F487569

General Info

Members Datasets Scaffolds Average Seq Length
988 557 837 322

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0178657|Ga0395900_0178657_100_1206
Length 368
Sequence MPKEYRPRTSQGRRVPILFGHDKRDRAAADFASRGPQQTRTQGRIVVKAFKYFAAALVVLLTPALAAAQKFPERNIRLIVPFPAGGPNDIIARVVSQKMSEILKQTIIVDNRGGQGGVIGTDLVAKAKPDGYTIAVTSAGALAISPSMEKVAYDTLKDLQPVTLVAKVPEMLVVAENVPAKNMKELVALAKKEPGKLNFASSGPGSLPHLAGELFKLTAHIDAVHVPYRGAAPAVNDLLGGQVQMVFLDLPVLLPHVKAGKLRPIAVGAEKRVATLPDVPTTAEVGYPTLLTENWYGMVAPAGTPKDIVATLNKAAVEAMKDPAVVSKLSSLGAILVGNSPDEFRTFIASEKAKWAKVIKDAGVPTQK

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
16 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2791355199
20 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
21 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
22 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
23 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
24 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
25 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
26 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
27 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
28 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
29 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
30 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
31 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
32 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
33 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
34 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
35 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
36 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
37 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
38 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
39 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
40 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
41 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
44 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
47 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
48 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
49 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
50 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
51 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
52 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
53 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
54 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
55 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
56 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
57 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
58 2922368715
59 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
60 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
61 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
62 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
63 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
64 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
65 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
66 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
67 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
68 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
69 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
70 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
71 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
72 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
73 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
74 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
75 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
76 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
77 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
78 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
79 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
80 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
81 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
82 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
83 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
84 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
85 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
86 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
87 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
88 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
89 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
90 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
91 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
92 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
93 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
94 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
95 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
96 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
97 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
98 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
99 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
100 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
101 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
102 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
103 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
104 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
105 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
106 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
107 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
108 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
109 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
110 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
111 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
112 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
113 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
114 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
115 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
116 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
117 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
118 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
119 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
120 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
121 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
122 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
124 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
128 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
129 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
130 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
131 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
132 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
133 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
134 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
135 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
136 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
137 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
138 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
139 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
140 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
141 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
142 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
143 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
144 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
145 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
146 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
147 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
148 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
149 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
150 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
151 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
152 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
155 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
156 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
163 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
164 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
165 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
166 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
167 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
168 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
169 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
170 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
172 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
173 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
174 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
175 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
176 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
177 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
178 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
179 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
180 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
181 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
182 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
183 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
184 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
185 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
187 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
188 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
189 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
190 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
191 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
192 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
193 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
194 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
195 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
196 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
197 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
198 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
199 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
200 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
201 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
202 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
204 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
207 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
208 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
209 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
210 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
211 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
212 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
217 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
218 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
226 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
229 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
280 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
281 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
282 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
283 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
285 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
289 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
290 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
291 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
292 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
293 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
294 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
295 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
299 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
300 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
303 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
304 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
305 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
306 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
307 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
308 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
311 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
312 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
313 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
314 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
315 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
316 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
317 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
318 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
319 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
320 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
334 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
335 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
336 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
337 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
338 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
339 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
342 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
352 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
353 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
354 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
360 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
361 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
362 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
363 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
374 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
375 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
378 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
379 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
380 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
381 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
386 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
387 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
388 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
389 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
395 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
396 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
397 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
398 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
399 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
400 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
401 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
402 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
403 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
406 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
407 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
408 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
414 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
419 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
420 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
430 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
433 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
459 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
460 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
461 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
462 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
463 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
464 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
465 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
466 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
467 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
468 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
469 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
470 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
471 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
474 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
475 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
476 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
477 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
478 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
479 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
480 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
481 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
482 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
483 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
484 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
485 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
486 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
487 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
488 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
489 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
490 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
491 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
492 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
493 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
494 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
495 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
496 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
497 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
498 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
499 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
500 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
501 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
502 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
503 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
504 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
505 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
506 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
507 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
508 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
513 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
514 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
515 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
516 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
517 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
518 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
521 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
522 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
523 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
524 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
525 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
526 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
527 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
528 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
529 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
530 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
531 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
532 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
533 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
534 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
535 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
536 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
537 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
538 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
539 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
540 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
541 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
542 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
543 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
544 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
545 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
546 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
547 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
548 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
549 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
550 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
551 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
552 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
553 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
556 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
557 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.89
Metatranscriptomes 0
Isolates 15.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 13.06
Rhizoplane 4.66
Rhizosphere 65.28
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000359 3300003203 Bacteria 20746
2 JGI25406J46586_10006073 3300003203 Bacteria 5580
3 JGI25153J46596_10004803 3300003215 Bacteria 7199
4 JGI25153J46596_10005279 3300003215 Bacteria 6793
5 JGI25153J46596_10005848 3300003215 Bacteria 6374
6 JGI25153J46596_10007756 3300003215 Bacteria 5222
7 rootH2_10062151 3300003320 Bacteria 1641
8 JGI25160J50197_1008171 3300003354 Bacteria 4013
9 JGI25160J50197_1031104 3300003354 Bacteria 1380
10 JGI25404J52841_10030037 3300003659 Bacteria 1165
11 Ga0055543_1011624 3300004625 Bacteria 1795
12 Ga0065165_1000919 3300005262 Bacteria 37849
13 Ga0065165_1002792 3300005262 Bacteria 13765
14 Ga0065165_1005273 3300005262 Bacteria 7373
15 Ga0070658_10045234 3300005327 Bacteria 3559
16 Ga0070658_10093766 3300005327 Bacteria 2476
17 Ga0070658_10293588 3300005327 Bacteria 1385
18 Ga0070676_10044708 3300005328 Bacteria 2578
19 Ga0070676_10136276 3300005328 Bacteria 1558
20 Ga0070683_100149805 3300005329 Bacteria 2212
21 Ga0070690_100059558 3300005330 Bacteria 2455
22 Ga0070690_100078710 3300005330 Bacteria 2154
23 Ga0070680_100077218 3300005336 Bacteria 2743
24 Ga0070680_100131705 3300005336 Bacteria 2093
25 Ga0070682_100190506 3300005337 Bacteria 1440
26 Ga0068868_100030792 3300005338 Bacteria 4115
27 Ga0070660_100151829 3300005339 Bacteria 1863
28 Ga0070660_100220170 3300005339 Bacteria 1542
29 Ga0070689_100219789 3300005340 Bacteria 1558
30 Ga0070687_100055331 3300005343 Bacteria 2072
31 Ga0070661_100271496 3300005344 Bacteria 1313
32 Ga0070668_100076521 3300005347 Bacteria 2614
33 Ga0070668_100133095 3300005347 Bacteria 1997
34 Ga0070668_100217989 3300005347 Bacteria 1572
35 Ga0070675_100118178 3300005354 Bacteria 2251
36 Ga0070671_100055275 3300005355 Bacteria 3302
37 Ga0070674_100386901 3300005356 Bacteria 1139
38 Ga0070673_100069800 3300005364 Bacteria 2817
39 Ga0070709_10007358 3300005434 Bacteria 6032
40 Ga0070709_10024332 3300005434 Bacteria 3563
41 Ga0070709_10078062 3300005434 Bacteria 2154
42 Ga0070709_10141936 3300005434 Bacteria 1651
43 Ga0070714_100024637 3300005435 Bacteria 4957
44 Ga0070713_100007733 3300005436 Bacteria 7568
45 Ga0070713_100039241 3300005436 Bacteria 3842
46 Ga0070710_10002417 3300005437 Bacteria 8854
47 Ga0070710_10038634 3300005437 Bacteria 2623
48 Ga0070711_100006676 3300005439 Bacteria 6977
49 Ga0070663_100069526 3300005455 Bacteria 2558
50 Ga0070663_100300982 3300005455 Bacteria 1284
51 Ga0070662_100351488 3300005457 Bacteria 1208
52 Ga0070681_10050857 3300005458 Bacteria 4134
53 Ga0070681_10074250 3300005458 Bacteria 3362
54 Ga0070681_10223614 3300005458 Bacteria 1797
55 Ga0068853_100042910 3300005539 Bacteria 3869
56 Ga0068853_100449012 3300005539 Bacteria 1212
57 Ga0070686_100008070 3300005544 Bacteria 5881
58 Ga0070696_100048131 3300005546 Bacteria 2959
59 Ga0070696_100107754 3300005546 Bacteria 2004
60 Ga0070665_100015092 3300005548 Bacteria 7756
61 Ga0070665_100099359 3300005548 Bacteria 2914
62 Ga0070665_100405452 3300005548 Bacteria 1371
63 Ga0068855_100001526 3300005563 Bacteria 29026
64 Ga0068855_100037526 3300005563 Bacteria 5761
65 Ga0068855_100076692 3300005563 Bacteria 3878
66 Ga0068857_100266693 3300005577 Bacteria 1573
67 Ga0068856_100365997 3300005614 Bacteria 1460
68 Ga0068856_100392745 3300005614 Bacteria 1407
69 Ga0068852_100141999 3300005616 Bacteria 2223
70 Ga0068852_100216491 3300005616 Bacteria 1820
71 Ga0068859_100092180 3300005617 Bacteria 3081
72 Ga0068866_10080273 3300005718 Bacteria 1750
73 Ga0068851_10141729 3300005834 Bacteria 1308
74 Ga0068863_100036014 3300005841 Bacteria 4713
75 Ga0068863_100116459 3300005841 Bacteria 2546
76 Ga0068863_100151155 3300005841 Bacteria 2221
77 Ga0068863_100445265 3300005841 Bacteria 1271
78 Ga0068863_100455047 3300005841 Bacteria 1256
79 Ga0068858_100029243 3300005842 Bacteria 5116
80 Ga0068858_100091077 3300005842 Bacteria 2838
81 Ga0068860_100000441 3300005843 Bacteria 52446
82 Ga0068862_100662443 3300005844 Bacteria 1008
83 Ga0081455_10001479 3300005937 Bacteria 29079
84 Ga0081455_10003833 3300005937 Bacteria 17148
85 Ga0081455_10053122 3300005937 Bacteria 3464
86 Ga0081455_10085161 3300005937 Bacteria 2578
87 Ga0081538_10025304 3300005981 Bacteria 4190
88 Ga0081538_10120242 3300005981 Bacteria 1264
89 Ga0081540_1004960 3300005983 Bacteria 10007
90 Ga0081540_1006444 3300005983 Bacteria 8542
91 Ga0081540_1021674 3300005983 Bacteria 3816
92 Ga0081540_1025036 3300005983 Bacteria 3447
93 Ga0081540_1026089 3300005983 Bacteria 3345
94 Ga0081540_1026760 3300005983 Bacteria 3284
95 Ga0081540_1026892 3300005983 Bacteria 3273
96 Ga0081539_10001114 3300005985 Bacteria 48756
97 Ga0081539_10001128 3300005985 Bacteria 48441
98 Ga0070717_10051443 3300006028 Bacteria 3390
99 Ga0070717_10057816 3300006028 Bacteria 3206
100 Ga0075365_10016412 3300006038 Bacteria 4505
101 Ga0075365_10078393 3300006038 Bacteria 2234
102 Ga0075365_10224578 3300006038 Bacteria 1318
103 Ga0075365_10240526 3300006038 Bacteria 1271
104 Ga0075368_10002709 3300006042 Bacteria 5837
105 Ga0075368_10032382 3300006042 Bacteria 2030
106 Ga0075363_100012045 3300006048 Bacteria 4157
107 Ga0075363_100016422 3300006048 Bacteria 3656
108 Ga0075364_10034512 3300006051 Bacteria 3264
109 Ga0075364_10062765 3300006051 Bacteria 2438
110 Ga0075364_10184785 3300006051 Bacteria 1411
111 Ga0075432_10017317 3300006058 Bacteria 2458
112 Ga0070715_10005346 3300006163 Bacteria 4276
113 Ga0070715_10022360 3300006163 Bacteria 2465
114 Ga0070716_100001217 3300006173 Bacteria 11316
115 Ga0070712_100102915 3300006175 Bacteria 2116
116 Ga0070712_100177090 3300006175 Bacteria 1659
117 Ga0070712_100449722 3300006175 Bacteria 1072
118 Ga0075362_10004628 3300006177 Bacteria 4960
119 Ga0075367_10024485 3300006178 Bacteria 3405
120 Ga0075367_10041204 3300006178 Bacteria 2699
121 Ga0075369_10080344 3300006186 Bacteria 1445
122 Ga0075369_10102720 3300006186 Bacteria 1283
123 Ga0075366_10019905 3300006195 Bacteria 3888
124 Ga0075366_10023974 3300006195 Bacteria 3557
125 Ga0075366_10073632 3300006195 Bacteria 2036
126 Ga0075366_10134994 3300006195 Bacteria 1490
127 Ga0097621_100010589 3300006237 Bacteria 6755
128 Ga0075370_10029799 3300006353 Bacteria 3041
129 Ga0075370_10032951 3300006353 Bacteria 2899
130 Ga0068871_100036409 3300006358 Bacteria 3918
131 Ga0075428_100000476 3300006844 Bacteria 40332
132 Ga0075428_100001723 3300006844 Bacteria 23380
133 Ga0075428_100274360 3300006844 Bacteria 1814
134 Ga0075430_100000201 3300006846 Bacteria 40551
135 Ga0075430_100000244 3300006846 Bacteria 37691
136 Ga0075430_100136323 3300006846 Bacteria 2045
137 Ga0075431_100000260 3300006847 Bacteria 40551
138 Ga0075433_10000007 3300006852 Bacteria 75995
139 Ga0075433_10127889 3300006852 Bacteria 2256
140 Ga0075433_10196700 3300006852 Bacteria 1793
141 Ga0075434_100000091 3300006871 Bacteria 49489
142 Ga0075434_100034266 3300006871 Bacteria 5014
143 Ga0075434_100110129 3300006871 Bacteria 2765
144 Ga0075434_100210094 3300006871 Bacteria 1966
145 Ga0075434_100276410 3300006871 Bacteria 1699
146 Ga0075429_100001265 3300006880 Bacteria 20558
147 Ga0075429_100063046 3300006880 Bacteria 3229
148 Ga0068865_100115705 3300006881 Bacteria 1985
149 Ga0068865_100121134 3300006881 Bacteria 1945
150 Ga0097620_100092182 3300006931 Bacteria 3081
151 Ga0099825_1020668 3300006941 Bacteria 4628
152 Ga0099824_1018360 3300006942 Bacteria 5770
153 Ga0075435_100003301 3300007076 Bacteria 10940
154 Ga0075435_100011769 3300007076 Bacteria 6454
155 Ga0075435_100312517 3300007076 Bacteria 1345
156 Ga0099795_10017367 3300007788 Bacteria 2293
157 Ga0105251_10119249 3300009011 Bacteria 1199
158 Ga0105240_10014700 3300009093 Bacteria 10677
159 Ga0111539_10001412 3300009094 Bacteria 31985
160 Ga0111539_10071975 3300009094 Bacteria 4078
161 Ga0111539_10569547 3300009094 Bacteria 1319
162 Ga0105245_10145957 3300009098 Bacteria 2232
163 Ga0105245_10221927 3300009098 Bacteria 1824
164 Ga0105245_10249822 3300009098 Bacteria 1723
165 Ga0114129_10002772 3300009147 Bacteria 24406
166 Ga0114129_10007261 3300009147 Bacteria 15774
167 Ga0114129_10071187 3300009147 Bacteria 4849
168 Ga0105243_10125749 3300009148 Bacteria 2168
169 Ga0105242_10004266 3300009176 Bacteria 11145
170 Ga0105242_10353114 3300009176 Bacteria 1358
171 Ga0105248_10047962 3300009177 Bacteria 4790
172 Ga0105248_10145936 3300009177 Bacteria 2670
173 Ga0105237_10023192 3300009545 Bacteria 6362
174 Ga0105238_10064515 3300009551 Bacteria 3662
175 Ga0105249_10083546 3300009553 Bacteria 2973
176 Ga0105239_10141596 3300010375 Bacteria 2680
177 Ga0105239_10166820 3300010375 Bacteria 2463
178 Ga0105239_10219240 3300010375 Bacteria 2133
179 Ga0105239_10253395 3300010375 Bacteria 1977
180 Ga0105239_10275570 3300010375 Bacteria 1893
181 Ga0105246_10034641 3300011119 Bacteria 3367
182 Ga0105246_10076063 3300011119 Bacteria 2378
183 Ga0105246_10126198 3300011119 Bacteria 1904
184 Ga0157371_10163070 3300013102 Bacteria 1592
185 Ga0157370_10232451 3300013104 Bacteria 1706
186 Ga0163162_10278586 3300013306 Bacteria 1804
187 Ga0163162_10311618 3300013306 Bacteria 1706
188 Ga0157375_10053365 3300013308 Bacteria 3977
189 Ga0163163_10006941 3300014325 Bacteria 9948
190 Ga0163163_10313152 3300014325 Bacteria 1623
191 Ga0157380_10347142 3300014326 Bacteria 1387
192 Ga0157379_10012889 3300014968 Bacteria 7313
193 Ga0157376_10288393 3300014969 Bacteria 1549
194 Ga0213876_10097083 3300021384 Bacteria 1561
195 Ga0209563_101090 3300025230 Bacteria 7793
196 Ga0209677_102351 3300025253 Bacteria 7241
197 Ga0209148_1000316 3300025254 Bacteria 68104
198 Ga0209233_1004623 3300025261 Bacteria 4654
199 Ga0209673_1025297 3300025273 Bacteria 1976
200 Ga0209564_1037958 3300025295 Bacteria 1348
201 Ga0209758_1000106 3300025297 Bacteria 218450
202 Ga0209758_1001405 3300025297 Bacteria 28529
203 Ga0209758_1002396 3300025297 Bacteria 19259
204 Ga0209758_1005929 3300025297 Bacteria 9080
205 Ga0209758_1006430 3300025297 Bacteria 8450
206 Ga0209758_1011834 3300025297 Bacteria 4981
207 Ga0209758_1024111 3300025297 Bacteria 2722
208 Ga0209758_1045760 3300025297 Bacteria 1585
209 Ga0209256_1002946 3300025299 Bacteria 12776
210 Ga0207426_1000374 3300025302 Bacteria 78498
211 Ga0207426_1001007 3300025302 Bacteria 27365
212 Ga0207426_1003263 3300025302 Bacteria 9067
213 Ga0207426_1008613 3300025302 Bacteria 4097
214 Ga0207426_1055401 3300025302 Bacteria 1161
215 Ga0209257_1001741 3300025304 Bacteria 24170
216 Ga0207692_10015365 3300025898 Bacteria 3366
217 Ga0207710_10007424 3300025900 Bacteria 4643
218 Ga0207688_10048222 3300025901 Bacteria 2380
219 Ga0207688_10079889 3300025901 Bacteria 1866
220 Ga0207680_10063441 3300025903 Bacteria 2261
221 Ga0207647_10152140 3300025904 Bacteria 1352
222 Ga0207699_10001489 3300025906 Bacteria 11129
223 Ga0207645_10021194 3300025907 Bacteria 4241
224 Ga0207645_10133652 3300025907 Bacteria 1615
225 Ga0207707_10122357 3300025912 Bacteria 2275
226 Ga0207707_10204665 3300025912 Bacteria 1720
227 Ga0207695_10000478 3300025913 Bacteria 86076
228 Ga0207671_10003084 3300025914 Bacteria 17008
229 Ga0207693_10005512 3300025915 Bacteria 10533
230 Ga0207693_10008449 3300025915 Bacteria 8426
231 Ga0207693_10027452 3300025915 Bacteria 4501
232 Ga0207693_10107351 3300025915 Bacteria 2190
233 Ga0207663_10000425 3300025916 Bacteria 18308
234 Ga0207660_10190158 3300025917 Bacteria 1598
235 Ga0207657_10130332 3300025919 Bacteria 2061
236 Ga0207649_10051415 3300025920 Bacteria 2552
237 Ga0207652_10166552 3300025921 Bacteria 1976
238 Ga0207681_10276192 3300025923 Bacteria 1321
239 Ga0207694_10114799 3300025924 Bacteria 2145
240 Ga0207650_10263109 3300025925 Bacteria 1400
241 Ga0207687_10029064 3300025927 Bacteria 3717
242 Ga0207687_10118046 3300025927 Bacteria 1979
243 Ga0207700_10005022 3300025928 Bacteria 7870
244 Ga0207700_10200398 3300025928 Bacteria 1682
245 Ga0207700_10321855 3300025928 Bacteria 1340
246 Ga0207664_10070747 3300025929 Bacteria 2808
247 Ga0207664_10146369 3300025929 Bacteria 2003
248 Ga0207644_10041059 3300025931 Bacteria 3271
249 Ga0207644_10048873 3300025931 Bacteria 3026
250 Ga0207690_10061018 3300025932 Bacteria 2562
251 Ga0207706_10057132 3300025933 Bacteria 3439
252 Ga0207686_10026307 3300025934 Bacteria 3393
253 Ga0207709_10018115 3300025935 Bacteria 3940
254 Ga0207670_10156546 3300025936 Bacteria 1697
255 Ga0207704_10163037 3300025938 Bacteria 1589
256 Ga0207665_10003367 3300025939 Bacteria 10702
257 Ga0207665_10021180 3300025939 Bacteria 4273
258 Ga0207691_10154586 3300025940 Bacteria 2015
259 Ga0207711_10009422 3300025941 Bacteria 8151
260 Ga0207711_10087313 3300025941 Bacteria 2736
261 Ga0207689_10058438 3300025942 Bacteria 3172
262 Ga0207661_10091550 3300025944 Bacteria 2534
263 Ga0207661_10302400 3300025944 Bacteria 1434
264 Ga0207667_10017077 3300025949 Bacteria 8183
265 Ga0207668_10036615 3300025972 Bacteria 3276
266 Ga0207640_10148610 3300025981 Bacteria 1718
267 Ga0207658_10164790 3300025986 Bacteria 1820
268 Ga0207677_10111086 3300026023 Bacteria 2041
269 Ga0207703_10106496 3300026035 Bacteria 2385
270 Ga0207703_10363723 3300026035 Bacteria 1335
271 Ga0207639_10197023 3300026041 Bacteria 1725
272 Ga0207678_10017546 3300026067 Bacteria 6287
273 Ga0207678_10035287 3300026067 Bacteria 4354
274 Ga0207678_10082834 3300026067 Bacteria 2744
275 Ga0207678_10124265 3300026067 Bacteria 2202
276 Ga0207641_10029014 3300026088 Bacteria 4574
277 Ga0207641_10260941 3300026088 Bacteria 1622
278 Ga0207648_10228656 3300026089 Bacteria 1654
279 Ga0207674_10066740 3300026116 Bacteria 3623
280 Ga0207674_10247135 3300026116 Bacteria 1731
281 Ga0207674_10295465 3300026116 Bacteria 1569
282 Ga0207683_10012926 3300026121 Bacteria 7128
283 Ga0207683_10111222 3300026121 Bacteria 2453
284 Ga0207683_10341545 3300026121 Bacteria 1373
285 Ga0207683_10393857 3300026121 Bacteria 1274
286 Ga0207698_10011050 3300026142 Bacteria 5837
287 Ga0209389_1000016 3300027296 Bacteria 184844
288 Ga0209389_1000027 3300027296 Bacteria 146917
289 Ga0209589_1000031 3300027357 Bacteria 147054
290 Ga0209489_100057 3300027361 Bacteria 147398
291 Ga0209489_100063 3300027361 Bacteria 144408
292 Ga0209700_100012 3300027363 Bacteria 357892
293 Ga0209588_1003621 3300027671 Bacteria 4291
294 Ga0209813_10003650 3300027866 Bacteria 3617
295 Ga0207428_10000115 3300027907 Bacteria 109072
296 Ga0207428_10005963 3300027907 Bacteria 11282
297 Ga0207428_10105287 3300027907 Bacteria 2176
298 Ga0268266_10063727 3300028379 Bacteria 3182
299 Ga0268266_10072985 3300028379 Bacteria 2977
300 Ga0268266_10079592 3300028379 Bacteria 2853
301 Ga0268266_10243943 3300028379 Bacteria 1659
302 Ga0268264_10000042 3300028381 Bacteria 372069
303 Ga0268264_10196256 3300028381 Bacteria 1843
304 Ga0268264_10242994 3300028381 Bacteria 1668
305 Ga0268264_10363661 3300028381 Bacteria 1381
306 Ga0265334_10029740 3300028573 Bacteria 2189
307 Ga0307517_10092417 3300028786 Bacteria 2462
308 Ga0307517_10156434 3300028786 Bacteria 1545
309 Ga0265338_10100786 3300028800 Bacteria 2353
310 Ga0307511_10123445 3300030521 Bacteria 1590
311 Ga0265330_10006763 3300031235 Bacteria 5653
312 Ga0265330_10008114 3300031235 Bacteria 5070
313 Ga0265332_10002834 3300031238 Bacteria 8597
314 Ga0265332_10012634 3300031238 Bacteria 3744
315 Ga0265325_10000026 3300031241 Bacteria 109937
316 Ga0265325_10008677 3300031241 Bacteria 5982
317 Ga0265325_10008781 3300031241 Bacteria 5941
318 Ga0265325_10013389 3300031241 Bacteria 4671
319 Ga0265325_10051223 3300031241 Bacteria 2123
320 Ga0265340_10001337 3300031247 Bacteria 14130
321 Ga0265340_10003564 3300031247 Bacteria 8764
322 Ga0265339_10003955 3300031249 Bacteria 10246
323 Ga0265339_10028820 3300031249 Bacteria 3154
324 Ga0265331_10006990 3300031250 Bacteria 6589
325 Ga0265331_10059477 3300031250 Bacteria 1807
326 Ga0265313_10013520 3300031595 Bacteria 4893
327 Ga0265313_10027363 3300031595 Bacteria 2985
328 Ga0265313_10027511 3300031595 Bacteria 2975
329 Ga0265313_10049471 3300031595 Bacteria 2022
330 Ga0265314_10002205 3300031711 Bacteria 20322
331 Ga0265314_10008159 3300031711 Bacteria 9012
332 Ga0265342_10000082 3300031712 Bacteria 102532
333 Ga0265342_10000291 3300031712 Bacteria 56828
334 Ga0265342_10005588 3300031712 Bacteria 9535
335 Ga0265342_10010349 3300031712 Bacteria 6481
336 Ga0265342_10014750 3300031712 Bacteria 5175
337 Ga0307516_10094154 3300031730 Bacteria 2820
338 Ga0307507_10021924 3300033179 Bacteria 7087
339 Ga0307510_10026321 3300033180 Bacteria 6688
340 Ga0307510_10230366 3300033180 Bacteria 1356
341 Ga0373959_0008517 3300034820 Bacteria 1748
342 Ga0373934_0047419 3300035086 Bacteria 1699
343 Ga0373949_0033249 3300035090 Bacteria 1238
344 Ga0373952_0016608 3300035092 Bacteria 1500
345 Ga0373923_0001865 3300035111 Bacteria 6270
346 Ga0373936_0006791 3300035113 Bacteria 4308
347 Ga0373936_0030592 3300035113 Bacteria 2123
348 Ga0373936_0049669 3300035113 Bacteria 1695
349 Ga0373941_0021210 3300035115 Bacteria 1830
350 Ga0373945_0000946 3300035116 Bacteria 8634
351 Ga0373945_0039019 3300035116 Bacteria 1710
352 Ga0373945_0124728 3300035116 Bacteria 1027
353 Ga0373953_0000156 3300035117 Bacteria 17676
354 Ga0373953_0062323 3300035117 Bacteria 1527
355 Ga0373954_0011119 3300035118 Bacteria 3982
356 Ga0373954_0013754 3300035118 Bacteria 3606
357 Ga0373954_0053883 3300035118 Bacteria 1891
358 Ga0373956_0004148 3300035119 Bacteria 5813
359 Ga0373956_0011980 3300035119 Bacteria 3584
360 Ga0373956_0118121 3300035119 Bacteria 1237
361 Ga0373957_0001409 3300035120 Bacteria 6498
362 Ga0373957_0006204 3300035120 Bacteria 3757
363 Ga0373957_0022408 3300035120 Bacteria 2251
364 Ga0373943_0001934 3300035170 Bacteria 9384
365 Ga0373943_0019251 3300035170 Bacteria 3139
366 Ga0373943_0086878 3300035170 Bacteria 1613
367 Ga0373946_0007183 3300035171 Bacteria 4068
368 Ga0373946_0024460 3300035171 Bacteria 2366
369 Ga0373955_0000395 3300035172 Bacteria 18509
370 Ga0373955_0002215 3300035172 Bacteria 8432
371 Ga0373955_0009768 3300035172 Bacteria 4508
372 Ga0373955_0050440 3300035172 Bacteria 2263
373 Ga0373924_0007061 3300035410 Bacteria 4043
374 Ga0373924_0011377 3300035410 Bacteria 3304
375 Ga0373924_0043936 3300035410 Bacteria 1836
376 Ga0373931_0013339 3300035691 Bacteria 3999
377 Ga0373931_0029855 3300035691 Bacteria 2803
378 Ga0373931_0094834 3300035691 Bacteria 1669
379 Ga0373935_0001093 3300035692 Bacteria 14823
380 Ga0373935_0029981 3300035692 Bacteria 3368
381 Ga0373935_0033201 3300035692 Bacteria 3211
382 Ga0373935_0034411 3300035692 Bacteria 3157
383 Ga0373927_0004563 3300035695 Bacteria 9675
384 Ga0373927_0021903 3300035695 Bacteria 4188
385 Ga0373927_0052489 3300035695 Bacteria 2637
386 Ga0373927_0175979 3300035695 Bacteria 1403
387 Ga0373933_0004898 3300035724 Bacteria 7306
388 Ga0373933_0007313 3300035724 Bacteria 6024
389 Ga0373933_0032029 3300035724 Bacteria 3054
390 Ga0373933_0102588 3300035724 Bacteria 1776
391 Ga0373947_0000288 3300035725 Bacteria 28482
392 Ga0373947_0024233 3300035725 Bacteria 3535
393 Ga0373947_0031415 3300035725 Bacteria 3125
394 Ga0373947_0056162 3300035725 Bacteria 2379
395 Ga0373947_0163548 3300035725 Bacteria 1440
396 Ga0373937_0000996 3300036401 Bacteria 24045
397 Ga0373937_0012002 3300036401 Bacteria 7606
398 Ga0373937_0147147 3300036401 Bacteria 2206
399 Ga0373937_0300677 3300036401 Bacteria 1517
400 Ga0373937_0566416 3300036401 Bacteria 1079
401 Ga0373925_0002967 3300037068 Bacteria 13392
402 Ga0373925_0018541 3300037068 Bacteria 5059
403 Ga0373925_0018593 3300037068 Bacteria 5052
404 Ga0373925_0021989 3300037068 Bacteria 4648
405 Ga0373925_0027832 3300037068 Bacteria 4138
406 Ga0373925_0277657 3300037068 Bacteria 1349
407 Ga0395899_0009357 3300037312 Bacteria 7526
408 Ga0395900_0119313 3300037418 Bacteria 2707
409 Ga0395900_0178657 3300037418 Bacteria 2158
410 Ga0395898_0014236 3300037466 Bacteria 8176
411 Ga0395898_0073654 3300037466 Bacteria 3299
412 Ga0395905_0028290 3300037471 Bacteria 5283
413 Ga0395901_0078788 3300038443 Bacteria 3440
414 Ga0395901_0127711 3300038443 Bacteria 2672
415 Ga0395901_0366626 3300038443 Bacteria 1484
416 Ga0436365_1106099 3300039437 Bacteria 4187
417 Ga0436365_1584283 3300039437 Bacteria 16431
418 Ga0436360_0575108 3300039438 Bacteria 1546
419 Ga0436362_1127865 3300039453 Bacteria 2188
420 Ga0451793_1689633 3300041452 Bacteria 4087
421 Ga0439444_0004615 3300042437 Bacteria 2011
422 Ga0466972_0000177 3300044658 Bacteria 49318
423 Ga0466966_0000474 3300044684 Bacteria 25834
424 Ga0466966_0259602 3300044684 Bacteria 1046
425 Ga0466961_0000023 3300044693 Bacteria 97134
426 Ga0466963_0113294 3300044694 Bacteria 1863
427 Ga0466964_0036413 3300044706 Bacteria 1973
428 Ga0466959_0000726 3300045049 Bacteria 19220
429 Ga0466958_0050655 3300045836 Bacteria 2514
430 Ga0466967_0351957 3300045976 Bacteria 1426
431 Ga0495592_0016624 3300046454 Bacteria 5584
432 Ga0495592_0025569 3300046454 Bacteria 4481
433 Ga0495592_0041102 3300046454 Bacteria 3466
434 Ga0495592_0067804 3300046454 Bacteria 2606
435 Ga0495592_0181855 3300046454 Bacteria 1431
436 Ga0495603_0008338 3300046455 Bacteria 6265
437 Ga0495603_0026574 3300046455 Bacteria 3496
438 Ga0495603_0027248 3300046455 Bacteria 3449
439 Ga0495603_0067670 3300046455 Bacteria 2102
440 Ga0495603_0074304 3300046455 Bacteria 1996
441 Ga0495591_030268 3300046458 Bacteria 1636
442 Ga0495591_051529 3300046458 Bacteria 1123
443 Ga0495629_0000183 3300046459 Bacteria 56534
444 Ga0495629_0000655 3300046459 Bacteria 27984
445 Ga0495629_0064830 3300046459 Bacteria 2550
446 Ga0495629_0337319 3300046459 Bacteria 1029
447 Ga0495638_0009065 3300046460 Bacteria 7011
448 Ga0495638_0051383 3300046460 Bacteria 2570
449 Ga0495641_0054290 3300046461 Bacteria 1821
450 Ga0495651_0005368 3300046462 Bacteria 9782
451 Ga0495651_0007056 3300046462 Bacteria 8588
452 Ga0495651_0008033 3300046462 Bacteria 8090
453 Ga0495651_0010752 3300046462 Bacteria 7037
454 Ga0495651_0077352 3300046462 Bacteria 2519
455 Ga0495653_0004854 3300046463 Bacteria 10903
456 Ga0495653_0025885 3300046463 Bacteria 4708
457 Ga0495653_0035742 3300046463 Bacteria 3918
458 Ga0495653_0142291 3300046463 Bacteria 1685
459 Ga0495580_0106313 3300046472 Bacteria 1949
460 Ga0495582_0001121 3300046473 Bacteria 15057
461 Ga0495582_0097360 3300046473 Bacteria 1645
462 Ga0495605_0041457 3300046474 Bacteria 2293
463 Ga0495605_0069308 3300046474 Bacteria 1670
464 Ga0495639_0009485 3300046475 Bacteria 4174
465 Ga0495662_0072451 3300046476 Bacteria 1670
466 Ga0495664_0018150 3300046477 Bacteria 4025
467 Ga0495664_0032191 3300046477 Bacteria 3076
468 Ga0495664_0102880 3300046477 Bacteria 1721
469 Ga0495584_0067035 3300046491 Bacteria 1805
470 Ga0495585_0003428 3300046492 Bacteria 10719
471 Ga0495594_0017097 3300046499 Bacteria 3828
472 Ga0495594_0155501 3300046499 Bacteria 1298
473 Ga0495596_0000078 3300046500 Bacteria 67709
474 Ga0495596_0103616 3300046500 Bacteria 1105
475 Ga0495607_0009340 3300046501 Bacteria 6643
476 Ga0495606_0010252 3300046507 Bacteria 7806
477 Ga0495608_0002221 3300046511 Bacteria 14008
478 Ga0495608_0009154 3300046511 Bacteria 6922
479 Ga0495608_0015766 3300046511 Bacteria 5230
480 Ga0495610_0057636 3300046512 Bacteria 1862
481 Ga0495616_0093166 3300046513 Bacteria 1423
482 Ga0495618_0013409 3300046514 Bacteria 4987
483 Ga0495618_0049560 3300046514 Bacteria 2652
484 Ga0495620_0014591 3300046515 Bacteria 3990
485 Ga0495620_0052579 3300046515 Bacteria 1729
486 Ga0495628_0000950 3300046516 Bacteria 26607
487 Ga0495628_0008803 3300046516 Bacteria 8638
488 Ga0495628_0049682 3300046516 Bacteria 3320
489 Ga0495628_0207020 3300046516 Bacteria 1476
490 Ga0495630_0069053 3300046517 Bacteria 2658
491 Ga0495630_0127087 3300046517 Bacteria 1935
492 Ga0495631_0000031 3300046518 Bacteria 85555
493 Ga0495631_0060865 3300046518 Bacteria 1638
494 Ga0495631_0081087 3300046518 Bacteria 1400
495 Ga0495637_0000365 3300046520 Bacteria 34448
496 Ga0495643_0104565 3300046522 Bacteria 1447
497 Ga0495644_0000234 3300046523 Bacteria 26118
498 Ga0495648_0017345 3300046524 Bacteria 5150
499 Ga0495648_0023302 3300046524 Bacteria 4244
500 Ga0495648_0163601 3300046524 Bacteria 1147
501 Ga0495666_0046661 3300046526 Bacteria 2088
502 Ga0495642_0017866 3300046528 Bacteria 2772
503 Ga0495652_0002257 3300046529 Bacteria 20113
504 Ga0495652_0026522 3300046529 Bacteria 5118
505 Ga0495652_0030285 3300046529 Bacteria 4747
506 Ga0495652_0038700 3300046529 Bacteria 4129
507 Ga0495652_0056866 3300046529 Bacteria 3320
508 Ga0495652_0106339 3300046529 Bacteria 2266
509 Ga0495652_0136539 3300046529 Bacteria 1934
510 Ga0495652_0278038 3300046529 Bacteria 1227
511 Ga0495665_0028743 3300046531 Bacteria 2979
512 Ga0495640_0009446 3300046533 Bacteria 7597
513 Ga0495640_0011385 3300046533 Bacteria 6843
514 Ga0495640_0012912 3300046533 Bacteria 6368
515 Ga0495640_0018366 3300046533 Bacteria 5190
516 Ga0495640_0042700 3300046533 Bacteria 3161
517 Ga0495640_0068492 3300046533 Bacteria 2388
518 Ga0495587_0002956 3300046536 Bacteria 11364
519 Ga0495587_0007940 3300046536 Bacteria 6854
520 Ga0495587_0018590 3300046536 Bacteria 4309
521 Ga0495587_0029301 3300046536 Bacteria 3342
522 Ga0495587_0029645 3300046536 Bacteria 3321
523 Ga0495621_0000357 3300046539 Bacteria 11123
524 Ga0495645_0001487 3300046543 Bacteria 15879
525 Ga0495645_0002475 3300046543 Bacteria 12548
526 Ga0495645_0002973 3300046543 Bacteria 11471
527 Ga0495645_0014710 3300046543 Bacteria 5557
528 Ga0495645_0042082 3300046543 Bacteria 3330
529 Ga0495622_0008747 3300046557 Bacteria 4691
530 Ga0495622_0015742 3300046557 Bacteria 3517
531 Ga0495622_0064788 3300046557 Bacteria 1690
532 Ga0495633_0002692 3300046558 Bacteria 12335
533 Ga0495667_0008800 3300046559 Bacteria 6864
534 Ga0495667_0034771 3300046559 Bacteria 3369
535 Ga0495667_0230581 3300046559 Bacteria 1180
536 Ga0495667_0250542 3300046559 Bacteria 1127
537 Ga0495656_0000174 3300046615 Bacteria 22784
538 Ga0495668_0012879 3300046616 Bacteria 4952
539 Ga0495668_0156697 3300046616 Bacteria 1247
540 Ga0495668_0212793 3300046616 Bacteria 1058
541 Ga0495634_0011443 3300046642 Bacteria 6457
542 Ga0495634_0025684 3300046642 Bacteria 4115
543 Ga0495634_0028246 3300046642 Bacteria 3895
544 Ga0495634_0030566 3300046642 Bacteria 3719
545 Ga0495634_0038590 3300046642 Bacteria 3255
546 Ga0495611_0054934 3300046648 Bacteria 1801
547 Ga0495625_0005608 3300046660 Bacteria 11377
548 Ga0495635_0000380 3300046663 Bacteria 28177
549 Ga0495635_0006494 3300046663 Bacteria 8155
550 Ga0495635_0036420 3300046663 Bacteria 3411
551 Ga0495635_0102821 3300046663 Bacteria 1952
552 Ga0495635_0257140 3300046663 Bacteria 1176
553 Ga0495659_0000220 3300046664 Bacteria 24427
554 Ga0495661_0147563 3300046665 Bacteria 1273
555 Ga0495588_0011399 3300046674 Bacteria 4170
556 Ga0495588_0017305 3300046674 Bacteria 3497
557 Ga0495588_0096356 3300046674 Bacteria 1552
558 Ga0495588_0134287 3300046674 Bacteria 1306
559 Ga0495657_0001852 3300046675 Bacteria 18026
560 Ga0495657_0004929 3300046675 Bacteria 10619
561 Ga0495657_0005248 3300046675 Bacteria 10255
562 Ga0495657_0021999 3300046675 Bacteria 4571
563 Ga0495657_0098633 3300046675 Bacteria 1864
564 Ga0495657_0187104 3300046675 Bacteria 1267
565 Ga0495599_0004515 3300046678 Bacteria 8252
566 Ga0495599_0027283 3300046678 Bacteria 3579
567 Ga0495599_0068007 3300046678 Bacteria 2224
568 Ga0495623_0001484 3300046679 Bacteria 15894
569 Ga0495623_0002235 3300046679 Bacteria 12884
570 Ga0495623_0004582 3300046679 Bacteria 9082
571 Ga0495646_0006953 3300046680 Bacteria 7181
572 Ga0495646_0055279 3300046680 Bacteria 2384
573 Ga0495647_0029945 3300046681 Bacteria 2016
574 Ga0495647_0055145 3300046681 Bacteria 1555
575 Ga0495658_0000357 3300046683 Bacteria 25736
576 Ga0495658_0040718 3300046683 Bacteria 2584
577 Ga0495669_0015903 3300046684 Bacteria 3221
578 Ga0495613_0009346 3300046689 Bacteria 7273
579 Ga0495613_0013096 3300046689 Bacteria 6163
580 Ga0495613_0030108 3300046689 Bacteria 4033
581 Ga0495613_0086422 3300046689 Bacteria 2274
582 Ga0495613_0153263 3300046689 Bacteria 1642
583 Ga0495624_0100338 3300046690 Bacteria 1782
584 Ga0495624_0151959 3300046690 Bacteria 1416
585 Ga0495670_0000414 3300046691 Bacteria 20494
586 Ga0495671_0061704 3300046692 Bacteria 1849
587 Ga0495649_0018372 3300046694 Bacteria 3934
588 Ga0495600_0007486 3300046809 Bacteria 6681
589 Ga0495600_0014864 3300046809 Bacteria 4911
590 Ga0495600_0067298 3300046809 Bacteria 2341
591 Ga0495600_0215515 3300046809 Bacteria 1229
592 Ga0495660_0050315 3300046810 Bacteria 2271
593 Ga0495581_0010000 3300047315 Bacteria 5486
594 Ga0495581_0103688 3300047315 Bacteria 1653
595 Ga0495604_0008886 3300047317 Bacteria 7941
596 Ga0495604_0017648 3300047317 Bacteria 5712
597 Ga0495604_0038454 3300047317 Bacteria 3764
598 Ga0495604_0050016 3300047317 Bacteria 3246
599 Ga0495604_0071653 3300047317 Bacteria 2620
600 Ga0495604_0138503 3300047317 Bacteria 1741
601 Ga0495636_0002324 3300047318 Bacteria 7303
602 Ga0495674_0024907 3300047319 Bacteria 5492
603 Ga0495674_0044316 3300047319 Bacteria 3955
604 Ga0495674_0055217 3300047319 Bacteria 3484
605 Ga0495674_0083157 3300047319 Bacteria 2744
606 Ga0495674_0168794 3300047319 Bacteria 1827
607 Ga0495676_0014158 3300047321 Bacteria 7141
608 Ga0495680_0001462 3300047322 Bacteria 25495
609 Ga0495680_0002016 3300047322 Bacteria 21294
610 Ga0495680_0012241 3300047322 Bacteria 7561
611 Ga0495680_0081922 3300047322 Bacteria 2435
612 Ga0495680_0281194 3300047322 Bacteria 1173
613 Ga0495675_0001856 3300047444 Bacteria 12578
614 Ga0495675_0014120 3300047444 Bacteria 5049
615 Ga0495675_0060074 3300047444 Bacteria 2409
616 Ga0495677_0081228 3300047445 Bacteria 1215
617 Ga0495685_018416 3300047447 Bacteria 2397
618 Ga0495673_0074730 3300047469 Bacteria 1417
619 Ga0495684_0000294 3300047471 Bacteria 40596
620 Ga0495684_0001528 3300047471 Bacteria 18538
621 Ga0495684_0048992 3300047471 Bacteria 3230
622 Ga0495684_0066991 3300047471 Bacteria 2730
623 Ga0495684_0103985 3300047471 Bacteria 2146
624 Ga0495686_0052087 3300047472 Bacteria 2567
625 Ga0495593_0000744 3300047673 Bacteria 18938
626 Ga0495593_0010818 3300047673 Bacteria 5260
627 Ga0495593_0036316 3300047673 Bacteria 2672
628 Ga0495602_0001368 3300048088 Bacteria 24064
629 Ga0495602_0004084 3300048088 Bacteria 15203
630 Ga0495614_0005613 3300048089 Bacteria 5658
631 Ga0495614_0093364 3300048089 Bacteria 1310
632 Ga0495614_0114140 3300048089 Bacteria 1187
633 Ga0496100_0002106 3300048903 Bacteria 10022
634 Ga0496100_0111181 3300048903 Bacteria 1903
635 Ga0496100_0152266 3300048903 Bacteria 1651
636 Ga0496101_0015113 3300048904 Bacteria 5195
637 Ga0496101_0028676 3300048904 Bacteria 3888
638 Ga0496102_0005062 3300048905 Bacteria 11158
639 Ga0496104_0001363 3300048907 Bacteria 21131
640 Ga0496104_0002005 3300048907 Bacteria 17670
641 Ga0496104_0023320 3300048907 Bacteria 5689
642 Ga0496104_0158815 3300048907 Bacteria 2169
643 Ga0496104_0210555 3300048907 Bacteria 1855
644 Ga0496104_0513471 3300048907 Bacteria 1109
645 Ga0496105_0033897 3300048908 Bacteria 4197
646 Ga0496105_0045632 3300048908 Bacteria 3616
647 Ga0496105_0124238 3300048908 Bacteria 2127
648 Ga0496105_0133756 3300048908 Bacteria 2043
649 Ga0496106_0014884 3300048909 Bacteria 5755
650 Ga0496107_0001189 3300048910 Bacteria 15840
651 Ga0496107_0054251 3300048910 Bacteria 2892
652 Ga0496107_0111890 3300048910 Bacteria 2007
653 Ga0496108_0010537 3300048911 Bacteria 7512
654 Ga0496108_0050304 3300048911 Bacteria 3488
655 Ga0496109_0000700 3300048912 Bacteria 27897
656 Ga0496109_0171908 3300048912 Bacteria 2033
657 Ga0496109_0208827 3300048912 Bacteria 1836
658 Ga0496110_0073990 3300048913 Bacteria 3024
659 Ga0496110_0150513 3300048913 Bacteria 2107
660 Ga0496110_0197818 3300048913 Bacteria 1826
661 Ga0496110_0217372 3300048913 Bacteria 1738
662 Ga0496111_0002128 3300048914 Bacteria 11829
663 Ga0496111_0030278 3300048914 Bacteria 3849
664 Ga0496111_0075974 3300048914 Bacteria 2448
665 Ga0496111_0199970 3300048914 Bacteria 1486
666 Ga0496112_0006626 3300048915 Bacteria 10196
667 Ga0496112_0043988 3300048915 Bacteria 4373
668 Ga0496112_0140196 3300048915 Bacteria 2387
669 Ga0496113_0001279 3300048916 Bacteria 13876
670 Ga0496113_0064157 3300048916 Bacteria 2776
671 Ga0496113_0153261 3300048916 Bacteria 1819
672 Ga0496113_0292007 3300048916 Bacteria 1304
673 Ga0496114_0155999 3300048917 Bacteria 1982
674 Ga0496114_0354705 3300048917 Bacteria 1297
675 Ga0496115_0024926 3300048918 Bacteria 4652
676 Ga0496115_0050932 3300048918 Bacteria 3320
677 Ga0496115_0109328 3300048918 Bacteria 2270
678 Ga0496116_0182671 3300048919 Bacteria 1120
679 Ga0496117_0081359 3300048920 Bacteria 2126
680 Ga0496118_0107467 3300048921 Bacteria 1863
681 Ga0496118_0183053 3300048921 Bacteria 1263
682 Ga0496119_0012670 3300048922 Bacteria 6823
683 Ga0496119_0058223 3300048922 Bacteria 2330
684 Ga0496121_0031768 3300048924 Bacteria 4816
685 Ga0496121_0050990 3300048924 Bacteria 3489
686 Ga0496121_0298115 3300048924 Bacteria 1095
687 Ga0496124_0061180 3300048927 Bacteria 3157
688 Ga0496126_0044707 3300048929 Bacteria 4076
689 Ga0496126_0053837 3300048929 Bacteria 3648
690 Ga0496126_0195743 3300048929 Bacteria 1709
691 Ga0501032_0095172 3300049569 Bacteria 1974
692 Ga0501033_0232716 3300049570 Bacteria 1308
693 Ga0501034_0064750 3300049571 Bacteria 3669
694 Ga0501034_0264153 3300049571 Bacteria 1663
695 Ga0501036_0005977 3300049572 Bacteria 9869
696 Ga0501037_0003231 3300049573 Bacteria 11812
697 Ga0501037_0031825 3300049573 Bacteria 3895
698 Ga0501038_0020838 3300049574 Bacteria 5891
699 Ga0501038_0058873 3300049574 Bacteria 3292
700 Ga0501038_0089706 3300049574 Bacteria 2578
701 Ga0501039_0001869 3300049575 Bacteria 15563
702 Ga0501043_0134930 3300049579 Bacteria 1934
703 Ga0501047_0008244 3300049581 Bacteria 9834
704 Ga0501047_0011033 3300049581 Bacteria 8549
705 Ga0501047_0045692 3300049581 Bacteria 4234
706 Ga0501047_0128370 3300049581 Bacteria 2415
707 Ga0501048_0034771 3300049582 Bacteria 3632
708 Ga0501067_0172555 3300049583 Bacteria 1204
709 Ga0501068_0014174 3300049584 Bacteria 4553
710 Ga0501069_0000929 3300049585 Bacteria 13961
711 Ga0501070_0038726 3300049586 Bacteria 3978
712 Ga0501071_0079370 3300049587 Bacteria 2399
713 Ga0501072_0177907 3300049588 Bacteria 1697
714 Ga0501072_0186968 3300049588 Bacteria 1652
715 Ga0501073_0017185 3300049589 Bacteria 5239
716 Ga0501074_0022225 3300049590 Bacteria 4609
717 Ga0501074_0089456 3300049590 Bacteria 2205
718 Ga0501076_0362473 3300049592 Bacteria 1191
719 Ga0501079_0064503 3300049741 Bacteria 2825
720 Ga0501079_0099173 3300049741 Bacteria 2258
721 Ga0501079_0210187 3300049741 Bacteria 1520
722 Ga0501080_0031235 3300049742 Bacteria 4963
723 Ga0501081_0168148 3300049743 Bacteria 1582
724 Ga0501083_0010731 3300049744 Bacteria 6442
725 Ga0501083_0047864 3300049744 Bacteria 2887
726 Ga0501035_0014209 3300049822 Bacteria 7348
727 Ga0501035_0060738 3300049822 Bacteria 3365
728 Ga0501035_0340851 3300049822 Bacteria 1256
729 Ga0501044_0000286 3300049823 Bacteria 64389
730 Ga0501044_0003023 3300049823 Bacteria 19032
731 Ga0501044_0034776 3300049823 Bacteria 5282
732 Ga0501044_0093844 3300049823 Bacteria 3025
733 Ga0501045_0114802 3300049824 Bacteria 1997
734 nmdc:mga03683_4316_c1 3300050489 Bacteria 4700
735 nmdc:mga03n38_13494_c2 3300050490 Bacteria 2796
736 nmdc:mga00v17_80108_c1 3300050491 Bacteria 2038
737 nmdc:mga0yw44_18826_c1 3300050492 Bacteria 3792
738 nmdc:mga0yw44_40147_c1 3300050492 Bacteria 2779
739 nmdc:mga0k408_6246_c1 3300050493 Bacteria 6358
740 nmdc:mga0k408_8333_c1 3300050493 Bacteria 5562
741 nmdc:mga0k408_94704_c1 3300050493 Bacteria 1756
742 nmdc:mga06z11_112871_c1 3300050494 Bacteria 1507
743 nmdc:mga06z11_43584_c1 3300050494 Bacteria 2259
744 nmdc:mga04h51_4263_c1 3300050495 Bacteria 3542
745 nmdc:mga04h51_6786_c1 3300050495 Bacteria 2990
746 nmdc:mga07m45_126220_c1 3300050496 Bacteria 1479
747 nmdc:mga07m45_177281_c1 3300050496 Bacteria 1239
748 nmdc:mga07m45_5888_c1 3300050496 Bacteria 6153
749 nmdc:mga07m45_81446_c1 3300050496 Bacteria 1848
750 nmdc:mga07m45_8967_c1 3300050496 Bacteria 5164
751 nmdc:mga05p37_2742_c1 3300050507 Bacteria 20456
752 nmdc:mga05p37_828_c1 3300050507 Bacteria 34679
753 nmdc:mga09592_103801_c1 3300050508 Bacteria 2436
754 nmdc:mga09592_21763_c1 3300050508 Bacteria 5287
755 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
756 nmdc:mga0qj67_64106_c1 3300050509 Bacteria 2922
757 nmdc:mga06r32_253385_c1 3300050510 Bacteria 1748
758 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
759 nmdc:mga08y16_228014_c1 3300050511 Bacteria 1927
760 nmdc:mga08y16_3986_c1 3300050511 Bacteria 15398
761 nmdc:mga08y16_4405_c1 3300050511 Bacteria 14718
762 nmdc:mga0n895_18031_c1 3300050512 Bacteria 6525
763 nmdc:mga0n895_385578_c1 3300050512 Bacteria 1418
764 nmdc:mga0n895_4431_c1 3300050512 Bacteria 11539
765 nmdc:mga0n895_94685_c1 3300050512 Bacteria 2991
766 nmdc:mga0rr50_4443_c1 3300050513 Bacteria 8252
767 nmdc:mga0a205_12519_c1 3300050515 Bacteria 7852
768 nmdc:mga0a205_75792_c2 3300050515 Bacteria 2296
769 nmdc:mga0sz30_17557_c1 3300050516 Bacteria 2855
770 nmdc:mga0sz30_20084_c1 3300050516 Bacteria 2692
771 Ga0495601_0000075 3300053077 Bacteria 54434
772 Ga0495601_0003475 3300053077 Bacteria 9043
773 Ga0495601_0007907 3300053077 Bacteria 6263
774 Ga0495601_0028022 3300053077 Bacteria 3486
775 Ga0495612_0002526 3300053078 Bacteria 7556
776 Ga0495612_0008861 3300053078 Bacteria 4076
777 Ga0495612_0011526 3300053078 Bacteria 3564
778 Ga0495612_0017374 3300053078 Bacteria 2881
779 Ga0495612_0077915 3300053078 Bacteria 1389
780 Ga0500610_0015285 3300053079 Bacteria 3631
781 Ga0500635_0004404 3300053080 Bacteria 3627
782 Ga0495595_0000253 3300053084 Bacteria 21240
783 Ga0495595_0000311 3300053084 Bacteria 18978
784 Ga0495595_0000670 3300053084 Bacteria 13076
785 Ga0495595_0002803 3300053084 Bacteria 6859
786 Ga0495595_0009800 3300053084 Bacteria 3971
787 Ga0495619_0000301 3300053085 Bacteria 34829
788 Ga0495619_0000315 3300053085 Bacteria 33904
789 Ga0495619_0000645 3300053085 Bacteria 22971
790 Ga0495619_0003855 3300053085 Bacteria 9655
791 Ga0495619_0036799 3300053085 Bacteria 3188
792 Ga0495619_0065853 3300053085 Bacteria 2418
793 Ga0495619_0191487 3300053085 Bacteria 1415
794 Ga0495619_0223462 3300053085 Bacteria 1304
795 Ga0500643_000052 3300053087 Bacteria 144656
796 Ga0500643_004518 3300053087 Bacteria 6255
797 Ga0500651_0004830 3300053093 Bacteria 7608
798 Ga0500566_0002512 3300053094 Bacteria 10894
799 Ga0500641_0007654 3300053096 Bacteria 3851
800 Ga0500648_136430 3300053097 Bacteria 1324
801 Ga0500650_0131108 3300053098 Bacteria 1165
802 Ga0500555_039695 3300053103 Bacteria 1313
803 Ga0500556_0008815 3300053104 Bacteria 2916
804 Ga0500557_000057 3300053105 Bacteria 47849
805 Ga0500569_004458 3300053109 Bacteria 2944
806 Ga0500593_003210 3300053117 Bacteria 6136
807 Ga0500594_0000589 3300053118 Bacteria 7788
808 Ga0500595_000002 3300053119 Bacteria 1074388
809 Ga0500595_000558 3300053119 Bacteria 22207
810 Ga0500595_002578 3300053119 Bacteria 8853
811 Ga0500607_103185 3300053121 Bacteria 1412
812 Ga0500642_0000263 3300053130 Bacteria 19627
813 Ga0500642_0016379 3300053130 Bacteria 2814
814 Ga0500658_0099854 3300053134 Bacteria 1265
815 Ga0500559_0025253 3300053136 Bacteria 2528
816 Ga0500564_093204 3300053138 Bacteria 1339
817 Ga0500568_0010868 3300053139 Bacteria 4245
818 Ga0500568_0038089 3300053139 Bacteria 1948
819 Ga0500568_0095310 3300053139 Bacteria 1120
820 Ga0500590_059797 3300053148 Bacteria 1917
821 Ga0500590_150761 3300053148 Bacteria 1049
822 Ga0500604_0040168 3300053151 Bacteria 1409
823 Ga0500616_0000002 3300053153 Bacteria 1611257
824 Ga0500616_0013214 3300053153 Bacteria 4804
825 Ga0500622_0004797 3300053156 Bacteria 8308
826 Ga0500622_0103055 3300053156 Bacteria 1403
827 Ga0500627_0085024 3300053158 Bacteria 1412
828 Ga0500638_152727 3300053162 Bacteria 1025
829 Ga0500636_0001378 3300053177 Bacteria 13188
830 Ga0500636_0002410 3300053177 Bacteria 10348
831 Ga0500636_0020617 3300053177 Bacteria 3902
832 Ga0500636_0037056 3300053177 Bacteria 2885
833 Ga0500625_003219 3300053729 Bacteria 6391
834 Ga0500596_003341 3300053735 Bacteria 3065
835 Ga0500599_009231 3300053736 Bacteria 1289
836 Ga0501084_0035333 3300054114 Bacteria 4178
837 Ga0500661_022306 3300055283 Bacteria 1122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0177907 Ga0501072_0177907_861_1676 248
2 3300047318 Ga0495636_0002324 Ga0495636_0002324_1128_1994 265
