F487501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 985 | 338 | 985 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10160592|Ga0157369_101605922 |
| Length | 165 |
| Sequence | MNAGTTAARIRSLGQQRRRNEMATDRRADVTWQGSLMEGSGTIRSTTSGKLGEQKVSWPNRAEDNPDATSPEELIAAAHAACYAMALSHALAQGGNAPDELQTSATVTFQPGEGITKIALTVDGRVPGIDAQQFEQAAQDAKQNCPVSKALAAVPEITIQASLSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 1.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 12.89 |
| Rhizosphere | 86.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10005153 | 3300002077 | Bacteria | 2704 |
| 2 | JGI24742J22300_10049925 | 3300002244 | Bacteria | 756 |
| 3 | rootH2_10145799 | 3300003320 | Bacteria | 1775 |
| 4 | JGI25407J50210_10019029 | 3300003373 | Bacteria | 1784 |
| 5 | Ga0070658_10028277 | 3300005327 | Bacteria | 4500 |
| 6 | Ga0070658_10079643 | 3300005327 | Bacteria | 2690 |
| 7 | Ga0070658_10141171 | 3300005327 | Bacteria | 2012 |
| 8 | Ga0070658_10397026 | 3300005327 | Bacteria | 1184 |
| 9 | Ga0070658_10648688 | 3300005327 | Bacteria | 916 |
| 10 | Ga0070683_100006562 | 3300005329 | Bacteria | 9771 |
| 11 | Ga0070683_100021449 | 3300005329 | Bacteria | 5766 |
| 12 | Ga0070683_100146936 | 3300005329 | Bacteria | 2234 |
| 13 | Ga0070683_100260818 | 3300005329 | Bacteria | 1648 |
| 14 | Ga0070690_100125816 | 3300005330 | Bacteria | 1725 |
| 15 | Ga0070690_101366406 | 3300005330 | Bacteria | 569 |
| 16 | Ga0070680_100010699 | 3300005336 | Bacteria | 7081 |
| 17 | Ga0070680_100027507 | 3300005336 | Bacteria | 4553 |
| 18 | Ga0070680_100232958 | 3300005336 | Bacteria | 1556 |
| 19 | Ga0070680_100266914 | 3300005336 | Bacteria | 1449 |
| 20 | Ga0070680_100984503 | 3300005336 | Bacteria | 728 |
| 21 | Ga0070682_100020032 | 3300005337 | Bacteria | 3931 |
| 22 | Ga0070682_100124898 | 3300005337 | Bacteria | 1733 |
| 23 | Ga0070682_100312310 | 3300005337 | Bacteria | 1158 |
| 24 | Ga0070682_100422041 | 3300005337 | Bacteria | 1014 |
| 25 | Ga0068868_100040728 | 3300005338 | Bacteria | 3616 |
| 26 | Ga0068868_100399438 | 3300005338 | Bacteria | 1186 |
| 27 | Ga0068868_100907006 | 3300005338 | Archaea | 801 |
| 28 | Ga0070660_100011899 | 3300005339 | Bacteria | 6204 |
| 29 | Ga0070660_100037138 | 3300005339 | Bacteria | 3693 |
| 30 | Ga0070660_100673639 | 3300005339 | Bacteria | 867 |
| 31 | Ga0070660_101432085 | 3300005339 | Bacteria | 587 |
| 32 | Ga0070689_100923289 | 3300005340 | Archaea | 773 |
| 33 | Ga0070691_10292626 | 3300005341 | Bacteria | 887 |
| 34 | Ga0070661_100172121 | 3300005344 | Bacteria | 1645 |
| 35 | Ga0070692_10025442 | 3300005345 | Bacteria | 2916 |
| 36 | Ga0070671_100184565 | 3300005355 | Bacteria | 1767 |
| 37 | Ga0070671_100189710 | 3300005355 | Bacteria | 1742 |
| 38 | Ga0070674_100073278 | 3300005356 | Bacteria | 2427 |
| 39 | Ga0070688_100045686 | 3300005365 | Bacteria | 2707 |
| 40 | Ga0070659_100029587 | 3300005366 | Bacteria | 4234 |
| 41 | Ga0070659_100124352 | 3300005366 | Bacteria | 2092 |
| 42 | Ga0070659_100634279 | 3300005366 | Bacteria | 920 |
| 43 | Ga0070703_10035822 | 3300005406 | Bacteria | 1522 |
| 44 | Ga0070709_10017111 | 3300005434 | Bacteria | 4151 |
| 45 | Ga0070709_10320167 | 3300005434 | Bacteria | 1138 |
| 46 | Ga0070714_100009938 | 3300005435 | Bacteria | 7505 |
| 47 | Ga0070714_100037737 | 3300005435 | Bacteria | 4061 |
| 48 | Ga0070714_100044953 | 3300005435 | Bacteria | 3740 |
| 49 | Ga0070714_100087445 | 3300005435 | Bacteria | 2726 |
| 50 | Ga0070714_100137329 | 3300005435 | Bacteria | 2191 |
| 51 | Ga0070714_100462205 | 3300005435 | Bacteria | 1207 |
| 52 | Ga0070713_100007160 | 3300005436 | Bacteria | 7805 |
| 53 | Ga0070713_100106750 | 3300005436 | Bacteria | 2435 |
| 54 | Ga0070710_10001797 | 3300005437 | Bacteria | 10144 |
| 55 | Ga0070710_10246260 | 3300005437 | Bacteria | 1147 |
| 56 | Ga0070710_10246810 | 3300005437 | Bacteria | 1146 |
| 57 | Ga0070710_10580965 | 3300005437 | Bacteria | 777 |
| 58 | Ga0070701_10013123 | 3300005438 | Bacteria | 3759 |
| 59 | Ga0070711_100082704 | 3300005439 | Bacteria | 2292 |
| 60 | Ga0070711_100109703 | 3300005439 | Bacteria | 2023 |
| 61 | Ga0070711_100140593 | 3300005439 | Bacteria | 1809 |
| 62 | Ga0070711_100251760 | 3300005439 | Bacteria | 1386 |
| 63 | Ga0070705_100103546 | 3300005440 | Bacteria | 1803 |
| 64 | Ga0070705_100227615 | 3300005440 | Bacteria | 1295 |
| 65 | Ga0070700_100005137 | 3300005441 | Bacteria | 6911 |
| 66 | Ga0070694_100187047 | 3300005444 | Bacteria | 1535 |
| 67 | Ga0070663_100165402 | 3300005455 | Bacteria | 1706 |
| 68 | Ga0070663_100182027 | 3300005455 | Bacteria | 1631 |
| 69 | Ga0070678_100007764 | 3300005456 | Bacteria | 6380 |
| 70 | Ga0070678_100636202 | 3300005456 | Bacteria | 956 |
| 71 | Ga0070678_100886505 | 3300005456 | Bacteria | 815 |
| 72 | Ga0070662_101510701 | 3300005457 | Bacteria | 579 |
| 73 | Ga0070681_10017854 | 3300005458 | Bacteria | 7090 |
| 74 | Ga0070681_10051277 | 3300005458 | Bacteria | 4116 |
| 75 | Ga0070681_10229762 | 3300005458 | Bacteria | 1770 |
| 76 | Ga0070681_10236695 | 3300005458 | Bacteria | 1740 |
| 77 | Ga0070681_10437565 | 3300005458 | Bacteria | 1220 |
| 78 | Ga0070681_10586761 | 3300005458 | Bacteria | 1028 |
| 79 | Ga0070681_11620582 | 3300005458 | Bacteria | 573 |
| 80 | Ga0068867_100046488 | 3300005459 | Bacteria | 3188 |
| 81 | Ga0070685_10077527 | 3300005466 | Bacteria | 1984 |
| 82 | Ga0070706_101278862 | 3300005467 | Bacteria | 673 |
| 83 | Ga0070707_100025765 | 3300005468 | Bacteria | 5582 |
| 84 | Ga0070707_100304464 | 3300005468 | Bacteria | 1549 |
| 85 | Ga0070698_100002914 | 3300005471 | Bacteria | 18836 |
| 86 | Ga0070698_100114693 | 3300005471 | Bacteria | 2658 |
| 87 | Ga0070698_100181898 | 3300005471 | Bacteria | 2040 |
| 88 | Ga0070698_100270808 | 3300005471 | Bacteria | 1630 |
| 89 | Ga0070679_100029228 | 3300005530 | Bacteria | 5438 |
| 90 | Ga0070679_100110684 | 3300005530 | Bacteria | 2733 |
| 91 | Ga0070679_100258710 | 3300005530 | Bacteria | 1696 |
| 92 | Ga0070679_100950938 | 3300005530 | Bacteria | 803 |
| 93 | Ga0070679_101743435 | 3300005530 | Bacteria | 571 |
| 94 | Ga0070679_101794976 | 3300005530 | Bacteria | 562 |
| 95 | Ga0070684_100008150 | 3300005535 | Bacteria | 8179 |
| 96 | Ga0070684_100040414 | 3300005535 | Bacteria | 4016 |
| 97 | Ga0070684_100260625 | 3300005535 | Bacteria | 1586 |
| 98 | Ga0070684_101161701 | 3300005535 | Bacteria | 726 |
| 99 | Ga0070684_101186283 | 3300005535 | Bacteria | 718 |
| 100 | Ga0070684_101192855 | 3300005535 | Bacteria | 716 |
| 101 | Ga0070684_101777082 | 3300005535 | Bacteria | 582 |
| 102 | Ga0068853_100059109 | 3300005539 | Bacteria | 3311 |
| 103 | Ga0068853_101281254 | 3300005539 | Bacteria | 708 |
| 104 | Ga0070672_100320970 | 3300005543 | Bacteria | 1316 |
| 105 | Ga0070686_100284373 | 3300005544 | Bacteria | 1221 |
| 106 | Ga0070695_100455635 | 3300005545 | Bacteria | 981 |
| 107 | Ga0070696_100020409 | 3300005546 | Bacteria | 4491 |
| 108 | Ga0070696_100477554 | 3300005546 | Bacteria | 988 |
| 109 | Ga0070693_100004618 | 3300005547 | Bacteria | 6537 |
| 110 | Ga0070693_100197461 | 3300005547 | Bacteria | 1305 |
| 111 | Ga0070693_100534058 | 3300005547 | Bacteria | 837 |
| 112 | Ga0070665_100018038 | 3300005548 | Bacteria | 7082 |
| 113 | Ga0070665_101039770 | 3300005548 | Bacteria | 831 |
| 114 | Ga0070704_100018182 | 3300005549 | Bacteria | 4487 |
| 115 | Ga0070704_100034939 | 3300005549 | Bacteria | 3413 |
| 116 | Ga0070704_100283928 | 3300005549 | Bacteria | 1373 |
| 117 | Ga0070704_101480419 | 3300005549 | Bacteria | 624 |
| 118 | Ga0068855_100149462 | 3300005563 | Bacteria | 2656 |
| 119 | Ga0068855_100871357 | 3300005563 | Bacteria | 953 |
| 120 | Ga0068855_101023909 | 3300005563 | Bacteria | 866 |
| 121 | Ga0068855_101035294 | 3300005563 | Bacteria | 861 |
| 122 | Ga0068856_100059260 | 3300005614 | Bacteria | 3781 |
| 123 | Ga0068856_100073164 | 3300005614 | Bacteria | 3394 |
| 124 | Ga0068856_100455018 | 3300005614 | Bacteria | 1301 |
| 125 | Ga0068856_100911453 | 3300005614 | Bacteria | 898 |
| 126 | Ga0068856_101465511 | 3300005614 | Bacteria | 697 |
| 127 | Ga0070702_100015913 | 3300005615 | Bacteria | 3850 |
| 128 | Ga0070702_100024100 | 3300005615 | Bacteria | 3242 |
| 129 | Ga0068852_100044443 | 3300005616 | Bacteria | 3772 |
| 130 | Ga0068852_100441584 | 3300005616 | Bacteria | 1286 |
| 131 | Ga0068852_100536706 | 3300005616 | Bacteria | 1169 |
| 132 | Ga0068859_100227120 | 3300005617 | Bacteria | 1955 |
| 133 | Ga0068864_101169583 | 3300005618 | Bacteria | 767 |
| 134 | Ga0068864_101396863 | 3300005618 | Bacteria | 702 |
| 135 | Ga0068866_10020135 | 3300005718 | Bacteria | 3051 |
| 136 | Ga0068861_100038349 | 3300005719 | Bacteria | 3567 |
| 137 | Ga0068863_100083643 | 3300005841 | Bacteria | 3024 |
| 138 | Ga0068860_100061442 | 3300005843 | Bacteria | 3570 |
| 139 | Ga0081455_10040841 | 3300005937 | Bacteria | 4087 |
| 140 | Ga0081455_10051736 | 3300005937 | Bacteria | 3521 |
| 141 | Ga0081538_10000565 | 3300005981 | Bacteria | 40995 |
| 142 | Ga0081538_10020213 | 3300005981 | Bacteria | 4914 |
| 143 | Ga0070717_10004885 | 3300006028 | Bacteria | 9755 |
| 144 | Ga0070717_10045128 | 3300006028 | Bacteria | 3603 |
| 145 | Ga0070717_10066518 | 3300006028 | Bacteria | 2997 |
| 146 | Ga0070717_10122989 | 3300006028 | Bacteria | 2225 |
| 147 | Ga0070717_10177241 | 3300006028 | Bacteria | 1856 |
| 148 | Ga0070717_10718537 | 3300006028 | Bacteria | 908 |
| 149 | Ga0070717_11215584 | 3300006028 | Bacteria | 686 |
| 150 | Ga0075365_10019883 | 3300006038 | Bacteria | 4154 |
| 151 | Ga0070715_10001967 | 3300006163 | Bacteria | 6192 |
| 152 | Ga0070715_10029792 | 3300006163 | Bacteria | 2201 |
| 153 | Ga0070716_100000458 | 3300006173 | Bacteria | 16870 |
| 154 | Ga0070712_100003766 | 3300006175 | Bacteria | 9343 |
| 155 | Ga0070712_100030800 | 3300006175 | Bacteria | 3610 |
| 156 | Ga0070712_100138100 | 3300006175 | Bacteria | 1856 |
| 157 | Ga0070712_100270618 | 3300006175 | Bacteria | 1364 |
| 158 | Ga0070712_100407967 | 3300006175 | Bacteria | 1123 |
| 159 | Ga0070712_100816050 | 3300006175 | Bacteria | 801 |
| 160 | Ga0097621_100067240 | 3300006237 | Bacteria | 2953 |
| 161 | Ga0068871_100094508 | 3300006358 | Bacteria | 2496 |
| 162 | Ga0068871_100228040 | 3300006358 | Bacteria | 1616 |
| 163 | Ga0068871_101918336 | 3300006358 | Bacteria | 563 |
| 164 | Ga0075431_100063116 | 3300006847 | Bacteria | 3822 |
| 165 | Ga0075433_10443802 | 3300006852 | Bacteria | 1144 |
| 166 | Ga0075433_11032740 | 3300006852 | Bacteria | 716 |
| 167 | Ga0075433_11058702 | 3300006852 | Bacteria | 706 |
| 168 | Ga0075434_100024252 | 3300006871 | Bacteria | 5929 |
| 169 | Ga0075434_100583166 | 3300006871 | Bacteria | 1137 |
| 170 | Ga0075434_100865927 | 3300006871 | Bacteria | 919 |
| 171 | Ga0075434_101286834 | 3300006871 | Bacteria | 742 |
| 172 | Ga0068865_100007703 | 3300006881 | Bacteria | 6635 |
| 173 | Ga0068865_100233232 | 3300006881 | Bacteria | 1445 |
| 174 | Ga0075436_100046335 | 3300006914 | Bacteria | 2998 |
| 175 | Ga0075436_100361909 | 3300006914 | Bacteria | 1047 |
| 176 | Ga0097620_100227122 | 3300006931 | Bacteria | 1955 |
| 177 | Ga0075435_100106665 | 3300007076 | Bacteria | 2326 |
| 178 | Ga0075435_100147410 | 3300007076 | Bacteria | 1977 |
| 179 | Ga0075435_100722467 | 3300007076 | Bacteria | 866 |
| 180 | Ga0075435_100794031 | 3300007076 | Bacteria | 824 |
| 181 | Ga0099795_10247292 | 3300007788 | Bacteria | 768 |
| 182 | Ga0105240_10053208 | 3300009093 | Bacteria | 5084 |
| 183 | Ga0105240_10132171 | 3300009093 | Bacteria | 2993 |
| 184 | Ga0111539_10297055 | 3300009094 | Bacteria | 1880 |
| 185 | Ga0105245_10022340 | 3300009098 | Bacteria | 5553 |
| 186 | Ga0105245_10087652 | 3300009098 | Bacteria | 2857 |
| 187 | Ga0105245_10130395 | 3300009098 | Bacteria | 2357 |
| 188 | Ga0105245_10273982 | 3300009098 | Bacteria | 1647 |
| 189 | Ga0105245_10490782 | 3300009098 | Bacteria | 1243 |
| 190 | Ga0105245_10523505 | 3300009098 | Bacteria | 1205 |
| 191 | Ga0105245_10588509 | 3300009098 | Bacteria | 1138 |
| 192 | Ga0105245_11770122 | 3300009098 | Bacteria | 670 |
| 193 | Ga0105247_10018625 | 3300009101 | Bacteria | 4167 |
| 194 | Ga0105247_11506430 | 3300009101 | Bacteria | 549 |
| 195 | Ga0114129_10067445 | 3300009147 | Bacteria | 4990 |
| 196 | Ga0114129_10252621 | 3300009147 | Bacteria | 2366 |
| 197 | Ga0114129_10315344 | 3300009147 | Bacteria | 2080 |
| 198 | Ga0114129_10720593 | 3300009147 | Bacteria | 1280 |
| 199 | Ga0114129_11402432 | 3300009147 | Bacteria | 862 |
| 200 | Ga0114129_11810409 | 3300009147 | Bacteria | 742 |
| 201 | Ga0105243_10121676 | 3300009148 | Bacteria | 2201 |
| 202 | Ga0105243_10451799 | 3300009148 | Bacteria | 1206 |
| 203 | Ga0105241_10042368 | 3300009174 | Bacteria | 3443 |
