_3526_4497 | 298 |
| 971 | 3300049585 | Ga0501069_0000929 | Ga0501069_0000929_9996_10967 | 298 |
| 972 | 3300049587 | Ga0501071_0079370 | Ga0501071_0079370_1180_2151 | 298 |
| 973 | 3300049589 | Ga0501073_0017185 | Ga0501073_0017185_1087_2058 | 298 |
| 974 | 3300049590 | Ga0501074_0022225 | Ga0501074_0022225_3503_4474 | 298 |
| 975 | 3300049741 | Ga0501079_0064503 | Ga0501079_0064503_1816_2787 | 298 |
| 976 | 3300049744 | Ga0501083_0010731 | Ga0501083_0010731_537_1508 | 298 |
| 977 | 3300049822 | Ga0501035_0014209 | Ga0501035_0014209_1899_2870 | 298 |
| 978 | 3300049823 | Ga0501044_0093844 | Ga0501044_0093844_156_1127 | 298 |
| 979 | 3300049824 | Ga0501045_0114802 | Ga0501045_0114802_100_1071 | 298 |
| 980 | 3300050509 | nmdc:mga0qj67_64106_c1 | nmdc:mga0qj67_64106_c1_1811_2785 | 298 |
| 981 | 3300050510 | nmdc:mga06r32_253385_c1 | nmdc:mga06r32_253385_c1_401_1375 | 298 |
| 982 | 3300054114 | Ga0501084_0035333 | Ga0501084_0035333_1238_2209 | 298 |
| 983 | 3300053117 | Ga0500593_003210 | Ga0500593_003210_1030_2013 | 299 |
| 984 | 3300049823 | Ga0501044_0000286 | Ga0501044_0000286_41085_42077 | 300 |
| 985 | iso_pu_bacteria | 2929199973 | 2929201839 | 304 |
| 986 | iso_pu_bacteria | 8055909800 | 8055916289 | 304 |
| 987 | 3300003203 | JGI25406J46586_10000359 | JGI25406J46586_1000035911 | 306 |
| 988 | 3300005985 | Ga0081539_10001128 | Ga0081539_1000112825 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ndr-assembly1.cif.gz_E | crystal structure of tphc in an open conformation | 0.894 | 33 | 285 |
| 4x9t-assembly1.cif.gz_A | crystal structure of a tctc solute binding protein from polaromonas (bpro_3516, target efi-510338), no ligand | 0.8862 | 31 | 287 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.885 | 32 | 288 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.8848 | 31 | 288 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.8608 | 35 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9647 | 131 | 251 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9626 | 131 | 244 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9445 | 131 | 252 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9345 | 131 | 251 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9229 | 132 | 241 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2FGX3-F1-model_v4 | Argininosuccinate lyase | 0.9226 | 18 | 291 |
GO:0016829
|
| AF-A0A537CYK4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9165 | 27 | 288 |
|
| AF-A0A537VTQ8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9037 | 43 | 290 |
|
| AF-A0A0A1VID7-F1-model_v4 | Extra-cytoplasmic solute receptor | 0.9001 | 19 | 287 |
|
| AF-A0A359LVB0-F1-model_v4 | Prohead serine protease domain-containing protein | 0.8998 | 45 | 291 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar