F487501

General Info

Members Datasets Scaffolds Average Seq Length
985 338 985 144

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10160592|Ga0157369_101605922
Length 165
Sequence MNAGTTAARIRSLGQQRRRNEMATDRRADVTWQGSLMEGSGTIRSTTSGKLGEQKVSWPNRAEDNPDATSPEELIAAAHAACYAMALSHALAQGGNAPDELQTSATVTFQPGEGITKIALTVDGRVPGIDAQQFEQAAQDAKQNCPVSKALAAVPEITIQASLSS

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 12.89
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10005153 3300002077 Bacteria 2704
2 JGI24742J22300_10049925 3300002244 Bacteria 756
3 rootH2_10145799 3300003320 Bacteria 1775
4 JGI25407J50210_10019029 3300003373 Bacteria 1784
5 Ga0070658_10028277 3300005327 Bacteria 4500
6 Ga0070658_10079643 3300005327 Bacteria 2690
7 Ga0070658_10141171 3300005327 Bacteria 2012
8 Ga0070658_10397026 3300005327 Bacteria 1184
9 Ga0070658_10648688 3300005327 Bacteria 916
10 Ga0070683_100006562 3300005329 Bacteria 9771
11 Ga0070683_100021449 3300005329 Bacteria 5766
12 Ga0070683_100146936 3300005329 Bacteria 2234
13 Ga0070683_100260818 3300005329 Bacteria 1648
14 Ga0070690_100125816 3300005330 Bacteria 1725
15 Ga0070690_101366406 3300005330 Bacteria 569
16 Ga0070680_100010699 3300005336 Bacteria 7081
17 Ga0070680_100027507 3300005336 Bacteria 4553
18 Ga0070680_100232958 3300005336 Bacteria 1556
19 Ga0070680_100266914 3300005336 Bacteria 1449
20 Ga0070680_100984503 3300005336 Bacteria 728
21 Ga0070682_100020032 3300005337 Bacteria 3931
22 Ga0070682_100124898 3300005337 Bacteria 1733
23 Ga0070682_100312310 3300005337 Bacteria 1158
24 Ga0070682_100422041 3300005337 Bacteria 1014
25 Ga0068868_100040728 3300005338 Bacteria 3616
26 Ga0068868_100399438 3300005338 Bacteria 1186
27 Ga0068868_100907006 3300005338 Archaea 801
28 Ga0070660_100011899 3300005339 Bacteria 6204
29 Ga0070660_100037138 3300005339 Bacteria 3693
30 Ga0070660_100673639 3300005339 Bacteria 867
31 Ga0070660_101432085 3300005339 Bacteria 587
32 Ga0070689_100923289 3300005340 Archaea 773
33 Ga0070691_10292626 3300005341 Bacteria 887
34 Ga0070661_100172121 3300005344 Bacteria 1645
35 Ga0070692_10025442 3300005345 Bacteria 2916
36 Ga0070671_100184565 3300005355 Bacteria 1767
37 Ga0070671_100189710 3300005355 Bacteria 1742
38 Ga0070674_100073278 3300005356 Bacteria 2427
39 Ga0070688_100045686 3300005365 Bacteria 2707
40 Ga0070659_100029587 3300005366 Bacteria 4234
41 Ga0070659_100124352 3300005366 Bacteria 2092
42 Ga0070659_100634279 3300005366 Bacteria 920
43 Ga0070703_10035822 3300005406 Bacteria 1522
44 Ga0070709_10017111 3300005434 Bacteria 4151
45 Ga0070709_10320167 3300005434 Bacteria 1138
46 Ga0070714_100009938 3300005435 Bacteria 7505
47 Ga0070714_100037737 3300005435 Bacteria 4061
48 Ga0070714_100044953 3300005435 Bacteria 3740
49 Ga0070714_100087445 3300005435 Bacteria 2726
50 Ga0070714_100137329 3300005435 Bacteria 2191
51 Ga0070714_100462205 3300005435 Bacteria 1207
52 Ga0070713_100007160 3300005436 Bacteria 7805
53 Ga0070713_100106750 3300005436 Bacteria 2435
54 Ga0070710_10001797 3300005437 Bacteria 10144
55 Ga0070710_10246260 3300005437 Bacteria 1147
56 Ga0070710_10246810 3300005437 Bacteria 1146
57 Ga0070710_10580965 3300005437 Bacteria 777
58 Ga0070701_10013123 3300005438 Bacteria 3759
59 Ga0070711_100082704 3300005439 Bacteria 2292
60 Ga0070711_100109703 3300005439 Bacteria 2023
61 Ga0070711_100140593 3300005439 Bacteria 1809
62 Ga0070711_100251760 3300005439 Bacteria 1386
63 Ga0070705_100103546 3300005440 Bacteria 1803
64 Ga0070705_100227615 3300005440 Bacteria 1295
65 Ga0070700_100005137 3300005441 Bacteria 6911
66 Ga0070694_100187047 3300005444 Bacteria 1535
67 Ga0070663_100165402 3300005455 Bacteria 1706
68 Ga0070663_100182027 3300005455 Bacteria 1631
69 Ga0070678_100007764 3300005456 Bacteria 6380
70 Ga0070678_100636202 3300005456 Bacteria 956
71 Ga0070678_100886505 3300005456 Bacteria 815
72 Ga0070662_101510701 3300005457 Bacteria 579
73 Ga0070681_10017854 3300005458 Bacteria 7090
74 Ga0070681_10051277 3300005458 Bacteria 4116
75 Ga0070681_10229762 3300005458 Bacteria 1770
76 Ga0070681_10236695 3300005458 Bacteria 1740
77 Ga0070681_10437565 3300005458 Bacteria 1220
78 Ga0070681_10586761 3300005458 Bacteria 1028
79 Ga0070681_11620582 3300005458 Bacteria 573
80 Ga0068867_100046488 3300005459 Bacteria 3188
81 Ga0070685_10077527 3300005466 Bacteria 1984
82 Ga0070706_101278862 3300005467 Bacteria 673
83 Ga0070707_100025765 3300005468 Bacteria 5582
84 Ga0070707_100304464 3300005468 Bacteria 1549
85 Ga0070698_100002914 3300005471 Bacteria 18836
86 Ga0070698_100114693 3300005471 Bacteria 2658
87 Ga0070698_100181898 3300005471 Bacteria 2040
88 Ga0070698_100270808 3300005471 Bacteria 1630
89 Ga0070679_100029228 3300005530 Bacteria 5438
90 Ga0070679_100110684 3300005530 Bacteria 2733
91 Ga0070679_100258710 3300005530 Bacteria 1696
92 Ga0070679_100950938 3300005530 Bacteria 803
93 Ga0070679_101743435 3300005530 Bacteria 571
94 Ga0070679_101794976 3300005530 Bacteria 562
95 Ga0070684_100008150 3300005535 Bacteria 8179
96 Ga0070684_100040414 3300005535 Bacteria 4016
97 Ga0070684_100260625 3300005535 Bacteria 1586
98 Ga0070684_101161701 3300005535 Bacteria 726
99 Ga0070684_101186283 3300005535 Bacteria 718
100 Ga0070684_101192855 3300005535 Bacteria 716
101 Ga0070684_101777082 3300005535 Bacteria 582
102 Ga0068853_100059109 3300005539 Bacteria 3311
103 Ga0068853_101281254 3300005539 Bacteria 708
104 Ga0070672_100320970 3300005543 Bacteria 1316
105 Ga0070686_100284373 3300005544 Bacteria 1221
106 Ga0070695_100455635 3300005545 Bacteria 981
107 Ga0070696_100020409 3300005546 Bacteria 4491
108 Ga0070696_100477554 3300005546 Bacteria 988
109 Ga0070693_100004618 3300005547 Bacteria 6537
110 Ga0070693_100197461 3300005547 Bacteria 1305
111 Ga0070693_100534058 3300005547 Bacteria 837
112 Ga0070665_100018038 3300005548 Bacteria 7082
113 Ga0070665_101039770 3300005548 Bacteria 831
114 Ga0070704_100018182 3300005549 Bacteria 4487
115 Ga0070704_100034939 3300005549 Bacteria 3413
116 Ga0070704_100283928 3300005549 Bacteria 1373
117 Ga0070704_101480419 3300005549 Bacteria 624
118 Ga0068855_100149462 3300005563 Bacteria 2656
119 Ga0068855_100871357 3300005563 Bacteria 953
120 Ga0068855_101023909 3300005563 Bacteria 866
121 Ga0068855_101035294 3300005563 Bacteria 861
122 Ga0068856_100059260 3300005614 Bacteria 3781
123 Ga0068856_100073164 3300005614 Bacteria 3394
124 Ga0068856_100455018 3300005614 Bacteria 1301
125 Ga0068856_100911453 3300005614 Bacteria 898
126 Ga0068856_101465511 3300005614 Bacteria 697
127 Ga0070702_100015913 3300005615 Bacteria 3850
128 Ga0070702_100024100 3300005615 Bacteria 3242
129 Ga0068852_100044443 3300005616 Bacteria 3772
130 Ga0068852_100441584 3300005616 Bacteria 1286
131 Ga0068852_100536706 3300005616 Bacteria 1169
132 Ga0068859_100227120 3300005617 Bacteria 1955
133 Ga0068864_101169583 3300005618 Bacteria 767
134 Ga0068864_101396863 3300005618 Bacteria 702
135 Ga0068866_10020135 3300005718 Bacteria 3051
136 Ga0068861_100038349 3300005719 Bacteria 3567
137 Ga0068863_100083643 3300005841 Bacteria 3024
138 Ga0068860_100061442 3300005843 Bacteria 3570
139 Ga0081455_10040841 3300005937 Bacteria 4087
140 Ga0081455_10051736 3300005937 Bacteria 3521
141 Ga0081538_10000565 3300005981 Bacteria 40995
142 Ga0081538_10020213 3300005981 Bacteria 4914
143 Ga0070717_10004885 3300006028 Bacteria 9755
144 Ga0070717_10045128 3300006028 Bacteria 3603
145 Ga0070717_10066518 3300006028 Bacteria 2997
146 Ga0070717_10122989 3300006028 Bacteria 2225
147 Ga0070717_10177241 3300006028 Bacteria 1856
148 Ga0070717_10718537 3300006028 Bacteria 908
149 Ga0070717_11215584 3300006028 Bacteria 686
150 Ga0075365_10019883 3300006038 Bacteria 4154
151 Ga0070715_10001967 3300006163 Bacteria 6192
152 Ga0070715_10029792 3300006163 Bacteria 2201
153 Ga0070716_100000458 3300006173 Bacteria 16870
154 Ga0070712_100003766 3300006175 Bacteria 9343
155 Ga0070712_100030800 3300006175 Bacteria 3610
156 Ga0070712_100138100 3300006175 Bacteria 1856
157 Ga0070712_100270618 3300006175 Bacteria 1364
158 Ga0070712_100407967 3300006175 Bacteria 1123
159 Ga0070712_100816050 3300006175 Bacteria 801
160 Ga0097621_100067240 3300006237 Bacteria 2953
161 Ga0068871_100094508 3300006358 Bacteria 2496
162 Ga0068871_100228040 3300006358 Bacteria 1616
163 Ga0068871_101918336 3300006358 Bacteria 563
164 Ga0075431_100063116 3300006847 Bacteria 3822
165 Ga0075433_10443802 3300006852 Bacteria 1144
166 Ga0075433_11032740 3300006852 Bacteria 716
167 Ga0075433_11058702 3300006852 Bacteria 706
168 Ga0075434_100024252 3300006871 Bacteria 5929
169 Ga0075434_100583166 3300006871 Bacteria 1137
170 Ga0075434_100865927 3300006871 Bacteria 919
171 Ga0075434_101286834 3300006871 Bacteria 742
172 Ga0068865_100007703 3300006881 Bacteria 6635
173 Ga0068865_100233232 3300006881 Bacteria 1445
174 Ga0075436_100046335 3300006914 Bacteria 2998
175 Ga0075436_100361909 3300006914 Bacteria 1047
176 Ga0097620_100227122 3300006931 Bacteria 1955
177 Ga0075435_100106665 3300007076 Bacteria 2326
178 Ga0075435_100147410 3300007076 Bacteria 1977
179 Ga0075435_100722467 3300007076 Bacteria 866
180 Ga0075435_100794031 3300007076 Bacteria 824
181 Ga0099795_10247292 3300007788 Bacteria 768
182 Ga0105240_10053208 3300009093 Bacteria 5084
183 Ga0105240_10132171 3300009093 Bacteria 2993
184 Ga0111539_10297055 3300009094 Bacteria 1880
185 Ga0105245_10022340 3300009098 Bacteria 5553
186 Ga0105245_10087652 3300009098 Bacteria 2857
187 Ga0105245_10130395 3300009098 Bacteria 2357
188 Ga0105245_10273982 3300009098 Bacteria 1647
189 Ga0105245_10490782 3300009098 Bacteria 1243
190 Ga0105245_10523505 3300009098 Bacteria 1205
191 Ga0105245_10588509 3300009098 Bacteria 1138
192 Ga0105245_11770122 3300009098 Bacteria 670
193 Ga0105247_10018625 3300009101 Bacteria 4167
194 Ga0105247_11506430 3300009101 Bacteria 549
195 Ga0114129_10067445 3300009147 Bacteria 4990
196 Ga0114129_10252621 3300009147 Bacteria 2366
197 Ga0114129_10315344 3300009147 Bacteria 2080
198 Ga0114129_10720593 3300009147 Bacteria 1280
199 Ga0114129_11402432 3300009147 Bacteria 862
200 Ga0114129_11810409 3300009147 Bacteria 742
201 Ga0105243_10121676 3300009148 Bacteria 2201
202 Ga0105243_10451799 3300009148 Bacteria 1206
203 Ga0105241_10042368 3300009174 Bacteria 3443
204 Ga0105241_10131538 3300009174 Bacteria 2027
205 Ga0105241_10190465 3300009174 Bacteria 1707
206 Ga0105242_10150103 3300009176 Bacteria 2031
207 Ga0105242_10296813 3300009176 Bacteria 1473
208 Ga0105242_10302755 3300009176 Bacteria 1460
209 Ga0105242_10784195 3300009176 Bacteria 942
210 Ga0105248_10215622 3300009177 Bacteria 2162
211 Ga0105248_10226015 3300009177 Bacteria 2107
212 Ga0105248_10458662 3300009177 Bacteria 1437
213 Ga0105248_11103642 3300009177 Bacteria 897
214 Ga0105237_10050489 3300009545 Bacteria 4179
215 Ga0105238_10305213 3300009551 Bacteria 1576
216 Ga0105238_10457584 3300009551 Bacteria 1273
217 Ga0105238_10796794 3300009551 Bacteria 960
218 Ga0105238_10827683 3300009551 Bacteria 942
219 Ga0105249_10014061 3300009553 Bacteria 7075
220 Ga0105249_11516808 3300009553 Bacteria 743
221 Ga0105239_10306154 3300010375 Bacteria 1790
222 Ga0105239_10477830 3300010375 Bacteria 1416
223 Ga0105239_10678086 3300010375 Bacteria 1178
224 Ga0105246_10096802 3300011119 Bacteria 2140
225 Ga0105246_10167261 3300011119 Bacteria 1681
226 Ga0157373_10081015 3300013100 Bacteria 2289
227 Ga0157373_10350753 3300013100 Bacteria 1053
228 Ga0157373_10367032 3300013100 Bacteria 1028
229 Ga0157373_10424928 3300013100 Bacteria 954
230 Ga0157373_10953659 3300013100 Bacteria 638
231 Ga0157371_10070716 3300013102 Bacteria 2470
232 Ga0157371_10378605 3300013102 Bacteria 1033
233 Ga0157371_10719588 3300013102 Bacteria 748
234 Ga0157370_10069449 3300013104 Bacteria 3327
235 Ga0157370_10184027 3300013104 Bacteria 1940
236 Ga0157370_10477258 3300013104 Bacteria 1146
237 Ga0157370_10517857 3300013104 Bacteria 1095
238 Ga0157369_10075073 3300013105 Bacteria 3625
239 Ga0157369_10160592 3300013105 Bacteria 2372
240 Ga0157369_10327266 3300013105 Bacteria 1592
241 Ga0157369_10351160 3300013105 Unclassified 1532
242 Ga0157369_10554559 3300013105 Bacteria 1188
243 Ga0157369_10906191 3300013105 Archaea 904
244 Ga0157369_11024689 3300013105 Bacteria 845
245 Ga0157374_10039944 3300013296 Bacteria 4320
246 Ga0157374_10093305 3300013296 Bacteria 2874
247 Ga0157374_10699746 3300013296 Bacteria 1026
248 Ga0157378_10105188 3300013297 Bacteria 2580
249 Ga0157372_10212225 3300013307 Bacteria 2243
250 Ga0157372_10345801 3300013307 Bacteria 1733
251 Ga0157372_10655564 3300013307 Bacteria 1222
252 Ga0157372_10766362 3300013307 Bacteria 1122
253 Ga0157372_10767644 3300013307 Bacteria 1121
254 Ga0157372_12223446 3300013307 Bacteria 630
255 Ga0157375_10057988 3300013308 Bacteria 3829
256 Ga0157375_11184822 3300013308 Bacteria 896
257 Ga0157380_10021024 3300014326 Bacteria 4889
258 Ga0182008_10079629 3300014497 Bacteria 1612
259 Ga0182008_10152412 3300014497 Bacteria 1160
260 Ga0157377_10003961 3300014745 Bacteria 6752
261 Ga0157377_10358249 3300014745 Bacteria 981
262 Ga0157379_10522780 3300014968 Bacteria 1102
263 Ga0157376_10053378 3300014969 Bacteria 3365
264 Ga0157376_10116057 3300014969 Bacteria 2364
265 Ga0157376_11346031 3300014969 Bacteria 745
266 Ga0182006_1118157 3300015261 Bacteria 924
267 Ga0182006_1130787 3300015261 Bacteria 864
268 Ga0163161_10150015 3300017792 Bacteria 1771
269 Ga0197907_11093402 3300020069 Bacteria 2661
270 Ga0206356_10416366 3300020070 Bacteria 645
271 Ga0206356_11466129 3300020070 Bacteria 680
272 Ga0206356_11562056 3300020070 Bacteria 1523
273 Ga0206349_1562762 3300020075 Bacteria 546
274 Ga0206354_10956547 3300020081 Bacteria 1123
275 Ga0206354_11132402 3300020081 Bacteria 1177
276 Ga0206354_11399885 3300020081 Bacteria 3652
277 Ga0206353_10006983 3300020082 Bacteria 1917
278 Ga0206353_11073345 3300020082 Bacteria 1121
279 Ga0206353_11081997 3300020082 Bacteria 1239
280 Ga0206353_11281008 3300020082 Bacteria 8162
281 Ga0224712_10269621 3300022467 Bacteria 790
282 Ga0224712_10368756 3300022467 Bacteria 681
283 Ga0224712_10597468 3300022467 Bacteria 539
284 Ga0207653_10027132 3300025885 Bacteria 1838
285 Ga0207692_10005665 3300025898 Bacteria 5014
286 Ga0207692_10154895 3300025898 Bacteria 1315
287 Ga0207642_10016067 3300025899 Bacteria 2809
288 Ga0207710_10029092 3300025900 Bacteria 2402
289 Ga0207688_10049727 3300025901 Bacteria 2344
290 Ga0207688_10723464 3300025901 Bacteria 630
291 Ga0207680_10365578 3300025903 Bacteria 1015
292 Ga0207647_10053456 3300025904 Bacteria 2489
293 Ga0207647_10181781 3300025904 Bacteria 1221
294 Ga0207685_10000925 3300025905 Bacteria 5603
295 Ga0207685_10060928 3300025905 Bacteria 1494
296 Ga0207699_10005147 3300025906 Bacteria 6262
297 Ga0207699_10917393 3300025906 Bacteria 646
298 Ga0207643_10367966 3300025908 Bacteria 905
299 Ga0207705_10057765 3300025909 Bacteria 2799
300 Ga0207705_10203997 3300025909 Bacteria 1498
301 Ga0207705_11079779 3300025909 Bacteria 619
302 Ga0207684_10521210 3300025910 Bacteria 1018
303 Ga0207654_10389101 3300025911 Bacteria 967
304 Ga0207707_10014650 3300025912 Bacteria 6832
305 Ga0207707_10061659 3300025912 Bacteria 3263
306 Ga0207707_10078672 3300025912 Bacteria 2880
307 Ga0207707_10093608 3300025912 Bacteria 2625
308 Ga0207707_10328587 3300025912 Bacteria 1319
309 Ga0207707_10371714 3300025912 Bacteria 1230
310 Ga0207707_10602573 3300025912 Bacteria 930
311 Ga0207707_10848421 3300025912 Bacteria 758
312 Ga0207695_10026136 3300025913 Bacteria 6519
313 Ga0207695_10062357 3300025913 Bacteria 3849
314 Ga0207693_10000860 3300025915 Bacteria 27073
315 Ga0207693_10004312 3300025915 Bacteria 12042
316 Ga0207693_10044202 3300025915 Bacteria 3501
317 Ga0207693_10241875 3300025915 Bacteria 1417
318 Ga0207663_10006640 3300025916 Bacteria 5944
319 Ga0207663_10118065 3300025916 Bacteria 1811
320 Ga0207663_10148746 3300025916 Bacteria 1640
321 Ga0207663_10225357 3300025916 Bacteria 1366
322 Ga0207663_10974781 3300025916 Bacteria 679
323 Ga0207660_10064459 3300025917 Bacteria 2645
324 Ga0207660_10274671 3300025917 Bacteria 1336
325 Ga0207660_10453966 3300025917 Bacteria 1037
326 Ga0207660_10735733 3300025917 Bacteria 805
327 Ga0207657_10025169 3300025919 Bacteria 5493
328 Ga0207657_10042837 3300025919 Bacteria 3991
329 Ga0207657_10136434 3300025919 Bacteria 2007
330 Ga0207657_10333579 3300025919 Bacteria 1198
331 Ga0207657_10377105 3300025919 Bacteria 1117
332 Ga0207657_10379853 3300025919 Bacteria 1113
333 Ga0207657_10418825 3300025919 Bacteria 1053
334 Ga0207649_10072216 3300025920 Bacteria 2207
335 Ga0207652_10327356 3300025921 Bacteria 1383
336 Ga0207652_10359706 3300025921 Bacteria 1314
337 Ga0207652_10864184 3300025921 Bacteria 800
338 Ga0207652_10864532 3300025921 Bacteria 800
339 Ga0207652_10876554 3300025921 Bacteria 794
340 Ga0207652_10976962 3300025921 Bacteria 745
341 Ga0207652_11120231 3300025921 Bacteria 688
342 Ga0207652_11449402 3300025921 Bacteria 590
343 Ga0207646_10005438 3300025922 Bacteria 13400
344 Ga0207646_10030202 3300025922 Bacteria 4916
345 Ga0207646_10682508 3300025922 Bacteria 919
346 Ga0207694_10015264 3300025924 Bacteria 5795
347 Ga0207694_10171558 3300025924 Bacteria 1756
348 Ga0207694_10425771 3300025924 Bacteria 1106
349 Ga0207694_10714524 3300025924 Bacteria 845
350 Ga0207659_10446433 3300025926 Bacteria 1089
351 Ga0207687_10050927 3300025927 Bacteria 2885
352 Ga0207687_10211193 3300025927 Bacteria 1523
353 Ga0207687_10341195 3300025927 Bacteria 1218
354 Ga0207687_10474474 3300025927 Bacteria 1041
355 Ga0207687_10523915 3300025927 Bacteria 992
356 Ga0207700_10039800 3300025928 Bacteria 3425
357 Ga0207700_10400851 3300025928 Bacteria 1202
358 Ga0207664_10015153 3300025929 Bacteria 5587
359 Ga0207664_10035134 3300025929 Bacteria 3865
360 Ga0207664_10050563 3300025929 Bacteria 3278
361 Ga0207664_10059772 3300025929 Bacteria 3037
362 Ga0207664_10166709 3300025929 Bacteria 1882
363 Ga0207664_10205090 3300025929 Bacteria 1703
364 Ga0207664_10229091 3300025929 Bacteria 1614
365 Ga0207664_10383241 3300025929 Bacteria 1248
366 Ga0207664_10431408 3300025929 Bacteria 1175
367 Ga0207664_11876071 3300025929 Bacteria 522
368 Ga0207644_10049049 3300025931 Bacteria 3021
369 Ga0207644_10326362 3300025931 Bacteria 1242
370 Ga0207690_10109203 3300025932 Bacteria 1989
371 Ga0207690_10144013 3300025932 Bacteria 1759
372 Ga0207690_10174389 3300025932 Bacteria 1613
373 Ga0207690_11369143 3300025932 Bacteria 592
374 Ga0207706_10264510 3300025933 Bacteria 1501
375 Ga0207686_10047158 3300025934 Bacteria 2662
376 Ga0207686_10344699 3300025934 Bacteria 1120
377 Ga0207686_10605421 3300025934 Bacteria 863
378 Ga0207686_11058438 3300025934 Bacteria 660
379 Ga0207709_10001472 3300025935 Bacteria 16327
380 Ga0207709_10633159 3300025935 Bacteria 850
381 Ga0207670_10500729 3300025936 Bacteria 986
382 Ga0207670_10781250 3300025936 Archaea 795
383 Ga0207669_10262640 3300025937 Bacteria 1292
384 Ga0207704_10009369 3300025938 Bacteria 4723
385 Ga0207704_10030898 3300025938 Bacteria 3010
386 Ga0207665_10000070 3300025939 Bacteria 66142
387 Ga0207665_10383881 3300025939 Bacteria 1067
388 Ga0207665_11155525 3300025939 Bacteria 617
389 Ga0207691_10026395 3300025940 Bacteria 5450
390 Ga0207711_10149353 3300025941 Bacteria 2108
391 Ga0207711_10341355 3300025941 Bacteria 1386
392 Ga0207711_10530542 3300025941 Bacteria 1098
393 Ga0207661_10039266 3300025944 Bacteria 3714
394 Ga0207661_10050622 3300025944 Bacteria 3310
395 Ga0207661_10204434 3300025944 Bacteria 1738
396 Ga0207679_10035943 3300025945 Bacteria 3509
397 Ga0207667_10241656 3300025949 Bacteria 1848
398 Ga0207667_10404213 3300025949 Bacteria 1390
399 Ga0207667_10473051 3300025949 Bacteria 1272
400 Ga0207667_10960821 3300025949 Bacteria 843
401 Ga0207667_11112171 3300025949 Bacteria 773
402 Ga0207712_10109438 3300025961 Bacteria 2070
403 Ga0207712_10380368 3300025961 Bacteria 1181
404 Ga0207668_11119590 3300025972 Bacteria 706
405 Ga0207677_10018592 3300026023 Bacteria 4173
406 Ga0207677_10231400 3300026023 Bacteria 1489
407 Ga0207677_11446935 3300026023 Unclassified 634
408 Ga0207639_10163601 3300026041 Bacteria 1877
409 Ga0207639_10539286 3300026041 Bacteria 1070
410 Ga0207678_10047021 3300026067 Bacteria 3732
411 Ga0207678_10246409 3300026067 Bacteria 1530
412 Ga0207708_10000913 3300026075 Bacteria 22178
413 Ga0207702_10081538 3300026078 Bacteria 2810
414 Ga0207702_10301959 3300026078 Bacteria 1520
415 Ga0207702_10717867 3300026078 Bacteria 985
416 Ga0207702_11541908 3300026078 Bacteria 658
417 Ga0207641_10207834 3300026088 Bacteria 1809
418 Ga0207641_10286333 3300026088 Bacteria 1552
419 Ga0207648_10000540 3300026089 Bacteria 42191
420 Ga0207648_10543977 3300026089 Bacteria 1066
421 Ga0207676_10551968 3300026095 Bacteria 1101
422 Ga0207674_10612019 3300026116 Bacteria 1052
423 Ga0207675_100015908 3300026118 Bacteria 7017
424 Ga0207683_10000587 3300026121 Bacteria 33514
425 Ga0207683_10008984 3300026121 Bacteria 8513
426 Ga0207683_10067372 3300026121 Bacteria 3158
427 Ga0207683_10580500 3300026121 Bacteria 1037
428 Ga0207683_10802018 3300026121 Bacteria 874
429 Ga0207698_10051379 3300026142 Bacteria 3151
430 Ga0207698_10464943 3300026142 Bacteria 1224
431 Ga0207698_10916821 3300026142 Bacteria 884
432 Ga0207428_10356841 3300027907 Bacteria 1075
433 Ga0268264_10048639 3300028381 Bacteria 3528
434 Ga0265337_1034958 3300028556 Bacteria 1475
435 Ga0265326_10052270 3300028558 Bacteria 1157
436 Ga0265326_10083143 3300028558 Bacteria 905
437 Ga0265319_1018082 3300028563 Bacteria 2666
438 Ga0265319_1024126 3300028563 Bacteria 2193
439 Ga0265319_1053860 3300028563 Bacteria 1320
440 Ga0265334_10019415 3300028573 Bacteria 2796
441 Ga0265334_10022996 3300028573 Bacteria 2538
442 Ga0265334_10180159 3300028573 Bacteria 738
443 Ga0265318_10004780 3300028577 Bacteria 6485
444 Ga0265318_10023055 3300028577 Bacteria 2484
445 Ga0265323_10200907 3300028653 Bacteria 627
446 Ga0265322_10037177 3300028654 Bacteria 1387
447 Ga0265336_10006870 3300028666 Bacteria 4074
448 Ga0265338_10004412 3300028800 Bacteria 19025
449 Ga0265338_10008321 3300028800 Bacteria 12619
450 Ga0265338_10015365 3300028800 Bacteria 8416
451 Ga0265338_10033767 3300028800 Bacteria 4958
452 Ga0265338_10325964 3300028800 Bacteria 1110
453 Ga0265338_10742252 3300028800 Bacteria 675
454 Ga0265330_10046868 3300031235 Bacteria 1903
455 Ga0265330_10145155 3300031235 Bacteria 1009
456 Ga0265332_10101710 3300031238 Bacteria 1212
457 Ga0265320_10004939 3300031240 Bacteria 8654
458 Ga0265320_10313680 3300031240 Bacteria 693
459 Ga0265325_10040329 3300031241 Bacteria 2452
460 Ga0265325_10072684 3300031241 Bacteria 1723
461 Ga0265329_10016002 3300031242 Bacteria 2608
462 Ga0265340_10012337 3300031247 Bacteria 4515
463 Ga0265340_10230654 3300031247 Bacteria 828
464 Ga0265339_10175154 3300031249 Bacteria 1071
465 Ga0265327_10084052 3300031251 Bacteria 1565
466 Ga0265327_10098284 3300031251 Bacteria 1416
467 Ga0265327_10121281 3300031251 Bacteria 1238
468 Ga0265327_10144496 3300031251 Bacteria 1109
469 Ga0265316_10004106 3300031344 Bacteria 14579
470 Ga0265316_10010660 3300031344 Bacteria 8355
471 Ga0265313_10006856 3300031595 Bacteria 7941
472 Ga0265314_10006499 3300031711 Bacteria 10333
473 Ga0265314_10028327 3300031711 Bacteria 4177
474 Ga0265314_10039527 3300031711 Bacteria 3396
475 Ga0265342_10033203 3300031712 Bacteria 3175
476 Ga0373934_0268851 3300035086 Bacteria 706
477 Ga0373941_0216203 3300035115 Unclassified 735
478 Ga0373941_0307850 3300035115 Bacteria 634
479 Ga0373953_0547168 3300035117 Bacteria 515
480 Ga0373954_0161668 3300035118 Bacteria 1096
481 Ga0373956_0056197 3300035119 Bacteria 1776
482 Ga0373960_0036954 3300035121 Bacteria 1394
483 Ga0373943_0181868 3300035170 Bacteria 1156
484 Ga0373955_0169132 3300035172 Bacteria 1293
485 Ga0373961_0203278 3300035241 Bacteria 700
486 Ga0373962_0092917 3300035242 Bacteria 932
487 Ga0373924_0230442 3300035410 Bacteria 819
488 Ga0373931_0280972 3300035691 Bacteria 1022
489 Ga0373931_0676639 3300035691 Bacteria 680
490 Ga0373927_0597580 3300035695 Bacteria 729
491 Ga0373927_0801886 3300035695 Bacteria 622
492 Ga0373947_0052627 3300035725 Bacteria 2453
493 Ga0373947_0079127 3300035725 Bacteria 2031
494 Ga0373947_0115982 3300035725 Bacteria 1698
495 Ga0373947_0777108 3300035725 Bacteria 654
496 Ga0373937_0032363 3300036401 Bacteria 4743
497 Ga0373937_0122282 3300036401 Bacteria 2426
498 Ga0373925_0734677 3300037068 Bacteria 814
499 Ga0395899_0020210 3300037312 Bacteria 5053
500 Ga0395899_0098323 3300037312 Bacteria 2114
501 Ga0395899_0241490 3300037312 Bacteria 1243
502 Ga0395899_0329322 3300037312 Bacteria 1027
503 Ga0395899_0492201 3300037312 Bacteria 797
504 Ga0395899_0527732 3300037312 Bacteria 762
505 Ga0395899_0652548 3300037312 Bacteria 665
506 Ga0395900_0001846 3300037418 Bacteria 24148
507 Ga0395900_0008531 3300037418 Bacteria 10532
508 Ga0395900_0014289 3300037418 Bacteria 8103
509 Ga0395900_0027207 3300037418 Bacteria 5856
510 Ga0395900_0043023 3300037418 Bacteria 4653
511 Ga0395900_0115199 3300037418 Bacteria 2758
512 Ga0395900_0243644 3300037418 Bacteria 1802
513 Ga0395900_0300856 3300037418 Bacteria 1590
514 Ga0395900_0373287 3300037418 Bacteria 1396
515 Ga0395900_0814163 3300037418 Unclassified 861
516 Ga0395898_0002591 3300037466 Bacteria 21125
517 Ga0395898_0006502 3300037466 Bacteria 12484
518 Ga0395898_0011007 3300037466 Bacteria 9426
519 Ga0395898_0013777 3300037466 Bacteria 8313
520 Ga0395898_0021795 3300037466 Bacteria 6492
521 Ga0395898_0044897 3300037466 Bacteria 4345
522 Ga0395898_0076736 3300037466 Bacteria 3226
523 Ga0395898_0102591 3300037466 Bacteria 2746
524 Ga0395898_0289405 3300037466 Bacteria 1563
525 Ga0395898_0290322 3300037466 Unclassified 1560
526 Ga0395898_0780906 3300037466 Bacteria 896
527 Ga0395898_0851442 3300037466 Bacteria 851
528 Ga0395898_1140795 3300037466 Bacteria 712
529 Ga0395898_1223196 3300037466 Bacteria 682
530 Ga0395898_1393963 3300037466 Bacteria 629
531 Ga0395898_1633523 3300037466 Bacteria 568
532 Ga0395905_0011076 3300037471 Bacteria 8729
533 Ga0395905_0011571 3300037471 Bacteria 8523
534 Ga0395905_0012069 3300037471 Bacteria 8326
535 Ga0395905_0025234 3300037471 Bacteria 5606
536 Ga0395905_0036388 3300037471 Bacteria 4623
537 Ga0395905_0058801 3300037471 Bacteria 3594
538 Ga0395905_0107338 3300037471 Bacteria 2621
539 Ga0395905_0949864 3300037471 Bacteria 763
540 Ga0395905_1225302 3300037471 Bacteria 654
541 Ga0395905_1394936 3300037471 Bacteria 605
542 Ga0395901_0009419 3300038443 Bacteria 9911
543 Ga0395901_0035205 3300038443 Bacteria 5173
544 Ga0395901_0045082 3300038443 Bacteria 4575
545 Ga0395901_0056424 3300038443 Bacteria 4085
546 Ga0395901_0072296 3300038443 Bacteria 3595
547 Ga0395901_0099220 3300038443 Bacteria 3054
548 Ga0395901_0138437 3300038443 Bacteria 2558
549 Ga0395901_0290117 3300038443 Bacteria 1698
550 Ga0395901_0387994 3300038443 Unclassified 1436
551 Ga0395901_0403445 3300038443 Bacteria 1404
552 Ga0395901_0856634 3300038443 Bacteria 894
553 Ga0395901_0971202 3300038443 Bacteria 827
554 Ga0395901_1097619 3300038443 Bacteria 766
555 Ga0395901_1646324 3300038443 Bacteria 594
556 Ga0436365_1518340 3300039437 Bacteria 1741
557 Ga0436360_0821888 3300039438 Bacteria 760
558 Ga0436363_1007763 3300039450 Bacteria 644
559 Ga0466969_0000426 3300044656 Bacteria 23045
560 Ga0466969_0038385 3300044656 Bacteria 2410
561 Ga0466972_0415790 3300044658 Bacteria 631
562 Ga0466965_0037696 3300044683 Bacteria 2374
563 Ga0466966_0058831 3300044684 Bacteria 2428
564 Ga0466966_0060183 3300044684 Bacteria 2397
565 Ga0466966_0196367 3300044684 Bacteria 1222
566 Ga0466961_0049628 3300044693 Bacteria 2682
567 Ga0466961_0051433 3300044693 Bacteria 2631
568 Ga0466961_0278520 3300044693 Bacteria 1024
569 Ga0466963_0002057 3300044694 Bacteria 11097
570 Ga0466963_0003865 3300044694 Bacteria 8646
571 Ga0466963_0007214 3300044694 Bacteria 6626
572 Ga0466963_0023648 3300044694 Bacteria 3905
573 Ga0466963_0025653 3300044694 Bacteria 3761
574 Ga0466963_0035965 3300044694 Bacteria 3228
575 Ga0466963_0119688 3300044694 Bacteria 1811
576 Ga0466963_0134680 3300044694 Bacteria 1709
577 Ga0466963_0172550 3300044694 Bacteria 1508
578 Ga0466963_0188851 3300044694 Bacteria 1439
579 Ga0466963_0210912 3300044694 Bacteria 1359
580 Ga0466963_0293165 3300044694 Bacteria 1144
581 Ga0466963_0423416 3300044694 Bacteria 939
582 Ga0466963_0505373 3300044694 Bacteria 853
583 Ga0466963_0615895 3300044694 Bacteria 766
584 Ga0466963_0877495 3300044694 Bacteria 632
585 Ga0466963_0940072 3300044694 Bacteria 609
586 Ga0466964_0003099 3300044706 Bacteria 6048
587 Ga0466964_0046814 3300044706 Bacteria 1764
588 Ga0466964_0068356 3300044706 Bacteria 1496
589 Ga0466964_0088440 3300044706 Unclassified 1344
590 Ga0466964_0308112 3300044706 Bacteria 800
591 Ga0466964_0418767 3300044706 Bacteria 704
592 Ga0466971_0040475 3300044719 Bacteria 2093
593 Ga0466971_0047179 3300044719 Bacteria 1936
594 Ga0466971_0055987 3300044719 Bacteria 1778
595 Ga0466971_0327410 3300044719 Bacteria 739
596 Ga0466971_0360093 3300044719 Bacteria 705
597 Ga0466971_0416333 3300044719 Bacteria 656
598 Ga0466968_0001254 3300044735 Bacteria 9025
599 Ga0466968_0024225 3300044735 Bacteria 2478
600 Ga0466968_0069422 3300044735 Bacteria 1532
601 Ga0466970_0060959 3300044765 Bacteria 2020
602 Ga0466957_0003337 3300044842 Bacteria 8801
603 Ga0466957_0061965 3300044842 Bacteria 2297
604 Ga0466957_0194949 3300044842 Bacteria 1328
605 Ga0466957_0235426 3300044842 Unclassified 1213
606 Ga0466957_0353344 3300044842 Bacteria 997
607 Ga0466957_0387881 3300044842 Bacteria 953
608 Ga0466957_0778631 3300044842 Bacteria 679
609 Ga0466957_1187654 3300044842 Bacteria 552
610 Ga0466959_0003554 3300045049 Bacteria 10250
611 Ga0466959_0129925 3300045049 Bacteria 1785
612 Ga0466959_0238404 3300045049 Bacteria 1257
613 Ga0466959_0601690 3300045049 Bacteria 739
614 Ga0466959_0763149 3300045049 Bacteria 647
615 Ga0466958_0005596 3300045836 Bacteria 6779
616 Ga0466958_0010267 3300045836 Bacteria 5241
617 Ga0466958_0014926 3300045836 Bacteria 4441
618 Ga0466958_0024973 3300045836 Bacteria 3519
619 Ga0466958_0030443 3300045836 Bacteria 3206
620 Ga0466958_0123278 3300045836 Bacteria 1623
621 Ga0466958_0141662 3300045836 Bacteria 1514
622 Ga0466958_0143179 3300045836 Bacteria 1506
623 Ga0466958_0349405 3300045836 Bacteria 952
624 Ga0466967_0003895 3300045976 Bacteria 9904
625 Ga0466967_0007111 3300045976 Bacteria 8031
626 Ga0466967_0011497 3300045976 Bacteria 6710
627 Ga0466967_0056803 3300045976 Bacteria 3453
628 Ga0466967_0086292 3300045976 Bacteria 2843
629 Ga0466967_0108686 3300045976 Bacteria 2545
630 Ga0466967_0117327 3300045976 Bacteria 2453
631 Ga0466967_0158405 3300045976 Bacteria 2123
632 Ga0466967_0183132 3300045976 Bacteria 1976
633 Ga0466967_0207794 3300045976 Bacteria 1856
634 Ga0466967_0246677 3300045976 Bacteria 1704
635 Ga0466967_0327619 3300045976 Bacteria 1478
636 Ga0466967_0378442 3300045976 Bacteria 1374
637 Ga0466967_0513827 3300045976 Bacteria 1176
638 Ga0466967_0518206 3300045976 Bacteria 1171
639 Ga0466967_0559520 3300045976 Bacteria 1126
640 Ga0466967_1002852 3300045976 Bacteria 831
641 Ga0466967_1501477 3300045976 Bacteria 671
642 Ga0495592_0000660 3300046454 Bacteria 23996
643 Ga0495592_0105262 3300046454 Bacteria 2004
644 Ga0495592_0593767 3300046454 Bacteria 676
645 Ga0495591_179963 3300046458 Bacteria 504
646 Ga0495629_0040254 3300046459 Bacteria 3288
647 Ga0495629_0958021 3300046459 Bacteria 559
648 Ga0495629_1071117 3300046459 Bacteria 522
649 Ga0495641_0068395 3300046461 Bacteria 1597
650 Ga0495641_0316249 3300046461 Bacteria 704
651 Ga0495651_0000034 3300046462 Bacteria 99213
652 Ga0495651_0092884 3300046462 Bacteria 2260
653 Ga0495653_0004267 3300046463 Bacteria 11577
654 Ga0495653_0078694 3300046463 Bacteria 2444
655 Ga0495580_0176297 3300046472 Bacteria 1477
656 Ga0495582_0191143 3300046473 Unclassified 1168
657 Ga0495582_0409476 3300046473 Bacteria 782
658 Ga0495582_0478393 3300046473 Bacteria 720
659 Ga0495639_0019026 3300046475 Bacteria 2995
660 Ga0495664_0686478 3300046477 Bacteria 605
661 Ga0495608_0003358 3300046511 Bacteria 11447
662 Ga0495608_0035925 3300046511 Bacteria 3338
663 Ga0495608_0194214 3300046511 Bacteria 1281
664 Ga0495618_0002980 3300046514 Bacteria 10705
665 Ga0495618_0131228 3300046514 Bacteria 1603
666 Ga0495618_0381564 3300046514 Bacteria 865
667 Ga0495628_0000184 3300046516 Bacteria 54832
668 Ga0495628_0276219 3300046516 Bacteria 1249
669 Ga0495628_0719723 3300046516 Bacteria 704
670 Ga0495630_0027552 3300046517 Bacteria 4217
671 Ga0495630_0221813 3300046517 Bacteria 1443
672 Ga0495630_0309735 3300046517 Bacteria 1207
673 Ga0495630_0465347 3300046517 Bacteria 969
674 Ga0495630_0839706 3300046517 Unclassified 701
675 Ga0495644_0002395 3300046523 Bacteria 7482
676 Ga0495644_0054024 3300046523 Bacteria 1509
677 Ga0495663_0056215 3300046525 Bacteria 1229
678 Ga0495642_0009669 3300046528 Bacteria 3689
679 Ga0495642_0041870 3300046528 Bacteria 1864
680 Ga0495652_0000319 3300046529 Bacteria 56845
681 Ga0495652_0148172 3300046529 Bacteria 1837
682 Ga0495640_0278178 3300046533 Bacteria 1043
683 Ga0495640_0420573 3300046533 Bacteria 819
684 Ga0495586_0014499 3300046535 Bacteria 4186
685 Ga0495586_0337734 3300046535 Bacteria 865
686 Ga0495587_0001086 3300046536 Bacteria 17851
687 Ga0495645_0000646 3300046543 Bacteria 24016
688 Ga0495645_0281181 3300046543 Bacteria 1094
689 Ga0495667_0048661 3300046559 Bacteria 2799
690 Ga0495667_0127345 3300046559 Bacteria 1643
691 Ga0495656_0216783 3300046615 Bacteria 956
692 Ga0495634_0049222 3300046642 Bacteria 2835
693 Ga0495634_0057751 3300046642 Bacteria 2589
694 Ga0495634_0061667 3300046642 Bacteria 2492
695 Ga0495634_0292093 3300046642 Bacteria 987
696 Ga0495611_0055720 3300046648 Bacteria 1789
697 Ga0495635_0037446 3300046663 Bacteria 3358
698 Ga0495635_0124509 3300046663 Bacteria 1758
699 Ga0495635_0709573 3300046663 Bacteria 652
700 Ga0495659_0330892 3300046664 Bacteria 648
701 Ga0495659_0356459 3300046664 Bacteria 626
702 Ga0495588_0041289 3300046674 Bacteria 2355
703 Ga0495657_0081837 3300046675 Bacteria 2087
704 Ga0495599_0000227 3300046678 Bacteria 35652
705 Ga0495623_0000601 3300046679 Bacteria 23980
706 Ga0495623_0093757 3300046679 Bacteria 1838
707 Ga0495646_0005450 3300046680 Bacteria 8044
708 Ga0495646_0444953 3300046680 Bacteria 670
709 Ga0495658_0032280 3300046683 Bacteria 2858
710 Ga0495658_0145090 3300046683 Bacteria 1454
711 Ga0495658_1115928 3300046683 Bacteria 503
712 Ga0495613_0047381 3300046689 Bacteria 3176
713 Ga0495613_0098497 3300046689 Bacteria 2113
714 Ga0495613_0247154 3300046689 Bacteria 1246
715 Ga0495613_0560334 3300046689 Bacteria 764
716 Ga0495624_0008996 3300046690 Bacteria 6941
717 Ga0495670_0029542 3300046691 Bacteria 2721
718 Ga0495589_0147151 3300046794 Bacteria 1126
719 Ga0495600_0084236 3300046809 Bacteria 2075
720 Ga0495600_0365923 3300046809 Bacteria 901
721 Ga0495600_0702501 3300046809 Bacteria 608
722 Ga0495581_0160630 3300047315 Unclassified 1313
723 Ga0495581_0222917 3300047315 Bacteria 1103
724 Ga0495604_0000194 3300047317 Bacteria 54877
725 Ga0495636_0159082 3300047318 Bacteria 1017
726 Ga0495674_0129366 3300047319 Bacteria 2128
727 Ga0495674_0161060 3300047319 Bacteria 1877
728 Ga0495674_1028982 3300047319 Bacteria 630
729 Ga0495676_0097590 3300047321 Bacteria 2182
730 Ga0495676_0098405 3300047321 Bacteria 2170
731 Ga0495675_0000224 3300047444 Bacteria 40977
732 Ga0495675_0335262 3300047444 Bacteria 892
733 Ga0495677_0024362 3300047445 Bacteria 2195
734 Ga0495684_0091036 3300047471 Bacteria 2310
735 Ga0495602_0001529 3300048088 Bacteria 23007
736 Ga0495602_0050029 3300048088 Bacteria 3738
737 Ga0495602_0077204 3300048088 Bacteria 2819
738 Ga0495602_0374177 3300048088 Bacteria 1022
739 Ga0496100_0004406 3300048903 Bacteria 7460
740 Ga0496100_0010904 3300048903 Bacteria 5159
741 Ga0496100_0036671 3300048903 Bacteria 3095
742 Ga0496100_0096918 3300048903 Bacteria 2024
743 Ga0496100_0261178 3300048903 Bacteria 1284
744 Ga0496100_0593280 3300048903 Bacteria 860
745 Ga0496100_0922441 3300048903 Bacteria 686
746 Ga0496100_1338262 3300048903 Bacteria 565
747 Ga0496101_0004655 3300048904 Bacteria 8677
748 Ga0496101_0013017 3300048904 Bacteria 5567
749 Ga0496101_0022295 3300048904 Bacteria 4358
750 Ga0496101_0065400 3300048904 Bacteria 2651
751 Ga0496101_0070263 3300048904 Bacteria 2563
752 Ga0496101_0324417 3300048904 Bacteria 1208
753 Ga0496101_0507036 3300048904 Bacteria 953
754 Ga0496101_0703668 3300048904 Bacteria 798
755 Ga0496101_1044518 3300048904 Bacteria 642
756 Ga0496102_0014233 3300048905 Bacteria 6912
757 Ga0496102_0015692 3300048905 Bacteria 6600
758 Ga0496102_0040396 3300048905 Bacteria 4219
759 Ga0496102_0087213 3300048905 Bacteria 2883
760 Ga0496102_0091032 3300048905 Bacteria 2823
761 Ga0496102_0222108 3300048905 Bacteria 1781
762 Ga0496102_0325689 3300048905 Bacteria 1447
763 Ga0496102_0607800 3300048905 Bacteria 1016
764 Ga0496102_0753810 3300048905 Bacteria 896
765 Ga0496103_0005102 3300048906 Bacteria 7910
766 Ga0496103_0011172 3300048906 Bacteria 5316
767 Ga0496103_0131263 3300048906 Bacteria 1600
768 Ga0496103_0145971 3300048906 Bacteria 1514
769 Ga0496103_0326406 3300048906 Bacteria 987
770 Ga0496103_0330838 3300048906 Bacteria 980
771 Ga0496104_0000224 3300048907 Bacteria 49763
772 Ga0496104_0098359 3300048907 Bacteria 2801
773 Ga0496104_0156538 3300048907 Bacteria 2186
774 Ga0496104_0314481 3300048907 Bacteria 1479
775 Ga0496104_0341751 3300048907 Bacteria 1410
776 Ga0496104_0700693 3300048907 Bacteria 920
777 Ga0496104_1002596 3300048907 Bacteria 739
778 Ga0496105_0000234 3300048908 Bacteria 37704
779 Ga0496105_0014369 3300048908 Bacteria 6300
780 Ga0496105_0034363 3300048908 Bacteria 4169
781 Ga0496105_0067458 3300048908 Bacteria 2954
782 Ga0496105_0082597 3300048908 Bacteria 2654
783 Ga0496105_0095628 3300048908 Bacteria 2454
784 Ga0496105_0851581 3300048908 Bacteria 690
785 Ga0496106_0060402 3300048909 Bacteria 2873
786 Ga0496106_0088170 3300048909 Bacteria 2391
787 Ga0496106_0147127 3300048909 Bacteria 1856
788 Ga0496106_0201229 3300048909 Bacteria 1585
789 Ga0496106_0235686 3300048909 Bacteria 1462
790 Ga0496106_0524720 3300048909 Unclassified 951
791 Ga0496106_1056270 3300048909 Bacteria 637
792 Ga0496107_0000435 3300048910 Bacteria 22638
793 Ga0496107_0006765 3300048910 Bacteria 7889
794 Ga0496107_0045031 3300048910 Bacteria 3173
795 Ga0496107_0078783 3300048910 Bacteria 2401
796 Ga0496107_0273643 3300048910 Bacteria 1257
797 Ga0496107_0926941 3300048910 Bacteria 634
798 Ga0496108_0007844 3300048911 Bacteria 8653
799 Ga0496108_0022133 3300048911 Bacteria 5226
800 Ga0496108_0033148 3300048911 Bacteria 4291
801 Ga0496108_0052345 3300048911 Bacteria 3421
802 Ga0496108_0119478 3300048911 Bacteria 2260
803 Ga0496108_0780557 3300048911 Bacteria 825
804 Ga0496109_0004645 3300048912 Bacteria 11465
805 Ga0496109_0018197 3300048912 Bacteria 6169
806 Ga0496109_0027975 3300048912 Bacteria 5040
807 Ga0496109_0037958 3300048912 Bacteria 4353
808 Ga0496109_0046713 3300048912 Bacteria 3934
809 Ga0496109_0204706 3300048912 Bacteria 1855
810 Ga0496109_0272445 3300048912 Bacteria 1595
811 Ga0496109_0585632 3300048912 Bacteria 1051
812 Ga0496109_0616573 3300048912 Bacteria 1021
813 Ga0496109_0849628 3300048912 Bacteria 851
814 Ga0496109_1766047 3300048912 Bacteria 552
815 Ga0496110_0000673 3300048913 Bacteria 23454
816 Ga0496110_0003719 3300048913 Bacteria 11747
817 Ga0496110_0007404 3300048913 Bacteria 8763
818 Ga0496110_0313174 3300048913 Bacteria 1429
819 Ga0496110_0433791 3300048913 Bacteria 1197
820 Ga0496110_0578763 3300048913 Bacteria 1019
821 Ga0496110_0980618 3300048913 Bacteria 752
822 Ga0496111_0000552 3300048914 Bacteria 19441
823 Ga0496111_0009530 3300048914 Bacteria 6489
824 Ga0496111_0029188 3300048914 Bacteria 3916
825 Ga0496111_0047943 3300048914 Bacteria 3077
826 Ga0496111_0064617 3300048914 Bacteria 2655
827 Ga0496111_0131371 3300048914 Bacteria 1853
828 Ga0496111_0142552 3300048914 Bacteria 1776
829 Ga0496111_0213972 3300048914 Bacteria 1432
830 Ga0496111_0250445 3300048914 Bacteria 1315
831 Ga0496111_0684799 3300048914 Bacteria 746
832 Ga0496112_0003867 3300048915 Bacteria 12515
833 Ga0496112_0004943 3300048915 Bacteria 11416
834 Ga0496112_0033651 3300048915 Bacteria 4983
835 Ga0496112_0049478 3300048915 Bacteria 4121
836 Ga0496112_0143342 3300048915 Bacteria 2358
837 Ga0496112_0180748 3300048915 Bacteria 2073
838 Ga0496112_0202567 3300048915 Bacteria 1943
839 Ga0496112_0213173 3300048915 Bacteria 1888
840 Ga0496112_0289448 3300048915 Bacteria 1584
841 Ga0496112_0356507 3300048915 Bacteria 1405
842 Ga0496112_0403758 3300048915 Bacteria 1306
843 Ga0496112_0513059 3300048915 Bacteria 1134
844 Ga0496112_0721121 3300048915 Bacteria 924
845 Ga0496112_0964368 3300048915 Bacteria 773
846 Ga0496113_0047455 3300048916 Bacteria 3191
847 Ga0496113_0191855 3300048916 Bacteria 1622
848 Ga0496113_0195875 3300048916 Bacteria 1605
849 Ga0496113_0264475 3300048916 Bacteria 1374
850 Ga0496113_0870221 3300048916 Unclassified 714
851 Ga0496113_1350035 3300048916 Bacteria 553
852 Ga0496114_0001528 3300048917 Bacteria 17548
853 Ga0496114_0004933 3300048917 Bacteria 10399
854 Ga0496114_0014140 3300048917 Bacteria 6400
855 Ga0496114_0032392 3300048917 Bacteria 4302
856 Ga0496114_0042955 3300048917 Bacteria 3748
857 Ga0496114_0137760 3300048917 Bacteria 2111
858 Ga0496114_0170497 3300048917 Bacteria 1896
859 Ga0496114_0406498 3300048917 Bacteria 1206
860 Ga0496115_0012226 3300048918 Bacteria 6454
861 Ga0496115_0014610 3300048918 Bacteria 5947
862 Ga0496115_0038437 3300048918 Bacteria 3797
863 Ga0496115_0045147 3300048918 Bacteria 3517
864 Ga0496115_0402020 3300048918 Bacteria 1111
865 Ga0496115_1200902 3300048918 Bacteria 570
866 Ga0501031_0029292 3300049568 Bacteria 3592
867 Ga0501031_0058066 3300049568 Bacteria 2521
868 Ga0501031_0086916 3300049568 Bacteria 2039
869 Ga0501032_0108625 3300049569 Bacteria 1837
870 Ga0501033_0298984 3300049570 Bacteria 1133
871 Ga0501034_0051390 3300049571 Bacteria 4156
872 Ga0501036_0016451 3300049572 Bacteria 6177
873 Ga0501036_0808932 3300049572 Bacteria 771
874 Ga0501037_0147865 3300049573 Bacteria 1680
875 Ga0501038_0038082 3300049574 Bacteria 4212
876 Ga0501039_0005439 3300049575 Bacteria 9631
877 Ga0501039_0261039 3300049575 Bacteria 1361
878 Ga0501040_0000505 3300049576 Bacteria 23311
879 Ga0501040_0029003 3300049576 Bacteria 3733
880 Ga0501040_0039796 3300049576 Bacteria 3198
881 Ga0501040_0925850 3300049576 Bacteria 631
882 Ga0501041_0016294 3300049577 Bacteria 4418
883 Ga0501041_0022710 3300049577 Bacteria 3758
884 Ga0501042_0000909 3300049578 Bacteria 16557
885 Ga0501042_0389243 3300049578 Bacteria 1010
886 Ga0501042_1082245 3300049578 Bacteria 584
887 Ga0501043_0416971 3300049579 Bacteria 1013
888 Ga0501043_0575844 3300049579 Bacteria 834
889 Ga0501046_0593892 3300049580 Bacteria 786
890 Ga0501047_0405004 3300049581 Bacteria 1197
891 Ga0501048_0012035 3300049582 Bacteria 6447
892 Ga0501048_0040658 3300049582 Bacteria 3331
893 Ga0501067_0080769 3300049583 Bacteria 1802
894 Ga0501067_0400517 3300049583 Bacteria 765
895 Ga0501067_0780233 3300049583 Bacteria 538
896 Ga0501068_0070924 3300049584 Bacteria 2126
897 Ga0501068_0161904 3300049584 Bacteria 1410
898 Ga0501068_1004721 3300049584 Bacteria 550
899 Ga0501069_0092763 3300049585 Bacteria 1708
900 Ga0501070_0268219 3300049586 Bacteria 1394
901 Ga0501070_0408439 3300049586 Bacteria 1098
902 Ga0501070_0610159 3300049586 Bacteria 869
903 Ga0501070_0913706 3300049586 Bacteria 684
904 Ga0501071_0005439 3300049587 Bacteria 8185
905 Ga0501071_0009020 3300049587 Bacteria 6621
906 Ga0501072_0000190 3300049588 Bacteria 44606
907 Ga0501072_0039548 3300049588 Bacteria 3703
908 Ga0501072_0087765 3300049588 Bacteria 2468
909 Ga0501072_0270955 3300049588 Bacteria 1351
910 Ga0501072_0423189 3300049588 Bacteria 1055
911 Ga0501072_0592595 3300049588 Bacteria 874
912 Ga0501073_0107665 3300049589 Bacteria 1934
913 Ga0501073_0147332 3300049589 Bacteria 1631
914 Ga0501073_0304600 3300049589 Bacteria 1099
915 Ga0501074_0039059 3300049590 Bacteria 3438
916 Ga0501074_0104613 3300049590 Bacteria 2026
917 Ga0501074_0361816 3300049590 Bacteria 1029
918 Ga0501074_0916428 3300049590 Bacteria 617
919 Ga0501075_0000311 3300049591 Bacteria 27242
920 Ga0501075_0014013 3300049591 Bacteria 5739
921 Ga0501075_0305852 3300049591 Bacteria 1211
922 Ga0501076_0000336 3300049592 Bacteria 28961
923 Ga0501076_0040018 3300049592 Bacteria 3682
924 Ga0501076_0136331 3300049592 Bacteria 1992
925 Ga0501077_0004089 3300049593 Bacteria 8806
926 Ga0501077_0067518 3300049593 Bacteria 2267
927 Ga0501079_0000420 3300049741 Bacteria 27607
928 Ga0501079_0100848 3300049741 Bacteria 2238
929 Ga0501079_0127770 3300049741 Bacteria 1977
930 Ga0501079_0157308 3300049741 Bacteria 1771
931 Ga0501079_0342885 3300049741 Bacteria 1170
932 Ga0501080_0019576 3300049742 Bacteria 6271
933 Ga0501080_0075689 3300049742 Bacteria 3131
934 Ga0501080_0807262 3300049742 Bacteria 823
935 Ga0501081_0004449 3300049743 Bacteria 8986
936 Ga0501081_0013186 3300049743 Bacteria 5436
937 Ga0501081_0082492 3300049743 Bacteria 2252
938 Ga0501081_0085192 3300049743 Bacteria 2217
939 Ga0501083_0054058 3300049744 Bacteria 2695
940 Ga0501083_0257923 3300049744 Bacteria 1134
941 Ga0501035_0582058 3300049822 Bacteria 914
942 Ga0501044_0316963 3300049823 Bacteria 1485
943 Ga0501045_0000886 3300049824 Bacteria 19464
944 Ga0501045_0022489 3300049824 Bacteria 4515
945 Ga0501045_0093764 3300049824 Bacteria 2220
946 nmdc:mga0yw44_168499_c1 3300050492 Bacteria 1437
947 nmdc:mga05p37_1113279_c1 3300050507 Bacteria 825
948 nmdc:mga05p37_229997_c1 3300050507 Bacteria 2235
949 nmdc:mga05p37_65168_c1 3300050507 Bacteria 4483
950 nmdc:mga08y16_58178_c1 3300050511 Bacteria 4038
951 nmdc:mga0n895_157292_c1 3300050512 Bacteria 2303
952 nmdc:mga0n895_216837_c1 3300050512 Bacteria 1943
953 nmdc:mga0n895_337963_c1 3300050512 Bacteria 1526
954 nmdc:mga0n895_687670_c1 3300050512 Bacteria 1020
955 nmdc:mga0rr50_305557_c1 3300050513 Bacteria 1331
956 nmdc:mga0rr50_362333_c1 3300050513 Bacteria 1220
957 nmdc:mga0rr50_97083_c1 3300050513 Bacteria 2307
958 nmdc:mga08x19_409862_c1 3300050514 Bacteria 951
959 nmdc:mga0a205_214190_c1 3300050515 Bacteria 1814
960 nmdc:mga0a205_230489_c1 3300050515 Bacteria 1735
961 Ga0495601_0017330 3300053077 Bacteria 4370
962 Ga0495601_0492279 3300053077 Bacteria 792
963 Ga0495655_0012971 3300053083 Bacteria 1712
964 Ga0495595_0004475 3300053084 Bacteria 5627
965 Ga0495595_0136519 3300053084 Bacteria 1201
966 Ga0495619_0000370 3300053085 Bacteria 30945
967 Ga0495619_0004646 3300053085 Bacteria 8752
968 Ga0495619_0056909 3300053085 Bacteria 2594
969 Ga0495619_0778014 3300053085 Bacteria 648
970 Ga0501084_0005273 3300054114 Bacteria 10577
971 Ga0501084_0014294 3300054114 Bacteria 6575
972 Ga0501084_0044844 3300054114 Bacteria 3702
973 Ga0501084_0066420 3300054114 Bacteria 3018
974 Ga0501084_0117279 3300054114 Bacteria 2238
975 Ga0501082_0014661 3300060353 Bacteria 6753
976 Ga0501082_0080559 3300060353 Bacteria 2810
977 Ga0466962_0015279 3300061719 Bacteria 3701
978 Ga0466962_0017831 3300061719 Bacteria 3416
979 Ga0466962_0238694 3300061719 Bacteria 892
980 Ga0466962_0357879 3300061719 Bacteria 727
981 Ga0530510_0000504 3300061734 Bacteria 24768
982 Ga0530510_0084301 3300061734 Bacteria 2314
983 Ga0530510_0215608 3300061734 Bacteria 1426
984 Ga0530510_0345962 3300061734 Bacteria 1117
985 Ga0530510_0352227 3300061734 Bacteria 1106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_11024689 Ga0157369_110246891 128
2 3300035086 Ga0373934_0268851 Ga0373934_0268851_20_412 128
3 3300039450 Ga0436363_1007763 Ga0436363_1007763_223_609 128
4 3300044842 Ga0466957_0387881 Ga0466957_0387881_306_695 128
5 3300049576 Ga0501040_0925850 Ga0501040_0925850_228_617 128
6 3300009098 Ga0105245_10273982 Ga0105245_102739822 129
7 3300009176 Ga0105242_10302755 Ga0105242_103027552 129
8 3300009177 Ga0105248_10458662 Ga0105248_104586623 129
9 3300013105 Ga0157369_10906191 Ga0157369_109061912 129
10 3300013296 Ga0157374_10039944 Ga0157374_100399444 129
11 3300035170 Ga0373943_0181868 Ga0373943_0181868_683_1072 129
12 3300037466 Ga0395898_0851442 Ga0395898_0851442_427_816 129
13 3300038443 Ga0395901_0290117 Ga0395901_0290117_1271_1660 129
14 3300046517 Ga0495630_0221813 Ga0495630_0221813_711_1100 129
15 3300046664 Ga0495659_0356459 Ga0495659_0356459_16_408 129
16 3300048903 Ga0496100_0593280 Ga0496100_0593280_296_685 129
17 3300048904 Ga0496101_0022295 Ga0496101_0022295_3600_3992 129
18 3300048904 Ga0496101_0324417 Ga0496101_0324417_284_673 129
19 3300048905 Ga0496102_0014233 Ga0496102_0014233_5891_6283 129
20 3300048909 Ga0496106_0147127 Ga0496106_0147127_1196_1588 129
21 3300048911 Ga0496108_0022133 Ga0496108_0022133_2845_3237 129
22 3300048911 Ga0496108_0119478 Ga0496108_0119478_1851_2243 129
23 3300048912 Ga0496109_0204706 Ga0496109_0204706_478_870 129
24 3300048913 Ga0496110_0003719 Ga0496110_0003719_5673_6065 129
25 3300048914 Ga0496111_0047943 Ga0496111_0047943_2243_2635 129
26 3300048915 Ga0496112_0202567 Ga0496112_0202567_243_635 129
27 3300048915 Ga0496112_0289448 Ga0496112_0289448_30_422 129
28 3300048916 Ga0496113_0047455 Ga0496113_0047455_16_408 129
29 3300048917 Ga0496114_0014140 Ga0496114_0014140_5761_6153 129
30 3300048917 Ga0496114_0406498 Ga0496114_0406498_784_1173 129
31 3300048918 Ga0496115_0038437 Ga0496115_0038437_127_519 129
32 3300048916 Ga0496113_0191855 Ga0496113_0191855_628_1029 132
33 3300046517 Ga0495630_0839706 Ga0495630_0839706_25_429 134
34 3300037418 Ga0395900_0373287 Ga0395900_0373287_310_720 135
35 3300037466 Ga0395898_0780906 Ga0395898_0780906_325_735 135
36 3300038443 Ga0395901_0856634 Ga0395901_0856634_303_713 135
37 3300048915 Ga0496112_0403758 Ga0496112_0403758_693_1103 135
38 3300044694 Ga0466963_0035965 Ga0466963_0035965_1335_1745 136
39 3300025933 Ga0207706_10264510 Ga0207706_102645102 139
40 3300009177 Ga0105248_10226015 Ga0105248_102260152 140
41 3300026089 Ga0207648_10543977 Ga0207648_105439772 140
42 3300035241 Ga0373961_0203278 Ga0373961_0203278_129_551 140
43 3300025929 Ga0207664_11876071 Ga0207664_118760711 141
44 3300035172 Ga0373955_0169132 Ga0373955_0169132_320_748 141
45 3300049588 Ga0501072_0592595 Ga0501072_0592595_58_486 141
46 3300005339 Ga0070660_101432085 Ga0070660_1014320851 142
47 3300005439 Ga0070711_100251760 Ga0070711_1002517602 142
48 3300025916 Ga0207663_10225357 Ga0207663_102253572 142
49 3300037466 Ga0395898_0102591 Ga0395898_0102591_2161_2604 142
50 3300046458 Ga0495591_179963 Ga0495591_179963_63_494 142
51 3300003373 JGI25407J50210_10019029 JGI25407J50210_100190292 143
52 3300005327 Ga0070658_10028277 Ga0070658_100282774 143
53 3300005327 Ga0070658_10079643 Ga0070658_100796432 143
54 3300005327 Ga0070658_10141171 Ga0070658_101411711 143
55 3300005329 Ga0070683_100146936 Ga0070683_1001469363 143
56 3300005330 Ga0070690_101366406 Ga0070690_1013664061 143
57 3300005336 Ga0070680_100984503 Ga0070680_1009845031 143
58 3300005337 Ga0070682_100422041 Ga0070682_1004220411 143
59 3300005339 Ga0070660_100011899 Ga0070660_1000118993 143
60 3300005339 Ga0070660_100673639 Ga0070660_1006736391 143
61 3300005366 Ga0070659_100029587 Ga0070659_1000295874 143
62 3300005366 Ga0070659_100124352 Ga0070659_1001243522 143
63 3300005435 Ga0070714_100037737 Ga0070714_1000377372 143
64 3300005435 Ga0070714_100044953 Ga0070714_1000449533 143
65 3300005435 Ga0070714_100137329 Ga0070714_1001373292 143
66 3300005458 Ga0070681_10236695 Ga0070681_102366952 143
67 3300005458 Ga0070681_10437565 Ga0070681_104375652 143
68 3300005458 Ga0070681_11620582 Ga0070681_116205821 143
69 3300005468 Ga0070707_100025765 Ga0070707_1000257658 143
70 3300005471 Ga0070698_100114693 Ga0070698_1001146933 143
71 3300005471 Ga0070698_100181898 Ga0070698_1001818983 143
72 3300005471 Ga0070698_100270808 Ga0070698_1002708081 143
73 3300005530 Ga0070679_100110684 Ga0070679_1001106844 143
74 3300005530 Ga0070679_101743435 Ga0070679_1017434351 143
75 3300005530 Ga0070679_101794976 Ga0070679_1017949761 143
76 3300005535 Ga0070684_101192855 Ga0070684_1011928551 143
77 3300005535 Ga0070684_101777082 Ga0070684_1017770821 143
78 3300005545 Ga0070695_100455635 Ga0070695_1004556352 143
79 3300005546 Ga0070696_100477554 Ga0070696_1004775542 143
80 3300005937 Ga0081455_10051736 Ga0081455_100517362 143
81 3300005981 Ga0081538_10000565 Ga0081538_100005659 143
82 3300005981 Ga0081538_10020213 Ga0081538_100202131 143
83 3300006028 Ga0070717_10122989 Ga0070717_101229894 143
84 3300006028 Ga0070717_10718537 Ga0070717_107185371 143
85 3300006175 Ga0070712_100816050 Ga0070712_1008160502 143
86 3300006358 Ga0068871_101918336 Ga0068871_1019183361 143
87 3300006852 Ga0075433_11058702 Ga0075433_110587021 143
88 3300009098 Ga0105245_10523505 Ga0105245_105235052 143
89 3300009101 Ga0105247_11506430 Ga0105247_115064301 143
90 3300009147 Ga0114129_10252621 Ga0114129_102526212 143
91 3300009147 Ga0114129_11402432 Ga0114129_114024321 143
92 3300009174 Ga0105241_10190465 Ga0105241_101904652 143
93 3300013100 Ga0157373_10081015 Ga0157373_100810153 143
94 3300013100 Ga0157373_10350753 Ga0157373_103507532 143
95 3300013100 Ga0157373_10953659 Ga0157373_109536592 143
96 3300013104 Ga0157370_10477258 Ga0157370_104772582 143
97 3300013105 Ga0157369_10351160 Ga0157369_103511602 143
98 3300013307 Ga0157372_10766362 Ga0157372_107663622 143
99 3300014497 Ga0182008_10152412 Ga0182008_101524122 143
100 3300015261 Ga0182006_1118157 Ga0182006_11181571 143
101 3300015261 Ga0182006_1130787 Ga0182006_11307872 143
102 3300020070 Ga0206356_11466129 Ga0206356_114661292 143
103 3300020082 Ga0206353_11081997 Ga0206353_110819972 143
104 3300025898 Ga0207692_10154895 Ga0207692_101548951 143
105 3300025901 Ga0207688_10723464 Ga0207688_107234642 143
106 3300025909 Ga0207705_10203997 Ga0207705_102039972 143
107 3300025911 Ga0207654_10389101 Ga0207654_103891011 143
108 3300025912 Ga0207707_10061659 Ga0207707_100616594 143
109 3300025912 Ga0207707_10328587 Ga0207707_103285872 143
110 3300025919 Ga0207657_10136434 Ga0207657_101364342 143
111 3300025919 Ga0207657_10333579 Ga0207657_103335792 143
112 3300025919 Ga0207657_10377105 Ga0207657_103771052 143
113 3300025919 Ga0207657_10418825 Ga0207657_104188252 143
114 3300025921 Ga0207652_10327356 Ga0207652_103273562 143
115 3300025921 Ga0207652_10976962 Ga0207652_109769621 143
116 3300025921 Ga0207652_11449402 Ga0207652_114494021 143
117 3300025922 Ga0207646_10005438 Ga0207646_1000543812 143
118 3300025929 Ga0207664_10035134 Ga0207664_100351344 143
119 3300025929 Ga0207664_10229091 Ga0207664_102290912 143
120 3300025931 Ga0207644_10049049 Ga0207644_100490492 143
121 3300025932 Ga0207690_10109203 Ga0207690_101092032 143
122 3300025932 Ga0207690_10144013 Ga0207690_101440132 143
123 3300025932 Ga0207690_11369143 Ga0207690_113691431 143
124 3300025934 Ga0207686_11058438 Ga0207686_110584381 143
125 3300025941 Ga0207711_10149353 Ga0207711_101493532 143
126 3300025941 Ga0207711_10530542 Ga0207711_105305422 143
127 3300025949 Ga0207667_10404213 Ga0207667_104042131 143
128 3300025961 Ga0207712_10380368 Ga0207712_103803683 143
129 3300026116 Ga0207674_10612019 Ga0207674_106120192 143
130 3300028556 Ga0265337_1034958 Ga0265337_10349582 143
131 3300028558 Ga0265326_10052270 Ga0265326_100522701 143
132 3300028558 Ga0265326_10083143 Ga0265326_100831432 143
133 3300028563 Ga0265319_1018082 Ga0265319_10180824 143
134 3300028563 Ga0265319_1024126 Ga0265319_10241262 143
135 3300028573 Ga0265334_10019415 Ga0265334_100194152 143
136 3300028573 Ga0265334_10180159 Ga0265334_101801592 143
137 3300028577 Ga0265318_10004780 Ga0265318_100047803 143
138 3300028653 Ga0265323_10200907 Ga0265323_102009072 143
139 3300028666 Ga0265336_10006870 Ga0265336_100068702 143
140 3300028800 Ga0265338_10004412 Ga0265338_100044129 143
141 3300028800 Ga0265338_10033767 Ga0265338_100337672 143
142 3300028800 Ga0265338_10742252 Ga0265338_107422521 143
143 3300031235 Ga0265330_10046868 Ga0265330_100468682 143
144 3300031235 Ga0265330_10145155 Ga0265330_101451552 143
145 3300031238 Ga0265332_10101710 Ga0265332_101017102 143
146 3300031240 Ga0265320_10313680 Ga0265320_103136801 143
147 3300031241 Ga0265325_10040329 Ga0265325_100403294 143
148 3300031249 Ga0265339_10175154 Ga0265339_101751542 143
149 3300031251 Ga0265327_10084052 Ga0265327_100840521 143
150 3300031251 Ga0265327_10144496 Ga0265327_101444962 143
151 3300031344 Ga0265316_10004106 Ga0265316_1000410617 143
152 3300031595 Ga0265313_10006856 Ga0265313_100068563 143
153 3300031711 Ga0265314_10028327 Ga0265314_100283272 143
154 3300031711 Ga0265314_10039527 Ga0265314_100395274 143
155 3300035115 Ga0373941_0216203 Ga0373941_0216203_215_646 143
156 3300035118 Ga0373954_0161668 Ga0373954_0161668_54_491 143
157 3300035121 Ga0373960_0036954 Ga0373960_0036954_694_1128 143
158 3300035695 Ga0373927_0597580 Ga0373927_0597580_125_559 143
159 3300035725 Ga0373947_0052627 Ga0373947_0052627_1063_1497 143
160 3300037068 Ga0373925_0734677 Ga0373925_0734677_339_773 143
161 3300037466 Ga0395898_0289405 Ga0395898_0289405_764_1198 143
162 3300037466 Ga0395898_1223196 Ga0395898_1223196_19_450 143
163 3300037466 Ga0395898_1633523 Ga0395898_1633523_53_487 143
164 3300037471 Ga0395905_0949864 Ga0395905_0949864_206_637 143
165 3300039437 Ga0436365_1518340 Ga0436365_1518340_936_1367 143
166 3300039438 Ga0436360_0821888 Ga0436360_0821888_19_450 143
167 3300044656 Ga0466969_0038385 Ga0466969_0038385_1825_2256 143
168 3300044684 Ga0466966_0058831 Ga0466966_0058831_508_939 143
169 3300044684 Ga0466966_0060183 Ga0466966_0060183_89_520 143
170 3300044684 Ga0466966_0196367 Ga0466966_0196367_214_705 143
171 3300044693 Ga0466961_0278520 Ga0466961_0278520_427_858 143
172 3300044694 Ga0466963_0003865 Ga0466963_0003865_237_668 143
173 3300044694 Ga0466963_0023648 Ga0466963_0023648_624_1055 143
174 3300044694 Ga0466963_0134680 Ga0466963_0134680_677_1108 143
175 3300044694 Ga0466963_0172550 Ga0466963_0172550_362_796 143
176 3300044694 Ga0466963_0210912 Ga0466963_0210912_429_860 143
177 3300044694 Ga0466963_0293165 Ga0466963_0293165_331_765 143
178 3300044694 Ga0466963_0423416 Ga0466963_0423416_405_839 143
179 3300044694 Ga0466963_0505373 Ga0466963_0505373_125_556 143
180 3300044694 Ga0466963_0615895 Ga0466963_0615895_109_540 143
181 3300044694 Ga0466963_0877495 Ga0466963_0877495_113_544 143
182 3300044706 Ga0466964_0088440 Ga0466964_0088440_311_745 143
183 3300044706 Ga0466964_0308112 Ga0466964_0308112_295_726 143
184 3300044706 Ga0466964_0418767 Ga0466964_0418767_116_547 143
185 3300044719 Ga0466971_0040475 Ga0466971_0040475_1277_1708 143
186 3300044719 Ga0466971_0360093 Ga0466971_0360093_14_445 143
187 3300044842 Ga0466957_0061965 Ga0466957_0061965_1753_2184 143
188 3300044842 Ga0466957_0235426 Ga0466957_0235426_308_742 143
189 3300044842 Ga0466957_0353344 Ga0466957_0353344_216_647 143
190 3300044842 Ga0466957_0778631 Ga0466957_0778631_87_521 143
191 3300044842 Ga0466957_1187654 Ga0466957_1187654_88_519 143
192 3300045049 Ga0466959_0129925 Ga0466959_0129925_717_1148 143
193 3300045049 Ga0466959_0601690 Ga0466959_0601690_201_632 143
194 3300045049 Ga0466959_0763149 Ga0466959_0763149_16_447 143
195 3300045836 Ga0466958_0010267 Ga0466958_0010267_1336_1770 143
196 3300045836 Ga0466958_0014926 Ga0466958_0014926_1122_1553 143
197 3300045836 Ga0466958_0024973 Ga0466958_0024973_2818_3249 143
198 3300045836 Ga0466958_0123278 Ga0466958_0123278_561_992 143
199 3300045836 Ga0466958_0141662 Ga0466958_0141662_51_482 143
200 3300045836 Ga0466958_0349405 Ga0466958_0349405_505_939 143
201 3300045976 Ga0466967_0108686 Ga0466967_0108686_1392_1823 143
202 3300045976 Ga0466967_0158405 Ga0466967_0158405_305_739 143
203 3300045976 Ga0466967_0183132 Ga0466967_0183132_668_1102 143
204 3300045976 Ga0466967_0327619 Ga0466967_0327619_928_1359 143
205 3300045976 Ga0466967_0378442 Ga0466967_0378442_485_916 143
206 3300045976 Ga0466967_0513827 Ga0466967_0513827_631_1062 143
207 3300045976 Ga0466967_0518206 Ga0466967_0518206_361_795 143
208 3300045976 Ga0466967_0559520 Ga0466967_0559520_234_668 143
209 3300045976 Ga0466967_1501477 Ga0466967_1501477_221_652 143
210 3300046454 Ga0495592_0105262 Ga0495592_0105262_573_1007 143
211 3300046459 Ga0495629_0040254 Ga0495629_0040254_822_1316 143
212 3300046459 Ga0495629_0958021 Ga0495629_0958021_112_546 143
213 3300046461 Ga0495641_0068395 Ga0495641_0068395_981_1415 143
214 3300046511 Ga0495608_0194214 Ga0495608_0194214_10_441 143
215 3300046514 Ga0495618_0131228 Ga0495618_0131228_173_604 143
216 3300046514 Ga0495618_0381564 Ga0495618_0381564_28_462 143
217 3300046516 Ga0495628_0276219 Ga0495628_0276219_212_646 143
218 3300046516 Ga0495628_0719723 Ga0495628_0719723_252_686 143
219 3300046517 Ga0495630_0027552 Ga0495630_0027552_903_1397 143
220 3300046529 Ga0495652_0148172 Ga0495652_0148172_25_459 143
221 3300046533 Ga0495640_0420573 Ga0495640_0420573_303_734 143
222 3300046535 Ga0495586_0014499 Ga0495586_0014499_2158_2592 143
223 3300046543 Ga0495645_0281181 Ga0495645_0281181_168_602 143
224 3300046559 Ga0495667_0127345 Ga0495667_0127345_504_998 143
225 3300046642 Ga0495634_0061667 Ga0495634_0061667_1573_2004 143
226 3300046642 Ga0495634_0292093 Ga0495634_0292093_443_877 143
227 3300046663 Ga0495635_0124509 Ga0495635_0124509_454_888 143
228 3300046663 Ga0495635_0709573 Ga0495635_0709573_208_642 143
229 3300046680 Ga0495646_0444953 Ga0495646_0444953_94_528 143
230 3300046683 Ga0495658_0032280 Ga0495658_0032280_1386_1820 143
231 3300046683 Ga0495658_1115928 Ga0495658_1115928_32_466 143
232 3300046689 Ga0495613_0047381 Ga0495613_0047381_991_1425 143
233 3300047319 Ga0495674_0129366 Ga0495674_0129366_610_1044 143
234 3300047319 Ga0495674_0161060 Ga0495674_0161060_682_1116 143
235 3300047444 Ga0495675_0335262 Ga0495675_0335262_184_621 143
236 3300048088 Ga0495602_0077204 Ga0495602_0077204_391_825 143
237 3300048088 Ga0495602_0374177 Ga0495602_0374177_194_628 143
238 3300048907 Ga0496104_0341751 Ga0496104_0341751_174_608 143
239 3300048912 Ga0496109_0849628 Ga0496109_0849628_295_729 143
240 3300048915 Ga0496112_0033651 Ga0496112_0033651_2431_2865 143
241 3300048918 Ga0496115_1200902 Ga0496115_1200902_112_543 143
242 3300049568 Ga0501031_0058066 Ga0501031_0058066_1540_1971 143
243 3300049568 Ga0501031_0086916 Ga0501031_0086916_161_592 143
244 3300049569 Ga0501032_0108625 Ga0501032_0108625_51_482 143
245 3300049570 Ga0501033_0298984 Ga0501033_0298984_362_793 143
246 3300049571 Ga0501034_0051390 Ga0501034_0051390_3003_3434 143
247 3300049572 Ga0501036_0016451 Ga0501036_0016451_3211_3642 143
248 3300049574 Ga0501038_0038082 Ga0501038_0038082_3576_4007 143
249 3300049575 Ga0501039_0261039 Ga0501039_0261039_896_1327 143
250 3300049576 Ga0501040_0000505 Ga0501040_0000505_16444_16875 143
251 3300049576 Ga0501040_0039796 Ga0501040_0039796_1375_1806 143
252 3300049577 Ga0501041_0016294 Ga0501041_0016294_2813_3244 143
253 3300049577 Ga0501041_0022710 Ga0501041_0022710_3245_3676 143
254 3300049578 Ga0501042_0000909 Ga0501042_0000909_12298_12729 143
255 3300049578 Ga0501042_1082245 Ga0501042_1082245_51_485 143
256 3300049579 Ga0501043_0575844 Ga0501043_0575844_312_743 143
257 3300049581 Ga0501047_0405004 Ga0501047_0405004_715_1146 143
258 3300049582 Ga0501048_0012035 Ga0501048_0012035_4469_4900 143
259 3300049583 Ga0501067_0400517 Ga0501067_0400517_217_696 143
260 3300049584 Ga0501068_0161904 Ga0501068_0161904_715_1146 143
261 3300049584 Ga0501068_1004721 Ga0501068_1004721_38_472 143
262 3300049585 Ga0501069_0092763 Ga0501069_0092763_526_1005 143
263 3300049586 Ga0501070_0268219 Ga0501070_0268219_29_460 143
264 3300049586 Ga0501070_0408439 Ga0501070_0408439_575_1006 143
265 3300049587 Ga0501071_0005439 Ga0501071_0005439_765_1196 143
266 3300049588 Ga0501072_0000190 Ga0501072_0000190_11411_11842 143
267 3300049588 Ga0501072_0039548 Ga0501072_0039548_439_870 143
268 3300049588 Ga0501072_0087765 Ga0501072_0087765_1441_1872 143
269 3300049589 Ga0501073_0107665 Ga0501073_0107665_1318_1749 143
270 3300049589 Ga0501073_0147332 Ga0501073_0147332_1170_1601 143
271 3300049589 Ga0501073_0304600 Ga0501073_0304600_532_963 143
272 3300049590 Ga0501074_0039059 Ga0501074_0039059_2723_3154 143
273 3300049590 Ga0501074_0104613 Ga0501074_0104613_640_1071 143
274 3300049591 Ga0501075_0000311 Ga0501075_0000311_2032_2463 143
275 3300049591 Ga0501075_0014013 Ga0501075_0014013_1217_1648 143
276 3300049592 Ga0501076_0000336 Ga0501076_0000336_2095_2526 143
277 3300049592 Ga0501076_0040018 Ga0501076_0040018_1536_1967 143
278 3300049593 Ga0501077_0004089 Ga0501077_0004089_7892_8323 143
279 3300049593 Ga0501077_0067518 Ga0501077_0067518_1630_2061 143
280 3300049741 Ga0501079_0000420 Ga0501079_0000420_14099_14530 143
281 3300049741 Ga0501079_0100848 Ga0501079_0100848_1061_1492 143
282 3300049741 Ga0501079_0127770 Ga0501079_0127770_1412_1843 143
283 3300049741 Ga0501079_0157308 Ga0501079_0157308_748_1182 143
284 3300049742 Ga0501080_0019576 Ga0501080_0019576_3698_4129 143
285 3300049742 Ga0501080_0075689 Ga0501080_0075689_1508_1939 143
286 3300049742 Ga0501080_0807262 Ga0501080_0807262_302_733 143
287 3300049743 Ga0501081_0004449 Ga0501081_0004449_5792_6223 143
288 3300049743 Ga0501081_0013186 Ga0501081_0013186_1645_2079 143
289 3300049743 Ga0501081_0082492 Ga0501081_0082492_910_1341 143
290 3300049744 Ga0501083_0257923 Ga0501083_0257923_63_494 143
291 3300049822 Ga0501035_0582058 Ga0501035_0582058_404_835 143
292 3300049823 Ga0501044_0316963 Ga0501044_0316963_73_504 143
293 3300049824 Ga0501045_0000886 Ga0501045_0000886_6972_7403 143
294 3300049824 Ga0501045_0093764 Ga0501045_0093764_1550_1981 143
295 3300050507 nmdc:mga05p37_1113279_c1 nmdc:mga05p37_1113279_c1_102_536 143
296 3300050512 nmdc:mga0n895_216837_c1 nmdc:mga0n895_216837_c1_1493_1927 143
297 3300050515 nmdc:mga0a205_230489_c1 nmdc:mga0a205_230489_c1_1209_1643 143
298 3300053077 Ga0495601_0492279 Ga0495601_0492279_341_775 143
299 3300053085 Ga0495619_0004646 Ga0495619_0004646_3516_4010 143
300 3300053085 Ga0495619_0056909 Ga0495619_0056909_1444_1881 143
301 3300053085 Ga0495619_0778014 Ga0495619_0778014_187_618 143
302 3300054114 Ga0501084_0005273 Ga0501084_0005273_3500_3934 143
303 3300054114 Ga0501084_0014294 Ga0501084_0014294_2947_3378 143
304 3300054114 Ga0501084_0117279 Ga0501084_0117279_1039_1470 143
305 3300060353 Ga0501082_0014661 Ga0501082_0014661_3835_4266 143
306 3300060353 Ga0501082_0080559 Ga0501082_0080559_2315_2746 143
307 3300061719 Ga0466962_0015279 Ga0466962_0015279_2417_2848 143
308 3300061719 Ga0466962_0238694 Ga0466962_0238694_228_662 143
309 3300061734 Ga0530510_0000504 Ga0530510_0000504_11052_11483 143
310 3300061734 Ga0530510_0215608 Ga0530510_0215608_367_801 143
311 3300061734 Ga0530510_0352227 Ga0530510_0352227_181_660 143
312 3300002077 JGI24744J21845_10005153 JGI24744J21845_100051535 144
313 3300002244 JGI24742J22300_10049925 JGI24742J22300_100499252 144
314 3300003320 rootH2_10145799 rootH2_101457992 144
315 3300005327 Ga0070658_10397026 Ga0070658_103970261 144
316 3300005327 Ga0070658_10648688 Ga0070658_106486881 144
317 3300005329 Ga0070683_100006562 Ga0070683_10000656211 144
318 3300005329 Ga0070683_100021449 Ga0070683_1000214496 144
319 3300005329 Ga0070683_100260818 Ga0070683_1002608183 144
320 3300005330 Ga0070690_100125816 Ga0070690_1001258162 144
321 3300005336 Ga0070680_100010699 Ga0070680_1000106995 144
322 3300005336 Ga0070680_100027507 Ga0070680_1000275076 144
323 3300005336 Ga0070680_100232958 Ga0070680_1002329583 144
324 3300005336 Ga0070680_100266914 Ga0070680_1002669142 144
325 3300005337 Ga0070682_100020032 Ga0070682_1000200324 144
326 3300005337 Ga0070682_100124898 Ga0070682_1001248982 144
327 3300005337 Ga0070682_100312310 Ga0070682_1003123102 144
328 3300005338 Ga0068868_100040728 Ga0068868_1000407285 144
329 3300005338 Ga0068868_100399438 Ga0068868_1003994382 144
330 3300005338 Ga0068868_100907006 Ga0068868_1009070062 144
331 3300005339 Ga0070660_100037138 Ga0070660_1000371382 144
332 3300005340 Ga0070689_100923289 Ga0070689_1009232891 144
333 3300005341 Ga0070691_10292626 Ga0070691_102926262 144
334 3300005344 Ga0070661_100172121 Ga0070661_1001721211 144
335 3300005345 Ga0070692_10025442 Ga0070692_100254423 144
336 3300005355 Ga0070671_100184565 Ga0070671_1001845652 144
337 3300005355 Ga0070671_100189710 Ga0070671_1001897102 144
338 3300005356 Ga0070674_100073278 Ga0070674_1000732783 144
339 3300005365 Ga0070688_100045686 Ga0070688_1000456862 144
340 3300005366 Ga0070659_100634279 Ga0070659_1006342791 144
341 3300005406 Ga0070703_10035822 Ga0070703_100358222 144