| 204 | Ga0105241_10131538 | 3300009174 | Bacteria | 2027 |
| 205 | Ga0105241_10190465 | 3300009174 | Bacteria | 1707 |
| 206 | Ga0105242_10150103 | 3300009176 | Bacteria | 2031 |
| 207 | Ga0105242_10296813 | 3300009176 | Bacteria | 1473 |
| 208 | Ga0105242_10302755 | 3300009176 | Bacteria | 1460 |
| 209 | Ga0105242_10784195 | 3300009176 | Bacteria | 942 |
| 210 | Ga0105248_10215622 | 3300009177 | Bacteria | 2162 |
| 211 | Ga0105248_10226015 | 3300009177 | Bacteria | 2107 |
| 212 | Ga0105248_10458662 | 3300009177 | Bacteria | 1437 |
| 213 | Ga0105248_11103642 | 3300009177 | Bacteria | 897 |
| 214 | Ga0105237_10050489 | 3300009545 | Bacteria | 4179 |
| 215 | Ga0105238_10305213 | 3300009551 | Bacteria | 1576 |
| 216 | Ga0105238_10457584 | 3300009551 | Bacteria | 1273 |
| 217 | Ga0105238_10796794 | 3300009551 | Bacteria | 960 |
| 218 | Ga0105238_10827683 | 3300009551 | Bacteria | 942 |
| 219 | Ga0105249_10014061 | 3300009553 | Bacteria | 7075 |
| 220 | Ga0105249_11516808 | 3300009553 | Bacteria | 743 |
| 221 | Ga0105239_10306154 | 3300010375 | Bacteria | 1790 |
| 222 | Ga0105239_10477830 | 3300010375 | Bacteria | 1416 |
| 223 | Ga0105239_10678086 | 3300010375 | Bacteria | 1178 |
| 224 | Ga0105246_10096802 | 3300011119 | Bacteria | 2140 |
| 225 | Ga0105246_10167261 | 3300011119 | Bacteria | 1681 |
| 226 | Ga0157373_10081015 | 3300013100 | Bacteria | 2289 |
| 227 | Ga0157373_10350753 | 3300013100 | Bacteria | 1053 |
| 228 | Ga0157373_10367032 | 3300013100 | Bacteria | 1028 |
| 229 | Ga0157373_10424928 | 3300013100 | Bacteria | 954 |
| 230 | Ga0157373_10953659 | 3300013100 | Bacteria | 638 |
| 231 | Ga0157371_10070716 | 3300013102 | Bacteria | 2470 |
| 232 | Ga0157371_10378605 | 3300013102 | Bacteria | 1033 |
| 233 | Ga0157371_10719588 | 3300013102 | Bacteria | 748 |
| 234 | Ga0157370_10069449 | 3300013104 | Bacteria | 3327 |
| 235 | Ga0157370_10184027 | 3300013104 | Bacteria | 1940 |
| 236 | Ga0157370_10477258 | 3300013104 | Bacteria | 1146 |
| 237 | Ga0157370_10517857 | 3300013104 | Bacteria | 1095 |
| 238 | Ga0157369_10075073 | 3300013105 | Bacteria | 3625 |
| 239 | Ga0157369_10160592 | 3300013105 | Bacteria | 2372 |
| 240 | Ga0157369_10327266 | 3300013105 | Bacteria | 1592 |
| 241 | Ga0157369_10351160 | 3300013105 | Unclassified | 1532 |
| 242 | Ga0157369_10554559 | 3300013105 | Bacteria | 1188 |
| 243 | Ga0157369_10906191 | 3300013105 | Archaea | 904 |
| 244 | Ga0157369_11024689 | 3300013105 | Bacteria | 845 |
| 245 | Ga0157374_10039944 | 3300013296 | Bacteria | 4320 |
| 246 | Ga0157374_10093305 | 3300013296 | Bacteria | 2874 |
| 247 | Ga0157374_10699746 | 3300013296 | Bacteria | 1026 |
| 248 | Ga0157378_10105188 | 3300013297 | Bacteria | 2580 |
| 249 | Ga0157372_10212225 | 3300013307 | Bacteria | 2243 |
| 250 | Ga0157372_10345801 | 3300013307 | Bacteria | 1733 |
| 251 | Ga0157372_10655564 | 3300013307 | Bacteria | 1222 |
| 252 | Ga0157372_10766362 | 3300013307 | Bacteria | 1122 |
| 253 | Ga0157372_10767644 | 3300013307 | Bacteria | 1121 |
| 254 | Ga0157372_12223446 | 3300013307 | Bacteria | 630 |
| 255 | Ga0157375_10057988 | 3300013308 | Bacteria | 3829 |
| 256 | Ga0157375_11184822 | 3300013308 | Bacteria | 896 |
| 257 | Ga0157380_10021024 | 3300014326 | Bacteria | 4889 |
| 258 | Ga0182008_10079629 | 3300014497 | Bacteria | 1612 |
| 259 | Ga0182008_10152412 | 3300014497 | Bacteria | 1160 |
| 260 | Ga0157377_10003961 | 3300014745 | Bacteria | 6752 |
| 261 | Ga0157377_10358249 | 3300014745 | Bacteria | 981 |
| 262 | Ga0157379_10522780 | 3300014968 | Bacteria | 1102 |
| 263 | Ga0157376_10053378 | 3300014969 | Bacteria | 3365 |
| 264 | Ga0157376_10116057 | 3300014969 | Bacteria | 2364 |
| 265 | Ga0157376_11346031 | 3300014969 | Bacteria | 745 |
| 266 | Ga0182006_1118157 | 3300015261 | Bacteria | 924 |
| 267 | Ga0182006_1130787 | 3300015261 | Bacteria | 864 |
| 268 | Ga0163161_10150015 | 3300017792 | Bacteria | 1771 |
| 269 | Ga0197907_11093402 | 3300020069 | Bacteria | 2661 |
| 270 | Ga0206356_10416366 | 3300020070 | Bacteria | 645 |
| 271 | Ga0206356_11466129 | 3300020070 | Bacteria | 680 |
| 272 | Ga0206356_11562056 | 3300020070 | Bacteria | 1523 |
| 273 | Ga0206349_1562762 | 3300020075 | Bacteria | 546 |
| 274 | Ga0206354_10956547 | 3300020081 | Bacteria | 1123 |
| 275 | Ga0206354_11132402 | 3300020081 | Bacteria | 1177 |
| 276 | Ga0206354_11399885 | 3300020081 | Bacteria | 3652 |
| 277 | Ga0206353_10006983 | 3300020082 | Bacteria | 1917 |
| 278 | Ga0206353_11073345 | 3300020082 | Bacteria | 1121 |
| 279 | Ga0206353_11081997 | 3300020082 | Bacteria | 1239 |
| 280 | Ga0206353_11281008 | 3300020082 | Bacteria | 8162 |
| 281 | Ga0224712_10269621 | 3300022467 | Bacteria | 790 |
| 282 | Ga0224712_10368756 | 3300022467 | Bacteria | 681 |
| 283 | Ga0224712_10597468 | 3300022467 | Bacteria | 539 |
| 284 | Ga0207653_10027132 | 3300025885 | Bacteria | 1838 |
| 285 | Ga0207692_10005665 | 3300025898 | Bacteria | 5014 |
| 286 | Ga0207692_10154895 | 3300025898 | Bacteria | 1315 |
| 287 | Ga0207642_10016067 | 3300025899 | Bacteria | 2809 |
| 288 | Ga0207710_10029092 | 3300025900 | Bacteria | 2402 |
| 289 | Ga0207688_10049727 | 3300025901 | Bacteria | 2344 |
| 290 | Ga0207688_10723464 | 3300025901 | Bacteria | 630 |
| 291 | Ga0207680_10365578 | 3300025903 | Bacteria | 1015 |
| 292 | Ga0207647_10053456 | 3300025904 | Bacteria | 2489 |
| 293 | Ga0207647_10181781 | 3300025904 | Bacteria | 1221 |
| 294 | Ga0207685_10000925 | 3300025905 | Bacteria | 5603 |
| 295 | Ga0207685_10060928 | 3300025905 | Bacteria | 1494 |
| 296 | Ga0207699_10005147 | 3300025906 | Bacteria | 6262 |
| 297 | Ga0207699_10917393 | 3300025906 | Bacteria | 646 |
| 298 | Ga0207643_10367966 | 3300025908 | Bacteria | 905 |
| 299 | Ga0207705_10057765 | 3300025909 | Bacteria | 2799 |
| 300 | Ga0207705_10203997 | 3300025909 | Bacteria | 1498 |
| 301 | Ga0207705_11079779 | 3300025909 | Bacteria | 619 |
| 302 | Ga0207684_10521210 | 3300025910 | Bacteria | 1018 |
| 303 | Ga0207654_10389101 | 3300025911 | Bacteria | 967 |
| 304 | Ga0207707_10014650 | 3300025912 | Bacteria | 6832 |
| 305 | Ga0207707_10061659 | 3300025912 | Bacteria | 3263 |
| 306 | Ga0207707_10078672 | 3300025912 | Bacteria | 2880 |
| 307 | Ga0207707_10093608 | 3300025912 | Bacteria | 2625 |
| 308 | Ga0207707_10328587 | 3300025912 | Bacteria | 1319 |
| 309 | Ga0207707_10371714 | 3300025912 | Bacteria | 1230 |
| 310 | Ga0207707_10602573 | 3300025912 | Bacteria | 930 |
| 311 | Ga0207707_10848421 | 3300025912 | Bacteria | 758 |
| 312 | Ga0207695_10026136 | 3300025913 | Bacteria | 6519 |
| 313 | Ga0207695_10062357 | 3300025913 | Bacteria | 3849 |
| 314 | Ga0207693_10000860 | 3300025915 | Bacteria | 27073 |
| 315 | Ga0207693_10004312 | 3300025915 | Bacteria | 12042 |
| 316 | Ga0207693_10044202 | 3300025915 | Bacteria | 3501 |
| 317 | Ga0207693_10241875 | 3300025915 | Bacteria | 1417 |
| 318 | Ga0207663_10006640 | 3300025916 | Bacteria | 5944 |
| 319 | Ga0207663_10118065 | 3300025916 | Bacteria | 1811 |
| 320 | Ga0207663_10148746 | 3300025916 | Bacteria | 1640 |
| 321 | Ga0207663_10225357 | 3300025916 | Bacteria | 1366 |
| 322 | Ga0207663_10974781 | 3300025916 | Bacteria | 679 |
| 323 | Ga0207660_10064459 | 3300025917 | Bacteria | 2645 |
| 324 | Ga0207660_10274671 | 3300025917 | Bacteria | 1336 |
| 325 | Ga0207660_10453966 | 3300025917 | Bacteria | 1037 |
| 326 | Ga0207660_10735733 | 3300025917 | Bacteria | 805 |
| 327 | Ga0207657_10025169 | 3300025919 | Bacteria | 5493 |
| 328 | Ga0207657_10042837 | 3300025919 | Bacteria | 3991 |
| 329 | Ga0207657_10136434 | 3300025919 | Bacteria | 2007 |
| 330 | Ga0207657_10333579 | 3300025919 | Bacteria | 1198 |
| 331 | Ga0207657_10377105 | 3300025919 | Bacteria | 1117 |
| 332 | Ga0207657_10379853 | 3300025919 | Bacteria | 1113 |
| 333 | Ga0207657_10418825 | 3300025919 | Bacteria | 1053 |
| 334 | Ga0207649_10072216 | 3300025920 | Bacteria | 2207 |
| 335 | Ga0207652_10327356 | 3300025921 | Bacteria | 1383 |
| 336 | Ga0207652_10359706 | 3300025921 | Bacteria | 1314 |
| 337 | Ga0207652_10864184 | 3300025921 | Bacteria | 800 |
| 338 | Ga0207652_10864532 | 3300025921 | Bacteria | 800 |
| 339 | Ga0207652_10876554 | 3300025921 | Bacteria | 794 |
| 340 | Ga0207652_10976962 | 3300025921 | Bacteria | 745 |
| 341 | Ga0207652_11120231 | 3300025921 | Bacteria | 688 |
| 342 | Ga0207652_11449402 | 3300025921 | Bacteria | 590 |
| 343 | Ga0207646_10005438 | 3300025922 | Bacteria | 13400 |
| 344 | Ga0207646_10030202 | 3300025922 | Bacteria | 4916 |
| 345 | Ga0207646_10682508 | 3300025922 | Bacteria | 919 |
| 346 | Ga0207694_10015264 | 3300025924 | Bacteria | 5795 |
| 347 | Ga0207694_10171558 | 3300025924 | Bacteria | 1756 |
| 348 | Ga0207694_10425771 | 3300025924 | Bacteria | 1106 |
| 349 | Ga0207694_10714524 | 3300025924 | Bacteria | 845 |
| 350 | Ga0207659_10446433 | 3300025926 | Bacteria | 1089 |
| 351 | Ga0207687_10050927 | 3300025927 | Bacteria | 2885 |
| 352 | Ga0207687_10211193 | 3300025927 | Bacteria | 1523 |
| 353 | Ga0207687_10341195 | 3300025927 | Bacteria | 1218 |
| 354 | Ga0207687_10474474 | 3300025927 | Bacteria | 1041 |
| 355 | Ga0207687_10523915 | 3300025927 | Bacteria | 992 |
| 356 | Ga0207700_10039800 | 3300025928 | Bacteria | 3425 |
| 357 | Ga0207700_10400851 | 3300025928 | Bacteria | 1202 |
| 358 | Ga0207664_10015153 | 3300025929 | Bacteria | 5587 |
| 359 | Ga0207664_10035134 | 3300025929 | Bacteria | 3865 |
| 360 | Ga0207664_10050563 | 3300025929 | Bacteria | 3278 |
| 361 | Ga0207664_10059772 | 3300025929 | Bacteria | 3037 |
| 362 | Ga0207664_10166709 | 3300025929 | Bacteria | 1882 |
| 363 | Ga0207664_10205090 | 3300025929 | Bacteria | 1703 |
| 364 | Ga0207664_10229091 | 3300025929 | Bacteria | 1614 |
| 365 | Ga0207664_10383241 | 3300025929 | Bacteria | 1248 |
| 366 | Ga0207664_10431408 | 3300025929 | Bacteria | 1175 |
| 367 | Ga0207664_11876071 | 3300025929 | Bacteria | 522 |
| 368 | Ga0207644_10049049 | 3300025931 | Bacteria | 3021 |
| 369 | Ga0207644_10326362 | 3300025931 | Bacteria | 1242 |
| 370 | Ga0207690_10109203 | 3300025932 | Bacteria | 1989 |
| 371 | Ga0207690_10144013 | 3300025932 | Bacteria | 1759 |
| 372 | Ga0207690_10174389 | 3300025932 | Bacteria | 1613 |
| 373 | Ga0207690_11369143 | 3300025932 | Bacteria | 592 |
| 374 | Ga0207706_10264510 | 3300025933 | Bacteria | 1501 |
| 375 | Ga0207686_10047158 | 3300025934 | Bacteria | 2662 |
| 376 | Ga0207686_10344699 | 3300025934 | Bacteria | 1120 |
| 377 | Ga0207686_10605421 | 3300025934 | Bacteria | 863 |
| 378 | Ga0207686_11058438 | 3300025934 | Bacteria | 660 |
| 379 | Ga0207709_10001472 | 3300025935 | Bacteria | 16327 |
| 380 | Ga0207709_10633159 | 3300025935 | Bacteria | 850 |
| 381 | Ga0207670_10500729 | 3300025936 | Bacteria | 986 |
| 382 | Ga0207670_10781250 | 3300025936 | Archaea | 795 |
| 383 | Ga0207669_10262640 | 3300025937 | Bacteria | 1292 |
| 384 | Ga0207704_10009369 | 3300025938 | Bacteria | 4723 |
| 385 | Ga0207704_10030898 | 3300025938 | Bacteria | 3010 |
| 386 | Ga0207665_10000070 | 3300025939 | Bacteria | 66142 |
| 387 | Ga0207665_10383881 | 3300025939 | Bacteria | 1067 |
| 388 | Ga0207665_11155525 | 3300025939 | Bacteria | 617 |
| 389 | Ga0207691_10026395 | 3300025940 | Bacteria | 5450 |
| 390 | Ga0207711_10149353 | 3300025941 | Bacteria | 2108 |
| 391 | Ga0207711_10341355 | 3300025941 | Bacteria | 1386 |
| 392 | Ga0207711_10530542 | 3300025941 | Bacteria | 1098 |
| 393 | Ga0207661_10039266 | 3300025944 | Bacteria | 3714 |
| 394 | Ga0207661_10050622 | 3300025944 | Bacteria | 3310 |
| 395 | Ga0207661_10204434 | 3300025944 | Bacteria | 1738 |
| 396 | Ga0207679_10035943 | 3300025945 | Bacteria | 3509 |
| 397 | Ga0207667_10241656 | 3300025949 | Bacteria | 1848 |
| 398 | Ga0207667_10404213 | 3300025949 | Bacteria | 1390 |
| 399 | Ga0207667_10473051 | 3300025949 | Bacteria | 1272 |
| 400 | Ga0207667_10960821 | 3300025949 | Bacteria | 843 |
| 401 | Ga0207667_11112171 | 3300025949 | Bacteria | 773 |
| 402 | Ga0207712_10109438 | 3300025961 | Bacteria | 2070 |
| 403 | Ga0207712_10380368 | 3300025961 | Bacteria | 1181 |
| 404 | Ga0207668_11119590 | 3300025972 | Bacteria | 706 |
| 405 | Ga0207677_10018592 | 3300026023 | Bacteria | 4173 |
| 406 | Ga0207677_10231400 | 3300026023 | Bacteria | 1489 |
| 407 | Ga0207677_11446935 | 3300026023 | Unclassified | 634 |
| 408 | Ga0207639_10163601 | 3300026041 | Bacteria | 1877 |
| 409 | Ga0207639_10539286 | 3300026041 | Bacteria | 1070 |
| 410 | Ga0207678_10047021 | 3300026067 | Bacteria | 3732 |
| 411 | Ga0207678_10246409 | 3300026067 | Bacteria | 1530 |
| 412 | Ga0207708_10000913 | 3300026075 | Bacteria | 22178 |
| 413 | Ga0207702_10081538 | 3300026078 | Bacteria | 2810 |
| 414 | Ga0207702_10301959 | 3300026078 | Bacteria | 1520 |
| 415 | Ga0207702_10717867 | 3300026078 | Bacteria | 985 |
| 416 | Ga0207702_11541908 | 3300026078 | Bacteria | 658 |
| 417 | Ga0207641_10207834 | 3300026088 | Bacteria | 1809 |
| 418 | Ga0207641_10286333 | 3300026088 | Bacteria | 1552 |
| 419 | Ga0207648_10000540 | 3300026089 | Bacteria | 42191 |
| 420 | Ga0207648_10543977 | 3300026089 | Bacteria | 1066 |
| 421 | Ga0207676_10551968 | 3300026095 | Bacteria | 1101 |
| 422 | Ga0207674_10612019 | 3300026116 | Bacteria | 1052 |
| 423 | Ga0207675_100015908 | 3300026118 | Bacteria | 7017 |
| 424 | Ga0207683_10000587 | 3300026121 | Bacteria | 33514 |
| 425 | Ga0207683_10008984 | 3300026121 | Bacteria | 8513 |
| 426 | Ga0207683_10067372 | 3300026121 | Bacteria | 3158 |
| 427 | Ga0207683_10580500 | 3300026121 | Bacteria | 1037 |
| 428 | Ga0207683_10802018 | 3300026121 | Bacteria | 874 |
| 429 | Ga0207698_10051379 | 3300026142 | Bacteria | 3151 |
| 430 | Ga0207698_10464943 | 3300026142 | Bacteria | 1224 |
| 431 | Ga0207698_10916821 | 3300026142 | Bacteria | 884 |
| 432 | Ga0207428_10356841 | 3300027907 | Bacteria | 1075 |
| 433 | Ga0268264_10048639 | 3300028381 | Bacteria | 3528 |
| 434 | Ga0265337_1034958 | 3300028556 | Bacteria | 1475 |
| 435 | Ga0265326_10052270 | 3300028558 | Bacteria | 1157 |
| 436 | Ga0265326_10083143 | 3300028558 | Bacteria | 905 |
| 437 | Ga0265319_1018082 | 3300028563 | Bacteria | 2666 |
| 438 | Ga0265319_1024126 | 3300028563 | Bacteria | 2193 |
| 439 | Ga0265319_1053860 | 3300028563 | Bacteria | 1320 |
| 440 | Ga0265334_10019415 | 3300028573 | Bacteria | 2796 |
| 441 | Ga0265334_10022996 | 3300028573 | Bacteria | 2538 |
| 442 | Ga0265334_10180159 | 3300028573 | Bacteria | 738 |
| 443 | Ga0265318_10004780 | 3300028577 | Bacteria | 6485 |
| 444 | Ga0265318_10023055 | 3300028577 | Bacteria | 2484 |
| 445 | Ga0265323_10200907 | 3300028653 | Bacteria | 627 |
| 446 | Ga0265322_10037177 | 3300028654 | Bacteria | 1387 |
| 447 | Ga0265336_10006870 | 3300028666 | Bacteria | 4074 |
| 448 | Ga0265338_10004412 | 3300028800 | Bacteria | 19025 |
| 449 | Ga0265338_10008321 | 3300028800 | Bacteria | 12619 |
| 450 | Ga0265338_10015365 | 3300028800 | Bacteria | 8416 |
| 451 | Ga0265338_10033767 | 3300028800 | Bacteria | 4958 |
| 452 | Ga0265338_10325964 | 3300028800 | Bacteria | 1110 |
| 453 | Ga0265338_10742252 | 3300028800 | Bacteria | 675 |
| 454 | Ga0265330_10046868 | 3300031235 | Bacteria | 1903 |
| 455 | Ga0265330_10145155 | 3300031235 | Bacteria | 1009 |
| 456 | Ga0265332_10101710 | 3300031238 | Bacteria | 1212 |
| 457 | Ga0265320_10004939 | 3300031240 | Bacteria | 8654 |
| 458 | Ga0265320_10313680 | 3300031240 | Bacteria | 693 |
| 459 | Ga0265325_10040329 | 3300031241 | Bacteria | 2452 |
| 460 | Ga0265325_10072684 | 3300031241 | Bacteria | 1723 |
| 461 | Ga0265329_10016002 | 3300031242 | Bacteria | 2608 |
| 462 | Ga0265340_10012337 | 3300031247 | Bacteria | 4515 |
| 463 | Ga0265340_10230654 | 3300031247 | Bacteria | 828 |
| 464 | Ga0265339_10175154 | 3300031249 | Bacteria | 1071 |
| 465 | Ga0265327_10084052 | 3300031251 | Bacteria | 1565 |
| 466 | Ga0265327_10098284 | 3300031251 | Bacteria | 1416 |
| 467 | Ga0265327_10121281 | 3300031251 | Bacteria | 1238 |
| 468 | Ga0265327_10144496 | 3300031251 | Bacteria | 1109 |
| 469 | Ga0265316_10004106 | 3300031344 | Bacteria | 14579 |
| 470 | Ga0265316_10010660 | 3300031344 | Bacteria | 8355 |
| 471 | Ga0265313_10006856 | 3300031595 | Bacteria | 7941 |
| 472 | Ga0265314_10006499 | 3300031711 | Bacteria | 10333 |
| 473 | Ga0265314_10028327 | 3300031711 | Bacteria | 4177 |
| 474 | Ga0265314_10039527 | 3300031711 | Bacteria | 3396 |
| 475 | Ga0265342_10033203 | 3300031712 | Bacteria | 3175 |
| 476 | Ga0373934_0268851 | 3300035086 | Bacteria | 706 |
| 477 | Ga0373941_0216203 | 3300035115 | Unclassified | 735 |
| 478 | Ga0373941_0307850 | 3300035115 | Bacteria | 634 |
| 479 | Ga0373953_0547168 | 3300035117 | Bacteria | 515 |
| 480 | Ga0373954_0161668 | 3300035118 | Bacteria | 1096 |
| 481 | Ga0373956_0056197 | 3300035119 | Bacteria | 1776 |
| 482 | Ga0373960_0036954 | 3300035121 | Bacteria | 1394 |
| 483 | Ga0373943_0181868 | 3300035170 | Bacteria | 1156 |
| 484 | Ga0373955_0169132 | 3300035172 | Bacteria | 1293 |
| 485 | Ga0373961_0203278 | 3300035241 | Bacteria | 700 |
| 486 | Ga0373962_0092917 | 3300035242 | Bacteria | 932 |
| 487 | Ga0373924_0230442 | 3300035410 | Bacteria | 819 |
| 488 | Ga0373931_0280972 | 3300035691 | Bacteria | 1022 |
| 489 | Ga0373931_0676639 | 3300035691 | Bacteria | 680 |
| 490 | Ga0373927_0597580 | 3300035695 | Bacteria | 729 |
| 491 | Ga0373927_0801886 | 3300035695 | Bacteria | 622 |
| 492 | Ga0373947_0052627 | 3300035725 | Bacteria | 2453 |
| 493 | Ga0373947_0079127 | 3300035725 | Bacteria | 2031 |
| 494 | Ga0373947_0115982 | 3300035725 | Bacteria | 1698 |
| 495 | Ga0373947_0777108 | 3300035725 | Bacteria | 654 |
| 496 | Ga0373937_0032363 | 3300036401 | Bacteria | 4743 |
| 497 | Ga0373937_0122282 | 3300036401 | Bacteria | 2426 |
| 498 | Ga0373925_0734677 | 3300037068 | Bacteria | 814 |
| 499 | Ga0395899_0020210 | 3300037312 | Bacteria | 5053 |
| 500 | Ga0395899_0098323 | 3300037312 | Bacteria | 2114 |
| 501 | Ga0395899_0241490 | 3300037312 | Bacteria | 1243 |
| 502 | Ga0395899_0329322 | 3300037312 | Bacteria | 1027 |
| 503 | Ga0395899_0492201 | 3300037312 | Bacteria | 797 |
| 504 | Ga0395899_0527732 | 3300037312 | Bacteria | 762 |
| 505 | Ga0395899_0652548 | 3300037312 | Bacteria | 665 |
| 506 | Ga0395900_0001846 | 3300037418 | Bacteria | 24148 |
| 507 | Ga0395900_0008531 | 3300037418 | Bacteria | 10532 |
| 508 | Ga0395900_0014289 | 3300037418 | Bacteria | 8103 |
| 509 | Ga0395900_0027207 | 3300037418 | Bacteria | 5856 |
| 510 | Ga0395900_0043023 | 3300037418 | Bacteria | 4653 |
| 511 | Ga0395900_0115199 | 3300037418 | Bacteria | 2758 |
| 512 | Ga0395900_0243644 | 3300037418 | Bacteria | 1802 |
| 513 | Ga0395900_0300856 | 3300037418 | Bacteria | 1590 |
| 514 | Ga0395900_0373287 | 3300037418 | Bacteria | 1396 |
| 515 | Ga0395900_0814163 | 3300037418 | Unclassified | 861 |
| 516 | Ga0395898_0002591 | 3300037466 | Bacteria | 21125 |
| 517 | Ga0395898_0006502 | 3300037466 | Bacteria | 12484 |
| 518 | Ga0395898_0011007 | 3300037466 | Bacteria | 9426 |
| 519 | Ga0395898_0013777 | 3300037466 | Bacteria | 8313 |
| 520 | Ga0395898_0021795 | 3300037466 | Bacteria | 6492 |
| 521 | Ga0395898_0044897 | 3300037466 | Bacteria | 4345 |
| 522 | Ga0395898_0076736 | 3300037466 | Bacteria | 3226 |
| 523 | Ga0395898_0102591 | 3300037466 | Bacteria | 2746 |
| 524 | Ga0395898_0289405 | 3300037466 | Bacteria | 1563 |
| 525 | Ga0395898_0290322 | 3300037466 | Unclassified | 1560 |
| 526 | Ga0395898_0780906 | 3300037466 | Bacteria | 896 |
| 527 | Ga0395898_0851442 | 3300037466 | Bacteria | 851 |
| 528 | Ga0395898_1140795 | 3300037466 | Bacteria | 712 |
| 529 | Ga0395898_1223196 | 3300037466 | Bacteria | 682 |
| 530 | Ga0395898_1393963 | 3300037466 | Bacteria | 629 |
| 531 | Ga0395898_1633523 | 3300037466 | Bacteria | 568 |
| 532 | Ga0395905_0011076 | 3300037471 | Bacteria | 8729 |
| 533 | Ga0395905_0011571 | 3300037471 | Bacteria | 8523 |
| 534 | Ga0395905_0012069 | 3300037471 | Bacteria | 8326 |
| 535 | Ga0395905_0025234 | 3300037471 | Bacteria | 5606 |
| 536 | Ga0395905_0036388 | 3300037471 | Bacteria | 4623 |
| 537 | Ga0395905_0058801 | 3300037471 | Bacteria | 3594 |
| 538 | Ga0395905_0107338 | 3300037471 | Bacteria | 2621 |
| 539 | Ga0395905_0949864 | 3300037471 | Bacteria | 763 |
| 540 | Ga0395905_1225302 | 3300037471 | Bacteria | 654 |
| 541 | Ga0395905_1394936 | 3300037471 | Bacteria | 605 |
| 542 | Ga0395901_0009419 | 3300038443 | Bacteria | 9911 |
| 543 | Ga0395901_0035205 | 3300038443 | Bacteria | 5173 |
| 544 | Ga0395901_0045082 | 3300038443 | Bacteria | 4575 |
| 545 | Ga0395901_0056424 | 3300038443 | Bacteria | 4085 |
| 546 | Ga0395901_0072296 | 3300038443 | Bacteria | 3595 |
| 547 | Ga0395901_0099220 | 3300038443 | Bacteria | 3054 |
| 548 | Ga0395901_0138437 | 3300038443 | Bacteria | 2558 |
| 549 | Ga0395901_0290117 | 3300038443 | Bacteria | 1698 |
| 550 | Ga0395901_0387994 | 3300038443 | Unclassified | 1436 |
| 551 | Ga0395901_0403445 | 3300038443 | Bacteria | 1404 |
| 552 | Ga0395901_0856634 | 3300038443 | Bacteria | 894 |
| 553 | Ga0395901_0971202 | 3300038443 | Bacteria | 827 |
| 554 | Ga0395901_1097619 | 3300038443 | Bacteria | 766 |
| 555 | Ga0395901_1646324 | 3300038443 | Bacteria | 594 |
| 556 | Ga0436365_1518340 | 3300039437 | Bacteria | 1741 |
| 557 | Ga0436360_0821888 | 3300039438 | Bacteria | 760 |
| 558 | Ga0436363_1007763 | 3300039450 | Bacteria | 644 |
| 559 | Ga0466969_0000426 | 3300044656 | Bacteria | 23045 |
| 560 | Ga0466969_0038385 | 3300044656 | Bacteria | 2410 |
| 561 | Ga0466972_0415790 | 3300044658 | Bacteria | 631 |
| 562 | Ga0466965_0037696 | 3300044683 | Bacteria | 2374 |
| 563 | Ga0466966_0058831 | 3300044684 | Bacteria | 2428 |
| 564 | Ga0466966_0060183 | 3300044684 | Bacteria | 2397 |
| 565 | Ga0466966_0196367 | 3300044684 | Bacteria | 1222 |
| 566 | Ga0466961_0049628 | 3300044693 | Bacteria | 2682 |
| 567 | Ga0466961_0051433 | 3300044693 | Bacteria | 2631 |
| 568 | Ga0466961_0278520 | 3300044693 | Bacteria | 1024 |
| 569 | Ga0466963_0002057 | 3300044694 | Bacteria | 11097 |
| 570 | Ga0466963_0003865 | 3300044694 | Bacteria | 8646 |
| 571 | Ga0466963_0007214 | 3300044694 | Bacteria | 6626 |
| 572 | Ga0466963_0023648 | 3300044694 | Bacteria | 3905 |
| 573 | Ga0466963_0025653 | 3300044694 | Bacteria | 3761 |
| 574 | Ga0466963_0035965 | 3300044694 | Bacteria | 3228 |
| 575 | Ga0466963_0119688 | 3300044694 | Bacteria | 1811 |
| 576 | Ga0466963_0134680 | 3300044694 | Bacteria | 1709 |
| 577 | Ga0466963_0172550 | 3300044694 | Bacteria | 1508 |
| 578 | Ga0466963_0188851 | 3300044694 | Bacteria | 1439 |
| 579 | Ga0466963_0210912 | 3300044694 | Bacteria | 1359 |
| 580 | Ga0466963_0293165 | 3300044694 | Bacteria | 1144 |
| 581 | Ga0466963_0423416 | 3300044694 | Bacteria | 939 |
| 582 | Ga0466963_0505373 | 3300044694 | Bacteria | 853 |
| 583 | Ga0466963_0615895 | 3300044694 | Bacteria | 766 |
| 584 | Ga0466963_0877495 | 3300044694 | Bacteria | 632 |
| 585 | Ga0466963_0940072 | 3300044694 | Bacteria | 609 |
| 586 | Ga0466964_0003099 | 3300044706 | Bacteria | 6048 |
| 587 | Ga0466964_0046814 | 3300044706 | Bacteria | 1764 |
| 588 | Ga0466964_0068356 | 3300044706 | Bacteria | 1496 |
| 589 | Ga0466964_0088440 | 3300044706 | Unclassified | 1344 |
| 590 | Ga0466964_0308112 | 3300044706 | Bacteria | 800 |
| 591 | Ga0466964_0418767 | 3300044706 | Bacteria | 704 |
| 592 | Ga0466971_0040475 | 3300044719 | Bacteria | 2093 |
| 593 | Ga0466971_0047179 | 3300044719 | Bacteria | 1936 |
| 594 | Ga0466971_0055987 | 3300044719 | Bacteria | 1778 |
| 595 | Ga0466971_0327410 | 3300044719 | Bacteria | 739 |
| 596 | Ga0466971_0360093 | 3300044719 | Bacteria | 705 |
| 597 | Ga0466971_0416333 | 3300044719 | Bacteria | 656 |
| 598 | Ga0466968_0001254 | 3300044735 | Bacteria | 9025 |
| 599 | Ga0466968_0024225 | 3300044735 | Bacteria | 2478 |
| 600 | Ga0466968_0069422 | 3300044735 | Bacteria | 1532 |
| 601 | Ga0466970_0060959 | 3300044765 | Bacteria | 2020 |
| 602 | Ga0466957_0003337 | 3300044842 | Bacteria | 8801 |
| 603 | Ga0466957_0061965 | 3300044842 | Bacteria | 2297 |
| 604 | Ga0466957_0194949 | 3300044842 | Bacteria | 1328 |
| 605 | Ga0466957_0235426 | 3300044842 | Unclassified | 1213 |
| 606 | Ga0466957_0353344 | 3300044842 | Bacteria | 997 |
| 607 | Ga0466957_0387881 | 3300044842 | Bacteria | 953 |
| 608 | Ga0466957_0778631 | 3300044842 | Bacteria | 679 |
| 609 | Ga0466957_1187654 | 3300044842 | Bacteria | 552 |
| 610 | Ga0466959_0003554 | 3300045049 | Bacteria | 10250 |
| 611 | Ga0466959_0129925 | 3300045049 | Bacteria | 1785 |
| 612 | Ga0466959_0238404 | 3300045049 | Bacteria | 1257 |
| 613 | Ga0466959_0601690 | 3300045049 | Bacteria | 739 |
| 614 | Ga0466959_0763149 | 3300045049 | Bacteria | 647 |
| 615 | Ga0466958_0005596 | 3300045836 | Bacteria | 6779 |
| 616 | Ga0466958_0010267 | 3300045836 | Bacteria | 5241 |
| 617 | Ga0466958_0014926 | 3300045836 | Bacteria | 4441 |
| 618 | Ga0466958_0024973 | 3300045836 | Bacteria | 3519 |
| 619 | Ga0466958_0030443 | 3300045836 | Bacteria | 3206 |
| 620 | Ga0466958_0123278 | 3300045836 | Bacteria | 1623 |
| 621 | Ga0466958_0141662 | 3300045836 | Bacteria | 1514 |
| 622 | Ga0466958_0143179 | 3300045836 | Bacteria | 1506 |
| 623 | Ga0466958_0349405 | 3300045836 | Bacteria | 952 |
| 624 | Ga0466967_0003895 | 3300045976 | Bacteria | 9904 |
| 625 | Ga0466967_0007111 | 3300045976 | Bacteria | 8031 |
| 626 | Ga0466967_0011497 | 3300045976 | Bacteria | 6710 |
| 627 | Ga0466967_0056803 | 3300045976 | Bacteria | 3453 |
| 628 | Ga0466967_0086292 | 3300045976 | Bacteria | 2843 |
| 629 | Ga0466967_0108686 | 3300045976 | Bacteria | 2545 |
| 630 | Ga0466967_0117327 | 3300045976 | Bacteria | 2453 |
| 631 | Ga0466967_0158405 | 3300045976 | Bacteria | 2123 |
| 632 | Ga0466967_0183132 | 3300045976 | Bacteria | 1976 |
| 633 | Ga0466967_0207794 | 3300045976 | Bacteria | 1856 |
| 634 | Ga0466967_0246677 | 3300045976 | Bacteria | 1704 |
| 635 | Ga0466967_0327619 | 3300045976 | Bacteria | 1478 |
| 636 | Ga0466967_0378442 | 3300045976 | Bacteria | 1374 |
| 637 | Ga0466967_0513827 | 3300045976 | Bacteria | 1176 |
| 638 | Ga0466967_0518206 | 3300045976 | Bacteria | 1171 |
| 639 | Ga0466967_0559520 | 3300045976 | Bacteria | 1126 |
| 640 | Ga0466967_1002852 | 3300045976 | Bacteria | 831 |
| 641 | Ga0466967_1501477 | 3300045976 | Bacteria | 671 |
| 642 | Ga0495592_0000660 | 3300046454 | Bacteria | 23996 |
| 643 | Ga0495592_0105262 | 3300046454 | Bacteria | 2004 |
| 644 | Ga0495592_0593767 | 3300046454 | Bacteria | 676 |
| 645 | Ga0495591_179963 | 3300046458 | Bacteria | 504 |
| 646 | Ga0495629_0040254 | 3300046459 | Bacteria | 3288 |
| 647 | Ga0495629_0958021 | 3300046459 | Bacteria | 559 |
| 648 | Ga0495629_1071117 | 3300046459 | Bacteria | 522 |
| 649 | Ga0495641_0068395 | 3300046461 | Bacteria | 1597 |
| 650 | Ga0495641_0316249 | 3300046461 | Bacteria | 704 |
| 651 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 652 | Ga0495651_0092884 | 3300046462 | Bacteria | 2260 |
| 653 | Ga0495653_0004267 | 3300046463 | Bacteria | 11577 |
| 654 | Ga0495653_0078694 | 3300046463 | Bacteria | 2444 |
| 655 | Ga0495580_0176297 | 3300046472 | Bacteria | 1477 |
| 656 | Ga0495582_0191143 | 3300046473 | Unclassified | 1168 |
| 657 | Ga0495582_0409476 | 3300046473 | Bacteria | 782 |
| 658 | Ga0495582_0478393 | 3300046473 | Bacteria | 720 |
| 659 | Ga0495639_0019026 | 3300046475 | Bacteria | 2995 |
| 660 | Ga0495664_0686478 | 3300046477 | Bacteria | 605 |
| 661 | Ga0495608_0003358 | 3300046511 | Bacteria | 11447 |
| 662 | Ga0495608_0035925 | 3300046511 | Bacteria | 3338 |
| 663 | Ga0495608_0194214 | 3300046511 | Bacteria | 1281 |
| 664 | Ga0495618_0002980 | 3300046514 | Bacteria | 10705 |
| 665 | Ga0495618_0131228 | 3300046514 | Bacteria | 1603 |
| 666 | Ga0495618_0381564 | 3300046514 | Bacteria | 865 |
| 667 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 668 | Ga0495628_0276219 | 3300046516 | Bacteria | 1249 |
| 669 | Ga0495628_0719723 | 3300046516 | Bacteria | 704 |
| 670 | Ga0495630_0027552 | 3300046517 | Bacteria | 4217 |
| 671 | Ga0495630_0221813 | 3300046517 | Bacteria | 1443 |
| 672 | Ga0495630_0309735 | 3300046517 | Bacteria | 1207 |
| 673 | Ga0495630_0465347 | 3300046517 | Bacteria | 969 |
| 674 | Ga0495630_0839706 | 3300046517 | Unclassified | 701 |
| 675 | Ga0495644_0002395 | 3300046523 | Bacteria | 7482 |
| 676 | Ga0495644_0054024 | 3300046523 | Bacteria | 1509 |
| 677 | Ga0495663_0056215 | 3300046525 | Bacteria | 1229 |
| 678 | Ga0495642_0009669 | 3300046528 | Bacteria | 3689 |
| 679 | Ga0495642_0041870 | 3300046528 | Bacteria | 1864 |
| 680 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 681 | Ga0495652_0148172 | 3300046529 | Bacteria | 1837 |
| 682 | Ga0495640_0278178 | 3300046533 | Bacteria | 1043 |
| 683 | Ga0495640_0420573 | 3300046533 | Bacteria | 819 |
| 684 | Ga0495586_0014499 | 3300046535 | Bacteria | 4186 |
| 685 | Ga0495586_0337734 | 3300046535 | Bacteria | 865 |
| 686 | Ga0495587_0001086 | 3300046536 | Bacteria | 17851 |
| 687 | Ga0495645_0000646 | 3300046543 | Bacteria | 24016 |
| 688 | Ga0495645_0281181 | 3300046543 | Bacteria | 1094 |
| 689 | Ga0495667_0048661 | 3300046559 | Bacteria | 2799 |
| 690 | Ga0495667_0127345 | 3300046559 | Bacteria | 1643 |
| 691 | Ga0495656_0216783 | 3300046615 | Bacteria | 956 |
| 692 | Ga0495634_0049222 | 3300046642 | Bacteria | 2835 |
| 693 | Ga0495634_0057751 | 3300046642 | Bacteria | 2589 |
| 694 | Ga0495634_0061667 | 3300046642 | Bacteria | 2492 |
| 695 | Ga0495634_0292093 | 3300046642 | Bacteria | 987 |
| 696 | Ga0495611_0055720 | 3300046648 | Bacteria | 1789 |
| 697 | Ga0495635_0037446 | 3300046663 | Bacteria | 3358 |
| 698 | Ga0495635_0124509 | 3300046663 | Bacteria | 1758 |
| 699 | Ga0495635_0709573 | 3300046663 | Bacteria | 652 |
| 700 | Ga0495659_0330892 | 3300046664 | Bacteria | 648 |
| 701 | Ga0495659_0356459 | 3300046664 | Bacteria | 626 |
| 702 | Ga0495588_0041289 | 3300046674 | Bacteria | 2355 |
| 703 | Ga0495657_0081837 | 3300046675 | Bacteria | 2087 |
| 704 | Ga0495599_0000227 | 3300046678 | Bacteria | 35652 |
| 705 | Ga0495623_0000601 | 3300046679 | Bacteria | 23980 |
| 706 | Ga0495623_0093757 | 3300046679 | Bacteria | 1838 |
| 707 | Ga0495646_0005450 | 3300046680 | Bacteria | 8044 |
| 708 | Ga0495646_0444953 | 3300046680 | Bacteria | 670 |
| 709 | Ga0495658_0032280 | 3300046683 | Bacteria | 2858 |
| 710 | Ga0495658_0145090 | 3300046683 | Bacteria | 1454 |
| 711 | Ga0495658_1115928 | 3300046683 | Bacteria | 503 |
| 712 | Ga0495613_0047381 | 3300046689 | Bacteria | 3176 |
| 713 | Ga0495613_0098497 | 3300046689 | Bacteria | 2113 |
| 714 | Ga0495613_0247154 | 3300046689 | Bacteria | 1246 |
| 715 | Ga0495613_0560334 | 3300046689 | Bacteria | 764 |
| 716 | Ga0495624_0008996 | 3300046690 | Bacteria | 6941 |
| 717 | Ga0495670_0029542 | 3300046691 | Bacteria | 2721 |
| 718 | Ga0495589_0147151 | 3300046794 | Bacteria | 1126 |
| 719 | Ga0495600_0084236 | 3300046809 | Bacteria | 2075 |
| 720 | Ga0495600_0365923 | 3300046809 | Bacteria | 901 |
| 721 | Ga0495600_0702501 | 3300046809 | Bacteria | 608 |
| 722 | Ga0495581_0160630 | 3300047315 | Unclassified | 1313 |
| 723 | Ga0495581_0222917 | 3300047315 | Bacteria | 1103 |
| 724 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 725 | Ga0495636_0159082 | 3300047318 | Bacteria | 1017 |
| 726 | Ga0495674_0129366 | 3300047319 | Bacteria | 2128 |
| 727 | Ga0495674_0161060 | 3300047319 | Bacteria | 1877 |
| 728 | Ga0495674_1028982 | 3300047319 | Bacteria | 630 |
| 729 | Ga0495676_0097590 | 3300047321 | Bacteria | 2182 |
| 730 | Ga0495676_0098405 | 3300047321 | Bacteria | 2170 |
| 731 | Ga0495675_0000224 | 3300047444 | Bacteria | 40977 |
| 732 | Ga0495675_0335262 | 3300047444 | Bacteria | 892 |
| 733 | Ga0495677_0024362 | 3300047445 | Bacteria | 2195 |
| 734 | Ga0495684_0091036 | 3300047471 | Bacteria | 2310 |
| 735 | Ga0495602_0001529 | 3300048088 | Bacteria | 23007 |
| 736 | Ga0495602_0050029 | 3300048088 | Bacteria | 3738 |
| 737 | Ga0495602_0077204 | 3300048088 | Bacteria | 2819 |
| 738 | Ga0495602_0374177 | 3300048088 | Bacteria | 1022 |
| 739 | Ga0496100_0004406 | 3300048903 | Bacteria | 7460 |
| 740 | Ga0496100_0010904 | 3300048903 | Bacteria | 5159 |
| 741 | Ga0496100_0036671 | 3300048903 | Bacteria | 3095 |
| 742 | Ga0496100_0096918 | 3300048903 | Bacteria | 2024 |
| 743 | Ga0496100_0261178 | 3300048903 | Bacteria | 1284 |
| 744 | Ga0496100_0593280 | 3300048903 | Bacteria | 860 |
| 745 | Ga0496100_0922441 | 3300048903 | Bacteria | 686 |
| 746 | Ga0496100_1338262 | 3300048903 | Bacteria | 565 |
| 747 | Ga0496101_0004655 | 3300048904 | Bacteria | 8677 |
| 748 | Ga0496101_0013017 | 3300048904 | Bacteria | 5567 |
| 749 | Ga0496101_0022295 | 3300048904 | Bacteria | 4358 |
| 750 | Ga0496101_0065400 | 3300048904 | Bacteria | 2651 |
| 751 | Ga0496101_0070263 | 3300048904 | Bacteria | 2563 |
| 752 | Ga0496101_0324417 | 3300048904 | Bacteria | 1208 |
| 753 | Ga0496101_0507036 | 3300048904 | Bacteria | 953 |
| 754 | Ga0496101_0703668 | 3300048904 | Bacteria | 798 |
| 755 | Ga0496101_1044518 | 3300048904 | Bacteria | 642 |
| 756 | Ga0496102_0014233 | 3300048905 | Bacteria | 6912 |
| 757 | Ga0496102_0015692 | 3300048905 | Bacteria | 6600 |
| 758 | Ga0496102_0040396 | 3300048905 | Bacteria | 4219 |
| 759 | Ga0496102_0087213 | 3300048905 | Bacteria | 2883 |
| 760 | Ga0496102_0091032 | 3300048905 | Bacteria | 2823 |
| 761 | Ga0496102_0222108 | 3300048905 | Bacteria | 1781 |
| 762 | Ga0496102_0325689 | 3300048905 | Bacteria | 1447 |
| 763 | Ga0496102_0607800 | 3300048905 | Bacteria | 1016 |
| 764 | Ga0496102_0753810 | 3300048905 | Bacteria | 896 |
| 765 | Ga0496103_0005102 | 3300048906 | Bacteria | 7910 |
| 766 | Ga0496103_0011172 | 3300048906 | Bacteria | 5316 |
| 767 | Ga0496103_0131263 | 3300048906 | Bacteria | 1600 |
| 768 | Ga0496103_0145971 | 3300048906 | Bacteria | 1514 |
| 769 | Ga0496103_0326406 | 3300048906 | Bacteria | 987 |
| 770 | Ga0496103_0330838 | 3300048906 | Bacteria | 980 |
| 771 | Ga0496104_0000224 | 3300048907 | Bacteria | 49763 |
| 772 | Ga0496104_0098359 | 3300048907 | Bacteria | 2801 |
| 773 | Ga0496104_0156538 | 3300048907 | Bacteria | 2186 |
| 774 | Ga0496104_0314481 | 3300048907 | Bacteria | 1479 |
| 775 | Ga0496104_0341751 | 3300048907 | Bacteria | 1410 |
| 776 | Ga0496104_0700693 | 3300048907 | Bacteria | 920 |
| 777 | Ga0496104_1002596 | 3300048907 | Bacteria | 739 |
| 778 | Ga0496105_0000234 | 3300048908 | Bacteria | 37704 |
| 779 | Ga0496105_0014369 | 3300048908 | Bacteria | 6300 |
| 780 | Ga0496105_0034363 | 3300048908 | Bacteria | 4169 |
| 781 | Ga0496105_0067458 | 3300048908 | Bacteria | 2954 |
| 782 | Ga0496105_0082597 | 3300048908 | Bacteria | 2654 |
| 783 | Ga0496105_0095628 | 3300048908 | Bacteria | 2454 |
| 784 | Ga0496105_0851581 | 3300048908 | Bacteria | 690 |
| 785 | Ga0496106_0060402 | 3300048909 | Bacteria | 2873 |
| 786 | Ga0496106_0088170 | 3300048909 | Bacteria | 2391 |
| 787 | Ga0496106_0147127 | 3300048909 | Bacteria | 1856 |
| 788 | Ga0496106_0201229 | 3300048909 | Bacteria | 1585 |
| 789 | Ga0496106_0235686 | 3300048909 | Bacteria | 1462 |
| 790 | Ga0496106_0524720 | 3300048909 | Unclassified | 951 |
| 791 | Ga0496106_1056270 | 3300048909 | Bacteria | 637 |
| 792 | Ga0496107_0000435 | 3300048910 | Bacteria | 22638 |
| 793 | Ga0496107_0006765 | 3300048910 | Bacteria | 7889 |
| 794 | Ga0496107_0045031 | 3300048910 | Bacteria | 3173 |
| 795 | Ga0496107_0078783 | 3300048910 | Bacteria | 2401 |
| 796 | Ga0496107_0273643 | 3300048910 | Bacteria | 1257 |
| 797 | Ga0496107_0926941 | 3300048910 | Bacteria | 634 |
| 798 | Ga0496108_0007844 | 3300048911 | Bacteria | 8653 |
| 799 | Ga0496108_0022133 | 3300048911 | Bacteria | 5226 |
| 800 | Ga0496108_0033148 | 3300048911 | Bacteria | 4291 |
| 801 | Ga0496108_0052345 | 3300048911 | Bacteria | 3421 |
| 802 | Ga0496108_0119478 | 3300048911 | Bacteria | 2260 |
| 803 | Ga0496108_0780557 | 3300048911 | Bacteria | 825 |
| 804 | Ga0496109_0004645 | 3300048912 | Bacteria | 11465 |
| 805 | Ga0496109_0018197 | 3300048912 | Bacteria | 6169 |
| 806 | Ga0496109_0027975 | 3300048912 | Bacteria | 5040 |
| 807 | Ga0496109_0037958 | 3300048912 | Bacteria | 4353 |
| 808 | Ga0496109_0046713 | 3300048912 | Bacteria | 3934 |
| 809 | Ga0496109_0204706 | 3300048912 | Bacteria | 1855 |
| 810 | Ga0496109_0272445 | 3300048912 | Bacteria | 1595 |
| 811 | Ga0496109_0585632 | 3300048912 | Bacteria | 1051 |
| 812 | Ga0496109_0616573 | 3300048912 | Bacteria | 1021 |
| 813 | Ga0496109_0849628 | 3300048912 | Bacteria | 851 |
| 814 | Ga0496109_1766047 | 3300048912 | Bacteria | 552 |
| 815 | Ga0496110_0000673 | 3300048913 | Bacteria | 23454 |
| 816 | Ga0496110_0003719 | 3300048913 | Bacteria | 11747 |
| 817 | Ga0496110_0007404 | 3300048913 | Bacteria | 8763 |
| 818 | Ga0496110_0313174 | 3300048913 | Bacteria | 1429 |
| 819 | Ga0496110_0433791 | 3300048913 | Bacteria | 1197 |
| 820 | Ga0496110_0578763 | 3300048913 | Bacteria | 1019 |
| 821 | Ga0496110_0980618 | 3300048913 | Bacteria | 752 |
| 822 | Ga0496111_0000552 | 3300048914 | Bacteria | 19441 |
| 823 | Ga0496111_0009530 | 3300048914 | Bacteria | 6489 |
| 824 | Ga0496111_0029188 | 3300048914 | Bacteria | 3916 |
| 825 | Ga0496111_0047943 | 3300048914 | Bacteria | 3077 |
| 826 | Ga0496111_0064617 | 3300048914 | Bacteria | 2655 |
| 827 | Ga0496111_0131371 | 3300048914 | Bacteria | 1853 |
| 828 | Ga0496111_0142552 | 3300048914 | Bacteria | 1776 |
| 829 | Ga0496111_0213972 | 3300048914 | Bacteria | 1432 |
| 830 | Ga0496111_0250445 | 3300048914 | Bacteria | 1315 |
| 831 | Ga0496111_0684799 | 3300048914 | Bacteria | 746 |
| 832 | Ga0496112_0003867 | 3300048915 | Bacteria | 12515 |
| 833 | Ga0496112_0004943 | 3300048915 | Bacteria | 11416 |
| 834 | Ga0496112_0033651 | 3300048915 | Bacteria | 4983 |
| 835 | Ga0496112_0049478 | 3300048915 | Bacteria | 4121 |
| 836 | Ga0496112_0143342 | 3300048915 | Bacteria | 2358 |
| 837 | Ga0496112_0180748 | 3300048915 | Bacteria | 2073 |
| 838 | Ga0496112_0202567 | 3300048915 | Bacteria | 1943 |
| 839 | Ga0496112_0213173 | 3300048915 | Bacteria | 1888 |
| 840 | Ga0496112_0289448 | 3300048915 | Bacteria | 1584 |
| 841 | Ga0496112_0356507 | 3300048915 | Bacteria | 1405 |
| 842 | Ga0496112_0403758 | 3300048915 | Bacteria | 1306 |
| 843 | Ga0496112_0513059 | 3300048915 | Bacteria | 1134 |
| 844 | Ga0496112_0721121 | 3300048915 | Bacteria | 924 |
| 845 | Ga0496112_0964368 | 3300048915 | Bacteria | 773 |
| 846 | Ga0496113_0047455 | 3300048916 | Bacteria | 3191 |
| 847 | Ga0496113_0191855 | 3300048916 | Bacteria | 1622 |
| 848 | Ga0496113_0195875 | 3300048916 | Bacteria | 1605 |
| 849 | Ga0496113_0264475 | 3300048916 | Bacteria | 1374 |
| 850 | Ga0496113_0870221 | 3300048916 | Unclassified | 714 |
| 851 | Ga0496113_1350035 | 3300048916 | Bacteria | 553 |
| 852 | Ga0496114_0001528 | 3300048917 | Bacteria | 17548 |
| 853 | Ga0496114_0004933 | 3300048917 | Bacteria | 10399 |
| 854 | Ga0496114_0014140 | 3300048917 | Bacteria | 6400 |
| 855 | Ga0496114_0032392 | 3300048917 | Bacteria | 4302 |
| 856 | Ga0496114_0042955 | 3300048917 | Bacteria | 3748 |
| 857 | Ga0496114_0137760 | 3300048917 | Bacteria | 2111 |
| 858 | Ga0496114_0170497 | 3300048917 | Bacteria | 1896 |
| 859 | Ga0496114_0406498 | 3300048917 | Bacteria | 1206 |
| 860 | Ga0496115_0012226 | 3300048918 | Bacteria | 6454 |
| 861 | Ga0496115_0014610 | 3300048918 | Bacteria | 5947 |
| 862 | Ga0496115_0038437 | 3300048918 | Bacteria | 3797 |
| 863 | Ga0496115_0045147 | 3300048918 | Bacteria | 3517 |
| 864 | Ga0496115_0402020 | 3300048918 | Bacteria | 1111 |
| 865 | Ga0496115_1200902 | 3300048918 | Bacteria | 570 |
| 866 | Ga0501031_0029292 | 3300049568 | Bacteria | 3592 |
| 867 | Ga0501031_0058066 | 3300049568 | Bacteria | 2521 |
| 868 | Ga0501031_0086916 | 3300049568 | Bacteria | 2039 |
| 869 | Ga0501032_0108625 | 3300049569 | Bacteria | 1837 |
| 870 | Ga0501033_0298984 | 3300049570 | Bacteria | 1133 |
| 871 | Ga0501034_0051390 | 3300049571 | Bacteria | 4156 |
| 872 | Ga0501036_0016451 | 3300049572 | Bacteria | 6177 |
| 873 | Ga0501036_0808932 | 3300049572 | Bacteria | 771 |
| 874 | Ga0501037_0147865 | 3300049573 | Bacteria | 1680 |
| 875 | Ga0501038_0038082 | 3300049574 | Bacteria | 4212 |
| 876 | Ga0501039_0005439 | 3300049575 | Bacteria | 9631 |
| 877 | Ga0501039_0261039 | 3300049575 | Bacteria | 1361 |
| 878 | Ga0501040_0000505 | 3300049576 | Bacteria | 23311 |
| 879 | Ga0501040_0029003 | 3300049576 | Bacteria | 3733 |
| 880 | Ga0501040_0039796 | 3300049576 | Bacteria | 3198 |
| 881 | Ga0501040_0925850 | 3300049576 | Bacteria | 631 |
| 882 | Ga0501041_0016294 | 3300049577 | Bacteria | 4418 |
| 883 | Ga0501041_0022710 | 3300049577 | Bacteria | 3758 |
| 884 | Ga0501042_0000909 | 3300049578 | Bacteria | 16557 |
| 885 | Ga0501042_0389243 | 3300049578 | Bacteria | 1010 |
| 886 | Ga0501042_1082245 | 3300049578 | Bacteria | 584 |
| 887 | Ga0501043_0416971 | 3300049579 | Bacteria | 1013 |
| 888 | Ga0501043_0575844 | 3300049579 | Bacteria | 834 |
| 889 | Ga0501046_0593892 | 3300049580 | Bacteria | 786 |
| 890 | Ga0501047_0405004 | 3300049581 | Bacteria | 1197 |
| 891 | Ga0501048_0012035 | 3300049582 | Bacteria | 6447 |
| 892 | Ga0501048_0040658 | 3300049582 | Bacteria | 3331 |
| 893 | Ga0501067_0080769 | 3300049583 | Bacteria | 1802 |
| 894 | Ga0501067_0400517 | 3300049583 | Bacteria | 765 |
| 895 | Ga0501067_0780233 | 3300049583 | Bacteria | 538 |
| 896 | Ga0501068_0070924 | 3300049584 | Bacteria | 2126 |
| 897 | Ga0501068_0161904 | 3300049584 | Bacteria | 1410 |
| 898 | Ga0501068_1004721 | 3300049584 | Bacteria | 550 |
| 899 | Ga0501069_0092763 | 3300049585 | Bacteria | 1708 |
| 900 | Ga0501070_0268219 | 3300049586 | Bacteria | 1394 |
| 901 | Ga0501070_0408439 | 3300049586 | Bacteria | 1098 |
| 902 | Ga0501070_0610159 | 3300049586 | Bacteria | 869 |
| 903 | Ga0501070_0913706 | 3300049586 | Bacteria | 684 |
| 904 | Ga0501071_0005439 | 3300049587 | Bacteria | 8185 |
| 905 | Ga0501071_0009020 | 3300049587 | Bacteria | 6621 |
| 906 | Ga0501072_0000190 | 3300049588 | Bacteria | 44606 |
| 907 | Ga0501072_0039548 | 3300049588 | Bacteria | 3703 |
| 908 | Ga0501072_0087765 | 3300049588 | Bacteria | 2468 |
| 909 | Ga0501072_0270955 | 3300049588 | Bacteria | 1351 |
| 910 | Ga0501072_0423189 | 3300049588 | Bacteria | 1055 |
| 911 | Ga0501072_0592595 | 3300049588 | Bacteria | 874 |
| 912 | Ga0501073_0107665 | 3300049589 | Bacteria | 1934 |
| 913 | Ga0501073_0147332 | 3300049589 | Bacteria | 1631 |
| 914 | Ga0501073_0304600 | 3300049589 | Bacteria | 1099 |
| 915 | Ga0501074_0039059 | 3300049590 | Bacteria | 3438 |
| 916 | Ga0501074_0104613 | 3300049590 | Bacteria | 2026 |
| 917 | Ga0501074_0361816 | 3300049590 | Bacteria | 1029 |
| 918 | Ga0501074_0916428 | 3300049590 | Bacteria | 617 |
| 919 | Ga0501075_0000311 | 3300049591 | Bacteria | 27242 |
| 920 | Ga0501075_0014013 | 3300049591 | Bacteria | 5739 |
| 921 | Ga0501075_0305852 | 3300049591 | Bacteria | 1211 |
| 922 | Ga0501076_0000336 | 3300049592 | Bacteria | 28961 |
| 923 | Ga0501076_0040018 | 3300049592 | Bacteria | 3682 |
| 924 | Ga0501076_0136331 | 3300049592 | Bacteria | 1992 |
| 925 | Ga0501077_0004089 | 3300049593 | Bacteria | 8806 |
| 926 | Ga0501077_0067518 | 3300049593 | Bacteria | 2267 |
| 927 | Ga0501079_0000420 | 3300049741 | Bacteria | 27607 |
| 928 | Ga0501079_0100848 | 3300049741 | Bacteria | 2238 |
| 929 | Ga0501079_0127770 | 3300049741 | Bacteria | 1977 |
| 930 | Ga0501079_0157308 | 3300049741 | Bacteria | 1771 |
| 931 | Ga0501079_0342885 | 3300049741 | Bacteria | 1170 |
| 932 | Ga0501080_0019576 | 3300049742 | Bacteria | 6271 |
| 933 | Ga0501080_0075689 | 3300049742 | Bacteria | 3131 |
| 934 | Ga0501080_0807262 | 3300049742 | Bacteria | 823 |
| 935 | Ga0501081_0004449 | 3300049743 | Bacteria | 8986 |
| 936 | Ga0501081_0013186 | 3300049743 | Bacteria | 5436 |
| 937 | Ga0501081_0082492 | 3300049743 | Bacteria | 2252 |
| 938 | Ga0501081_0085192 | 3300049743 | Bacteria | 2217 |
| 939 | Ga0501083_0054058 | 3300049744 | Bacteria | 2695 |
| 940 | Ga0501083_0257923 | 3300049744 | Bacteria | 1134 |
| 941 | Ga0501035_0582058 | 3300049822 | Bacteria | 914 |
| 942 | Ga0501044_0316963 | 3300049823 | Bacteria | 1485 |
| 943 | Ga0501045_0000886 | 3300049824 | Bacteria | 19464 |
| 944 | Ga0501045_0022489 | 3300049824 | Bacteria | 4515 |
| 945 | Ga0501045_0093764 | 3300049824 | Bacteria | 2220 |
| 946 | nmdc:mga0yw44_168499_c1 | 3300050492 | Bacteria | 1437 |
| 947 | nmdc:mga05p37_1113279_c1 | 3300050507 | Bacteria | 825 |
| 948 | nmdc:mga05p37_229997_c1 | 3300050507 | Bacteria | 2235 |
| 949 | nmdc:mga05p37_65168_c1 | 3300050507 | Bacteria | 4483 |
| 950 | nmdc:mga08y16_58178_c1 | 3300050511 | Bacteria | 4038 |
| 951 | nmdc:mga0n895_157292_c1 | 3300050512 | Bacteria | 2303 |
| 952 | nmdc:mga0n895_216837_c1 | 3300050512 | Bacteria | 1943 |
| 953 | nmdc:mga0n895_337963_c1 | 3300050512 | Bacteria | 1526 |
| 954 | nmdc:mga0n895_687670_c1 | 3300050512 | Bacteria | 1020 |
| 955 | nmdc:mga0rr50_305557_c1 | 3300050513 | Bacteria | 1331 |
| 956 | nmdc:mga0rr50_362333_c1 | 3300050513 | Bacteria | 1220 |
| 957 | nmdc:mga0rr50_97083_c1 | 3300050513 | Bacteria | 2307 |
| 958 | nmdc:mga08x19_409862_c1 | 3300050514 | Bacteria | 951 |
| 959 | nmdc:mga0a205_214190_c1 | 3300050515 | Bacteria | 1814 |
| 960 | nmdc:mga0a205_230489_c1 | 3300050515 | Bacteria | 1735 |
| 961 | Ga0495601_0017330 | 3300053077 | Bacteria | 4370 |
| 962 | Ga0495601_0492279 | 3300053077 | Bacteria | 792 |
| 963 | Ga0495655_0012971 | 3300053083 | Bacteria | 1712 |
| 964 | Ga0495595_0004475 | 3300053084 | Bacteria | 5627 |
| 965 | Ga0495595_0136519 | 3300053084 | Bacteria | 1201 |
| 966 | Ga0495619_0000370 | 3300053085 | Bacteria | 30945 |
| 967 | Ga0495619_0004646 | 3300053085 | Bacteria | 8752 |
| 968 | Ga0495619_0056909 | 3300053085 | Bacteria | 2594 |
| 969 | Ga0495619_0778014 | 3300053085 | Bacteria | 648 |
| 970 | Ga0501084_0005273 | 3300054114 | Bacteria | 10577 |
| 971 | Ga0501084_0014294 | 3300054114 | Bacteria | 6575 |
| 972 | Ga0501084_0044844 | 3300054114 | Bacteria | 3702 |
| 973 | Ga0501084_0066420 | 3300054114 | Bacteria | 3018 |
| 974 | Ga0501084_0117279 | 3300054114 | Bacteria | 2238 |
| 975 | Ga0501082_0014661 | 3300060353 | Bacteria | 6753 |
| 976 | Ga0501082_0080559 | 3300060353 | Bacteria | 2810 |
| 977 | Ga0466962_0015279 | 3300061719 | Bacteria | 3701 |
| 978 | Ga0466962_0017831 | 3300061719 | Bacteria | 3416 |
| 979 | Ga0466962_0238694 | 3300061719 | Bacteria | 892 |
| 980 | Ga0466962_0357879 | 3300061719 | Bacteria | 727 |
| 981 | Ga0530510_0000504 | 3300061734 | Bacteria | 24768 |
| 982 | Ga0530510_0084301 | 3300061734 | Bacteria | 2314 |
| 983 | Ga0530510_0215608 | 3300061734 | Bacteria | 1426 |
| 984 | Ga0530510_0345962 | 3300061734 | Bacteria | 1117 |
| 985 | Ga0530510_0352227 | 3300061734 | Bacteria | 1106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_11024689 | Ga0157369_110246891 | 128 |
| 2 | 3300035086 | Ga0373934_0268851 | Ga0373934_0268851_20_412 | 128 |
| 3 | 3300039450 | Ga0436363_1007763 | Ga0436363_1007763_223_609 | 128 |
| 4 | 3300044842 | Ga0466957_0387881 | Ga0466957_0387881_306_695 | 128 |
| 5 | 3300049576 | Ga0501040_0925850 | Ga0501040_0925850_228_617 | 128 |
| 6 | 3300009098 | Ga0105245_10273982 | Ga0105245_102739822 | 129 |
| 7 | 3300009176 | Ga0105242_10302755 | Ga0105242_103027552 | 129 |
| 8 | 3300009177 | Ga0105248_10458662 | Ga0105248_104586623 | 129 |
| 9 | 3300013105 | Ga0157369_10906191 | Ga0157369_109061912 | 129 |
| 10 | 3300013296 | Ga0157374_10039944 | Ga0157374_100399444 | 129 |
| 11 | 3300035170 | Ga0373943_0181868 | Ga0373943_0181868_683_1072 | 129 |
| 12 | 3300037466 | Ga0395898_0851442 | Ga0395898_0851442_427_816 | 129 |
| 13 | 3300038443 | Ga0395901_0290117 | Ga0395901_0290117_1271_1660 | 129 |
| 14 | 3300046517 | Ga0495630_0221813 | Ga0495630_0221813_711_1100 | 129 |
| 15 | 3300046664 | Ga0495659_0356459 | Ga0495659_0356459_16_408 | 129 |
| 16 | 3300048903 | Ga0496100_0593280 | Ga0496100_0593280_296_685 | 129 |
| 17 | 3300048904 | Ga0496101_0022295 | Ga0496101_0022295_3600_3992 | 129 |
| 18 | 3300048904 | Ga0496101_0324417 | Ga0496101_0324417_284_673 | 129 |
| 19 | 3300048905 | Ga0496102_0014233 | Ga0496102_0014233_5891_6283 | 129 |
| 20 | 3300048909 | Ga0496106_0147127 | Ga0496106_0147127_1196_1588 | 129 |
| 21 | 3300048911 | Ga0496108_0022133 | Ga0496108_0022133_2845_3237 | 129 |
| 22 | 3300048911 | Ga0496108_0119478 | Ga0496108_0119478_1851_2243 | 129 |
| 23 | 3300048912 | Ga0496109_0204706 | Ga0496109_0204706_478_870 | 129 |
| 24 | 3300048913 | Ga0496110_0003719 | Ga0496110_0003719_5673_6065 | 129 |
| 25 | 3300048914 | Ga0496111_0047943 | Ga0496111_0047943_2243_2635 | 129 |
| 26 | 3300048915 | Ga0496112_0202567 | Ga0496112_0202567_243_635 | 129 |
| 27 | 3300048915 | Ga0496112_0289448 | Ga0496112_0289448_30_422 | 129 |
| 28 | 3300048916 | Ga0496113_0047455 | Ga0496113_0047455_16_408 | 129 |
| 29 | 3300048917 | Ga0496114_0014140 | Ga0496114_0014140_5761_6153 | 129 |
| 30 | 3300048917 | Ga0496114_0406498 | Ga0496114_0406498_784_1173 | 129 |
| 31 | 3300048918 | Ga0496115_0038437 | Ga0496115_0038437_127_519 | 129 |
| 32 | 3300048916 | Ga0496113_0191855 | Ga0496113_0191855_628_1029 | 132 |
| 33 | 3300046517 | Ga0495630_0839706 | Ga0495630_0839706_25_429 | 134 |
| 34 | 3300037418 | Ga0395900_0373287 | Ga0395900_0373287_310_720 | 135 |
| 35 | 3300037466 | Ga0395898_0780906 | Ga0395898_0780906_325_735 | 135 |
| 36 | 3300038443 | Ga0395901_0856634 | Ga0395901_0856634_303_713 | 135 |
| 37 | 3300048915 | Ga0496112_0403758 | Ga0496112_0403758_693_1103 | 135 |
| 38 | 3300044694 | Ga0466963_0035965 | Ga0466963_0035965_1335_1745 | 136 |
| 39 | 3300025933 | Ga0207706_10264510 | Ga0207706_102645102 | 139 |
| 40 | 3300009177 | Ga0105248_10226015 | Ga0105248_102260152 | 140 |
| 41 | 3300026089 | Ga0207648_10543977 | Ga0207648_105439772 | 140 |
| 42 | 3300035241 | Ga0373961_0203278 | Ga0373961_0203278_129_551 | 140 |
| 43 | 3300025929 | Ga0207664_11876071 | Ga0207664_118760711 | 141 |
| 44 | 3300035172 | Ga0373955_0169132 | Ga0373955_0169132_320_748 | 141 |
| 45 | 3300049588 | Ga0501072_0592595 | Ga0501072_0592595_58_486 | 141 |
| 46 | 3300005339 | Ga0070660_101432085 | Ga0070660_1014320851 | 142 |
| 47 | 3300005439 | Ga0070711_100251760 | Ga0070711_1002517602 | 142 |
| 48 | 3300025916 | Ga0207663_10225357 | Ga0207663_102253572 | 142 |
| 49 | 3300037466 | Ga0395898_0102591 | Ga0395898_0102591_2161_2604 | 142 |
| 50 | 3300046458 | Ga0495591_179963 | Ga0495591_179963_63_494 | 142 |
| 51 | 3300003373 | JGI25407J50210_10019029 | JGI25407J50210_100190292 | 143 |
| 52 | 3300005327 | Ga0070658_10028277 | Ga0070658_100282774 | 143 |
| 53 | 3300005327 | Ga0070658_10079643 | Ga0070658_100796432 | 143 |
| 54 | 3300005327 | Ga0070658_10141171 | Ga0070658_101411711 | 143 |
| 55 | 3300005329 | Ga0070683_100146936 | Ga0070683_1001469363 | 143 |
| 56 | 3300005330 | Ga0070690_101366406 | Ga0070690_1013664061 | 143 |
| 57 | 3300005336 | Ga0070680_100984503 | Ga0070680_1009845031 | 143 |
| 58 | 3300005337 | Ga0070682_100422041 | Ga0070682_1004220411 | 143 |
| 59 | 3300005339 | Ga0070660_100011899 | Ga0070660_1000118993 | 143 |
| 60 | 3300005339 | Ga0070660_100673639 | Ga0070660_1006736391 | 143 |
| 61 | 3300005366 | Ga0070659_100029587 | Ga0070659_1000295874 | 143 |
| 62 | 3300005366 | Ga0070659_100124352 | Ga0070659_1001243522 | 143 |
| 63 | 3300005435 | Ga0070714_100037737 | Ga0070714_1000377372 | 143 |
| 64 | 3300005435 | Ga0070714_100044953 | Ga0070714_1000449533 | 143 |
| 65 | 3300005435 | Ga0070714_100137329 | Ga0070714_1001373292 | 143 |
| 66 | 3300005458 | Ga0070681_10236695 | Ga0070681_102366952 | 143 |
| 67 | 3300005458 | Ga0070681_10437565 | Ga0070681_104375652 | 143 |
| 68 | 3300005458 | Ga0070681_11620582 | Ga0070681_116205821 | 143 |
| 69 | 3300005468 | Ga0070707_100025765 | Ga0070707_1000257658 | 143 |
| 70 | 3300005471 | Ga0070698_100114693 | Ga0070698_1001146933 | 143 |
| 71 | 3300005471 | Ga0070698_100181898 | Ga0070698_1001818983 | 143 |
| 72 | 3300005471 | Ga0070698_100270808 | Ga0070698_1002708081 | 143 |
| 73 | 3300005530 | Ga0070679_100110684 | Ga0070679_1001106844 | 143 |
| 74 | 3300005530 | Ga0070679_101743435 | Ga0070679_1017434351 | 143 |
| 75 | 3300005530 | Ga0070679_101794976 | Ga0070679_1017949761 | 143 |
| 76 | 3300005535 | Ga0070684_101192855 | Ga0070684_1011928551 | 143 |
| 77 | 3300005535 | Ga0070684_101777082 | Ga0070684_1017770821 | 143 |
| 78 | 3300005545 | Ga0070695_100455635 | Ga0070695_1004556352 | 143 |
| 79 | 3300005546 | Ga0070696_100477554 | Ga0070696_1004775542 | 143 |
| 80 | 3300005937 | Ga0081455_10051736 | Ga0081455_100517362 | 143 |
| 81 | 3300005981 | Ga0081538_10000565 | Ga0081538_100005659 | 143 |
| 82 | 3300005981 | Ga0081538_10020213 | Ga0081538_100202131 | 143 |
| 83 | 3300006028 | Ga0070717_10122989 | Ga0070717_101229894 | 143 |
| 84 | 3300006028 | Ga0070717_10718537 | Ga0070717_107185371 | 143 |
| 85 | 3300006175 | Ga0070712_100816050 | Ga0070712_1008160502 | 143 |
| 86 | 3300006358 | Ga0068871_101918336 | Ga0068871_1019183361 | 143 |
| 87 | 3300006852 | Ga0075433_11058702 | Ga0075433_110587021 | 143 |
| 88 | 3300009098 | Ga0105245_10523505 | Ga0105245_105235052 | 143 |
| 89 | 3300009101 | Ga0105247_11506430 | Ga0105247_115064301 | 143 |
| 90 | 3300009147 | Ga0114129_10252621 | Ga0114129_102526212 | 143 |
| 91 | 3300009147 | Ga0114129_11402432 | Ga0114129_114024321 | 143 |
| 92 | 3300009174 | Ga0105241_10190465 | Ga0105241_101904652 | 143 |
| 93 | 3300013100 | Ga0157373_10081015 | Ga0157373_100810153 | 143 |
| 94 | 3300013100 | Ga0157373_10350753 | Ga0157373_103507532 | 143 |
| 95 | 3300013100 | Ga0157373_10953659 | Ga0157373_109536592 | 143 |
| 96 | 3300013104 | Ga0157370_10477258 | Ga0157370_104772582 | 143 |
| 97 | 3300013105 | Ga0157369_10351160 | Ga0157369_103511602 | 143 |
| 98 | 3300013307 | Ga0157372_10766362 | Ga0157372_107663622 | 143 |
| 99 | 3300014497 | Ga0182008_10152412 | Ga0182008_101524122 | 143 |
| 100 | 3300015261 | Ga0182006_1118157 | Ga0182006_11181571 | 143 |
| 101 | 3300015261 | Ga0182006_1130787 | Ga0182006_11307872 | 143 |
| 102 | 3300020070 | Ga0206356_11466129 | Ga0206356_114661292 | 143 |
| 103 | 3300020082 | Ga0206353_11081997 | Ga0206353_110819972 | 143 |
| 104 | 3300025898 | Ga0207692_10154895 | Ga0207692_101548951 | 143 |
| 105 | 3300025901 | Ga0207688_10723464 | Ga0207688_107234642 | 143 |
| 106 | 3300025909 | Ga0207705_10203997 | Ga0207705_102039972 | 143 |
| 107 | 3300025911 | Ga0207654_10389101 | Ga0207654_103891011 | 143 |
| 108 | 3300025912 | Ga0207707_10061659 | Ga0207707_100616594 | 143 |
| 109 | 3300025912 | Ga0207707_10328587 | Ga0207707_103285872 | 143 |
| 110 | 3300025919 | Ga0207657_10136434 | Ga0207657_101364342 | 143 |
| 111 | 3300025919 | Ga0207657_10333579 | Ga0207657_103335792 | 143 |
| 112 | 3300025919 | Ga0207657_10377105 | Ga0207657_103771052 | 143 |
| 113 | 3300025919 | Ga0207657_10418825 | Ga0207657_104188252 | 143 |
| 114 | 3300025921 | Ga0207652_10327356 | Ga0207652_103273562 | 143 |
| 115 | 3300025921 | Ga0207652_10976962 | Ga0207652_109769621 | 143 |
| 116 | 3300025921 | Ga0207652_11449402 | Ga0207652_114494021 | 143 |
| 117 | 3300025922 | Ga0207646_10005438 | Ga0207646_1000543812 | 143 |
| 118 | 3300025929 | Ga0207664_10035134 | Ga0207664_100351344 | 143 |
| 119 | 3300025929 | Ga0207664_10229091 | Ga0207664_102290912 | 143 |
| 120 | 3300025931 | Ga0207644_10049049 | Ga0207644_100490492 | 143 |
| 121 | 3300025932 | Ga0207690_10109203 | Ga0207690_101092032 | 143 |
| 122 | 3300025932 | Ga0207690_10144013 | Ga0207690_101440132 | 143 |
| 123 | 3300025932 | Ga0207690_11369143 | Ga0207690_113691431 | 143 |
| 124 | 3300025934 | Ga0207686_11058438 | Ga0207686_110584381 | 143 |
| 125 | 3300025941 | Ga0207711_10149353 | Ga0207711_101493532 | 143 |
| 126 | 3300025941 | Ga0207711_10530542 | Ga0207711_105305422 | 143 |
| 127 | 3300025949 | Ga0207667_10404213 | Ga0207667_104042131 | 143 |
| 128 | 3300025961 | Ga0207712_10380368 | Ga0207712_103803683 | 143 |
| 129 | 3300026116 | Ga0207674_10612019 | Ga0207674_106120192 | 143 |
| 130 | 3300028556 | Ga0265337_1034958 | Ga0265337_10349582 | 143 |
| 131 | 3300028558 | Ga0265326_10052270 | Ga0265326_100522701 | 143 |
| 132 | 3300028558 | Ga0265326_10083143 | Ga0265326_100831432 | 143 |
| 133 | 3300028563 | Ga0265319_1018082 | Ga0265319_10180824 | 143 |
| 134 | 3300028563 | Ga0265319_1024126 | Ga0265319_10241262 | 143 |
| 135 | 3300028573 | Ga0265334_10019415 | Ga0265334_100194152 | 143 |
| 136 | 3300028573 | Ga0265334_10180159 | Ga0265334_101801592 | 143 |
| 137 | 3300028577 | Ga0265318_10004780 | Ga0265318_100047803 | 143 |
| 138 | 3300028653 | Ga0265323_10200907 | Ga0265323_102009072 | 143 |
| 139 | 3300028666 | Ga0265336_10006870 | Ga0265336_100068702 | 143 |
| 140 | 3300028800 | Ga0265338_10004412 | Ga0265338_100044129 | 143 |
| 141 | 3300028800 | Ga0265338_10033767 | Ga0265338_100337672 | 143 |
| 142 | 3300028800 | Ga0265338_10742252 | Ga0265338_107422521 | 143 |
| 143 | 3300031235 | Ga0265330_10046868 | Ga0265330_100468682 | 143 |
| 144 | 3300031235 | Ga0265330_10145155 | Ga0265330_101451552 | 143 |
| 145 | 3300031238 | Ga0265332_10101710 | Ga0265332_101017102 | 143 |
| 146 | 3300031240 | Ga0265320_10313680 | Ga0265320_103136801 | 143 |
| 147 | 3300031241 | Ga0265325_10040329 | Ga0265325_100403294 | 143 |
| 148 | 3300031249 | Ga0265339_10175154 | Ga0265339_101751542 | 143 |
| 149 | 3300031251 | Ga0265327_10084052 | Ga0265327_100840521 | 143 |
| 150 | 3300031251 | Ga0265327_10144496 | Ga0265327_101444962 | 143 |
| 151 | 3300031344 | Ga0265316_10004106 | Ga0265316_1000410617 | 143 |
| 152 | 3300031595 | Ga0265313_10006856 | Ga0265313_100068563 | 143 |
| 153 | 3300031711 | Ga0265314_10028327 | Ga0265314_100283272 | 143 |
| 154 | 3300031711 | Ga0265314_10039527 | Ga0265314_100395274 | 143 |
| 155 | 3300035115 | Ga0373941_0216203 | Ga0373941_0216203_215_646 | 143 |
| 156 | 3300035118 | Ga0373954_0161668 | Ga0373954_0161668_54_491 | 143 |
| 157 | 3300035121 | Ga0373960_0036954 | Ga0373960_0036954_694_1128 | 143 |
| 158 | 3300035695 | Ga0373927_0597580 | Ga0373927_0597580_125_559 | 143 |
| 159 | 3300035725 | Ga0373947_0052627 | Ga0373947_0052627_1063_1497 | 143 |
| 160 | 3300037068 | Ga0373925_0734677 | Ga0373925_0734677_339_773 | 143 |
| 161 | 3300037466 | Ga0395898_0289405 | Ga0395898_0289405_764_1198 | 143 |
| 162 | 3300037466 | Ga0395898_1223196 | Ga0395898_1223196_19_450 | 143 |
| 163 | 3300037466 | Ga0395898_1633523 | Ga0395898_1633523_53_487 | 143 |
| 164 | 3300037471 | Ga0395905_0949864 | Ga0395905_0949864_206_637 | 143 |
| 165 | 3300039437 | Ga0436365_1518340 | Ga0436365_1518340_936_1367 | 143 |
| 166 | 3300039438 | Ga0436360_0821888 | Ga0436360_0821888_19_450 | 143 |
| 167 | 3300044656 | Ga0466969_0038385 | Ga0466969_0038385_1825_2256 | 143 |
| 168 | 3300044684 | Ga0466966_0058831 | Ga0466966_0058831_508_939 | 143 |
| 169 | 3300044684 | Ga0466966_0060183 | Ga0466966_0060183_89_520 | 143 |
| 170 | 3300044684 | Ga0466966_0196367 | Ga0466966_0196367_214_705 | 143 |
| 171 | 3300044693 | Ga0466961_0278520 | Ga0466961_0278520_427_858 | 143 |
| 172 | 3300044694 | Ga0466963_0003865 | Ga0466963_0003865_237_668 | 143 |
| 173 | 3300044694 | Ga0466963_0023648 | Ga0466963_0023648_624_1055 | 143 |
| 174 | 3300044694 | Ga0466963_0134680 | Ga0466963_0134680_677_1108 | 143 |
| 175 | 3300044694 | Ga0466963_0172550 | Ga0466963_0172550_362_796 | 143 |
| 176 | 3300044694 | Ga0466963_0210912 | Ga0466963_0210912_429_860 | 143 |
| 177 | 3300044694 | Ga0466963_0293165 | Ga0466963_0293165_331_765 | 143 |
| 178 | 3300044694 | Ga0466963_0423416 | Ga0466963_0423416_405_839 | 143 |
| 179 | 3300044694 | Ga0466963_0505373 | Ga0466963_0505373_125_556 | 143 |
| 180 | 3300044694 | Ga0466963_0615895 | Ga0466963_0615895_109_540 | 143 |
| 181 | 3300044694 | Ga0466963_0877495 | Ga0466963_0877495_113_544 | 143 |
| 182 | 3300044706 | Ga0466964_0088440 | Ga0466964_0088440_311_745 | 143 |
| 183 | 3300044706 | Ga0466964_0308112 | Ga0466964_0308112_295_726 | 143 |
| 184 | 3300044706 | Ga0466964_0418767 | Ga0466964_0418767_116_547 | 143 |
| 185 | 3300044719 | Ga0466971_0040475 | Ga0466971_0040475_1277_1708 | 143 |
| 186 | 3300044719 | Ga0466971_0360093 | Ga0466971_0360093_14_445 | 143 |
| 187 | 3300044842 | Ga0466957_0061965 | Ga0466957_0061965_1753_2184 | 143 |
| 188 | 3300044842 | Ga0466957_0235426 | Ga0466957_0235426_308_742 | 143 |
| 189 | 3300044842 | Ga0466957_0353344 | Ga0466957_0353344_216_647 | 143 |
| 190 | 3300044842 | Ga0466957_0778631 | Ga0466957_0778631_87_521 | 143 |
| 191 | 3300044842 | Ga0466957_1187654 | Ga0466957_1187654_88_519 | 143 |
| 192 | 3300045049 | Ga0466959_0129925 | Ga0466959_0129925_717_1148 | 143 |
| 193 | 3300045049 | Ga0466959_0601690 | Ga0466959_0601690_201_632 | 143 |
| 194 | 3300045049 | Ga0466959_0763149 | Ga0466959_0763149_16_447 | 143 |
| 195 | 3300045836 | Ga0466958_0010267 | Ga0466958_0010267_1336_1770 | 143 |
| 196 | 3300045836 | Ga0466958_0014926 | Ga0466958_0014926_1122_1553 | 143 |
| 197 | 3300045836 | Ga0466958_0024973 | Ga0466958_0024973_2818_3249 | 143 |
| 198 | 3300045836 | Ga0466958_0123278 | Ga0466958_0123278_561_992 | 143 |
| 199 | 3300045836 | Ga0466958_0141662 | Ga0466958_0141662_51_482 | 143 |
| 200 | 3300045836 | Ga0466958_0349405 | Ga0466958_0349405_505_939 | 143 |
| 201 | 3300045976 | Ga0466967_0108686 | Ga0466967_0108686_1392_1823 | 143 |
| 202 | 3300045976 | Ga0466967_0158405 | Ga0466967_0158405_305_739 | 143 |
| 203 | 3300045976 | Ga0466967_0183132 | Ga0466967_0183132_668_1102 | 143 |
| 204 | 3300045976 | Ga0466967_0327619 | Ga0466967_0327619_928_1359 | 143 |
| 205 | 3300045976 | Ga0466967_0378442 | Ga0466967_0378442_485_916 | 143 |
| 206 | 3300045976 | Ga0466967_0513827 | Ga0466967_0513827_631_1062 | 143 |
| 207 | 3300045976 | Ga0466967_0518206 | Ga0466967_0518206_361_795 | 143 |
| 208 | 3300045976 | Ga0466967_0559520 | Ga0466967_0559520_234_668 | 143 |
| 209 | 3300045976 | Ga0466967_1501477 | Ga0466967_1501477_221_652 | 143 |
| 210 | 3300046454 | Ga0495592_0105262 | Ga0495592_0105262_573_1007 | 143 |
| 211 | 3300046459 | Ga0495629_0040254 | Ga0495629_0040254_822_1316 | 143 |
| 212 | 3300046459 | Ga0495629_0958021 | Ga0495629_0958021_112_546 | 143 |
| 213 | 3300046461 | Ga0495641_0068395 | Ga0495641_0068395_981_1415 | 143 |
| 214 | 3300046511 | Ga0495608_0194214 | Ga0495608_0194214_10_441 | 143 |
| 215 | 3300046514 | Ga0495618_0131228 | Ga0495618_0131228_173_604 | 143 |
| 216 | 3300046514 | Ga0495618_0381564 | Ga0495618_0381564_28_462 | 143 |
| 217 | 3300046516 | Ga0495628_0276219 | Ga0495628_0276219_212_646 | 143 |
| 218 | 3300046516 | Ga0495628_0719723 | Ga0495628_0719723_252_686 | 143 |
| 219 | 3300046517 | Ga0495630_0027552 | Ga0495630_0027552_903_1397 | 143 |
| 220 | 3300046529 | Ga0495652_0148172 | Ga0495652_0148172_25_459 | 143 |
| 221 | 3300046533 | Ga0495640_0420573 | Ga0495640_0420573_303_734 | 143 |
| 222 | 3300046535 | Ga0495586_0014499 | Ga0495586_0014499_2158_2592 | 143 |
| 223 | 3300046543 | Ga0495645_0281181 | Ga0495645_0281181_168_602 | 143 |
| 224 | 3300046559 | Ga0495667_0127345 | Ga0495667_0127345_504_998 | 143 |
| 225 | 3300046642 | Ga0495634_0061667 | Ga0495634_0061667_1573_2004 | 143 |
| 226 | 3300046642 | Ga0495634_0292093 | Ga0495634_0292093_443_877 | 143 |
| 227 | 3300046663 | Ga0495635_0124509 | Ga0495635_0124509_454_888 | 143 |
| 228 | 3300046663 | Ga0495635_0709573 | Ga0495635_0709573_208_642 | 143 |
| 229 | 3300046680 | Ga0495646_0444953 | Ga0495646_0444953_94_528 | 143 |
| 230 | 3300046683 | Ga0495658_0032280 | Ga0495658_0032280_1386_1820 | 143 |
| 231 | 3300046683 | Ga0495658_1115928 | Ga0495658_1115928_32_466 | 143 |
| 232 | 3300046689 | Ga0495613_0047381 | Ga0495613_0047381_991_1425 | 143 |
| 233 | 3300047319 | Ga0495674_0129366 | Ga0495674_0129366_610_1044 | 143 |