3 3300047447 Ga0495685_018416 Ga0495685_018416_274_1140 265
4 3300050496 nmdc:mga07m45_5888_c1 nmdc:mga07m45_5888_c1_4739_5722 265
5 3300039437 Ga0436365_1106099 Ga0436365_1106099_2217_3134 266
6 3300042437 Ga0439444_0004615 Ga0439444_0004615_19_897 269
7 3300005338 Ga0068868_100030792 Ga0068868_1000307924 270
8 3300005347 Ga0070668_100133095 Ga0070668_1001330951 270
9 3300005539 Ga0068853_100042910 Ga0068853_1000429103 270
10 3300005548 Ga0070665_100015092 Ga0070665_1000150927 270
11 3300005841 Ga0068863_100455047 Ga0068863_1004550471 270
12 3300005842 Ga0068858_100091077 Ga0068858_1000910773 270
13 3300009098 Ga0105245_10145957 Ga0105245_101459572 270
14 3300011119 Ga0105246_10034641 Ga0105246_100346413 270
15 3300014326 Ga0157380_10347142 Ga0157380_103471421 270
16 3300025907 Ga0207645_10021194 Ga0207645_100211944 270
17 3300025942 Ga0207689_10058438 Ga0207689_100584383 270
18 3300025972 Ga0207668_10036615 Ga0207668_100366152 270
19 3300026023 Ga0207677_10111086 Ga0207677_101110862 270
20 3300026035 Ga0207703_10363723 Ga0207703_103637231 270
21 3300026116 Ga0207674_10066740 Ga0207674_100667403 270
22 3300006353 Ga0075370_10029799 Ga0075370_100297993 273
23 3300006195 Ga0075366_10073632 Ga0075366_100736322 274
24 3300006871 Ga0075434_100110129 Ga0075434_1001101292 274
25 3300026067 Ga0207678_10035287 Ga0207678_100352873 274
26 3300025297 Ga0209758_1001405 Ga0209758_10014056 275
27 iso_pu_bacteria 8016622563 8016630208 275
28 3300034820 Ga0373959_0008517 Ga0373959_0008517_405_1319 279
29 3300036401 Ga0373937_0147147 Ga0373937_0147147_171_1079 279
30 3300035692 Ga0373935_0029981 Ga0373935_0029981_2278_3240 280
31 3300046810 Ga0495660_0050315 Ga0495660_0050315_1294_2217 280
32 3300049741 Ga0501079_0210187 Ga0501079_0210187_401_1366 280
33 3300049743 Ga0501081_0168148 Ga0501081_0168148_358_1323 280
34 3300050493 nmdc:mga0k408_8333_c1 nmdc:mga0k408_8333_c1_1190_2191 280
35 3300053177 Ga0500636_0037056 Ga0500636_0037056_1663_2625 280
36 3300035120 Ga0373957_0022408 Ga0373957_0022408_14_928 281
37 3300046459 Ga0495629_0337319 Ga0495629_0337319_10_924 281
38 3300049574 Ga0501038_0089706 Ga0501038_0089706_1441_2361 281
39 3300049581 Ga0501047_0011033 Ga0501047_0011033_6636_7556 281
40 3300049586 Ga0501070_0038726 Ga0501070_0038726_470_1390 281
41 3300049742 Ga0501080_0031235 Ga0501080_0031235_49_969 281
42 3300049823 Ga0501044_0003023 Ga0501044_0003023_12634_13554 281
43 3300028381 Ga0268264_10242994 Ga0268264_102429943 282
44 3300033179 Ga0307507_10021924 Ga0307507_100219246 282
45 3300033180 Ga0307510_10230366 Ga0307510_102303661 282
46 3300035410 Ga0373924_0011377 Ga0373924_0011377_1086_2015 285
47 3300053139 Ga0500568_0095310 Ga0500568_0095310_88_1071 285
48 3300053153 Ga0500616_0013214 Ga0500616_0013214_1549_2499 285
49 iso_pu_bacteria 2888419890 2888426842 285
50 3300005356 Ga0070674_100386901 Ga0070674_1003869011 286
51 3300006186 Ga0075369_10102720 Ga0075369_101027202 286
52 3300009011 Ga0105251_10119249 Ga0105251_101192492 287
53 3300013306 Ga0163162_10278586 Ga0163162_102785862 287
54 3300035092 Ga0373952_0016608 Ga0373952_0016608_422_1399 287
55 3300036401 Ga0373937_0012002 Ga0373937_0012002_395_1330 287
56 3300046462 Ga0495651_0077352 Ga0495651_0077352_66_1001 287
57 3300046463 Ga0495653_0025885 Ga0495653_0025885_158_1093 287
58 3300046531 Ga0495665_0028743 Ga0495665_0028743_71_1012 287
59 3300046663 Ga0495635_0036420 Ga0495635_0036420_2127_3062 287
60 3300046675 Ga0495657_0098633 Ga0495657_0098633_187_1122 287
61 3300046683 Ga0495658_0040718 Ga0495658_0040718_567_1502 287
62 3300047322 Ga0495680_0012241 Ga0495680_0012241_675_1610 287
63 3300048904 Ga0496101_0015113 Ga0496101_0015113_1542_2483 287
64 3300048910 Ga0496107_0054251 Ga0496107_0054251_673_1614 287
65 3300048914 Ga0496111_0002128 Ga0496111_0002128_1000_1941 287
66 3300053077 Ga0495601_0007907 Ga0495601_0007907_4745_5680 287
67 3300053078 Ga0495612_0077915 Ga0495612_0077915_229_1164 287
68 3300053084 Ga0495595_0002803 Ga0495595_0002803_119_1054 287
69 3300053085 Ga0495619_0000315 Ga0495619_0000315_25352_26287 287
70 3300005330 Ga0070690_100078710 Ga0070690_1000787102 288
71 3300005339 Ga0070660_100151829 Ga0070660_1001518292 288
72 3300005340 Ga0070689_100219789 Ga0070689_1002197891 288
73 3300005841 Ga0068863_100151155 Ga0068863_1001511552 288
74 3300014325 Ga0163163_10006941 Ga0163163_100069419 288
75 3300025936 Ga0207670_10156546 Ga0207670_101565461 288
76 3300025941 Ga0207711_10087313 Ga0207711_100873133 288
77 3300026088 Ga0207641_10260941 Ga0207641_102609412 288
78 3300048911 Ga0496108_0010537 Ga0496108_0010537_4515_5498 288
79 3300048912 Ga0496109_0000700 Ga0496109_0000700_26696_27679 288
80 3300048913 Ga0496110_0150513 Ga0496110_0150513_574_1557 288
81 3300048914 Ga0496111_0030278 Ga0496111_0030278_2744_3727 288
82 3300048915 Ga0496112_0006626 Ga0496112_0006626_2360_3343 288
83 3300048916 Ga0496113_0001279 Ga0496113_0001279_12567_13550 288
84 3300048922 Ga0496119_0058223 Ga0496119_0058223_20_979 288
85 3300050496 nmdc:mga07m45_177281_c1 nmdc:mga07m45_177281_c1_102_1067 288
86 3300053162 Ga0500638_152727 Ga0500638_152727_47_1006 288
87 iso_pu_bacteria 2847930680 2847932081 288
88 iso_pu_bacteria 2904479285 2904483567 288
89 iso_pu_bacteria 2824600985 2824604431 289
90 iso_pu_bacteria 2824609381 2824615028 289
91 iso_pu_bacteria 2824653114 2824659188 289
92 3300005937 Ga0081455_10001479 Ga0081455_1000147928 290
93 3300006195 Ga0075366_10019905 Ga0075366_100199053 290
94 3300009094 Ga0111539_10001412 Ga0111539_1000141220 290
95 3300009147 Ga0114129_10002772 Ga0114129_1000277224 290
96 3300025981 Ga0207640_10148610 Ga0207640_101486102 290
97 3300046500 Ga0495596_0000078 Ga0495596_0000078_4867_5835 290
98 3300046515 Ga0495620_0014591 Ga0495620_0014591_1455_2417 290
99 3300046518 Ga0495631_0000031 Ga0495631_0000031_40775_41737 290
100 3300046520 Ga0495637_0000365 Ga0495637_0000365_15983_16945 290
101 3300046526 Ga0495666_0046661 Ga0495666_0046661_725_1669 290
102 3300046539 Ga0495621_0000357 Ga0495621_0000357_4143_5105 290
103 3300046660 Ga0495625_0005608 Ga0495625_0005608_6287_7249 290
104 3300047469 Ga0495673_0074730 Ga0495673_0074730_52_999 290
105 3300050507 nmdc:mga05p37_828_c1 nmdc:mga05p37_828_c1_10272_11222 290
106 3300050508 nmdc:mga09592_21763_c1 nmdc:mga09592_21763_c1_3282_4232 290
107 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_15295_16245 290
108 3300050510 nmdc:mga06r32_513_c1 nmdc:mga06r32_513_c1_15222_16172 290
109 3300050511 nmdc:mga08y16_4405_c1 nmdc:mga08y16_4405_c1_10272_11222 290
110 3300050512 nmdc:mga0n895_94685_c1 nmdc:mga0n895_94685_c1_1055_2005 290
111 3300050515 nmdc:mga0a205_12519_c1 nmdc:mga0a205_12519_c1_3278_4228 290
112 3300053079 Ga0500610_0015285 Ga0500610_0015285_38_1000 290
113 3300053118 Ga0500594_0000589 Ga0500594_0000589_4656_5618 290
114 3300055283 Ga0500661_022306 Ga0500661_022306_165_1112 290
115 3300009094 Ga0111539_10569547 Ga0111539_105695471 291
116 3300025901 Ga0207688_10048222 Ga0207688_100482222 291
117 3300028381 Ga0268264_10363661 Ga0268264_103636611 291
118 3300035724 Ga0373933_0102588 Ga0373933_0102588_14_967 291
119 3300050511 nmdc:mga08y16_228014_c1 nmdc:mga08y16_228014_c1_84_1061 291
120 iso_pu_bacteria 2508501009 2508545757 292
121 iso_pu_bacteria 2508501042 2508694582 292
122 iso_pu_bacteria 2511231028 2511398413 292
123 iso_pu_bacteria 2513237092 2513624505 292
124 iso_pu_bacteria 2513237094 2513638631 292
125 iso_pu_bacteria 2513237095 2513649981 292
126 iso_pu_bacteria 2513237104 2513716826 292
127 iso_pu_bacteria 2513237139 2513874273 292
128 iso_pu_bacteria 2515154112 2515624489 292
129 iso_pu_bacteria 2517093001 2517104581 292
130 iso_pu_bacteria 2617270735 2617354178 292
131 iso_pu_bacteria 2643221547 2643757459 292
132 iso_pu_bacteria 2744054633 2745077237 292
133 iso_pu_bacteria 2791355196 2793059409 292
134 iso_pu_bacteria 2802429603 2805916039 292
135 iso_pu_bacteria 2816332527 2818240981 292
136 iso_pu_bacteria 2824661429 2824665218 292
137 iso_pu_bacteria 2824696289 2824701854 292
138 iso_pu_bacteria 2824773399 2824778256 292
139 iso_pu_bacteria 2841957949 2841960688 292
140 iso_pu_bacteria 2842038055 2842041788 292
141 iso_pu_bacteria 2842045827 2842049830 292
142 iso_pu_bacteria 2844315083 2844321329 292
143 iso_pu_bacteria 2847939898 2847943318 292
144 iso_pu_bacteria 2849076700 2849077046 292
145 iso_pu_bacteria 2874590934 2874595720 292
146 iso_pu_bacteria 2874620515 2874624216 292
147 iso_pu_bacteria 2874628541 2874630313 292
148 iso_pu_bacteria 2874645413 2874651648 292
149 iso_pu_bacteria 2876761206 2876767655 292
150 iso_pu_bacteria 2876771140 2876775915 292
151 iso_pu_bacteria 2876818435 2876821543 292
152 iso_pu_bacteria 2879074833 2879080006 292
153 iso_pu_bacteria 2879099564 2879100589 292
154 iso_pu_bacteria 2879127579 2879134089 292
155 iso_pu_bacteria 2879142872 2879148574 292
156 iso_pu_bacteria 2881665667 2881669308 292
157 iso_pu_bacteria 2885409591 2885412175 292
158 iso_pu_bacteria 2888378607 2888387626 292
159 iso_pu_bacteria 2888388044 2888391536 292
160 iso_pu_bacteria 2903727486 2903731481 292
161 iso_pu_bacteria 2904666416 2904670927 292
162 iso_pu_bacteria 2906602504 2906607943 292
163 iso_pu_bacteria 2906643746 2906650121 292
164 iso_pu_bacteria 2922368715 2922376610 292
165 iso_pu_bacteria 2929615660 2929619886 292
166 iso_pu_bacteria 2929624759 2929629198 292
167 iso_pu_bacteria 2932794094 2932796661 292
168 iso_pu_bacteria 2932801729 2932802559 292
169 iso_pu_bacteria 2935608549 2935613262 292
170 iso_pu_bacteria 2935648319 2935656624 292
171 iso_pu_bacteria 2935656913 2935665452 292
172 iso_pu_bacteria 2935769743 2935775201 292
173 iso_pu_bacteria 2935777560 2935780103 292
174 iso_pu_bacteria 2935785616 2935790225 292
175 iso_pu_bacteria 2935793552 2935798733 292
176 iso_pu_bacteria 2935819856 2935824884 292
177 iso_pu_bacteria 2935847175 2935852104 292
178 iso_pu_bacteria 2935883170 2935887001 292
179 iso_pu_bacteria 2935908558 2935911451 292
180 iso_pu_bacteria 2935916978 2935920986 292
181 iso_pu_bacteria 2935926038 2935928480 292
182 iso_pu_bacteria 2935934488 2935938125 292
183 iso_pu_bacteria 2935942939 2935945407 292
184 iso_pu_bacteria 2935951376 2935954087 292
185 iso_pu_bacteria 2935959822 2935965466 292
186 iso_pu_bacteria 2935967501 2935971645 292
187 iso_pu_bacteria 2935975950 2935980049 292
188 iso_pu_bacteria 2935984226 2935989477 292
189 iso_pu_bacteria 2936011229 2936019487 292
190 iso_pu_bacteria 2936019824 2936028103 292
191 iso_pu_bacteria 2936028420 2936036937 292
192 iso_pu_bacteria 2936046547 2936054960 292
193 iso_pu_bacteria 2936055302 2936060733 292
194 iso_pu_bacteria 3005594810 3005601681 292
195 iso_pu_bacteria 8016522445 8016525096 292
196 iso_pu_bacteria 8016530956 8016538672 292
197 iso_pu_bacteria 8016539877 8016542959 292
198 iso_pu_bacteria 8016557553 8016558739 292
199 iso_pu_bacteria 8016575299 8016581015 292
200 iso_pu_bacteria 8016595262 8016596715 292
201 iso_pu_bacteria 8016630954 8016636942 292
202 iso_pu_bacteria 8019530166 8019538344 292
203 iso_pu_bacteria 8019538911 8019541478 292
204 iso_pu_bacteria 8019547302 8019549149 292
205 iso_pu_bacteria 8019619141 8019623901 292
206 iso_pu_bacteria 8019629233 8019638139 292
207 iso_pu_bacteria 8019638758 8019641497 292
208 iso_pu_bacteria 8019648815 8019651545 292
209 iso_pu_bacteria 8019659431 8019666053 292
210 iso_pu_bacteria 8019668869 8019675572 292
211 iso_pu_bacteria 8019678201 8019680527 292
212 iso_pu_bacteria 8019687851 8019695226 292
213 iso_pu_bacteria 8056967851 8056976133 292
214 3300025297 Ga0209758_1045760 Ga0209758_10457601 293
215 iso_pu_bacteria 2513237141 2513892373 293
216 iso_pu_bacteria 2524023205 2524438538 293
217 iso_pu_bacteria 2721755755 2723842586 293
218 iso_pu_bacteria 2791355199 2793078542 293
219 iso_pu_bacteria 2857509624 2857514669 293
220 iso_pu_bacteria 2874604998 2874606729 293
221 iso_pu_bacteria 3005718088 3005724363 293
222 iso_pu_bacteria 8006994254 8006999137 293
223 iso_pu_bacteria 8056673599 8056678856 293
224 3300006844 Ga0075428_100000476 Ga0075428_10000047638 294
225 3300006880 Ga0075429_100063046 Ga0075429_1000630461 294
226 3300010375 Ga0105239_10275570 Ga0105239_102755702 294
227 3300014968 Ga0157379_10012889 Ga0157379_100128894 294
228 3300025921 Ga0207652_10166552 Ga0207652_101665521 294
229 3300027907 Ga0207428_10005963 Ga0207428_100059635 294
230 3300035691 Ga0373931_0029855 Ga0373931_0029855_77_1045 294
231 3300044694 Ga0466963_0113294 Ga0466963_0113294_490_1449 294
232 3300045976 Ga0466967_0351957 Ga0466967_0351957_67_1026 294
233 3300046529 Ga0495652_0030285 Ga0495652_0030285_1686_2699 294
234 3300046663 Ga0495635_0257140 Ga0495635_0257140_28_1041 294
235 3300046689 Ga0495613_0086422 Ga0495613_0086422_287_1324 294
236 3300046809 Ga0495600_0215515 Ga0495600_0215515_106_1107 294
237 3300048903 Ga0496100_0152266 Ga0496100_0152266_369_1337 294
238 3300048907 Ga0496104_0002005 Ga0496104_0002005_3954_4955 294
239 3300048907 Ga0496104_0023320 Ga0496104_0023320_3088_4056 294
240 3300048908 Ga0496105_0045632 Ga0496105_0045632_2182_3150 294
241 3300048909 Ga0496106_0014884 Ga0496106_0014884_1630_2598 294
242 3300048911 Ga0496108_0050304 Ga0496108_0050304_1140_2108 294
243 3300048912 Ga0496109_0208827 Ga0496109_0208827_78_1046 294
244 3300048913 Ga0496110_0073990 Ga0496110_0073990_1144_2112 294
245 3300048915 Ga0496112_0043988 Ga0496112_0043988_2280_3248 294
246 3300048916 Ga0496113_0153261 Ga0496113_0153261_30_998 294
247 3300048916 Ga0496113_0292007 Ga0496113_0292007_60_1061 294
248 3300048918 Ga0496115_0050932 Ga0496115_0050932_961_1929 294
249 3300049822 Ga0501035_0060738 Ga0501035_0060738_2337_3308 294
250 3300050508 nmdc:mga09592_103801_c1 nmdc:mga09592_103801_c1_1078_2046 294
251 3300050511 nmdc:mga08y16_3986_c1 nmdc:mga08y16_3986_c1_4094_5062 294
252 3300006028 Ga0070717_10057816 Ga0070717_100578163 295
253 3300006038 Ga0075365_10016412 Ga0075365_100164124 295
254 3300006042 Ga0075368_10002709 Ga0075368_100027095 295
255 3300006048 Ga0075363_100016422 Ga0075363_1000164224 295
256 3300006051 Ga0075364_10034512 Ga0075364_100345122 295
257 3300006177 Ga0075362_10004628 Ga0075362_100046286 295
258 3300006195 Ga0075366_10023974 Ga0075366_100239743 295
259 3300007788 Ga0099795_10017367 Ga0099795_100173672 295
260 3300035113 Ga0373936_0030592 Ga0373936_0030592_127_1095 295
261 3300035170 Ga0373943_0086878 Ga0373943_0086878_10_972 295
262 3300035725 Ga0373947_0163548 Ga0373947_0163548_97_1065 295
263 3300037068 Ga0373925_0018593 Ga0373925_0018593_2018_2986 295
264 3300046529 Ga0495652_0106339 Ga0495652_0106339_384_1373 295
265 3300046557 Ga0495622_0008747 Ga0495622_0008747_1731_2693 295
266 3300047322 Ga0495680_0281194 Ga0495680_0281194_40_1002 295
267 3300048907 Ga0496104_0158815 Ga0496104_0158815_705_1673 295
268 3300048908 Ga0496105_0033897 Ga0496105_0033897_2810_3778 295
269 3300048913 Ga0496110_0217372 Ga0496110_0217372_329_1297 295
270 3300048914 Ga0496111_0199970 Ga0496111_0199970_419_1387 295
271 3300048917 Ga0496114_0155999 Ga0496114_0155999_588_1556 295
272 3300048918 Ga0496115_0109328 Ga0496115_0109328_254_1222 295
273 3300048924 Ga0496121_0298115 Ga0496121_0298115_76_1038 295