342 3300005434 Ga0070709_10017111 Ga0070709_100171112 144
343 3300005434 Ga0070709_10320167 Ga0070709_103201671 144
344 3300005435 Ga0070714_100009938 Ga0070714_1000099388 144
345 3300005435 Ga0070714_100087445 Ga0070714_1000874451 144
346 3300005435 Ga0070714_100462205 Ga0070714_1004622052 144
347 3300005436 Ga0070713_100007160 Ga0070713_1000071604 144
348 3300005436 Ga0070713_100106750 Ga0070713_1001067503 144
349 3300005437 Ga0070710_10001797 Ga0070710_100017976 144
350 3300005437 Ga0070710_10246260 Ga0070710_102462603 144
351 3300005437 Ga0070710_10246810 Ga0070710_102468102 144
352 3300005437 Ga0070710_10580965 Ga0070710_105809651 144
353 3300005438 Ga0070701_10013123 Ga0070701_100131232 144
354 3300005439 Ga0070711_100082704 Ga0070711_1000827043 144
355 3300005439 Ga0070711_100109703 Ga0070711_1001097033 144
356 3300005439 Ga0070711_100140593 Ga0070711_1001405933 144
357 3300005440 Ga0070705_100103546 Ga0070705_1001035462 144
358 3300005440 Ga0070705_100227615 Ga0070705_1002276152 144
359 3300005441 Ga0070700_100005137 Ga0070700_1000051375 144
360 3300005444 Ga0070694_100187047 Ga0070694_1001870473 144
361 3300005455 Ga0070663_100165402 Ga0070663_1001654023 144
362 3300005455 Ga0070663_100182027 Ga0070663_1001820272 144
363 3300005456 Ga0070678_100007764 Ga0070678_1000077647 144
364 3300005456 Ga0070678_100636202 Ga0070678_1006362022 144
365 3300005456 Ga0070678_100886505 Ga0070678_1008865052 144
366 3300005457 Ga0070662_101510701 Ga0070662_1015107012 144
367 3300005458 Ga0070681_10017854 Ga0070681_100178547 144
368 3300005458 Ga0070681_10051277 Ga0070681_100512775 144
369 3300005458 Ga0070681_10229762 Ga0070681_102297624 144
370 3300005458 Ga0070681_10586761 Ga0070681_105867611 144
371 3300005459 Ga0068867_100046488 Ga0068867_1000464885 144
372 3300005466 Ga0070685_10077527 Ga0070685_100775273 144
373 3300005467 Ga0070706_101278862 Ga0070706_1012788622 144
374 3300005468 Ga0070707_100304464 Ga0070707_1003044642 144
375 3300005471 Ga0070698_100002914 Ga0070698_10000291410 144
376 3300005530 Ga0070679_100029228 Ga0070679_1000292282 144
377 3300005530 Ga0070679_100258710 Ga0070679_1002587103 144
378 3300005530 Ga0070679_100950938 Ga0070679_1009509381 144
379 3300005535 Ga0070684_100008150 Ga0070684_1000081507 144
380 3300005535 Ga0070684_100040414 Ga0070684_1000404145 144
381 3300005535 Ga0070684_100260625 Ga0070684_1002606251 144
382 3300005535 Ga0070684_101161701 Ga0070684_1011617012 144
383 3300005535 Ga0070684_101186283 Ga0070684_1011862831 144
384 3300005539 Ga0068853_100059109 Ga0068853_1000591092 144
385 3300005539 Ga0068853_101281254 Ga0068853_1012812542 144
386 3300005543 Ga0070672_100320970 Ga0070672_1003209702 144
387 3300005544 Ga0070686_100284373 Ga0070686_1002843732 144
388 3300005546 Ga0070696_100020409 Ga0070696_1000204093 144
389 3300005547 Ga0070693_100004618 Ga0070693_1000046184 144
390 3300005547 Ga0070693_100197461 Ga0070693_1001974612 144
391 3300005547 Ga0070693_100534058 Ga0070693_1005340581 144
392 3300005548 Ga0070665_100018038 Ga0070665_1000180385 144
393 3300005548 Ga0070665_101039770 Ga0070665_1010397702 144
394 3300005549 Ga0070704_100018182 Ga0070704_1000181823 144
395 3300005549 Ga0070704_100034939 Ga0070704_1000349391 144
396 3300005549 Ga0070704_100283928 Ga0070704_1002839281 144
397 3300005549 Ga0070704_101480419 Ga0070704_1014804192 144
398 3300005563 Ga0068855_100149462 Ga0068855_1001494621 144
399 3300005563 Ga0068855_100871357 Ga0068855_1008713572 144
400 3300005563 Ga0068855_101023909 Ga0068855_1010239092 144
401 3300005563 Ga0068855_101035294 Ga0068855_1010352942 144
402 3300005614 Ga0068856_100059260 Ga0068856_1000592602 144
403 3300005614 Ga0068856_100073164 Ga0068856_1000731646 144
404 3300005614 Ga0068856_100455018 Ga0068856_1004550182 144
405 3300005614 Ga0068856_100911453 Ga0068856_1009114532 144
406 3300005614 Ga0068856_101465511 Ga0068856_1014655112 144
407 3300005615 Ga0070702_100015913 Ga0070702_1000159134 144
408 3300005615 Ga0070702_100024100 Ga0070702_1000241004 144
409 3300005616 Ga0068852_100044443 Ga0068852_1000444435 144
410 3300005616 Ga0068852_100441584 Ga0068852_1004415841 144
411 3300005616 Ga0068852_100536706 Ga0068852_1005367062 144
412 3300005617 Ga0068859_100227120 Ga0068859_1002271202 144
413 3300005618 Ga0068864_101169583 Ga0068864_1011695832 144
414 3300005618 Ga0068864_101396863 Ga0068864_1013968632 144
415 3300005718 Ga0068866_10020135 Ga0068866_100201353 144
416 3300005719 Ga0068861_100038349 Ga0068861_1000383493 144
417 3300005841 Ga0068863_100083643 Ga0068863_1000836433 144
418 3300005843 Ga0068860_100061442 Ga0068860_1000614422 144
419 3300005937 Ga0081455_10040841 Ga0081455_100408413 144
420 3300006028 Ga0070717_10004885 Ga0070717_100048852 144
421 3300006028 Ga0070717_10045128 Ga0070717_100451283 144
422 3300006028 Ga0070717_10066518 Ga0070717_100665183 144
423 3300006028 Ga0070717_10177241 Ga0070717_101772413 144
424 3300006028 Ga0070717_11215584 Ga0070717_112155841 144
425 3300006038 Ga0075365_10019883 Ga0075365_100198835 144
426 3300006163 Ga0070715_10001967 Ga0070715_100019674 144
427 3300006163 Ga0070715_10029792 Ga0070715_100297923 144
428 3300006173 Ga0070716_100000458 Ga0070716_10000045814 144
429 3300006175 Ga0070712_100003766 Ga0070712_1000037663 144
430 3300006175 Ga0070712_100030800 Ga0070712_1000308002 144
431 3300006175 Ga0070712_100138100 Ga0070712_1001381003 144
432 3300006175 Ga0070712_100270618 Ga0070712_1002706182 144
433 3300006175 Ga0070712_100407967 Ga0070712_1004079672 144
434 3300006237 Ga0097621_100067240 Ga0097621_1000672404 144
435 3300006358 Ga0068871_100094508 Ga0068871_1000945083 144
436 3300006358 Ga0068871_100228040 Ga0068871_1002280402 144
437 3300006847 Ga0075431_100063116 Ga0075431_1000631165 144
438 3300006852 Ga0075433_10443802 Ga0075433_104438022 144
439 3300006852 Ga0075433_11032740 Ga0075433_110327401 144
440 3300006871 Ga0075434_100024252 Ga0075434_1000242523 144
441 3300006871 Ga0075434_100583166 Ga0075434_1005831662 144
442 3300006871 Ga0075434_100865927 Ga0075434_1008659272 144
443 3300006871 Ga0075434_101286834 Ga0075434_1012868342 144
444 3300006881 Ga0068865_100007703 Ga0068865_1000077034 144
445 3300006881 Ga0068865_100233232 Ga0068865_1002332322 144
446 3300006914 Ga0075436_100046335 Ga0075436_1000463352 144
447 3300006914 Ga0075436_100361909 Ga0075436_1003619091 144
448 3300006931 Ga0097620_100227122 Ga0097620_1002271222 144
449 3300007076 Ga0075435_100106665 Ga0075435_1001066652 144
450 3300007076 Ga0075435_100147410 Ga0075435_1001474103 144
451 3300007076 Ga0075435_100722467 Ga0075435_1007224672 144
452 3300007076 Ga0075435_100794031 Ga0075435_1007940312 144
453 3300007788 Ga0099795_10247292 Ga0099795_102472921 144
454 3300009093 Ga0105240_10053208 Ga0105240_100532084 144
455 3300009093 Ga0105240_10132171 Ga0105240_101321715 144
456 3300009094 Ga0111539_10297055 Ga0111539_102970553 144
457 3300009098 Ga0105245_10022340 Ga0105245_100223407 144
458 3300009098 Ga0105245_10087652 Ga0105245_100876524 144
459 3300009098 Ga0105245_10130395 Ga0105245_101303952 144
460 3300009098 Ga0105245_10490782 Ga0105245_104907822 144
461 3300009098 Ga0105245_10588509 Ga0105245_105885092 144
462 3300009098 Ga0105245_11770122 Ga0105245_117701221 144
463 3300009101 Ga0105247_10018625 Ga0105247_100186253 144
464 3300009147 Ga0114129_10067445 Ga0114129_100674457 144
465 3300009147 Ga0114129_10315344 Ga0114129_103153442 144
466 3300009147 Ga0114129_10720593 Ga0114129_107205932 144
467 3300009147 Ga0114129_11810409 Ga0114129_118104092 144
468 3300009148 Ga0105243_10121676 Ga0105243_101216761 144
469 3300009148 Ga0105243_10451799 Ga0105243_104517992 144
470 3300009174 Ga0105241_10042368 Ga0105241_100423685 144
471 3300009174 Ga0105241_10131538 Ga0105241_101315382 144
472 3300009176 Ga0105242_10150103 Ga0105242_101501034 144
473 3300009176 Ga0105242_10296813 Ga0105242_102968133 144
474 3300009176 Ga0105242_10784195 Ga0105242_107841952 144
475 3300009177 Ga0105248_10215622 Ga0105248_102156222 144
476 3300009177 Ga0105248_11103642 Ga0105248_111036421 144
477 3300009545 Ga0105237_10050489 Ga0105237_100504892 144
478 3300009551 Ga0105238_10305213 Ga0105238_103052133 144
479 3300009551 Ga0105238_10457584 Ga0105238_104575842 144
480 3300009551 Ga0105238_10796794 Ga0105238_107967941 144
481 3300009551 Ga0105238_10827683 Ga0105238_108276832 144
482 3300009553 Ga0105249_10014061 Ga0105249_100140615 144
483 3300009553 Ga0105249_11516808 Ga0105249_115168082 144
484 3300010375 Ga0105239_10306154 Ga0105239_103061542 144
485 3300010375 Ga0105239_10477830 Ga0105239_104778302 144
486 3300010375 Ga0105239_10678086 Ga0105239_106780863 144
487 3300011119 Ga0105246_10096802 Ga0105246_100968023 144
488 3300011119 Ga0105246_10167261 Ga0105246_101672613 144
489 3300013100 Ga0157373_10367032 Ga0157373_103670321 144
490 3300013100 Ga0157373_10424928 Ga0157373_104249281 144
491 3300013102 Ga0157371_10070716 Ga0157371_100707164 144
492 3300013102 Ga0157371_10378605 Ga0157371_103786051 144
493 3300013102 Ga0157371_10719588 Ga0157371_107195882 144
494 3300013104 Ga0157370_10069449 Ga0157370_100694491 144
495 3300013104 Ga0157370_10184027 Ga0157370_101840272 144
496 3300013104 Ga0157370_10517857 Ga0157370_105178572 144
497 3300013105 Ga0157369_10075073 Ga0157369_100750732 144
498 3300013105 Ga0157369_10160592 Ga0157369_101605922 144
499 3300013105 Ga0157369_10327266 Ga0157369_103272663 144
500 3300013105 Ga0157369_10554559 Ga0157369_105545592 144
501 3300013296 Ga0157374_10093305 Ga0157374_100933054 144
502 3300013296 Ga0157374_10699746 Ga0157374_106997461 144
503 3300013297 Ga0157378_10105188 Ga0157378_101051883 144
504 3300013307 Ga0157372_10212225 Ga0157372_102122251 144
505 3300013307 Ga0157372_10345801 Ga0157372_103458012 144
506 3300013307 Ga0157372_10655564 Ga0157372_106555642 144
507 3300013307 Ga0157372_10767644 Ga0157372_107676442 144
508 3300013307 Ga0157372_12223446 Ga0157372_122234462 144
509 3300013308 Ga0157375_10057988 Ga0157375_100579882 144
510 3300013308 Ga0157375_11184822 Ga0157375_111848222 144
511 3300014326 Ga0157380_10021024 Ga0157380_100210242 144
512 3300014497 Ga0182008_10079629 Ga0182008_100796291 144
513 3300014745 Ga0157377_10003961 Ga0157377_100039616 144
514 3300014745 Ga0157377_10358249 Ga0157377_103582492 144
515 3300014968 Ga0157379_10522780 Ga0157379_105227801 144
516 3300014969 Ga0157376_10053378 Ga0157376_100533784 144
517 3300014969 Ga0157376_10116057 Ga0157376_101160572 144
518 3300014969 Ga0157376_11346031 Ga0157376_113460312 144
519 3300017792 Ga0163161_10150015 Ga0163161_101500152 144
520 3300020069 Ga0197907_11093402 Ga0197907_110934024 144
521 3300020070 Ga0206356_10416366 Ga0206356_104163661 144
522 3300020070 Ga0206356_11562056 Ga0206356_115620561 144
523 3300020075 Ga0206349_1562762 Ga0206349_15627621 144
524 3300020081 Ga0206354_10956547 Ga0206354_109565472 144
525 3300020081 Ga0206354_11132402 Ga0206354_111324022 144
526 3300020081 Ga0206354_11399885 Ga0206354_113998854 144
527 3300020082 Ga0206353_10006983 Ga0206353_100069831 144
528 3300020082 Ga0206353_11073345 Ga0206353_110733452 144
529 3300020082 Ga0206353_11281008 Ga0206353_112810083 144
530 3300022467 Ga0224712_10269621 Ga0224712_102696211 144
531 3300022467 Ga0224712_10368756 Ga0224712_103687561 144
532 3300022467 Ga0224712_10597468 Ga0224712_105974681 144
533 3300025885 Ga0207653_10027132 Ga0207653_100271323 144
534 3300025898 Ga0207692_10005665 Ga0207692_100056653 144
535 3300025899 Ga0207642_10016067 Ga0207642_100160673 144
536 3300025900 Ga0207710_10029092 Ga0207710_100290923 144
537 3300025901 Ga0207688_10049727 Ga0207688_100497273 144
538 3300025903 Ga0207680_10365578 Ga0207680_103655782 144
539 3300025904 Ga0207647_10053456 Ga0207647_100534562 144
540 3300025904 Ga0207647_10181781 Ga0207647_101817813 144
541 3300025905 Ga0207685_10000925 Ga0207685_100009257 144
542 3300025905 Ga0207685_10060928 Ga0207685_100609282 144
543 3300025906 Ga0207699_10005147 Ga0207699_100051471 144
544 3300025906 Ga0207699_10917393 Ga0207699_109173932 144
545 3300025908 Ga0207643_10367966 Ga0207643_103679662 144
546 3300025909 Ga0207705_10057765 Ga0207705_100577651 144
547 3300025909 Ga0207705_11079779 Ga0207705_110797792 144
548 3300025910 Ga0207684_10521210 Ga0207684_105212102 144
549 3300025912 Ga0207707_10014650 Ga0207707_100146505 144
550 3300025912 Ga0207707_10078672 Ga0207707_100786724 144
551 3300025912 Ga0207707_10093608 Ga0207707_100936083 144
552 3300025912 Ga0207707_10371714 Ga0207707_103717142 144
553 3300025912 Ga0207707_10602573 Ga0207707_106025732 144
554 3300025912 Ga0207707_10848421 Ga0207707_108484211 144
555 3300025913 Ga0207695_10026136 Ga0207695_100261362 144
556 3300025913 Ga0207695_10062357 Ga0207695_100623575 144
557 3300025915 Ga0207693_10000860 Ga0207693_1000086017 144
558 3300025915 Ga0207693_10004312 Ga0207693_100043128 144
559 3300025915 Ga0207693_10044202 Ga0207693_100442022 144
560 3300025915 Ga0207693_10241875 Ga0207693_102418752 144
561 3300025916 Ga0207663_10006640 Ga0207663_100066405 144
562 3300025916 Ga0207663_10118065 Ga0207663_101180653 144
563 3300025916 Ga0207663_10148746 Ga0207663_101487463 144
564 3300025916 Ga0207663_10974781 Ga0207663_109747812 144
565 3300025917 Ga0207660_10064459 Ga0207660_100644593 144
566 3300025917 Ga0207660_10274671 Ga0207660_102746712 144
567 3300025917 Ga0207660_10453966 Ga0207660_104539661 144
568 3300025917 Ga0207660_10735733 Ga0207660_107357332 144
569 3300025919 Ga0207657_10025169 Ga0207657_100251697 144
570 3300025919 Ga0207657_10042837 Ga0207657_100428376 144
571 3300025919 Ga0207657_10379853 Ga0207657_103798532 144
572 3300025920 Ga0207649_10072216 Ga0207649_100722161 144
573 3300025921 Ga0207652_10359706 Ga0207652_103597062 144