| 234 | 3300047319 | Ga0495674_0161060 | Ga0495674_0161060_682_1116 | 143 |
| 235 | 3300047444 | Ga0495675_0335262 | Ga0495675_0335262_184_621 | 143 |
| 236 | 3300048088 | Ga0495602_0077204 | Ga0495602_0077204_391_825 | 143 |
| 237 | 3300048088 | Ga0495602_0374177 | Ga0495602_0374177_194_628 | 143 |
| 238 | 3300048907 | Ga0496104_0341751 | Ga0496104_0341751_174_608 | 143 |
| 239 | 3300048912 | Ga0496109_0849628 | Ga0496109_0849628_295_729 | 143 |
| 240 | 3300048915 | Ga0496112_0033651 | Ga0496112_0033651_2431_2865 | 143 |
| 241 | 3300048918 | Ga0496115_1200902 | Ga0496115_1200902_112_543 | 143 |
| 242 | 3300049568 | Ga0501031_0058066 | Ga0501031_0058066_1540_1971 | 143 |
| 243 | 3300049568 | Ga0501031_0086916 | Ga0501031_0086916_161_592 | 143 |
| 244 | 3300049569 | Ga0501032_0108625 | Ga0501032_0108625_51_482 | 143 |
| 245 | 3300049570 | Ga0501033_0298984 | Ga0501033_0298984_362_793 | 143 |
| 246 | 3300049571 | Ga0501034_0051390 | Ga0501034_0051390_3003_3434 | 143 |
| 247 | 3300049572 | Ga0501036_0016451 | Ga0501036_0016451_3211_3642 | 143 |
| 248 | 3300049574 | Ga0501038_0038082 | Ga0501038_0038082_3576_4007 | 143 |
| 249 | 3300049575 | Ga0501039_0261039 | Ga0501039_0261039_896_1327 | 143 |
| 250 | 3300049576 | Ga0501040_0000505 | Ga0501040_0000505_16444_16875 | 143 |
| 251 | 3300049576 | Ga0501040_0039796 | Ga0501040_0039796_1375_1806 | 143 |
| 252 | 3300049577 | Ga0501041_0016294 | Ga0501041_0016294_2813_3244 | 143 |
| 253 | 3300049577 | Ga0501041_0022710 | Ga0501041_0022710_3245_3676 | 143 |
| 254 | 3300049578 | Ga0501042_0000909 | Ga0501042_0000909_12298_12729 | 143 |
| 255 | 3300049578 | Ga0501042_1082245 | Ga0501042_1082245_51_485 | 143 |
| 256 | 3300049579 | Ga0501043_0575844 | Ga0501043_0575844_312_743 | 143 |
| 257 | 3300049581 | Ga0501047_0405004 | Ga0501047_0405004_715_1146 | 143 |
| 258 | 3300049582 | Ga0501048_0012035 | Ga0501048_0012035_4469_4900 | 143 |
| 259 | 3300049583 | Ga0501067_0400517 | Ga0501067_0400517_217_696 | 143 |
| 260 | 3300049584 | Ga0501068_0161904 | Ga0501068_0161904_715_1146 | 143 |
| 261 | 3300049584 | Ga0501068_1004721 | Ga0501068_1004721_38_472 | 143 |
| 262 | 3300049585 | Ga0501069_0092763 | Ga0501069_0092763_526_1005 | 143 |
| 263 | 3300049586 | Ga0501070_0268219 | Ga0501070_0268219_29_460 | 143 |
| 264 | 3300049586 | Ga0501070_0408439 | Ga0501070_0408439_575_1006 | 143 |
| 265 | 3300049587 | Ga0501071_0005439 | Ga0501071_0005439_765_1196 | 143 |
| 266 | 3300049588 | Ga0501072_0000190 | Ga0501072_0000190_11411_11842 | 143 |
| 267 | 3300049588 | Ga0501072_0039548 | Ga0501072_0039548_439_870 | 143 |
| 268 | 3300049588 | Ga0501072_0087765 | Ga0501072_0087765_1441_1872 | 143 |
| 269 | 3300049589 | Ga0501073_0107665 | Ga0501073_0107665_1318_1749 | 143 |
| 270 | 3300049589 | Ga0501073_0147332 | Ga0501073_0147332_1170_1601 | 143 |
| 271 | 3300049589 | Ga0501073_0304600 | Ga0501073_0304600_532_963 | 143 |
| 272 | 3300049590 | Ga0501074_0039059 | Ga0501074_0039059_2723_3154 | 143 |
| 273 | 3300049590 | Ga0501074_0104613 | Ga0501074_0104613_640_1071 | 143 |
| 274 | 3300049591 | Ga0501075_0000311 | Ga0501075_0000311_2032_2463 | 143 |
| 275 | 3300049591 | Ga0501075_0014013 | Ga0501075_0014013_1217_1648 | 143 |
| 276 | 3300049592 | Ga0501076_0000336 | Ga0501076_0000336_2095_2526 | 143 |
| 277 | 3300049592 | Ga0501076_0040018 | Ga0501076_0040018_1536_1967 | 143 |
| 278 | 3300049593 | Ga0501077_0004089 | Ga0501077_0004089_7892_8323 | 143 |
| 279 | 3300049593 | Ga0501077_0067518 | Ga0501077_0067518_1630_2061 | 143 |
| 280 | 3300049741 | Ga0501079_0000420 | Ga0501079_0000420_14099_14530 | 143 |
| 281 | 3300049741 | Ga0501079_0100848 | Ga0501079_0100848_1061_1492 | 143 |
| 282 | 3300049741 | Ga0501079_0127770 | Ga0501079_0127770_1412_1843 | 143 |
| 283 | 3300049741 | Ga0501079_0157308 | Ga0501079_0157308_748_1182 | 143 |
| 284 | 3300049742 | Ga0501080_0019576 | Ga0501080_0019576_3698_4129 | 143 |
| 285 | 3300049742 | Ga0501080_0075689 | Ga0501080_0075689_1508_1939 | 143 |
| 286 | 3300049742 | Ga0501080_0807262 | Ga0501080_0807262_302_733 | 143 |
| 287 | 3300049743 | Ga0501081_0004449 | Ga0501081_0004449_5792_6223 | 143 |
| 288 | 3300049743 | Ga0501081_0013186 | Ga0501081_0013186_1645_2079 | 143 |
| 289 | 3300049743 | Ga0501081_0082492 | Ga0501081_0082492_910_1341 | 143 |
| 290 | 3300049744 | Ga0501083_0257923 | Ga0501083_0257923_63_494 | 143 |
| 291 | 3300049822 | Ga0501035_0582058 | Ga0501035_0582058_404_835 | 143 |
| 292 | 3300049823 | Ga0501044_0316963 | Ga0501044_0316963_73_504 | 143 |
| 293 | 3300049824 | Ga0501045_0000886 | Ga0501045_0000886_6972_7403 | 143 |
| 294 | 3300049824 | Ga0501045_0093764 | Ga0501045_0093764_1550_1981 | 143 |
| 295 | 3300050507 | nmdc:mga05p37_1113279_c1 | nmdc:mga05p37_1113279_c1_102_536 | 143 |
| 296 | 3300050512 | nmdc:mga0n895_216837_c1 | nmdc:mga0n895_216837_c1_1493_1927 | 143 |
| 297 | 3300050515 | nmdc:mga0a205_230489_c1 | nmdc:mga0a205_230489_c1_1209_1643 | 143 |
| 298 | 3300053077 | Ga0495601_0492279 | Ga0495601_0492279_341_775 | 143 |
| 299 | 3300053085 | Ga0495619_0004646 | Ga0495619_0004646_3516_4010 | 143 |
| 300 | 3300053085 | Ga0495619_0056909 | Ga0495619_0056909_1444_1881 | 143 |
| 301 | 3300053085 | Ga0495619_0778014 | Ga0495619_0778014_187_618 | 143 |
| 302 | 3300054114 | Ga0501084_0005273 | Ga0501084_0005273_3500_3934 | 143 |
| 303 | 3300054114 | Ga0501084_0014294 | Ga0501084_0014294_2947_3378 | 143 |
| 304 | 3300054114 | Ga0501084_0117279 | Ga0501084_0117279_1039_1470 | 143 |
| 305 | 3300060353 | Ga0501082_0014661 | Ga0501082_0014661_3835_4266 | 143 |
| 306 | 3300060353 | Ga0501082_0080559 | Ga0501082_0080559_2315_2746 | 143 |
| 307 | 3300061719 | Ga0466962_0015279 | Ga0466962_0015279_2417_2848 | 143 |
| 308 | 3300061719 | Ga0466962_0238694 | Ga0466962_0238694_228_662 | 143 |
| 309 | 3300061734 | Ga0530510_0000504 | Ga0530510_0000504_11052_11483 | 143 |
| 310 | 3300061734 | Ga0530510_0215608 | Ga0530510_0215608_367_801 | 143 |
| 311 | 3300061734 | Ga0530510_0352227 | Ga0530510_0352227_181_660 | 143 |
| 312 | 3300002077 | JGI24744J21845_10005153 | JGI24744J21845_100051535 | 144 |
| 313 | 3300002244 | JGI24742J22300_10049925 | JGI24742J22300_100499252 | 144 |
| 314 | 3300003320 | rootH2_10145799 | rootH2_101457992 | 144 |
| 315 | 3300005327 | Ga0070658_10397026 | Ga0070658_103970261 | 144 |
| 316 | 3300005327 | Ga0070658_10648688 | Ga0070658_106486881 | 144 |
| 317 | 3300005329 | Ga0070683_100006562 | Ga0070683_10000656211 | 144 |
| 318 | 3300005329 | Ga0070683_100021449 | Ga0070683_1000214496 | 144 |
| 319 | 3300005329 | Ga0070683_100260818 | Ga0070683_1002608183 | 144 |
| 320 | 3300005330 | Ga0070690_100125816 | Ga0070690_1001258162 | 144 |
| 321 | 3300005336 | Ga0070680_100010699 | Ga0070680_1000106995 | 144 |
| 322 | 3300005336 | Ga0070680_100027507 | Ga0070680_1000275076 | 144 |
| 323 | 3300005336 | Ga0070680_100232958 | Ga0070680_1002329583 | 144 |
| 324 | 3300005336 | Ga0070680_100266914 | Ga0070680_1002669142 | 144 |
| 325 | 3300005337 | Ga0070682_100020032 | Ga0070682_1000200324 | 144 |
| 326 | 3300005337 | Ga0070682_100124898 | Ga0070682_1001248982 | 144 |
| 327 | 3300005337 | Ga0070682_100312310 | Ga0070682_1003123102 | 144 |
| 328 | 3300005338 | Ga0068868_100040728 | Ga0068868_1000407285 | 144 |
| 329 | 3300005338 | Ga0068868_100399438 | Ga0068868_1003994382 | 144 |
| 330 | 3300005338 | Ga0068868_100907006 | Ga0068868_1009070062 | 144 |
| 331 | 3300005339 | Ga0070660_100037138 | Ga0070660_1000371382 | 144 |
| 332 | 3300005340 | Ga0070689_100923289 | Ga0070689_1009232891 | 144 |
| 333 | 3300005341 | Ga0070691_10292626 | Ga0070691_102926262 | 144 |
| 334 | 3300005344 | Ga0070661_100172121 | Ga0070661_1001721211 | 144 |
| 335 | 3300005345 | Ga0070692_10025442 | Ga0070692_100254423 | 144 |
| 336 | 3300005355 | Ga0070671_100184565 | Ga0070671_1001845652 | 144 |
| 337 | 3300005355 | Ga0070671_100189710 | Ga0070671_1001897102 | 144 |
| 338 | 3300005356 | Ga0070674_100073278 | Ga0070674_1000732783 | 144 |
| 339 | 3300005365 | Ga0070688_100045686 | Ga0070688_1000456862 | 144 |
| 340 | 3300005366 | Ga0070659_100634279 | Ga0070659_1006342791 | 144 |
| 341 | 3300005406 | Ga0070703_10035822 | Ga0070703_100358222 | 144 |
| 342 | 3300005434 | Ga0070709_10017111 | Ga0070709_100171112 | 144 |
| 343 | 3300005434 | Ga0070709_10320167 | Ga0070709_103201671 | 144 |
| 344 | 3300005435 | Ga0070714_100009938 | Ga0070714_1000099388 | 144 |
| 345 | 3300005435 | Ga0070714_100087445 | Ga0070714_1000874451 | 144 |
| 346 | 3300005435 | Ga0070714_100462205 | Ga0070714_1004622052 | 144 |
| 347 | 3300005436 | Ga0070713_100007160 | Ga0070713_1000071604 | 144 |
| 348 | 3300005436 | Ga0070713_100106750 | Ga0070713_1001067503 | 144 |
| 349 | 3300005437 | Ga0070710_10001797 | Ga0070710_100017976 | 144 |
| 350 | 3300005437 | Ga0070710_10246260 | Ga0070710_102462603 | 144 |
| 351 | 3300005437 | Ga0070710_10246810 | Ga0070710_102468102 | 144 |
| 352 | 3300005437 | Ga0070710_10580965 | Ga0070710_105809651 | 144 |
| 353 | 3300005438 | Ga0070701_10013123 | Ga0070701_100131232 | 144 |
| 354 | 3300005439 | Ga0070711_100082704 | Ga0070711_1000827043 | 144 |
| 355 | 3300005439 | Ga0070711_100109703 | Ga0070711_1001097033 | 144 |
| 356 | 3300005439 | Ga0070711_100140593 | Ga0070711_1001405933 | 144 |
| 357 | 3300005440 | Ga0070705_100103546 | Ga0070705_1001035462 | 144 |
| 358 | 3300005440 | Ga0070705_100227615 | Ga0070705_1002276152 | 144 |
| 359 | 3300005441 | Ga0070700_100005137 | Ga0070700_1000051375 | 144 |
| 360 | 3300005444 | Ga0070694_100187047 | Ga0070694_1001870473 | 144 |
| 361 | 3300005455 | Ga0070663_100165402 | Ga0070663_1001654023 | 144 |
| 362 | 3300005455 | Ga0070663_100182027 | Ga0070663_1001820272 | 144 |
| 363 | 3300005456 | Ga0070678_100007764 | Ga0070678_1000077647 | 144 |
| 364 | 3300005456 | Ga0070678_100636202 | Ga0070678_1006362022 | 144 |
| 365 | 3300005456 | Ga0070678_100886505 | Ga0070678_1008865052 | 144 |
| 366 | 3300005457 | Ga0070662_101510701 | Ga0070662_1015107012 | 144 |
| 367 | 3300005458 | Ga0070681_10017854 | Ga0070681_100178547 | 144 |
| 368 | 3300005458 | Ga0070681_10051277 | Ga0070681_100512775 | 144 |
| 369 | 3300005458 | Ga0070681_10229762 | Ga0070681_102297624 | 144 |
| 370 | 3300005458 | Ga0070681_10586761 | Ga0070681_105867611 | 144 |
| 371 | 3300005459 | Ga0068867_100046488 | Ga0068867_1000464885 | 144 |
| 372 | 3300005466 | Ga0070685_10077527 | Ga0070685_100775273 | 144 |
| 373 | 3300005467 | Ga0070706_101278862 | Ga0070706_1012788622 | 144 |
| 374 | 3300005468 | Ga0070707_100304464 | Ga0070707_1003044642 | 144 |
| 375 | 3300005471 | Ga0070698_100002914 | Ga0070698_10000291410 | 144 |
| 376 | 3300005530 | Ga0070679_100029228 | Ga0070679_1000292282 | 144 |
| 377 | 3300005530 | Ga0070679_100258710 | Ga0070679_1002587103 | 144 |
| 378 | 3300005530 | Ga0070679_100950938 | Ga0070679_1009509381 | 144 |
| 379 | 3300005535 | Ga0070684_100008150 | Ga0070684_1000081507 | 144 |
| 380 | 3300005535 | Ga0070684_100040414 | Ga0070684_1000404145 | 144 |
| 381 | 3300005535 | Ga0070684_100260625 | Ga0070684_1002606251 | 144 |
| 382 | 3300005535 | Ga0070684_101161701 | Ga0070684_1011617012 | 144 |
| 383 | 3300005535 | Ga0070684_101186283 | Ga0070684_1011862831 | 144 |
| 384 | 3300005539 | Ga0068853_100059109 | Ga0068853_1000591092 | 144 |
| 385 | 3300005539 | Ga0068853_101281254 | Ga0068853_1012812542 | 144 |
| 386 | 3300005543 | Ga0070672_100320970 | Ga0070672_1003209702 | 144 |
| 387 | 3300005544 | Ga0070686_100284373 | Ga0070686_1002843732 | 144 |
| 388 | 3300005546 | Ga0070696_100020409 | Ga0070696_1000204093 | 144 |
| 389 | 3300005547 | Ga0070693_100004618 | Ga0070693_1000046184 | 144 |
| 390 | 3300005547 | Ga0070693_100197461 | Ga0070693_1001974612 | 144 |
| 391 | 3300005547 | Ga0070693_100534058 | Ga0070693_1005340581 | 144 |
| 392 | 3300005548 | Ga0070665_100018038 | Ga0070665_1000180385 | 144 |
| 393 | 3300005548 | Ga0070665_101039770 | Ga0070665_1010397702 | 144 |
| 394 | 3300005549 | Ga0070704_100018182 | Ga0070704_1000181823 | 144 |
| 395 | 3300005549 | Ga0070704_100034939 | Ga0070704_1000349391 | 144 |
| 396 | 3300005549 | Ga0070704_100283928 | Ga0070704_1002839281 | 144 |
| 397 | 3300005549 | Ga0070704_101480419 | Ga0070704_1014804192 | 144 |
| 398 | 3300005563 | Ga0068855_100149462 | Ga0068855_1001494621 | 144 |
| 399 | 3300005563 | Ga0068855_100871357 | Ga0068855_1008713572 | 144 |
| 400 | 3300005563 | Ga0068855_101023909 | Ga0068855_1010239092 | 144 |
| 401 | 3300005563 | Ga0068855_101035294 | Ga0068855_1010352942 | 144 |
| 402 | 3300005614 | Ga0068856_100059260 | Ga0068856_1000592602 | 144 |
| 403 | 3300005614 | Ga0068856_100073164 | Ga0068856_1000731646 | 144 |
| 404 | 3300005614 | Ga0068856_100455018 | Ga0068856_1004550182 | 144 |