274 3300048929 Ga0496126_0044707 Ga0496126_0044707_1267_2229 295
275 3300050489 nmdc:mga03683_4316_c1 nmdc:mga03683_4316_c1_2476_3459 295
276 3300050491 nmdc:mga00v17_80108_c1 nmdc:mga00v17_80108_c1_263_1246 295
277 3300050492 nmdc:mga0yw44_40147_c1 nmdc:mga0yw44_40147_c1_1754_2737 295
278 3300050493 nmdc:mga0k408_6246_c1 nmdc:mga0k408_6246_c1_61_1044 295
279 3300050494 nmdc:mga06z11_43584_c1 nmdc:mga06z11_43584_c1_236_1219 295
280 3300050495 nmdc:mga04h51_6786_c1 nmdc:mga04h51_6786_c1_1658_2641 295
281 3300050516 nmdc:mga0sz30_20084_c1 nmdc:mga0sz30_20084_c1_187_1170 295
282 3300053080 Ga0500635_0004404 Ga0500635_0004404_1882_2844 295
283 3300053087 Ga0500643_004518 Ga0500643_004518_5245_6228 295
284 3300053097 Ga0500648_136430 Ga0500648_136430_104_1066 295
285 3300053119 Ga0500595_000002 Ga0500595_000002_732200_733183 295
286 3300053136 Ga0500559_0025253 Ga0500559_0025253_12_974 295
287 3300053148 Ga0500590_059797 Ga0500590_059797_586_1548 295
288 3300053177 Ga0500636_0020617 Ga0500636_0020617_2603_3565 295
289 3300053735 Ga0500596_003341 Ga0500596_003341_769_1731 295
290 iso_pu_bacteria 2941531003 2941531902 295
291 3300003215 JGI25153J46596_10005279 JGI25153J46596_100052792 296
292 3300003215 JGI25153J46596_10005848 JGI25153J46596_100058486 296
293 3300003215 JGI25153J46596_10007756 JGI25153J46596_100077562 296
294 3300003320 rootH2_10062151 rootH2_100621511 296
295 3300003354 JGI25160J50197_1031104 JGI25160J50197_10311041 296
296 3300004625 Ga0055543_1011624 Ga0055543_10116241 296
297 3300005262 Ga0065165_1000919 Ga0065165_100091939 296
298 3300005262 Ga0065165_1002792 Ga0065165_10027923 296
299 3300005262 Ga0065165_1005273 Ga0065165_10052733 296
300 3300005327 Ga0070658_10045234 Ga0070658_100452342 296
301 3300005337 Ga0070682_100190506 Ga0070682_1001905062 296
302 3300005339 Ga0070660_100220170 Ga0070660_1002201701 296
303 3300005347 Ga0070668_100076521 Ga0070668_1000765212 296
304 3300005355 Ga0070671_100055275 Ga0070671_1000552753 296
305 3300005434 Ga0070709_10007358 Ga0070709_100073582 296
306 3300005435 Ga0070714_100024637 Ga0070714_1000246374 296
307 3300005436 Ga0070713_100007733 Ga0070713_1000077334 296
308 3300005439 Ga0070711_100006676 Ga0070711_1000066764 296
309 3300005455 Ga0070663_100300982 Ga0070663_1003009821 296
310 3300005457 Ga0070662_100351488 Ga0070662_1003514882 296
311 3300005539 Ga0068853_100449012 Ga0068853_1004490122 296
312 3300005548 Ga0070665_100099359 Ga0070665_1000993593 296
313 3300005548 Ga0070665_100405452 Ga0070665_1004054521 296
314 3300005616 Ga0068852_100141999 Ga0068852_1001419992 296
315 3300005841 Ga0068863_100445265 Ga0068863_1004452651 296
316 3300005844 Ga0068862_100662443 Ga0068862_1006624431 296
317 3300005981 Ga0081538_10025304 Ga0081538_100253044 296
318 3300006038 Ga0075365_10240526 Ga0075365_102405262 296
319 3300006042 Ga0075368_10032382 Ga0075368_100323822 296
320 3300006048 Ga0075363_100012045 Ga0075363_1000120454 296
321 3300006051 Ga0075364_10062765 Ga0075364_100627652 296
322 3300006163 Ga0070715_10022360 Ga0070715_100223602 296
323 3300006175 Ga0070712_100102915 Ga0070712_1001029152 296
324 3300006178 Ga0075367_10041204 Ga0075367_100412041 296
325 3300006195 Ga0075366_10134994 Ga0075366_101349942 296
326 3300006353 Ga0075370_10032951 Ga0075370_100329514 296
327 3300006941 Ga0099825_1020668 Ga0099825_10206684 296
328 3300006942 Ga0099824_1018360 Ga0099824_10183603 296
329 3300009147 Ga0114129_10071187 Ga0114129_100711872 296
330 3300009177 Ga0105248_10145936 Ga0105248_101459361 296
331 3300009545 Ga0105237_10023192 Ga0105237_100231923 296
332 3300010375 Ga0105239_10141596 Ga0105239_101415963 296
333 3300010375 Ga0105239_10166820 Ga0105239_101668203 296
334 3300010375 Ga0105239_10219240 Ga0105239_102192401 296
335 3300011119 Ga0105246_10076063 Ga0105246_100760631 296
336 3300013104 Ga0157370_10232451 Ga0157370_102324512 296
337 3300013306 Ga0163162_10311618 Ga0163162_103116181 296
338 3300013308 Ga0157375_10053365 Ga0157375_100533653 296
339 3300014325 Ga0163163_10313152 Ga0163163_103131521 296
340 3300014969 Ga0157376_10288393 Ga0157376_102883932 296
341 3300021384 Ga0213876_10097083 Ga0213876_100970831 296
342 3300025230 Ga0209563_101090 Ga0209563_1010902 296
343 3300025253 Ga0209677_102351 Ga0209677_1023512 296
344 3300025254 Ga0209148_1000316 Ga0209148_100031655 296
345 3300025261 Ga0209233_1004623 Ga0209233_10046236 296
346 3300025273 Ga0209673_1025297 Ga0209673_10252972 296
347 3300025295 Ga0209564_1037958 Ga0209564_10379581 296
348 3300025297 Ga0209758_1000106 Ga0209758_1000106122 296
349 3300025297 Ga0209758_1002396 Ga0209758_10023963 296
350 3300025297 Ga0209758_1024111 Ga0209758_10241112 296
351 3300025299 Ga0209256_1002946 Ga0209256_10029469 296
352 3300025302 Ga0207426_1001007 Ga0207426_100100711 296
353 3300025302 Ga0207426_1003263 Ga0207426_100326310 296
354 3300025302 Ga0207426_1008613 Ga0207426_10086134 296
355 3300025302 Ga0207426_1055401 Ga0207426_10554011 296
356 3300025304 Ga0209257_1001741 Ga0209257_100174113 296
357 3300025898 Ga0207692_10015365 Ga0207692_100153652 296
358 3300025901 Ga0207688_10079889 Ga0207688_100798892 296
359 3300025904 Ga0207647_10152140 Ga0207647_101521402 296
360 3300025913 Ga0207695_10000478 Ga0207695_1000047850 296
361 3300025914 Ga0207671_10003084 Ga0207671_100030849 296
362 3300025915 Ga0207693_10005512 Ga0207693_100055127 296
363 3300025916 Ga0207663_10000425 Ga0207663_1000042511 296
364 3300025923 Ga0207681_10276192 Ga0207681_102761921 296
365 3300025929 Ga0207664_10070747 Ga0207664_100707472 296
366 3300025931 Ga0207644_10041059 Ga0207644_100410591 296
367 3300025939 Ga0207665_10003367 Ga0207665_100033677 296
368 3300026116 Ga0207674_10247135 Ga0207674_102471352 296
369 3300027296 Ga0209389_1000016 Ga0209389_100001681 296
370 3300027296 Ga0209389_1000027 Ga0209389_100002763 296
371 3300027357 Ga0209589_1000031 Ga0209589_100003175 296
372 3300027361 Ga0209489_100057 Ga0209489_10005772 296
373 3300027361 Ga0209489_100063 Ga0209489_10006339 296
374 3300027363 Ga0209700_100012 Ga0209700_10001282 296
375 3300027866 Ga0209813_10003650 Ga0209813_100036503 296
376 3300028379 Ga0268266_10072985 Ga0268266_100729853 296
377 3300028379 Ga0268266_10243943 Ga0268266_102439432 296
378 3300028786 Ga0307517_10156434 Ga0307517_101564341 296
379 3300031711 Ga0265314_10008159 Ga0265314_100081598 296
380 3300031712 Ga0265342_10005588 Ga0265342_100055883 296
381 3300033180 Ga0307510_10026321 Ga0307510_100263214 296
382 3300035086 Ga0373934_0047419 Ga0373934_0047419_107_1072 296
383 3300035119 Ga0373956_0011980 Ga0373956_0011980_209_1174 296
384 3300035120 Ga0373957_0006204 Ga0373957_0006204_1115_2080 296
385 3300035692 Ga0373935_0033201 Ga0373935_0033201_947_1912 296
386 3300035724 Ga0373933_0007313 Ga0373933_0007313_3395_4360 296
387 3300037471 Ga0395905_0028290 Ga0395905_0028290_895_1860 296
388 3300039437 Ga0436365_1584283 Ga0436365_1584283_11469_12434 296
389 3300041452 Ga0451793_1689633 Ga0451793_1689633_2110_3075 296
390 3300044684 Ga0466966_0000474 Ga0466966_0000474_7012_7989 296
391 3300044693 Ga0466961_0000023 Ga0466961_0000023_77044_78021 296
392 3300045049 Ga0466959_0000726 Ga0466959_0000726_5990_6967 296
393 3300045836 Ga0466958_0050655 Ga0466958_0050655_1523_2500 296
394 3300046454 Ga0495592_0025569 Ga0495592_0025569_977_1942 296
395 3300046454 Ga0495592_0181855 Ga0495592_0181855_75_1040 296
396 3300046455 Ga0495603_0067670 Ga0495603_0067670_726_1691 296
397 3300046459 Ga0495629_0064830 Ga0495629_0064830_369_1334 296
398 3300046460 Ga0495638_0009065 Ga0495638_0009065_1115_2080 296
399 3300046462 Ga0495651_0010752 Ga0495651_0010752_3113_4078 296
400 3300046474 Ga0495605_0041457 Ga0495605_0041457_81_1103 296
401 3300046477 Ga0495664_0032191 Ga0495664_0032191_1418_2383 296
402 3300046507 Ga0495606_0010252 Ga0495606_0010252_6311_7288 296
403 3300046514 Ga0495618_0049560 Ga0495618_0049560_304_1269 296
404 3300046516 Ga0495628_0008803 Ga0495628_0008803_532_1497 296
405 3300046522 Ga0495643_0104565 Ga0495643_0104565_299_1264 296
406 3300046524 Ga0495648_0017345 Ga0495648_0017345_421_1398 296
407 3300046524 Ga0495648_0023302 Ga0495648_0023302_801_1766 296
408 3300046524 Ga0495648_0163601 Ga0495648_0163601_159_1124 296
409 3300046529 Ga0495652_0026522 Ga0495652_0026522_1442_2407 296
410 3300046533 Ga0495640_0011385 Ga0495640_0011385_501_1466 296
411 3300046533 Ga0495640_0042700 Ga0495640_0042700_1335_2300 296
412 3300046536 Ga0495587_0007940 Ga0495587_0007940_2267_3232 296
413 3300046536 Ga0495587_0029301 Ga0495587_0029301_468_1433 296
414 3300046543 Ga0495645_0014710 Ga0495645_0014710_1298_2263 296
415 3300046543 Ga0495645_0042082 Ga0495645_0042082_1866_2831 296
416 3300046559 Ga0495667_0250542 Ga0495667_0250542_53_1018 296
417 3300046616 Ga0495668_0156697 Ga0495668_0156697_194_1159 296
418 3300046616 Ga0495668_0212793 Ga0495668_0212793_32_997 296
419 3300046642 Ga0495634_0025684 Ga0495634_0025684_977_1942 296
420 3300046642 Ga0495634_0028246 Ga0495634_0028246_2276_3241 296
421 3300046665 Ga0495661_0147563 Ga0495661_0147563_225_1190 296
422 3300046674 Ga0495588_0017305 Ga0495588_0017305_2340_3305 296
423 3300046675 Ga0495657_0004929 Ga0495657_0004929_949_1914 296
424 3300046678 Ga0495599_0004515 Ga0495599_0004515_2450_3415 296
425 3300046679 Ga0495623_0002235 Ga0495623_0002235_3677_4642 296
426 3300046689 Ga0495613_0030108 Ga0495613_0030108_1308_2273 296
427 3300046690 Ga0495624_0151959 Ga0495624_0151959_389_1354 296
428 3300046692 Ga0495671_0061704 Ga0495671_0061704_238_1203 296
429 3300046694 Ga0495649_0018372 Ga0495649_0018372_2785_3762 296
430 3300047317 Ga0495604_0038454 Ga0495604_0038454_184_1149 296
431 3300047317 Ga0495604_0071653 Ga0495604_0071653_257_1222 296
432 3300047319 Ga0495674_0083157 Ga0495674_0083157_780_1745 296
433 3300047322 Ga0495680_0002016 Ga0495680_0002016_6425_7390 296
434 3300047444 Ga0495675_0001856 Ga0495675_0001856_2437_3402 296
435 3300047444 Ga0495675_0014120 Ga0495675_0014120_1074_2039 296
436 3300047471 Ga0495684_0048992 Ga0495684_0048992_103_1068 296
437 3300047471 Ga0495684_0066991 Ga0495684_0066991_1382_2347 296
438 3300047472 Ga0495686_0052087 Ga0495686_0052087_513_1478 296
439 3300048907 Ga0496104_0210555 Ga0496104_0210555_787_1809 296
440 3300048910 Ga0496107_0111890 Ga0496107_0111890_814_1779 296
441 3300048914 Ga0496111_0075974 Ga0496111_0075974_1200_2222 296
442 3300048915 Ga0496112_0140196 Ga0496112_0140196_517_1482 296
443 3300048916 Ga0496113_0064157 Ga0496113_0064157_948_1970 296
444 3300048917 Ga0496114_0354705 Ga0496114_0354705_170_1135 296
445 3300048919 Ga0496116_0182671 Ga0496116_0182671_120_1085 296
446 3300048920 Ga0496117_0081359 Ga0496117_0081359_109_1074 296
447 3300048921 Ga0496118_0107467 Ga0496118_0107467_96_1061 296
448 3300048921 Ga0496118_0183053 Ga0496118_0183053_67_1089 296
449 3300048924 Ga0496121_0031768 Ga0496121_0031768_3408_4373 296
450 3300048924 Ga0496121_0050990 Ga0496121_0050990_1219_2184 296
451 3300048927 Ga0496124_0061180 Ga0496124_0061180_476_1438 296
452 3300048929 Ga0496126_0053837 Ga0496126_0053837_106_1074 296
453 3300050490 nmdc:mga03n38_13494_c2 nmdc:mga03n38_13494_c2_1502_2524 296
454 3300050492 nmdc:mga0yw44_18826_c1 nmdc:mga0yw44_18826_c1_610_1575 296
455 3300050493 nmdc:mga0k408_94704_c1 nmdc:mga0k408_94704_c1_467_1432 296
456 3300050495 nmdc:mga04h51_4263_c1 nmdc:mga04h51_4263_c1_1797_2819 296
457 3300050496 nmdc:mga07m45_81446_c1 nmdc:mga07m45_81446_c1_843_1820 296
458 3300050496 nmdc:mga07m45_8967_c1 nmdc:mga07m45_8967_c1_3356_4318 296
459 3300050516 nmdc:mga0sz30_17557_c1 nmdc:mga0sz30_17557_c1_341_1363 296
460 3300053085 Ga0495619_0191487 Ga0495619_0191487_78_1043 296
461 3300053087 Ga0500643_000052 Ga0500643_000052_47861_48826 296
462 3300053094 Ga0500566_0002512 Ga0500566_0002512_109_1074 296
463 3300053096 Ga0500641_0007654 Ga0500641_0007654_1243_2208 296
464 3300053103 Ga0500555_039695 Ga0500555_039695_126_1091 296
465 3300053104 Ga0500556_0008815 Ga0500556_0008815_1217_2182 296
466 3300053105 Ga0500557_000057 Ga0500557_000057_35947_36912 296
467 3300053109 Ga0500569_004458 Ga0500569_004458_1064_2086 296
468 3300053121 Ga0500607_103185 Ga0500607_103185_378_1343 296
469 3300053130 Ga0500642_0000263 Ga0500642_0000263_15970_16935 296
470 3300053130 Ga0500642_0016379 Ga0500642_0016379_112_1077 296
471 3300053134 Ga0500658_0099854 Ga0500658_0099854_222_1187 296
472 3300053138 Ga0500564_093204 Ga0500564_093204_90_1055 296
473 3300053139 Ga0500568_0010868 Ga0500568_0010868_2883_3848 296
474 3300053148 Ga0500590_150761 Ga0500590_150761_19_984 296
475 3300053151 Ga0500604_0040168 Ga0500604_0040168_333_1298 296
476 3300053156 Ga0500622_0004797 Ga0500622_0004797_4032_5054 296
477 3300053158 Ga0500627_0085024 Ga0500627_0085024_51_1016 296
478 3300053177 Ga0500636_0001378 Ga0500636_0001378_4983_5948 296
479 3300053729 Ga0500625_003219 Ga0500625_003219_348_1313 296
480 3300053736 Ga0500599_009231 Ga0500599_009231_199_1164 296
481 iso_pu_bacteria 2528768022 2528850385 296
482 iso_pu_bacteria 2932784394 2932789671 296
483 iso_pu_bacteria 2932809354 2932814823 296
484 iso_pu_bacteria 2932818245 2932824320 296
485 iso_pu_bacteria 2932828146 2932833952 296
486 iso_pu_bacteria 2933577622 2933581804 296
487 iso_pu_bacteria 2935616580 2935623658 296
488 iso_pu_bacteria 2935638405 2935645045 296
489 iso_pu_bacteria 2935665750 2935672094 296
490 iso_pu_bacteria 2935675223 2935684100 296
491 iso_pu_bacteria 2935684952 2935689149 296
492 iso_pu_bacteria 2935694250 2935697591 296
493 iso_pu_bacteria 2935703347 2935711383 296
494 iso_pu_bacteria 2935713505 2935720095 296
495 iso_pu_bacteria 2935722832 2935728288 296
496 iso_pu_bacteria 2935732158 2935737115 296
497 iso_pu_bacteria 2935741537 2935746824 296
498 iso_pu_bacteria 2935750917 2935757791 296
499 iso_pu_bacteria 2935760218 2935764171 296
500 iso_pu_bacteria 2935801545 2935808757 296
501 iso_pu_bacteria 2935810662 2935817554 296
502 iso_pu_bacteria 2935827899 2935834109 296
503 iso_pu_bacteria 2935837841 2935844711 296
504 iso_pu_bacteria 2935855204 2935861735 296
505 iso_pu_bacteria 2935864058 2935868629 296
506 iso_pu_bacteria 2935873716 2935879403 296
507 iso_pu_bacteria 2935992306 2935998429 296
508 iso_pu_bacteria 2936002035 2936009110 296
509 iso_pu_bacteria 2936037263 2936044351 296
510 iso_pu_bacteria 2940556831 2940563387 296
511 iso_pu_bacteria 2941538514 2941545394 296
512 iso_pu_bacteria 8017057580 8017066283 296
513 iso_pu_bacteria 8019576017 8019578340 296
514 iso_pu_bacteria 8019586578 8019596378 296
515 iso_pu_bacteria 8019597564 8019605323 296
516 iso_pu_bacteria 8019608314 8019613219 296
517 iso_pu_bacteria 8055225921 8055228655 296
518 iso_pu_bacteria 8055742211 8055750362 296
519 3300003203 JGI25406J46586_10006073 JGI25406J46586_100060736 297
520 3300003215 JGI25153J46596_10004803 JGI25153J46596_100048033 297
521 3300003354 JGI25160J50197_1008171 JGI25160J50197_10081713 297
522 3300003659 JGI25404J52841_10030037 JGI25404J52841_100300371 297
523 3300005327 Ga0070658_10093766 Ga0070658_100937662 297
524 3300005327 Ga0070658_10293588 Ga0070658_102935882 297
525 3300005328 Ga0070676_10044708 Ga0070676_100447082 297