574 3300025921 Ga0207652_10864184 Ga0207652_108641841 144
575 3300025921 Ga0207652_10864532 Ga0207652_108645322 144
576 3300025921 Ga0207652_10876554 Ga0207652_108765542 144
577 3300025921 Ga0207652_11120231 Ga0207652_111202312 144
578 3300025922 Ga0207646_10030202 Ga0207646_100302026 144
579 3300025922 Ga0207646_10682508 Ga0207646_106825082 144
580 3300025924 Ga0207694_10015264 Ga0207694_100152646 144
581 3300025924 Ga0207694_10171558 Ga0207694_101715583 144
582 3300025924 Ga0207694_10425771 Ga0207694_104257712 144
583 3300025924 Ga0207694_10714524 Ga0207694_107145242 144
584 3300025926 Ga0207659_10446433 Ga0207659_104464332 144
585 3300025927 Ga0207687_10050927 Ga0207687_100509272 144
586 3300025927 Ga0207687_10211193 Ga0207687_102111932 144
587 3300025927 Ga0207687_10341195 Ga0207687_103411951 144
588 3300025927 Ga0207687_10474474 Ga0207687_104744741 144
589 3300025927 Ga0207687_10523915 Ga0207687_105239152 144
590 3300025928 Ga0207700_10039800 Ga0207700_100398005 144
591 3300025928 Ga0207700_10400851 Ga0207700_104008512 144
592 3300025929 Ga0207664_10015153 Ga0207664_100151535 144
593 3300025929 Ga0207664_10050563 Ga0207664_100505632 144
594 3300025929 Ga0207664_10059772 Ga0207664_100597725 144
595 3300025929 Ga0207664_10166709 Ga0207664_101667093 144
596 3300025929 Ga0207664_10205090 Ga0207664_102050902 144
597 3300025929 Ga0207664_10383241 Ga0207664_103832412 144
598 3300025929 Ga0207664_10431408 Ga0207664_104314082 144
599 3300025931 Ga0207644_10326362 Ga0207644_103263622 144
600 3300025932 Ga0207690_10174389 Ga0207690_101743893 144
601 3300025934 Ga0207686_10047158 Ga0207686_100471583 144
602 3300025934 Ga0207686_10344699 Ga0207686_103446992 144
603 3300025934 Ga0207686_10605421 Ga0207686_106054211 144
604 3300025935 Ga0207709_10001472 Ga0207709_1000147215 144
605 3300025935 Ga0207709_10633159 Ga0207709_106331592 144
606 3300025936 Ga0207670_10500729 Ga0207670_105007292 144
607 3300025936 Ga0207670_10781250 Ga0207670_107812502 144
608 3300025937 Ga0207669_10262640 Ga0207669_102626403 144
609 3300025938 Ga0207704_10009369 Ga0207704_100093692 144
610 3300025938 Ga0207704_10030898 Ga0207704_100308982 144
611 3300025939 Ga0207665_10000070 Ga0207665_1000007063 144
612 3300025939 Ga0207665_10383881 Ga0207665_103838812 144
613 3300025939 Ga0207665_11155525 Ga0207665_111555251 144
614 3300025940 Ga0207691_10026395 Ga0207691_100263953 144
615 3300025941 Ga0207711_10341355 Ga0207711_103413551 144
616 3300025944 Ga0207661_10039266 Ga0207661_100392662 144
617 3300025944 Ga0207661_10050622 Ga0207661_100506223 144
618 3300025944 Ga0207661_10204434 Ga0207661_102044341 144
619 3300025945 Ga0207679_10035943 Ga0207679_100359435 144
620 3300025949 Ga0207667_10241656 Ga0207667_102416563 144
621 3300025949 Ga0207667_10473051 Ga0207667_104730512 144
622 3300025949 Ga0207667_10960821 Ga0207667_109608212 144
623 3300025949 Ga0207667_11112171 Ga0207667_111121712 144
624 3300025961 Ga0207712_10109438 Ga0207712_101094382 144
625 3300025972 Ga0207668_11119590 Ga0207668_111195901 144
626 3300026023 Ga0207677_10018592 Ga0207677_100185925 144
627 3300026023 Ga0207677_10231400 Ga0207677_102314002 144
628 3300026023 Ga0207677_11446935 Ga0207677_114469352 144
629 3300026041 Ga0207639_10163601 Ga0207639_101636011 144
630 3300026041 Ga0207639_10539286 Ga0207639_105392861 144
631 3300026067 Ga0207678_10047021 Ga0207678_100470213 144
632 3300026067 Ga0207678_10246409 Ga0207678_102464091 144
633 3300026075 Ga0207708_10000913 Ga0207708_1000091317 144
634 3300026078 Ga0207702_10081538 Ga0207702_100815382 144
635 3300026078 Ga0207702_10301959 Ga0207702_103019592 144
636 3300026078 Ga0207702_10717867 Ga0207702_107178672 144
637 3300026078 Ga0207702_11541908 Ga0207702_115419082 144
638 3300026088 Ga0207641_10207834 Ga0207641_102078343 144
639 3300026088 Ga0207641_10286333 Ga0207641_102863332 144
640 3300026089 Ga0207648_10000540 Ga0207648_1000054028 144
641 3300026095 Ga0207676_10551968 Ga0207676_105519682 144
642 3300026118 Ga0207675_100015908 Ga0207675_1000159086 144
643 3300026121 Ga0207683_10000587 Ga0207683_1000058728 144
644 3300026121 Ga0207683_10008984 Ga0207683_100089841 144
645 3300026121 Ga0207683_10067372 Ga0207683_100673722 144
646 3300026121 Ga0207683_10580500 Ga0207683_105805002 144
647 3300026121 Ga0207683_10802018 Ga0207683_108020182 144
648 3300026142 Ga0207698_10051379 Ga0207698_100513795 144
649 3300026142 Ga0207698_10464943 Ga0207698_104649432 144
650 3300026142 Ga0207698_10916821 Ga0207698_109168212 144
651 3300027907 Ga0207428_10356841 Ga0207428_103568412 144
652 3300028381 Ga0268264_10048639 Ga0268264_100486396 144
653 3300028563 Ga0265319_1053860 Ga0265319_10538602 144
654 3300028573 Ga0265334_10022996 Ga0265334_100229962 144
655 3300028577 Ga0265318_10023055 Ga0265318_100230552 144
656 3300028654 Ga0265322_10037177 Ga0265322_100371772 144
657 3300028800 Ga0265338_10008321 Ga0265338_100083215 144
658 3300028800 Ga0265338_10015365 Ga0265338_100153656 144
659 3300028800 Ga0265338_10325964 Ga0265338_103259642 144
660 3300031240 Ga0265320_10004939 Ga0265320_100049396 144
661 3300031241 Ga0265325_10072684 Ga0265325_100726841 144
662 3300031242 Ga0265329_10016002 Ga0265329_100160023 144
663 3300031247 Ga0265340_10012337 Ga0265340_100123375 144
664 3300031247 Ga0265340_10230654 Ga0265340_102306542 144
665 3300031251 Ga0265327_10098284 Ga0265327_100982842 144
666 3300031251 Ga0265327_10121281 Ga0265327_101212812 144
667 3300031344 Ga0265316_10010660 Ga0265316_100106603 144
668 3300031711 Ga0265314_10006499 Ga0265314_100064996 144
669 3300031712 Ga0265342_10033203 Ga0265342_100332033 144
670 3300035115 Ga0373941_0307850 Ga0373941_0307850_134_571 144
671 3300035117 Ga0373953_0547168 Ga0373953_0547168_32_469 144
672 3300035119 Ga0373956_0056197 Ga0373956_0056197_1313_1753 144
673 3300035242 Ga0373962_0092917 Ga0373962_0092917_340_777 144
674 3300035410 Ga0373924_0230442 Ga0373924_0230442_205_642 144
675 3300035691 Ga0373931_0280972 Ga0373931_0280972_359_796 144
676 3300035691 Ga0373931_0676639 Ga0373931_0676639_217_657 144
677 3300035695 Ga0373927_0801886 Ga0373927_0801886_106_543 144
678 3300035725 Ga0373947_0079127 Ga0373947_0079127_180_614 144
679 3300035725 Ga0373947_0115982 Ga0373947_0115982_395_832 144
680 3300035725 Ga0373947_0777108 Ga0373947_0777108_204_641 144
681 3300036401 Ga0373937_0032363 Ga0373937_0032363_2349_2786 144
682 3300036401 Ga0373937_0122282 Ga0373937_0122282_23_463 144
683 3300037312 Ga0395899_0020210 Ga0395899_0020210_1100_1534 144
684 3300037312 Ga0395899_0098323 Ga0395899_0098323_833_1267 144
685 3300037312 Ga0395899_0241490 Ga0395899_0241490_100_534 144
686 3300037312 Ga0395899_0329322 Ga0395899_0329322_316_750 144
687 3300037312 Ga0395899_0492201 Ga0395899_0492201_73_507 144
688 3300037312 Ga0395899_0527732 Ga0395899_0527732_161_595 144
689 3300037312 Ga0395899_0652548 Ga0395899_0652548_80_514 144
690 3300037418 Ga0395900_0001846 Ga0395900_0001846_14537_14971 144
691 3300037418 Ga0395900_0008531 Ga0395900_0008531_1388_1822 144
692 3300037418 Ga0395900_0014289 Ga0395900_0014289_7508_7942 144
693 3300037418 Ga0395900_0027207 Ga0395900_0027207_4609_5046 144
694 3300037418 Ga0395900_0043023 Ga0395900_0043023_2173_2607 144
695 3300037418 Ga0395900_0115199 Ga0395900_0115199_1178_1612 144
696 3300037418 Ga0395900_0243644 Ga0395900_0243644_1249_1683 144
697 3300037418 Ga0395900_0300856 Ga0395900_0300856_437_871 144
698 3300037418 Ga0395900_0814163 Ga0395900_0814163_79_513 144
699 3300037466 Ga0395898_0002591 Ga0395898_0002591_15551_15985 144
700 3300037466 Ga0395898_0006502 Ga0395898_0006502_1594_2028 144
701 3300037466 Ga0395898_0011007 Ga0395898_0011007_4690_5127 144
702 3300037466 Ga0395898_0013777 Ga0395898_0013777_1018_1452 144
703 3300037466 Ga0395898_0021795 Ga0395898_0021795_3381_3815 144
704 3300037466 Ga0395898_0044897 Ga0395898_0044897_2126_2560 144
705 3300037466 Ga0395898_0076736 Ga0395898_0076736_275_709 144
706 3300037466 Ga0395898_0290322 Ga0395898_0290322_154_588 144
707 3300037466 Ga0395898_1140795 Ga0395898_1140795_120_554 144
708 3300037466 Ga0395898_1393963 Ga0395898_1393963_150_584 144
709 3300037471 Ga0395905_0011076 Ga0395905_0011076_7097_7531 144
710 3300037471 Ga0395905_0011571 Ga0395905_0011571_3082_3519 144
711 3300037471 Ga0395905_0012069 Ga0395905_0012069_2058_2492 144
712 3300037471 Ga0395905_0025234 Ga0395905_0025234_2205_2639 144
713 3300037471 Ga0395905_0036388 Ga0395905_0036388_3748_4182 144
714 3300037471 Ga0395905_0058801 Ga0395905_0058801_1169_1603 144
715 3300037471 Ga0395905_0107338 Ga0395905_0107338_973_1407 144
716 3300037471 Ga0395905_1225302 Ga0395905_1225302_136_570 144
717 3300037471 Ga0395905_1394936 Ga0395905_1394936_13_447 144
718 3300038443 Ga0395901_0009419 Ga0395901_0009419_5248_5682 144
719 3300038443 Ga0395901_0035205 Ga0395901_0035205_192_626 144
720 3300038443 Ga0395901_0045082 Ga0395901_0045082_2804_3238 144
721 3300038443 Ga0395901_0056424 Ga0395901_0056424_919_1353 144
722 3300038443 Ga0395901_0072296 Ga0395901_0072296_1085_1519 144
723 3300038443 Ga0395901_0099220 Ga0395901_0099220_1232_1666 144
724 3300038443 Ga0395901_0138437 Ga0395901_0138437_1307_1744 144
725 3300038443 Ga0395901_0387994 Ga0395901_0387994_763_1197 144
726 3300038443 Ga0395901_0403445 Ga0395901_0403445_541_975 144
727 3300038443 Ga0395901_0971202 Ga0395901_0971202_64_501 144
728 3300038443 Ga0395901_1097619 Ga0395901_1097619_22_456 144
729 3300038443 Ga0395901_1646324 Ga0395901_1646324_77_511 144
730 3300044656 Ga0466969_0000426 Ga0466969_0000426_1827_2264 144
731 3300044658 Ga0466972_0415790 Ga0466972_0415790_158_595 144
732 3300044683 Ga0466965_0037696 Ga0466965_0037696_830_1267 144
733 3300044693 Ga0466961_0049628 Ga0466961_0049628_1673_2110 144
734 3300044693 Ga0466961_0051433 Ga0466961_0051433_1388_1825 144
735 3300044694 Ga0466963_0002057 Ga0466963_0002057_8090_8527 144
736 3300044694 Ga0466963_0007214 Ga0466963_0007214_3418_3855 144
737 3300044694 Ga0466963_0025653 Ga0466963_0025653_2252_2689 144
738 3300044694 Ga0466963_0119688 Ga0466963_0119688_1004_1441 144
739 3300044694 Ga0466963_0188851 Ga0466963_0188851_416_850 144
740 3300044694 Ga0466963_0940072 Ga0466963_0940072_158_592 144
741 3300044706 Ga0466964_0003099 Ga0466964_0003099_2579_3016 144
742 3300044706 Ga0466964_0046814 Ga0466964_0046814_1308_1745 144
743 3300044706 Ga0466964_0068356 Ga0466964_0068356_305_775 144
744 3300044719 Ga0466971_0047179 Ga0466971_0047179_1306_1743 144
745 3300044719 Ga0466971_0055987 Ga0466971_0055987_850_1287 144
746 3300044719 Ga0466971_0327410 Ga0466971_0327410_163_597 144
747 3300044719 Ga0466971_0416333 Ga0466971_0416333_147_584 144
748 3300044735 Ga0466968_0001254 Ga0466968_0001254_4193_4630 144
749 3300044735 Ga0466968_0024225 Ga0466968_0024225_127_564 144
750 3300044735 Ga0466968_0069422 Ga0466968_0069422_367_804 144
751 3300044765 Ga0466970_0060959 Ga0466970_0060959_863_1300 144
752 3300044842 Ga0466957_0003337 Ga0466957_0003337_6067_6504 144
753 3300044842 Ga0466957_0194949 Ga0466957_0194949_285_722 144
754 3300045049 Ga0466959_0003554 Ga0466959_0003554_3283_3720 144
755 3300045049 Ga0466959_0238404 Ga0466959_0238404_697_1134 144
756 3300045836 Ga0466958_0005596 Ga0466958_0005596_4507_4944 144
757 3300045836 Ga0466958_0030443 Ga0466958_0030443_1200_1637 144
758 3300045836 Ga0466958_0143179 Ga0466958_0143179_115_549 144
759 3300045976 Ga0466967_0003895 Ga0466967_0003895_9053_9490 144
760 3300045976 Ga0466967_0007111 Ga0466967_0007111_5963_6400 144
761 3300045976 Ga0466967_0011497 Ga0466967_0011497_4286_4720 144
762 3300045976 Ga0466967_0056803 Ga0466967_0056803_2259_2696 144
763 3300045976 Ga0466967_0086292 Ga0466967_0086292_1686_2156 144
764 3300045976 Ga0466967_0117327 Ga0466967_0117327_1837_2274 144
765 3300045976 Ga0466967_0207794 Ga0466967_0207794_310_747 144
766 3300045976 Ga0466967_0246677 Ga0466967_0246677_399_836 144
767 3300045976 Ga0466967_1002852 Ga0466967_1002852_306_743 144
768 3300046454 Ga0495592_0000660 Ga0495592_0000660_10560_10997 144
769 3300046454 Ga0495592_0593767 Ga0495592_0593767_156_590 144
770 3300046459 Ga0495629_1071117 Ga0495629_1071117_12_449 144
771 3300046461 Ga0495641_0316249 Ga0495641_0316249_14_451 144
772 3300046462 Ga0495651_0000034 Ga0495651_0000034_10578_11015 144
773 3300046462 Ga0495651_0092884 Ga0495651_0092884_626_1066 144
774 3300046463 Ga0495653_0004267 Ga0495653_0004267_591_1028 144
775 3300046463 Ga0495653_0078694 Ga0495653_0078694_1496_1936 144
776 3300046472 Ga0495580_0176297 Ga0495580_0176297_411_845 144
777 3300046473 Ga0495582_0191143 Ga0495582_0191143_302_736 144
778 3300046473 Ga0495582_0409476 Ga0495582_0409476_54_491 144
779 3300046473 Ga0495582_0478393 Ga0495582_0478393_166_603 144
780 3300046475 Ga0495639_0019026 Ga0495639_0019026_916_1350 144
781 3300046477 Ga0495664_0686478 Ga0495664_0686478_56_493 144
782 3300046511 Ga0495608_0003358 Ga0495608_0003358_464_901 144
783 3300046511 Ga0495608_0035925 Ga0495608_0035925_1312_1752 144
784 3300046514 Ga0495618_0002980 Ga0495618_0002980_6871_7308 144
785 3300046516 Ga0495628_0000184 Ga0495628_0000184_43818_44255 144
786 3300046517 Ga0495630_0309735 Ga0495630_0309735_383_817 144
787 3300046517 Ga0495630_0465347 Ga0495630_0465347_420_854 144
788 3300046523 Ga0495644_0002395 Ga0495644_0002395_3146_3583 144
789 3300046523 Ga0495644_0054024 Ga0495644_0054024_549_983 144
790 3300046525 Ga0495663_0056215 Ga0495663_0056215_130_564 144
791 3300046528 Ga0495642_0009669 Ga0495642_0009669_3106_3540 144
792 3300046528 Ga0495642_0041870 Ga0495642_0041870_92_526 144
793 3300046529 Ga0495652_0000319 Ga0495652_0000319_45833_46270 144
794 3300046533 Ga0495640_0278178 Ga0495640_0278178_116_553 144