526 3300005328 Ga0070676_10136276 Ga0070676_101362761 297
527 3300005329 Ga0070683_100149805 Ga0070683_1001498052 297
528 3300005330 Ga0070690_100059558 Ga0070690_1000595583 297
529 3300005336 Ga0070680_100077218 Ga0070680_1000772182 297
530 3300005336 Ga0070680_100131705 Ga0070680_1001317052 297
531 3300005343 Ga0070687_100055331 Ga0070687_1000553312 297
532 3300005344 Ga0070661_100271496 Ga0070661_1002714962 297
533 3300005347 Ga0070668_100217989 Ga0070668_1002179892 297
534 3300005354 Ga0070675_100118178 Ga0070675_1001181784 297
535 3300005364 Ga0070673_100069800 Ga0070673_1000698003 297
536 3300005434 Ga0070709_10024332 Ga0070709_100243322 297
537 3300005434 Ga0070709_10078062 Ga0070709_100780622 297
538 3300005434 Ga0070709_10141936 Ga0070709_101419362 297
539 3300005436 Ga0070713_100039241 Ga0070713_1000392412 297
540 3300005437 Ga0070710_10002417 Ga0070710_100024172 297
541 3300005437 Ga0070710_10038634 Ga0070710_100386342 297
542 3300005455 Ga0070663_100069526 Ga0070663_1000695262 297
543 3300005458 Ga0070681_10050857 Ga0070681_100508573 297
544 3300005458 Ga0070681_10074250 Ga0070681_100742504 297
545 3300005458 Ga0070681_10223614 Ga0070681_102236141 297
546 3300005544 Ga0070686_100008070 Ga0070686_1000080702 297
547 3300005546 Ga0070696_100048131 Ga0070696_1000481312 297
548 3300005546 Ga0070696_100107754 Ga0070696_1001077541 297
549 3300005563 Ga0068855_100001526 Ga0068855_10000152612 297
550 3300005563 Ga0068855_100076692 Ga0068855_1000766923 297
551 3300005577 Ga0068857_100266693 Ga0068857_1002666932 297
552 3300005614 Ga0068856_100365997 Ga0068856_1003659972 297
553 3300005614 Ga0068856_100392745 Ga0068856_1003927451 297
554 3300005616 Ga0068852_100216491 Ga0068852_1002164912 297
555 3300005617 Ga0068859_100092180 Ga0068859_1000921802 297
556 3300005718 Ga0068866_10080273 Ga0068866_100802732 297
557 3300005834 Ga0068851_10141729 Ga0068851_101417292 297
558 3300005841 Ga0068863_100036014 Ga0068863_1000360146 297
559 3300005841 Ga0068863_100116459 Ga0068863_1001164592 297
560 3300005842 Ga0068858_100029243 Ga0068858_1000292434 297
561 3300005843 Ga0068860_100000441 Ga0068860_10000044125 297
562 3300005937 Ga0081455_10003833 Ga0081455_1000383311 297
563 3300005937 Ga0081455_10053122 Ga0081455_100531223 297
564 3300005937 Ga0081455_10085161 Ga0081455_100851613 297
565 3300005981 Ga0081538_10120242 Ga0081538_101202421 297
566 3300005983 Ga0081540_1004960 Ga0081540_10049609 297
567 3300005983 Ga0081540_1006444 Ga0081540_10064446 297
568 3300005983 Ga0081540_1021674 Ga0081540_10216742 297
569 3300005983 Ga0081540_1025036 Ga0081540_10250364 297
570 3300005983 Ga0081540_1026089 Ga0081540_10260893 297
571 3300005983 Ga0081540_1026760 Ga0081540_10267602 297
572 3300005983 Ga0081540_1026892 Ga0081540_10268922 297
573 3300005985 Ga0081539_10001114 Ga0081539_1000111441 297
574 3300006028 Ga0070717_10051443 Ga0070717_100514432 297
575 3300006038 Ga0075365_10078393 Ga0075365_100783933 297
576 3300006038 Ga0075365_10224578 Ga0075365_102245782 297
577 3300006051 Ga0075364_10184785 Ga0075364_101847851 297
578 3300006058 Ga0075432_10017317 Ga0075432_100173171 297
579 3300006163 Ga0070715_10005346 Ga0070715_100053465 297
580 3300006173 Ga0070716_100001217 Ga0070716_10000121713 297
581 3300006175 Ga0070712_100177090 Ga0070712_1001770902 297
582 3300006175 Ga0070712_100449722 Ga0070712_1004497221 297
583 3300006178 Ga0075367_10024485 Ga0075367_100244853 297
584 3300006186 Ga0075369_10080344 Ga0075369_100803442 297
585 3300006237 Ga0097621_100010589 Ga0097621_1000105898 297
586 3300006358 Ga0068871_100036409 Ga0068871_1000364095 297
587 3300006844 Ga0075428_100001723 Ga0075428_10000172317 297
588 3300006844 Ga0075428_100274360 Ga0075428_1002743603 297
589 3300006846 Ga0075430_100000201 Ga0075430_10000020117 297
590 3300006847 Ga0075431_100000260 Ga0075431_10000026017 297
591 3300006852 Ga0075433_10000007 Ga0075433_1000000762 297
592 3300006852 Ga0075433_10127889 Ga0075433_101278892 297
593 3300006852 Ga0075433_10196700 Ga0075433_101967002 297
594 3300006871 Ga0075434_100000091 Ga0075434_10000009130 297
595 3300006871 Ga0075434_100034266 Ga0075434_1000342664 297
596 3300006871 Ga0075434_100210094 Ga0075434_1002100942 297
597 3300006871 Ga0075434_100276410 Ga0075434_1002764102 297
598 3300006880 Ga0075429_100001265 Ga0075429_10000126516 297
599 3300006881 Ga0068865_100115705 Ga0068865_1001157052 297
600 3300006881 Ga0068865_100121134 Ga0068865_1001211342 297
601 3300006931 Ga0097620_100092182 Ga0097620_1000921823 297
602 3300007076 Ga0075435_100003301 Ga0075435_1000033014 297
603 3300007076 Ga0075435_100011769 Ga0075435_1000117692 297
604 3300007076 Ga0075435_100312517 Ga0075435_1003125172 297
605 3300009093 Ga0105240_10014700 Ga0105240_100147006 297
606 3300009094 Ga0111539_10071975 Ga0111539_100719754 297
607 3300009098 Ga0105245_10221927 Ga0105245_102219272 297
608 3300009098 Ga0105245_10249822 Ga0105245_102498221 297
609 3300009147 Ga0114129_10007261 Ga0114129_1000726118 297
610 3300009148 Ga0105243_10125749 Ga0105243_101257492 297
611 3300009176 Ga0105242_10004266 Ga0105242_1000426612 297
612 3300009176 Ga0105242_10353114 Ga0105242_103531141 297
613 3300009177 Ga0105248_10047962 Ga0105248_100479626 297
614 3300009551 Ga0105238_10064515 Ga0105238_100645152 297
615 3300009553 Ga0105249_10083546 Ga0105249_100835464 297
616 3300010375 Ga0105239_10253395 Ga0105239_102533952 297
617 3300011119 Ga0105246_10126198 Ga0105246_101261981 297
618 3300013102 Ga0157371_10163070 Ga0157371_101630702 297
619 3300025297 Ga0209758_1005929 Ga0209758_10059294 297
620 3300025297 Ga0209758_1006430 Ga0209758_10064309 297
621 3300025297 Ga0209758_1011834 Ga0209758_10118345 297
622 3300025302 Ga0207426_1000374 Ga0207426_100037411 297
623 3300025900 Ga0207710_10007424 Ga0207710_100074243 297
624 3300025903 Ga0207680_10063441 Ga0207680_100634412 297
625 3300025906 Ga0207699_10001489 Ga0207699_1000148914 297
626 3300025907 Ga0207645_10133652 Ga0207645_101336522 297
627 3300025912 Ga0207707_10122357 Ga0207707_101223572 297
628 3300025912 Ga0207707_10204665 Ga0207707_102046652 297
629 3300025915 Ga0207693_10008449 Ga0207693_100084497 297
630 3300025915 Ga0207693_10027452 Ga0207693_100274523 297
631 3300025915 Ga0207693_10107351 Ga0207693_101073511 297
632 3300025917 Ga0207660_10190158 Ga0207660_101901582 297
633 3300025919 Ga0207657_10130332 Ga0207657_101303322 297
634 3300025920 Ga0207649_10051415 Ga0207649_100514153 297
635 3300025924 Ga0207694_10114799 Ga0207694_101147992 297
636 3300025925 Ga0207650_10263109 Ga0207650_102631092 297
637 3300025927 Ga0207687_10029064 Ga0207687_100290644 297
638 3300025927 Ga0207687_10118046 Ga0207687_101180462 297
639 3300025928 Ga0207700_10005022 Ga0207700_100050229 297
640 3300025928 Ga0207700_10200398 Ga0207700_102003982 297
641 3300025928 Ga0207700_10321855 Ga0207700_103218551 297
642 3300025929 Ga0207664_10146369 Ga0207664_101463693 297
643 3300025931 Ga0207644_10048873 Ga0207644_100488734 297
644 3300025932 Ga0207690_10061018 Ga0207690_100610182 297
645 3300025933 Ga0207706_10057132 Ga0207706_100571323 297
646 3300025934 Ga0207686_10026307 Ga0207686_100263072 297
647 3300025935 Ga0207709_10018115 Ga0207709_100181155 297
648 3300025938 Ga0207704_10163037 Ga0207704_101630372 297
649 3300025939 Ga0207665_10021180 Ga0207665_100211804 297
650 3300025940 Ga0207691_10154586 Ga0207691_101545862 297
651 3300025941 Ga0207711_10009422 Ga0207711_1000942211 297
652 3300025944 Ga0207661_10091550 Ga0207661_100915502 297
653 3300025944 Ga0207661_10302400 Ga0207661_103024001 297
654 3300025949 Ga0207667_10017077 Ga0207667_1001707712 297
655 3300025986 Ga0207658_10164790 Ga0207658_101647902 297
656 3300026035 Ga0207703_10106496 Ga0207703_101064962 297
657 3300026041 Ga0207639_10197023 Ga0207639_101970233 297
658 3300026067 Ga0207678_10017546 Ga0207678_100175468 297
659 3300026067 Ga0207678_10082834 Ga0207678_100828342 297
660 3300026067 Ga0207678_10124265 Ga0207678_101242652 297
661 3300026088 Ga0207641_10029014 Ga0207641_100290145 297
662 3300026089 Ga0207648_10228656 Ga0207648_102286562 297
663 3300026116 Ga0207674_10295465 Ga0207674_102954652 297
664 3300026121 Ga0207683_10012926 Ga0207683_100129263 297
665 3300026121 Ga0207683_10111222 Ga0207683_101112223 297
666 3300026121 Ga0207683_10341545 Ga0207683_103415452 297
667 3300026121 Ga0207683_10393857 Ga0207683_103938572 297
668 3300026142 Ga0207698_10011050 Ga0207698_100110508 297
669 3300027671 Ga0209588_1003621 Ga0209588_10036213 297
670 3300027907 Ga0207428_10000115 Ga0207428_1000011520 297
671 3300027907 Ga0207428_10105287 Ga0207428_101052873 297
672 3300028379 Ga0268266_10063727 Ga0268266_100637273 297
673 3300028379 Ga0268266_10079592 Ga0268266_100795922 297
674 3300028381 Ga0268264_10000042 Ga0268264_1000004274 297
675 3300028381 Ga0268264_10196256 Ga0268264_101962562 297
676 3300028573 Ga0265334_10029740 Ga0265334_100297402 297
677 3300028786 Ga0307517_10092417 Ga0307517_100924173 297
678 3300028800 Ga0265338_10100786 Ga0265338_101007862 297
679 3300030521 Ga0307511_10123445 Ga0307511_101234451 297
680 3300031235 Ga0265330_10006763 Ga0265330_100067638 297
681 3300031235 Ga0265330_10008114 Ga0265330_100081144 297
682 3300031238 Ga0265332_10002834 Ga0265332_100028344 297
683 3300031238 Ga0265332_10012634 Ga0265332_100126342 297
684 3300031241 Ga0265325_10000026 Ga0265325_100000261 297
685 3300031241 Ga0265325_10008677 Ga0265325_100086779 297
686 3300031241 Ga0265325_10008781 Ga0265325_100087812 297
687 3300031241 Ga0265325_10051223 Ga0265325_100512232 297
688 3300031247 Ga0265340_10001337 Ga0265340_100013373 297
689 3300031247 Ga0265340_10003564 Ga0265340_100035643 297
690 3300031249 Ga0265339_10003955 Ga0265339_100039559 297
691 3300031249 Ga0265339_10028820 Ga0265339_100288203 297
692 3300031250 Ga0265331_10006990 Ga0265331_100069903 297
693 3300031250 Ga0265331_10059477 Ga0265331_100594772 297
694 3300031595 Ga0265313_10013520 Ga0265313_100135203 297
695 3300031595 Ga0265313_10027363 Ga0265313_100273631 297
696 3300031595 Ga0265313_10027511 Ga0265313_100275113 297
697 3300031595 Ga0265313_10049471 Ga0265313_100494712 297
698 3300031712 Ga0265342_10000082 Ga0265342_1000008222 297
699 3300031712 Ga0265342_10000291 Ga0265342_1000029136 297
700 3300031712 Ga0265342_10010349 Ga0265342_100103494 297
701 3300031712 Ga0265342_10014750 Ga0265342_100147505 297
702 3300031730 Ga0307516_10094154 Ga0307516_100941543 297
703 3300035090 Ga0373949_0033249 Ga0373949_0033249_200_1186 297
704 3300035111 Ga0373923_0001865 Ga0373923_0001865_4004_5032 297
705 3300035113 Ga0373936_0006791 Ga0373936_0006791_1988_2959 297
706 3300035113 Ga0373936_0049669 Ga0373936_0049669_275_1270 297
707 3300035115 Ga0373941_0021210 Ga0373941_0021210_187_1173 297
708 3300035116 Ga0373945_0000946 Ga0373945_0000946_781_1809 297
709 3300035116 Ga0373945_0039019 Ga0373945_0039019_241_1236 297
710 3300035116 Ga0373945_0124728 Ga0373945_0124728_10_975 297
711 3300035117 Ga0373953_0000156 Ga0373953_0000156_16625_17593 297
712 3300035117 Ga0373953_0062323 Ga0373953_0062323_292_1320 297
713 3300035118 Ga0373954_0011119 Ga0373954_0011119_1917_2885 297
714 3300035118 Ga0373954_0013754 Ga0373954_0013754_1347_2312 297
715 3300035118 Ga0373954_0053883 Ga0373954_0053883_190_1161 297
716 3300035119 Ga0373956_0004148 Ga0373956_0004148_1714_2682 297
717 3300035119 Ga0373956_0118121 Ga0373956_0118121_180_1175 297
718 3300035120 Ga0373957_0001409 Ga0373957_0001409_2590_3558 297
719 3300035170 Ga0373943_0001934 Ga0373943_0001934_397_1425 297
720 3300035170 Ga0373943_0019251 Ga0373943_0019251_917_1903 297
721 3300035171 Ga0373946_0024460 Ga0373946_0024460_367_1395 297
722 3300035172 Ga0373955_0000395 Ga0373955_0000395_6852_7820 297
723 3300035172 Ga0373955_0002215 Ga0373955_0002215_1812_2777 297
724 3300035172 Ga0373955_0009768 Ga0373955_0009768_1001_1996 297
725 3300035172 Ga0373955_0050440 Ga0373955_0050440_150_1178 297
726 3300035410 Ga0373924_0007061 Ga0373924_0007061_113_1108 297
727 3300035410 Ga0373924_0043936 Ga0373924_0043936_112_1140 297
728 3300035691 Ga0373931_0013339 Ga0373931_0013339_1590_2576 297
729 3300035691 Ga0373931_0094834 Ga0373931_0094834_320_1285 297
730 3300035692 Ga0373935_0001093 Ga0373935_0001093_8917_9903 297
731 3300035692 Ga0373935_0034411 Ga0373935_0034411_1589_2617 297
732 3300035695 Ga0373927_0004563 Ga0373927_0004563_4203_5168 297
733 3300035695 Ga0373927_0021903 Ga0373927_0021903_2423_3409 297
734 3300035695 Ga0373927_0052489 Ga0373927_0052489_1157_2152 297
735 3300035724 Ga0373933_0004898 Ga0373933_0004898_5002_5970 297
736 3300035724 Ga0373933_0032029 Ga0373933_0032029_285_1280 297
737 3300035725 Ga0373947_0000288 Ga0373947_0000288_24067_25053 297
738 3300035725 Ga0373947_0031415 Ga0373947_0031415_14_1042 297
739 3300035725 Ga0373947_0056162 Ga0373947_0056162_366_1331 297
740 3300036401 Ga0373937_0000996 Ga0373937_0000996_18805_19770 297
741 3300036401 Ga0373937_0300677 Ga0373937_0300677_333_1298 297
742 3300036401 Ga0373937_0566416 Ga0373937_0566416_12_998 297
743 3300037068 Ga0373925_0002967 Ga0373925_0002967_1102_2073 297
744 3300037068 Ga0373925_0018541 Ga0373925_0018541_1787_2758 297
745 3300037068 Ga0373925_0021989 Ga0373925_0021989_273_1238 297
746 3300037068 Ga0373925_0027832 Ga0373925_0027832_445_1431 297
747 3300037068 Ga0373925_0277657 Ga0373925_0277657_332_1312 297
748 3300037312 Ga0395899_0009357 Ga0395899_0009357_1246_2214 297
749 3300037418 Ga0395900_0119313 Ga0395900_0119313_57_1025 297
750 3300037418 Ga0395900_0178657 Ga0395900_0178657_100_1206 297
751 3300037466 Ga0395898_0014236 Ga0395898_0014236_5641_6609 297
752 3300038443 Ga0395901_0127711 Ga0395901_0127711_572_1678 297
753 3300038443 Ga0395901_0366626 Ga0395901_0366626_27_995 297
754 3300039438 Ga0436360_0575108 Ga0436360_0575108_335_1303 297
755 3300039453 Ga0436362_1127865 Ga0436362_1127865_535_1503 297
756 3300044658 Ga0466972_0000177 Ga0466972_0000177_30211_31197 297
757 3300044684 Ga0466966_0259602 Ga0466966_0259602_38_1006 297
758 3300044706 Ga0466964_0036413 Ga0466964_0036413_891_1913 297
759 3300046454 Ga0495592_0016624 Ga0495592_0016624_1646_2611 297
760 3300046454 Ga0495592_0041102 Ga0495592_0041102_1399_2367 297
761 3300046454 Ga0495592_0067804 Ga0495592_0067804_1161_2189 297
762 3300046455 Ga0495603_0008338 Ga0495603_0008338_4009_4995 297
763 3300046455 Ga0495603_0026574 Ga0495603_0026574_1581_2609 297
764 3300046455 Ga0495603_0027248 Ga0495603_0027248_2266_3261 297
765 3300046455 Ga0495603_0074304 Ga0495603_0074304_850_1815 297
766 3300046458 Ga0495591_030268 Ga0495591_030268_258_1286 297
767 3300046458 Ga0495591_051529 Ga0495591_051529_107_1087 297
768 3300046459 Ga0495629_0000183 Ga0495629_0000183_27346_28332 297
769 3300046459 Ga0495629_0000655 Ga0495629_0000655_21891_22859 297
770 3300046460 Ga0495638_0051383 Ga0495638_0051383_826_1806 297
771 3300046461 Ga0495641_0054290 Ga0495641_0054290_15_980 297
772 3300046462 Ga0495651_0005368 Ga0495651_0005368_709_1674 297
773 3300046462 Ga0495651_0007056 Ga0495651_0007056_7300_8295 297
774 3300046462 Ga0495651_0008033 Ga0495651_0008033_1795_2763 297
775 3300046463 Ga0495653_0004854 Ga0495653_0004854_8934_9902 297
776 3300046463 Ga0495653_0035742 Ga0495653_0035742_1412_2407 297
777 3300046463 Ga0495653_0142291 Ga0495653_0142291_233_1261 297
778 3300046472 Ga0495580_0106313 Ga0495580_0106313_230_1258 297
779 3300046473 Ga0495582_0001121 Ga0495582_0001121_9817_10803 297
780 3300046473 Ga0495582_0097360 Ga0495582_0097360_126_1121 297
781 3300046474 Ga0495605_0069308 Ga0495605_0069308_160_1137 297
782 3300046475 Ga0495639_0009485 Ga0495639_0009485_3122_4150 297
783 3300046476 Ga0495662_0072451 Ga0495662_0072451_60_1088 297
784 3300046477 Ga0495664_0018150 Ga0495664_0018150_274_1302 297
785 3300046477 Ga0495664_0102880 Ga0495664_0102880_578_1573 297
786 3300046491 Ga0495584_0067035 Ga0495584_0067035_69_1097 297
787 3300046492 Ga0495585_0003428 Ga0495585_0003428_871_1899 297
788 3300046499 Ga0495594_0017097 Ga0495594_0017097_2472_3500 297
789 3300046499 Ga0495594_0155501 Ga0495594_0155501_102_1082 297
790 3300046500 Ga0495596_0103616 Ga0495596_0103616_64_1044 297
791 3300046501 Ga0495607_0009340 Ga0495607_0009340_5433_6461 297
792 3300046511 Ga0495608_0002221 Ga0495608_0002221_4643_5638 297
793 3300046511 Ga0495608_0009154 Ga0495608_0009154_1795_2763 297
794 3300046511 Ga0495608_0015766 Ga0495608_0015766_1533_2498 297
795 3300046512 Ga0495610_0057636 Ga0495610_0057636_82_1062 297
796 3300046513 Ga0495616_0093166 Ga0495616_0093166_35_1015 297
797 3300046514 Ga0495618_0013409 Ga0495618_0013409_2444_3439 297
798 3300046515 Ga0495620_0052579 Ga0495620_0052579_166_1134 297
799 3300046516 Ga0495628_0000950 Ga0495628_0000950_8197_9162 297
800 3300046516 Ga0495628_0049682 Ga0495628_0049682_1129_2097 297
801 3300046516 Ga0495628_0207020 Ga0495628_0207020_215_1186 297
802 3300046517 Ga0495630_0069053 Ga0495630_0069053_1192_2187 297
803 3300046517 Ga0495630_0127087 Ga0495630_0127087_933_1901 297
804 3300046518 Ga0495631_0060865 Ga0495631_0060865_637_1605 297
805 3300046518 Ga0495631_0081087 Ga0495631_0081087_212_1180 297
806 3300046523 Ga0495644_0000234 Ga0495644_0000234_3426_4454 297
807 3300046528 Ga0495642_0017866 Ga0495642_0017866_731_1711 297
808 3300046529 Ga0495652_0002257 Ga0495652_0002257_14277_15242 297
809 3300046529 Ga0495652_0038700 Ga0495652_0038700_2895_3890 297
810 3300046529 Ga0495652_0056866 Ga0495652_0056866_982_1977 297
811 3300046529 Ga0495652_0136539 Ga0495652_0136539_795_1763 297
812 3300046529 Ga0495652_0278038 Ga0495652_0278038_215_1195 297
813 3300046533 Ga0495640_0012912 Ga0495640_0012912_3421_4416 297
814 3300046533 Ga0495640_0018366 Ga0495640_0018366_229_1200 297
815 3300046533 Ga0495640_0068492 Ga0495640_0068492_1217_2182 297
816 3300046536 Ga0495587_0002956 Ga0495587_0002956_218_1213 297
817 3300046536 Ga0495587_0018590 Ga0495587_0018590_734_1699 297
818 3300046536 Ga0495587_0029645 Ga0495587_0029645_1130_2098 297
819 3300046543 Ga0495645_0001487 Ga0495645_0001487_4439_5404 297
820 3300046543 Ga0495645_0002475 Ga0495645_0002475_11483_12478 297
821 3300046543 Ga0495645_0002973 Ga0495645_0002973_7705_8673 297
822 3300046557 Ga0495622_0015742 Ga0495622_0015742_349_1377 297
823 3300046557 Ga0495622_0064788 Ga0495622_0064788_269_1255 297
824 3300046558 Ga0495633_0002692 Ga0495633_0002692_1252_2280 297
825 3300046559 Ga0495667_0008800 Ga0495667_0008800_1485_2513 297
826 3300046559 Ga0495667_0034771 Ga0495667_0034771_287_1252 297
827 3300046559 Ga0495667_0230581 Ga0495667_0230581_88_1083 297
828 3300046615 Ga0495656_0000174 Ga0495656_0000174_191_1219 297
829 3300046616 Ga0495668_0012879 Ga0495668_0012879_1969_2937 297
830 3300046642 Ga0495634_0011443 Ga0495634_0011443_1288_2256 297
831 3300046642 Ga0495634_0030566 Ga0495634_0030566_397_1392 297
832 3300046642 Ga0495634_0038590 Ga0495634_0038590_228_1256 297
833 3300046648 Ga0495611_0054934 Ga0495611_0054934_134_1162 297
834 3300046663 Ga0495635_0000380 Ga0495635_0000380_1130_2098 297
835 3300046663 Ga0495635_0006494 Ga0495635_0006494_3442_4407 297
836 3300046663 Ga0495635_0102821 Ga0495635_0102821_712_1707 297
837 3300046664 Ga0495659_0000220 Ga0495659_0000220_6193_7221 297
838 3300046674 Ga0495588_0011399 Ga0495588_0011399_1957_2985 297
839 3300046674 Ga0495588_0096356 Ga0495588_0096356_132_1118 297
840 3300046674 Ga0495588_0134287 Ga0495588_0134287_62_1027 297
841 3300046675 Ga0495657_0001852 Ga0495657_0001852_15343_16338 297
842 3300046675 Ga0495657_0005248 Ga0495657_0005248_2193_3161 297
843 3300046675 Ga0495657_0021999 Ga0495657_0021999_479_1444 297
844 3300046675 Ga0495657_0187104 Ga0495657_0187104_83_1111 297
845 3300046678 Ga0495599_0027283 Ga0495599_0027283_71_1066 297
846 3300046678 Ga0495599_0068007 Ga0495599_0068007_273_1244 297
847 3300046679 Ga0495623_0001484 Ga0495623_0001484_12947_13942 297
848 3300046679 Ga0495623_0004582 Ga0495623_0004582_5111_6076 297
849 3300046680 Ga0495646_0006953 Ga0495646_0006953_1680_2675 297
850 3300046680 Ga0495646_0055279 Ga0495646_0055279_634_1605 297
851 3300046681 Ga0495647_0029945 Ga0495647_0029945_95_1090 297
852 3300046681 Ga0495647_0055145 Ga0495647_0055145_189_1175 297
853 3300046683 Ga0495658_0000357 Ga0495658_0000357_6164_7150 297
854 3300046684 Ga0495669_0015903 Ga0495669_0015903_2155_3123 297
855 3300046689 Ga0495613_0009346 Ga0495613_0009346_5878_6864 297
856 3300046689 Ga0495613_0013096 Ga0495613_0013096_1965_2933 297
857 3300046689 Ga0495613_0153263 Ga0495613_0153263_548_1543 297
858 3300046690 Ga0495624_0100338 Ga0495624_0100338_223_1194 297
859 3300046691 Ga0495670_0000414 Ga0495670_0000414_2251_3279 297
860 3300046809 Ga0495600_0007486 Ga0495600_0007486_90_1118 297
861 3300046809 Ga0495600_0014864 Ga0495600_0014864_2510_3475 297
862 3300046809 Ga0495600_0067298 Ga0495600_0067298_402_1370 297
863 3300047315 Ga0495581_0010000 Ga0495581_0010000_1325_2311 297
864 3300047315 Ga0495581_0103688 Ga0495581_0103688_231_1211 297
865 3300047317 Ga0495604_0008886 Ga0495604_0008886_1130_2098 297
866 3300047317 Ga0495604_0017648 Ga0495604_0017648_1362_2357 297
867 3300047317 Ga0495604_0050016 Ga0495604_0050016_358_1323 297
868 3300047317 Ga0495604_0138503 Ga0495604_0138503_674_1702 297
869 3300047319 Ga0495674_0024907 Ga0495674_0024907_3117_4112 297
870 3300047319 Ga0495674_0044316 Ga0495674_0044316_904_1875 297
871 3300047319 Ga0495674_0055217 Ga0495674_0055217_1517_2512 297
872 3300047321 Ga0495676_0014158 Ga0495676_0014158_4480_5466 297
873 3300047322 Ga0495680_0001462 Ga0495680_0001462_5517_6545 297
874 3300047322 Ga0495680_0081922 Ga0495680_0081922_528_1523 297
875 3300047444 Ga0495675_0060074 Ga0495675_0060074_32_1027 297
876 3300047445 Ga0495677_0081228 Ga0495677_0081228_48_1016 297
877 3300047471 Ga0495684_0000294 Ga0495684_0000294_17177_18145 297
878 3300047471 Ga0495684_0001528 Ga0495684_0001528_4137_5165 297
879 3300047471 Ga0495684_0103985 Ga0495684_0103985_260_1255 297
880 3300047673 Ga0495593_0000744 Ga0495593_0000744_8898_9866 297
881 3300047673 Ga0495593_0010818 Ga0495593_0010818_1930_2916 297
882 3300047673 Ga0495593_0036316 Ga0495593_0036316_1480_2475 297
883 3300048088 Ga0495602_0001368 Ga0495602_0001368_712_1707 297
884 3300048088 Ga0495602_0004084 Ga0495602_0004084_8575_9540 297
885 3300048089 Ga0495614_0005613 Ga0495614_0005613_1555_2550 297
886 3300048089 Ga0495614_0093364 Ga0495614_0093364_66_1037 297
887 3300048089 Ga0495614_0114140 Ga0495614_0114140_129_1115 297
888 3300048903 Ga0496100_0002106 Ga0496100_0002106_610_1605 297
889 3300048903 Ga0496100_0111181 Ga0496100_0111181_495_1523 297
890 3300048904 Ga0496101_0028676 Ga0496101_0028676_100_1095 297
891 3300048905 Ga0496102_0005062 Ga0496102_0005062_9508_10503 297
892 3300048907 Ga0496104_0001363 Ga0496104_0001363_7177_8142 297
893 3300048907 Ga0496104_0513471 Ga0496104_0513471_87_1082 297
894 3300048908 Ga0496105_0124238 Ga0496105_0124238_587_1582 297
895 3300048908 Ga0496105_0133756 Ga0496105_0133756_835_1800 297
896 3300048910 Ga0496107_0001189 Ga0496107_0001189_627_1622 297
897 3300048912 Ga0496109_0171908 Ga0496109_0171908_512_1507 297
898 3300048913 Ga0496110_0197818 Ga0496110_0197818_710_1675 297
899 3300048918 Ga0496115_0024926 Ga0496115_0024926_549_1535 297
900 3300048922 Ga0496119_0012670 Ga0496119_0012670_4282_5250 297
901 3300048929 Ga0496126_0195743 Ga0496126_0195743_400_1368 297
902 3300049571 Ga0501034_0064750 Ga0501034_0064750_1954_2922 297
903 3300049571 Ga0501034_0264153 Ga0501034_0264153_574_1542 297
904 3300049573 Ga0501037_0031825 Ga0501037_0031825_2655_3623 297
905 3300049574 Ga0501038_0058873 Ga0501038_0058873_361_1329 297
906 3300049579 Ga0501043_0134930 Ga0501043_0134930_816_1784 297
907 3300049581 Ga0501047_0008244 Ga0501047_0008244_4481_5449 297
908 3300049581 Ga0501047_0045692 Ga0501047_0045692_1845_2813 297
909 3300049588 Ga0501072_0186968 Ga0501072_0186968_490_1458 297
910 3300049590 Ga0501074_0089456 Ga0501074_0089456_190_1158 297
911 3300049592 Ga0501076_0362473 Ga0501076_0362473_25_993 297
912 3300049741 Ga0501079_0099173 Ga0501079_0099173_1081_2049 297
913 3300049744 Ga0501083_0047864 Ga0501083_0047864_1097_2065 297
914 3300049822 Ga0501035_0340851 Ga0501035_0340851_93_1061 297
915 3300049823 Ga0501044_0034776 Ga0501044_0034776_3227_4195 297
916 3300050494 nmdc:mga06z11_112871_c1 nmdc:mga06z11_112871_c1_408_1379 297
917 3300050496 nmdc:mga07m45_126220_c1 nmdc:mga07m45_126220_c1_270_1244 297
918 3300050507 nmdc:mga05p37_2742_c1 nmdc:mga05p37_2742_c1_3600_4589 297
919 3300050512 nmdc:mga0n895_18031_c1 nmdc:mga0n895_18031_c1_3338_4309 297
920 3300050512 nmdc:mga0n895_385578_c1 nmdc:mga0n895_385578_c1_120_1106 297
921 3300050512 nmdc:mga0n895_4431_c1 nmdc:mga0n895_4431_c1_2648_3637 297
922 3300050513 nmdc:mga0rr50_4443_c1 nmdc:mga0rr50_4443_c1_4898_5887 297
923 3300050515 nmdc:mga0a205_75792_c2 nmdc:mga0a205_75792_c2_706_1695 297
924 3300053077 Ga0495601_0000075 Ga0495601_0000075_27467_28432 297
925 3300053077 Ga0495601_0003475 Ga0495601_0003475_4331_5326 297
926 3300053077 Ga0495601_0028022 Ga0495601_0028022_1080_2075 297
927 3300053078 Ga0495612_0002526 Ga0495612_0002526_5495_6460 297
928 3300053078 Ga0495612_0008861 Ga0495612_0008861_1412_2407 297
929 3300053078 Ga0495612_0011526 Ga0495612_0011526_2497_3492 297
930 3300053078 Ga0495612_0017374 Ga0495612_0017374_861_1832 297
931 3300053084 Ga0495595_0000253 Ga0495595_0000253_18232_19227 297
932 3300053084 Ga0495595_0000311 Ga0495595_0000311_15374_16339 297
933 3300053084 Ga0495595_0000670 Ga0495595_0000670_10442_11410 297
934 3300053084 Ga0495595_0009800 Ga0495595_0009800_2483_3511 297
935 3300053085 Ga0495619_0000301 Ga0495619_0000301_26576_27562 297
936 3300053085 Ga0495619_0000645 Ga0495619_0000645_15198_16163 297
937 3300053085 Ga0495619_0003855 Ga0495619_0003855_6852_7820 297
938 3300053085 Ga0495619_0036799 Ga0495619_0036799_832_1827 297
939 3300053085 Ga0495619_0065853 Ga0495619_0065853_1202_2167 297
940 3300053085 Ga0495619_0223462 Ga0495619_0223462_191_1186 297
941 3300053093 Ga0500651_0004830 Ga0500651_0004830_692_1660 297
942 3300053098 Ga0500650_0131108 Ga0500650_0131108_135_1100 297
943 3300053119 Ga0500595_000558 Ga0500595_000558_7887_8855 297
944 3300053119 Ga0500595_002578 Ga0500595_002578_5232_6200 297
945 3300053139 Ga0500568_0038089 Ga0500568_0038089_802_1770 297
946 3300053153 Ga0500616_0000002 Ga0500616_0000002_783781_784770 297
947 3300053156 Ga0500622_0103055 Ga0500622_0103055_415_1383 297
948 3300053177 Ga0500636_0002410 Ga0500636_0002410_5203_6171 297
949 3300005563 Ga0068855_100037526 Ga0068855_1000375263 298
950 3300006846 Ga0075430_100000244 Ga0075430_10000024418 298
951 3300006846 Ga0075430_100136323 Ga0075430_1001363232 298
952 3300031241 Ga0265325_10013389 Ga0265325_100133894 298
953 3300031711 Ga0265314_10002205 Ga0265314_1000220514 298
954 3300035171 Ga0373946_0007183 Ga0373946_0007183_473_1453 298
955 3300035695 Ga0373927_0175979 Ga0373927_0175979_213_1193 298
956 3300035725 Ga0373947_0024233 Ga0373947_0024233_537_1517 298
957 3300037466 Ga0395898_0073654 Ga0395898_0073654_1585_2556 298
958 3300038443 Ga0395901_0078788 Ga0395901_0078788_19_990 298
959 3300046533 Ga0495640_0009446 Ga0495640_0009446_1918_2898 298
960 3300047319 Ga0495674_0168794 Ga0495674_0168794_396_1376 298
961 3300049569 Ga0501032_0095172 Ga0501032_0095172_811_1782 298
962 3300049570 Ga0501033_0232716 Ga0501033_0232716_222_1193 298
963 3300049572 Ga0501036_0005977 Ga0501036_0005977_4936_5907 298
964 3300049573 Ga0501037_0003231 Ga0501037_0003231_10699_11670 298
965 3300049574 Ga0501038_0020838 Ga0501038_0020838_1447_2418 298
966 3300049575 Ga0501039_0001869 Ga0501039_0001869_12620_13591 298
967 3300049581 Ga0501047_0128370 Ga0501047_0128370_1335_2306 298
968 3300049582 Ga0501048_0034771 Ga0501048_0034771_509_1480 298
969 3300049583 Ga0501067_0172555 Ga0501067_0172555_102_1073 298
970 3300049584 Ga0501068_0014174 Ga0501068_0014174_3526_4497 298
971 3300049585 Ga0501069_0000929 Ga0501069_0000929_9996_10967 298
972 3300049587 Ga0501071_0079370 Ga0501071_0079370_1180_2151 298
973 3300049589 Ga0501073_0017185 Ga0501073_0017185_1087_2058 298
974 3300049590 Ga0501074_0022225 Ga0501074_0022225_3503_4474 298
975 3300049741 Ga0501079_0064503 Ga0501079_0064503_1816_2787 298
976 3300049744 Ga0501083_0010731 Ga0501083_0010731_537_1508 298
977 3300049822 Ga0501035_0014209 Ga0501035_0014209_1899_2870 298
978 3300049823 Ga0501044_0093844 Ga0501044_0093844_156_1127 298
979 3300049824 Ga0501045_0114802 Ga0501045_0114802_100_1071 298
980 3300050509 nmdc:mga0qj67_64106_c1 nmdc:mga0qj67_64106_c1_1811_2785 298
981 3300050510 nmdc:mga06r32_253385_c1 nmdc:mga06r32_253385_c1_401_1375 298
982 3300054114 Ga0501084_0035333 Ga0501084_0035333_1238_2209 298
983 3300053117 Ga0500593_003210 Ga0500593_003210_1030_2013 299
984 3300049823 Ga0501044_0000286 Ga0501044_0000286_41085_42077 300
985 iso_pu_bacteria 2929199973 2929201839 304
986 iso_pu_bacteria 8055909800 8055916289 304
987 3300003203 JGI25406J46586_10000359 JGI25406J46586_1000035911 306
988 3300005985 Ga0081539_10001128 Ga0081539_1000112825 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

91

364

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.894 33 285
4x9t-assembly1.cif.gz_A crystal structure of a tctc solute binding protein from polaromonas (bpro_3516, target efi-510338), no ligand 0.8862 31 287
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.885 32 288
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8848 31 288
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8608 35 301
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9647 131 251 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9626 131 244 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9445 131 252 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9345 131 251 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9229 132 241 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P2FGX3-F1-model_v4 Argininosuccinate lyase 0.9226 18 291 GO:0016829
AF-A0A537CYK4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9165 27 288
AF-A0A537VTQ8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9037 43 290
AF-A0A0A1VID7-F1-model_v4 Extra-cytoplasmic solute receptor 0.9001 19 287
AF-A0A359LVB0-F1-model_v4 Prohead serine protease domain-containing protein 0.8998 45 291

Feature Viewer

pLDDT pTM Quality
88.51 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map