795 3300046535 Ga0495586_0337734 Ga0495586_0337734_195_632 144
796 3300046536 Ga0495587_0001086 Ga0495587_0001086_10578_11015 144
797 3300046543 Ga0495645_0000646 Ga0495645_0000646_10578_11015 144
798 3300046559 Ga0495667_0048661 Ga0495667_0048661_1059_1499 144
799 3300046615 Ga0495656_0216783 Ga0495656_0216783_424_858 144
800 3300046642 Ga0495634_0049222 Ga0495634_0049222_1782_2222 144
801 3300046642 Ga0495634_0057751 Ga0495634_0057751_509_949 144
802 3300046648 Ga0495611_0055720 Ga0495611_0055720_721_1158 144
803 3300046663 Ga0495635_0037446 Ga0495635_0037446_180_620 144
804 3300046664 Ga0495659_0330892 Ga0495659_0330892_120_554 144
805 3300046674 Ga0495588_0041289 Ga0495588_0041289_1560_1994 144
806 3300046675 Ga0495657_0081837 Ga0495657_0081837_466_903 144
807 3300046678 Ga0495599_0000227 Ga0495599_0000227_3956_4393 144
808 3300046679 Ga0495623_0000601 Ga0495623_0000601_12966_13403 144
809 3300046679 Ga0495623_0093757 Ga0495623_0093757_49_489 144
810 3300046680 Ga0495646_0005450 Ga0495646_0005450_6942_7379 144
811 3300046683 Ga0495658_0145090 Ga0495658_0145090_59_496 144
812 3300046689 Ga0495613_0098497 Ga0495613_0098497_1018_1452 144
813 3300046689 Ga0495613_0247154 Ga0495613_0247154_421_858 144
814 3300046689 Ga0495613_0560334 Ga0495613_0560334_260_697 144
815 3300046690 Ga0495624_0008996 Ga0495624_0008996_5759_6196 144
816 3300046691 Ga0495670_0029542 Ga0495670_0029542_114_551 144
817 3300046794 Ga0495589_0147151 Ga0495589_0147151_514_948 144
818 3300046809 Ga0495600_0084236 Ga0495600_0084236_1258_1698 144
819 3300046809 Ga0495600_0365923 Ga0495600_0365923_423_860 144
820 3300046809 Ga0495600_0702501 Ga0495600_0702501_117_551 144
821 3300047315 Ga0495581_0160630 Ga0495581_0160630_186_620 144
822 3300047315 Ga0495581_0222917 Ga0495581_0222917_226_663 144
823 3300047317 Ga0495604_0000194 Ga0495604_0000194_10551_10988 144
824 3300047318 Ga0495636_0159082 Ga0495636_0159082_28_462 144
825 3300047319 Ga0495674_1028982 Ga0495674_1028982_50_490 144
826 3300047321 Ga0495676_0097590 Ga0495676_0097590_1480_1917 144
827 3300047321 Ga0495676_0098405 Ga0495676_0098405_827_1261 144
828 3300047444 Ga0495675_0000224 Ga0495675_0000224_10578_11015 144
829 3300047445 Ga0495677_0024362 Ga0495677_0024362_1522_1959 144
830 3300047471 Ga0495684_0091036 Ga0495684_0091036_123_563 144
831 3300048088 Ga0495602_0001529 Ga0495602_0001529_22282_22719 144
832 3300048088 Ga0495602_0050029 Ga0495602_0050029_688_1128 144
833 3300048903 Ga0496100_0004406 Ga0496100_0004406_3156_3593 144
834 3300048903 Ga0496100_0010904 Ga0496100_0010904_29_466 144
835 3300048903 Ga0496100_0036671 Ga0496100_0036671_1260_1697 144
836 3300048903 Ga0496100_0096918 Ga0496100_0096918_846_1280 144
837 3300048903 Ga0496100_0261178 Ga0496100_0261178_503_937 144
838 3300048903 Ga0496100_0922441 Ga0496100_0922441_104_538 144
839 3300048903 Ga0496100_1338262 Ga0496100_1338262_118_552 144
840 3300048904 Ga0496101_0004655 Ga0496101_0004655_4646_5083 144
841 3300048904 Ga0496101_0013017 Ga0496101_0013017_3044_3481 144
842 3300048904 Ga0496101_0065400 Ga0496101_0065400_1847_2281 144
843 3300048904 Ga0496101_0070263 Ga0496101_0070263_1267_1701 144
844 3300048904 Ga0496101_0507036 Ga0496101_0507036_304_741 144
845 3300048904 Ga0496101_0703668 Ga0496101_0703668_91_525 144
846 3300048904 Ga0496101_1044518 Ga0496101_1044518_189_626 144
847 3300048905 Ga0496102_0015692 Ga0496102_0015692_4574_5014 144
848 3300048905 Ga0496102_0040396 Ga0496102_0040396_1507_1941 144
849 3300048905 Ga0496102_0087213 Ga0496102_0087213_133_570 144
850 3300048905 Ga0496102_0091032 Ga0496102_0091032_2186_2623 144
851 3300048905 Ga0496102_0222108 Ga0496102_0222108_823_1260 144
852 3300048905 Ga0496102_0325689 Ga0496102_0325689_590_1024 144
853 3300048905 Ga0496102_0607800 Ga0496102_0607800_29_463 144
854 3300048905 Ga0496102_0753810 Ga0496102_0753810_185_619 144
855 3300048906 Ga0496103_0005102 Ga0496103_0005102_1841_2281 144
856 3300048906 Ga0496103_0011172 Ga0496103_0011172_2375_2812 144
857 3300048906 Ga0496103_0131263 Ga0496103_0131263_712_1149 144
858 3300048906 Ga0496103_0145971 Ga0496103_0145971_330_764 144
859 3300048906 Ga0496103_0326406 Ga0496103_0326406_465_902 144
860 3300048906 Ga0496103_0330838 Ga0496103_0330838_192_629 144
861 3300048907 Ga0496104_0000224 Ga0496104_0000224_48869_49306 144
862 3300048907 Ga0496104_0098359 Ga0496104_0098359_336_773 144
863 3300048907 Ga0496104_0156538 Ga0496104_0156538_987_1421 144
864 3300048907 Ga0496104_0314481 Ga0496104_0314481_432_869 144
865 3300048907 Ga0496104_0700693 Ga0496104_0700693_378_812 144
866 3300048907 Ga0496104_1002596 Ga0496104_1002596_96_533 144
867 3300048908 Ga0496105_0000234 Ga0496105_0000234_18454_18891 144
868 3300048908 Ga0496105_0014369 Ga0496105_0014369_3336_3770 144
869 3300048908 Ga0496105_0034363 Ga0496105_0034363_889_1323 144
870 3300048908 Ga0496105_0067458 Ga0496105_0067458_967_1404 144
871 3300048908 Ga0496105_0082597 Ga0496105_0082597_1993_2430 144
872 3300048908 Ga0496105_0095628 Ga0496105_0095628_1357_1797 144
873 3300048908 Ga0496105_0851581 Ga0496105_0851581_186_620 144
874 3300048909 Ga0496106_0060402 Ga0496106_0060402_1963_2397 144
875 3300048909 Ga0496106_0088170 Ga0496106_0088170_478_915 144
876 3300048909 Ga0496106_0201229 Ga0496106_0201229_404_841 144
877 3300048909 Ga0496106_0235686 Ga0496106_0235686_655_1089 144
878 3300048909 Ga0496106_0524720 Ga0496106_0524720_114_548 144
879 3300048909 Ga0496106_1056270 Ga0496106_1056270_101_538 144
880 3300048910 Ga0496107_0000435 Ga0496107_0000435_5807_6244 144
881 3300048910 Ga0496107_0006765 Ga0496107_0006765_7078_7512 144
882 3300048910 Ga0496107_0045031 Ga0496107_0045031_2527_2967 144
883 3300048910 Ga0496107_0078783 Ga0496107_0078783_751_1188 144
884 3300048910 Ga0496107_0273643 Ga0496107_0273643_569_1003 144
885 3300048910 Ga0496107_0926941 Ga0496107_0926941_26_460 144
886 3300048911 Ga0496108_0007844 Ga0496108_0007844_7675_8112 144
887 3300048911 Ga0496108_0033148 Ga0496108_0033148_2172_2609 144
888 3300048911 Ga0496108_0052345 Ga0496108_0052345_1268_1705 144
889 3300048911 Ga0496108_0780557 Ga0496108_0780557_240_677 144
890 3300048912 Ga0496109_0004645 Ga0496109_0004645_3670_4107 144
891 3300048912 Ga0496109_0018197 Ga0496109_0018197_2191_2625 144
892 3300048912 Ga0496109_0027975 Ga0496109_0027975_2260_2694 144
893 3300048912 Ga0496109_0037958 Ga0496109_0037958_1168_1605 144
894 3300048912 Ga0496109_0046713 Ga0496109_0046713_1151_1588 144
895 3300048912 Ga0496109_0272445 Ga0496109_0272445_183_617 144
896 3300048912 Ga0496109_0585632 Ga0496109_0585632_584_1021 144
897 3300048912 Ga0496109_0616573 Ga0496109_0616573_553_993 144
898 3300048912 Ga0496109_1766047 Ga0496109_1766047_67_501 144
899 3300048913 Ga0496110_0000673 Ga0496110_0000673_4712_5149 144
900 3300048913 Ga0496110_0007404 Ga0496110_0007404_242_679 144
901 3300048913 Ga0496110_0313174 Ga0496110_0313174_799_1233 144
902 3300048913 Ga0496110_0433791 Ga0496110_0433791_88_525 144
903 3300048913 Ga0496110_0578763 Ga0496110_0578763_71_505 144
904 3300048913 Ga0496110_0980618 Ga0496110_0980618_260_697 144
905 3300048914 Ga0496111_0000552 Ga0496111_0000552_2835_3272 144
906 3300048914 Ga0496111_0009530 Ga0496111_0009530_5100_5537 144
907 3300048914 Ga0496111_0029188 Ga0496111_0029188_722_1156 144
908 3300048914 Ga0496111_0064617 Ga0496111_0064617_1304_1741 144
909 3300048914 Ga0496111_0131371 Ga0496111_0131371_323_757 144
910 3300048914 Ga0496111_0142552 Ga0496111_0142552_138_578 144
911 3300048914 Ga0496111_0213972 Ga0496111_0213972_616_1053 144
912 3300048914 Ga0496111_0250445 Ga0496111_0250445_787_1221 144
913 3300048914 Ga0496111_0684799 Ga0496111_0684799_177_611 144
914 3300048915 Ga0496112_0003867 Ga0496112_0003867_11302_11736 144
915 3300048915 Ga0496112_0004943 Ga0496112_0004943_8666_9100 144
916 3300048915 Ga0496112_0049478 Ga0496112_0049478_570_1007 144
917 3300048915 Ga0496112_0143342 Ga0496112_0143342_1000_1437 144
918 3300048915 Ga0496112_0180748 Ga0496112_0180748_1612_2049 144
919 3300048915 Ga0496112_0213173 Ga0496112_0213173_163_597 144
920 3300048915 Ga0496112_0356507 Ga0496112_0356507_326_760 144
921 3300048915 Ga0496112_0513059 Ga0496112_0513059_167_601 144
922 3300048915 Ga0496112_0721121 Ga0496112_0721121_247_687 144
923 3300048915 Ga0496112_0964368 Ga0496112_0964368_128_565 144
924 3300048916 Ga0496113_0195875 Ga0496113_0195875_542_979 144
925 3300048916 Ga0496113_0264475 Ga0496113_0264475_285_719 144
926 3300048916 Ga0496113_0870221 Ga0496113_0870221_164_598 144
927 3300048916 Ga0496113_1350035 Ga0496113_1350035_52_492 144
928 3300048917 Ga0496114_0001528 Ga0496114_0001528_15694_16131 144
929 3300048917 Ga0496114_0004933 Ga0496114_0004933_6812_7246 144
930 3300048917 Ga0496114_0032392 Ga0496114_0032392_669_1109 144
931 3300048917 Ga0496114_0042955 Ga0496114_0042955_2922_3359 144
932 3300048917 Ga0496114_0137760 Ga0496114_0137760_1281_1718 144
933 3300048917 Ga0496114_0170497 Ga0496114_0170497_781_1215 144
934 3300048918 Ga0496115_0012226 Ga0496115_0012226_4736_5170 144
935 3300048918 Ga0496115_0014610 Ga0496115_0014610_1922_2362 144
936 3300048918 Ga0496115_0045147 Ga0496115_0045147_2696_3133 144
937 3300048918 Ga0496115_0402020 Ga0496115_0402020_555_992 144
938 3300049568 Ga0501031_0029292 Ga0501031_0029292_704_1138 144
939 3300049572 Ga0501036_0808932 Ga0501036_0808932_193_627 144
940 3300049573 Ga0501037_0147865 Ga0501037_0147865_540_974 144
941 3300049575 Ga0501039_0005439 Ga0501039_0005439_8861_9295 144
942 3300049576 Ga0501040_0029003 Ga0501040_0029003_157_591 144
943 3300049578 Ga0501042_0389243 Ga0501042_0389243_74_508 144
944 3300049579 Ga0501043_0416971 Ga0501043_0416971_122_556 144
945 3300049580 Ga0501046_0593892 Ga0501046_0593892_308_742 144
946 3300049582 Ga0501048_0040658 Ga0501048_0040658_622_1056 144
947 3300049583 Ga0501067_0080769 Ga0501067_0080769_331_765 144
948 3300049583 Ga0501067_0780233 Ga0501067_0780233_18_452 144
949 3300049584 Ga0501068_0070924 Ga0501068_0070924_106_540 144
950 3300049586 Ga0501070_0610159 Ga0501070_0610159_333_767 144
951 3300049586 Ga0501070_0913706 Ga0501070_0913706_133_567 144
952 3300049587 Ga0501071_0009020 Ga0501071_0009020_3635_4069 144
953 3300049588 Ga0501072_0270955 Ga0501072_0270955_682_1116 144
954 3300049588 Ga0501072_0423189 Ga0501072_0423189_475_909 144
955 3300049590 Ga0501074_0361816 Ga0501074_0361816_260_694 144
956 3300049590 Ga0501074_0916428 Ga0501074_0916428_55_489 144
957 3300049591 Ga0501075_0305852 Ga0501075_0305852_698_1132 144
958 3300049592 Ga0501076_0136331 Ga0501076_0136331_1281_1715 144
959 3300049741 Ga0501079_0342885 Ga0501079_0342885_594_1028 144
960 3300049743 Ga0501081_0085192 Ga0501081_0085192_1483_1917 144
961 3300049744 Ga0501083_0054058 Ga0501083_0054058_1845_2279 144
962 3300049824 Ga0501045_0022489 Ga0501045_0022489_983_1417 144
963 3300050492 nmdc:mga0yw44_168499_c1 nmdc:mga0yw44_168499_c1_730_1164 144
964 3300050507 nmdc:mga05p37_229997_c1 nmdc:mga05p37_229997_c1_1179_1613 144
965 3300050507 nmdc:mga05p37_65168_c1 nmdc:mga05p37_65168_c1_2006_2440 144
966 3300050511 nmdc:mga08y16_58178_c1 nmdc:mga08y16_58178_c1_3335_3772 144
967 3300050512 nmdc:mga0n895_157292_c1 nmdc:mga0n895_157292_c1_294_731 144
968 3300050512 nmdc:mga0n895_337963_c1 nmdc:mga0n895_337963_c1_390_824 144
969 3300050512 nmdc:mga0n895_687670_c1 nmdc:mga0n895_687670_c1_269_706 144
970 3300050513 nmdc:mga0rr50_305557_c1 nmdc:mga0rr50_305557_c1_322_759 144
971 3300050513 nmdc:mga0rr50_362333_c1 nmdc:mga0rr50_362333_c1_222_659 144
972 3300050513 nmdc:mga0rr50_97083_c1 nmdc:mga0rr50_97083_c1_740_1174 144
973 3300050514 nmdc:mga08x19_409862_c1 nmdc:mga08x19_409862_c1_380_820 144
974 3300050515 nmdc:mga0a205_214190_c1 nmdc:mga0a205_214190_c1_853_1287 144
975 3300053077 Ga0495601_0017330 Ga0495601_0017330_1817_2254 144
976 3300053083 Ga0495655_0012971 Ga0495655_0012971_342_776 144
977 3300053084 Ga0495595_0004475 Ga0495595_0004475_277_714 144
978 3300053084 Ga0495595_0136519 Ga0495595_0136519_268_708 144
979 3300053085 Ga0495619_0000370 Ga0495619_0000370_6434_6871 144
980 3300054114 Ga0501084_0044844 Ga0501084_0044844_1559_1993 144
981 3300054114 Ga0501084_0066420 Ga0501084_0066420_1284_1718 144
982 3300061719 Ga0466962_0017831 Ga0466962_0017831_1455_1892 144
983 3300061719 Ga0466962_0357879 Ga0466962_0357879_192_626 144
984 3300061734 Ga0530510_0084301 Ga0530510_0084301_1603_2037 144
985 3300061734 Ga0530510_0345962 Ga0530510_0345962_363_797 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

63

160

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9197 3 143
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9135 3 143
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9046 1 144
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9046 2 144
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.904 1 144
ID Description Score Start End Superfamily
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9117 3 143 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9055 3 143 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.891 1 144 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8848 4 142 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8848 6 143 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7W0QLY7-F1-model_v4 OsmC family peroxiredoxin 1.003 55 143 GO:0004601
GO:0006979
AF-A0A6G3XRH8-F1-model_v4 OsmC family peroxiredoxin 0.9951 61 143 GO:0004601
GO:0006979
AF-A0A538JYZ6-F1-model_v4 OsmC family peroxiredoxin 0.9884 1 144 GO:0004601
GO:0006979
AF-A0A353ZMU4-F1-model_v4 Peroxiredoxin 0.9847 57 144 GO:0004601
GO:0006979
AF-A0A6G3XRH8-F1-model_v4 OsmC family peroxiredoxin 0.9832 61 143 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
94.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map