| 405 | 3300005614 | Ga0068856_100911453 | Ga0068856_1009114532 | 144 |
| 406 | 3300005614 | Ga0068856_101465511 | Ga0068856_1014655112 | 144 |
| 407 | 3300005615 | Ga0070702_100015913 | Ga0070702_1000159134 | 144 |
| 408 | 3300005615 | Ga0070702_100024100 | Ga0070702_1000241004 | 144 |
| 409 | 3300005616 | Ga0068852_100044443 | Ga0068852_1000444435 | 144 |
| 410 | 3300005616 | Ga0068852_100441584 | Ga0068852_1004415841 | 144 |
| 411 | 3300005616 | Ga0068852_100536706 | Ga0068852_1005367062 | 144 |
| 412 | 3300005617 | Ga0068859_100227120 | Ga0068859_1002271202 | 144 |
| 413 | 3300005618 | Ga0068864_101169583 | Ga0068864_1011695832 | 144 |
| 414 | 3300005618 | Ga0068864_101396863 | Ga0068864_1013968632 | 144 |
| 415 | 3300005718 | Ga0068866_10020135 | Ga0068866_100201353 | 144 |
| 416 | 3300005719 | Ga0068861_100038349 | Ga0068861_1000383493 | 144 |
| 417 | 3300005841 | Ga0068863_100083643 | Ga0068863_1000836433 | 144 |
| 418 | 3300005843 | Ga0068860_100061442 | Ga0068860_1000614422 | 144 |
| 419 | 3300005937 | Ga0081455_10040841 | Ga0081455_100408413 | 144 |
| 420 | 3300006028 | Ga0070717_10004885 | Ga0070717_100048852 | 144 |
| 421 | 3300006028 | Ga0070717_10045128 | Ga0070717_100451283 | 144 |
| 422 | 3300006028 | Ga0070717_10066518 | Ga0070717_100665183 | 144 |
| 423 | 3300006028 | Ga0070717_10177241 | Ga0070717_101772413 | 144 |
| 424 | 3300006028 | Ga0070717_11215584 | Ga0070717_112155841 | 144 |
| 425 | 3300006038 | Ga0075365_10019883 | Ga0075365_100198835 | 144 |
| 426 | 3300006163 | Ga0070715_10001967 | Ga0070715_100019674 | 144 |
| 427 | 3300006163 | Ga0070715_10029792 | Ga0070715_100297923 | 144 |
| 428 | 3300006173 | Ga0070716_100000458 | Ga0070716_10000045814 | 144 |
| 429 | 3300006175 | Ga0070712_100003766 | Ga0070712_1000037663 | 144 |
| 430 | 3300006175 | Ga0070712_100030800 | Ga0070712_1000308002 | 144 |
| 431 | 3300006175 | Ga0070712_100138100 | Ga0070712_1001381003 | 144 |
| 432 | 3300006175 | Ga0070712_100270618 | Ga0070712_1002706182 | 144 |
| 433 | 3300006175 | Ga0070712_100407967 | Ga0070712_1004079672 | 144 |
| 434 | 3300006237 | Ga0097621_100067240 | Ga0097621_1000672404 | 144 |
| 435 | 3300006358 | Ga0068871_100094508 | Ga0068871_1000945083 | 144 |
| 436 | 3300006358 | Ga0068871_100228040 | Ga0068871_1002280402 | 144 |
| 437 | 3300006847 | Ga0075431_100063116 | Ga0075431_1000631165 | 144 |
| 438 | 3300006852 | Ga0075433_10443802 | Ga0075433_104438022 | 144 |
| 439 | 3300006852 | Ga0075433_11032740 | Ga0075433_110327401 | 144 |
| 440 | 3300006871 | Ga0075434_100024252 | Ga0075434_1000242523 | 144 |
| 441 | 3300006871 | Ga0075434_100583166 | Ga0075434_1005831662 | 144 |
| 442 | 3300006871 | Ga0075434_100865927 | Ga0075434_1008659272 | 144 |
| 443 | 3300006871 | Ga0075434_101286834 | Ga0075434_1012868342 | 144 |
| 444 | 3300006881 | Ga0068865_100007703 | Ga0068865_1000077034 | 144 |
| 445 | 3300006881 | Ga0068865_100233232 | Ga0068865_1002332322 | 144 |
| 446 | 3300006914 | Ga0075436_100046335 | Ga0075436_1000463352 | 144 |
| 447 | 3300006914 | Ga0075436_100361909 | Ga0075436_1003619091 | 144 |
| 448 | 3300006931 | Ga0097620_100227122 | Ga0097620_1002271222 | 144 |
| 449 | 3300007076 | Ga0075435_100106665 | Ga0075435_1001066652 | 144 |
| 450 | 3300007076 | Ga0075435_100147410 | Ga0075435_1001474103 | 144 |
| 451 | 3300007076 | Ga0075435_100722467 | Ga0075435_1007224672 | 144 |
| 452 | 3300007076 | Ga0075435_100794031 | Ga0075435_1007940312 | 144 |
| 453 | 3300007788 | Ga0099795_10247292 | Ga0099795_102472921 | 144 |
| 454 | 3300009093 | Ga0105240_10053208 | Ga0105240_100532084 | 144 |
| 455 | 3300009093 | Ga0105240_10132171 | Ga0105240_101321715 | 144 |
| 456 | 3300009094 | Ga0111539_10297055 | Ga0111539_102970553 | 144 |
| 457 | 3300009098 | Ga0105245_10022340 | Ga0105245_100223407 | 144 |
| 458 | 3300009098 | Ga0105245_10087652 | Ga0105245_100876524 | 144 |
| 459 | 3300009098 | Ga0105245_10130395 | Ga0105245_101303952 | 144 |
| 460 | 3300009098 | Ga0105245_10490782 | Ga0105245_104907822 | 144 |
| 461 | 3300009098 | Ga0105245_10588509 | Ga0105245_105885092 | 144 |
| 462 | 3300009098 | Ga0105245_11770122 | Ga0105245_117701221 | 144 |
| 463 | 3300009101 | Ga0105247_10018625 | Ga0105247_100186253 | 144 |
| 464 | 3300009147 | Ga0114129_10067445 | Ga0114129_100674457 | 144 |
| 465 | 3300009147 | Ga0114129_10315344 | Ga0114129_103153442 | 144 |
| 466 | 3300009147 | Ga0114129_10720593 | Ga0114129_107205932 | 144 |
| 467 | 3300009147 | Ga0114129_11810409 | Ga0114129_118104092 | 144 |
| 468 | 3300009148 | Ga0105243_10121676 | Ga0105243_101216761 | 144 |
| 469 | 3300009148 | Ga0105243_10451799 | Ga0105243_104517992 | 144 |
| 470 | 3300009174 | Ga0105241_10042368 | Ga0105241_100423685 | 144 |
| 471 | 3300009174 | Ga0105241_10131538 | Ga0105241_101315382 | 144 |
| 472 | 3300009176 | Ga0105242_10150103 | Ga0105242_101501034 | 144 |
| 473 | 3300009176 | Ga0105242_10296813 | Ga0105242_102968133 | 144 |
| 474 | 3300009176 | Ga0105242_10784195 | Ga0105242_107841952 | 144 |
| 475 | 3300009177 | Ga0105248_10215622 | Ga0105248_102156222 | 144 |
| 476 | 3300009177 | Ga0105248_11103642 | Ga0105248_111036421 | 144 |
| 477 | 3300009545 | Ga0105237_10050489 | Ga0105237_100504892 | 144 |
| 478 | 3300009551 | Ga0105238_10305213 | Ga0105238_103052133 | 144 |
| 479 | 3300009551 | Ga0105238_10457584 | Ga0105238_104575842 | 144 |
| 480 | 3300009551 | Ga0105238_10796794 | Ga0105238_107967941 | 144 |
| 481 | 3300009551 | Ga0105238_10827683 | Ga0105238_108276832 | 144 |
| 482 | 3300009553 | Ga0105249_10014061 | Ga0105249_100140615 | 144 |
| 483 | 3300009553 | Ga0105249_11516808 | Ga0105249_115168082 | 144 |
| 484 | 3300010375 | Ga0105239_10306154 | Ga0105239_103061542 | 144 |
| 485 | 3300010375 | Ga0105239_10477830 | Ga0105239_104778302 | 144 |
| 486 | 3300010375 | Ga0105239_10678086 | Ga0105239_106780863 | 144 |
| 487 | 3300011119 | Ga0105246_10096802 | Ga0105246_100968023 | 144 |
| 488 | 3300011119 | Ga0105246_10167261 | Ga0105246_101672613 | 144 |
| 489 | 3300013100 | Ga0157373_10367032 | Ga0157373_103670321 | 144 |
| 490 | 3300013100 | Ga0157373_10424928 | Ga0157373_104249281 | 144 |
| 491 | 3300013102 | Ga0157371_10070716 | Ga0157371_100707164 | 144 |
| 492 | 3300013102 | Ga0157371_10378605 | Ga0157371_103786051 | 144 |
| 493 | 3300013102 | Ga0157371_10719588 | Ga0157371_107195882 | 144 |
| 494 | 3300013104 | Ga0157370_10069449 | Ga0157370_100694491 | 144 |
| 495 | 3300013104 | Ga0157370_10184027 | Ga0157370_101840272 | 144 |
| 496 | 3300013104 | Ga0157370_10517857 | Ga0157370_105178572 | 144 |
| 497 | 3300013105 | Ga0157369_10075073 | Ga0157369_100750732 | 144 |
| 498 | 3300013105 | Ga0157369_10160592 | Ga0157369_101605922 | 144 |
| 499 | 3300013105 | Ga0157369_10327266 | Ga0157369_103272663 | 144 |
| 500 | 3300013105 | Ga0157369_10554559 | Ga0157369_105545592 | 144 |
| 501 | 3300013296 | Ga0157374_10093305 | Ga0157374_100933054 | 144 |
| 502 | 3300013296 | Ga0157374_10699746 | Ga0157374_106997461 | 144 |
| 503 | 3300013297 | Ga0157378_10105188 | Ga0157378_101051883 | 144 |
| 504 | 3300013307 | Ga0157372_10212225 | Ga0157372_102122251 | 144 |
| 505 | 3300013307 | Ga0157372_10345801 | Ga0157372_103458012 | 144 |
| 506 | 3300013307 | Ga0157372_10655564 | Ga0157372_106555642 | 144 |
| 507 | 3300013307 | Ga0157372_10767644 | Ga0157372_107676442 | 144 |
| 508 | 3300013307 | Ga0157372_12223446 | Ga0157372_122234462 | 144 |
| 509 | 3300013308 | Ga0157375_10057988 | Ga0157375_100579882 | 144 |
| 510 | 3300013308 | Ga0157375_11184822 | Ga0157375_111848222 | 144 |
| 511 | 3300014326 | Ga0157380_10021024 | Ga0157380_100210242 | 144 |
| 512 | 3300014497 | Ga0182008_10079629 | Ga0182008_100796291 | 144 |
| 513 | 3300014745 | Ga0157377_10003961 | Ga0157377_100039616 | 144 |
| 514 | 3300014745 | Ga0157377_10358249 | Ga0157377_103582492 | 144 |
| 515 | 3300014968 | Ga0157379_10522780 | Ga0157379_105227801 | 144 |
| 516 | 3300014969 | Ga0157376_10053378 | Ga0157376_100533784 | 144 |
| 517 | 3300014969 | Ga0157376_10116057 | Ga0157376_101160572 | 144 |
| 518 | 3300014969 | Ga0157376_11346031 | Ga0157376_113460312 | 144 |
| 519 | 3300017792 | Ga0163161_10150015 | Ga0163161_101500152 | 144 |
| 520 | 3300020069 | Ga0197907_11093402 | Ga0197907_110934024 | 144 |
| 521 | 3300020070 | Ga0206356_10416366 | Ga0206356_104163661 | 144 |
| 522 | 3300020070 | Ga0206356_11562056 | Ga0206356_115620561 | 144 |
| 523 | 3300020075 | Ga0206349_1562762 | Ga0206349_15627621 | 144 |
| 524 | 3300020081 | Ga0206354_10956547 | Ga0206354_109565472 | 144 |
| 525 | 3300020081 | Ga0206354_11132402 | Ga0206354_111324022 | 144 |
| 526 | 3300020081 | Ga0206354_11399885 | Ga0206354_113998854 | 144 |
| 527 | 3300020082 | Ga0206353_10006983 | Ga0206353_100069831 | 144 |
| 528 | 3300020082 | Ga0206353_11073345 | Ga0206353_110733452 | 144 |
| 529 | 3300020082 | Ga0206353_11281008 | Ga0206353_112810083 | 144 |
| 530 | 3300022467 | Ga0224712_10269621 | Ga0224712_102696211 | 144 |
| 531 | 3300022467 | Ga0224712_10368756 | Ga0224712_103687561 | 144 |
| 532 | 3300022467 | Ga0224712_10597468 | Ga0224712_105974681 | 144 |
| 533 | 3300025885 | Ga0207653_10027132 | Ga0207653_100271323 | 144 |
| 534 | 3300025898 | Ga0207692_10005665 | Ga0207692_100056653 | 144 |
| 535 | 3300025899 | Ga0207642_10016067 | Ga0207642_100160673 | 144 |
| 536 | 3300025900 | Ga0207710_10029092 | Ga0207710_100290923 | 144 |
| 537 | 3300025901 | Ga0207688_10049727 | Ga0207688_100497273 | 144 |
| 538 | 3300025903 | Ga0207680_10365578 | Ga0207680_103655782 | 144 |
| 539 | 3300025904 | Ga0207647_10053456 | Ga0207647_100534562 | 144 |
| 540 | 3300025904 | Ga0207647_10181781 | Ga0207647_101817813 | 144 |
| 541 | 3300025905 | Ga0207685_10000925 | Ga0207685_100009257 | 144 |
| 542 | 3300025905 | Ga0207685_10060928 | Ga0207685_100609282 | 144 |
| 543 | 3300025906 | Ga0207699_10005147 | Ga0207699_100051471 | 144 |
| 544 | 3300025906 | Ga0207699_10917393 | Ga0207699_109173932 | 144 |
| 545 | 3300025908 | Ga0207643_10367966 | Ga0207643_103679662 | 144 |
| 546 | 3300025909 | Ga0207705_10057765 | Ga0207705_100577651 | 144 |
| 547 | 3300025909 | Ga0207705_11079779 | Ga0207705_110797792 | 144 |
| 548 | 3300025910 | Ga0207684_10521210 | Ga0207684_105212102 | 144 |
| 549 | 3300025912 | Ga0207707_10014650 | Ga0207707_100146505 | 144 |
| 550 | 3300025912 | Ga0207707_10078672 | Ga0207707_100786724 | 144 |
| 551 | 3300025912 | Ga0207707_10093608 | Ga0207707_100936083 | 144 |
| 552 | 3300025912 | Ga0207707_10371714 | Ga0207707_103717142 | 144 |
| 553 | 3300025912 | Ga0207707_10602573 | Ga0207707_106025732 | 144 |
| 554 | 3300025912 | Ga0207707_10848421 | Ga0207707_108484211 | 144 |
| 555 | 3300025913 | Ga0207695_10026136 | Ga0207695_100261362 | 144 |
| 556 | 3300025913 | Ga0207695_10062357 | Ga0207695_100623575 | 144 |
| 557 | 3300025915 | Ga0207693_10000860 | Ga0207693_1000086017 | 144 |
| 558 | 3300025915 | Ga0207693_10004312 | Ga0207693_100043128 | 144 |
| 559 | 3300025915 | Ga0207693_10044202 | Ga0207693_100442022 | 144 |
| 560 | 3300025915 | Ga0207693_10241875 | Ga0207693_102418752 | 144 |
| 561 | 3300025916 | Ga0207663_10006640 | Ga0207663_100066405 | 144 |
| 562 | 3300025916 | Ga0207663_10118065 | Ga0207663_101180653 | 144 |
| 563 | 3300025916 | Ga0207663_10148746 | Ga0207663_101487463 | 144 |
| 564 | 3300025916 | Ga0207663_10974781 | Ga0207663_109747812 | 144 |
| 565 | 3300025917 | Ga0207660_10064459 | Ga0207660_100644593 | 144 |
| 566 | 3300025917 | Ga0207660_10274671 | Ga0207660_102746712 | 144 |
| 567 | 3300025917 | Ga0207660_10453966 | Ga0207660_104539661 | 144 |
| 568 | 3300025917 | Ga0207660_10735733 | Ga0207660_107357332 | 144 |
| 569 | 3300025919 | Ga0207657_10025169 | Ga0207657_100251697 | 144 |
| 570 | 3300025919 | Ga0207657_10042837 | Ga0207657_100428376 | 144 |
| 571 | 3300025919 | Ga0207657_10379853 | Ga0207657_103798532 | 144 |
| 572 | 3300025920 | Ga0207649_10072216 | Ga0207649_100722161 | 144 |
| 573 | 3300025921 | Ga0207652_10359706 | Ga0207652_103597062 | 144 |
| 574 | 3300025921 | Ga0207652_10864184 | Ga0207652_108641841 | 144 |
| 575 | 3300025921 | Ga0207652_10864532 | Ga0207652_108645322 | 144 |
| 576 | 3300025921 | Ga0207652_10876554 | Ga0207652_108765542 | 144 |
| 577 | 3300025921 | Ga0207652_11120231 | Ga0207652_111202312 | 144 |
| 578 | 3300025922 | Ga0207646_10030202 | Ga0207646_100302026 | 144 |
| 579 | 3300025922 | Ga0207646_10682508 | Ga0207646_106825082 | 144 |
| 580 | 3300025924 | Ga0207694_10015264 | Ga0207694_100152646 | 144 |
| 581 | 3300025924 | Ga0207694_10171558 | Ga0207694_101715583 | 144 |
| 582 | 3300025924 | Ga0207694_10425771 | Ga0207694_104257712 | 144 |
| 583 | 3300025924 | Ga0207694_10714524 | Ga0207694_107145242 | 144 |
| 584 | 3300025926 | Ga0207659_10446433 | Ga0207659_104464332 | 144 |
| 585 | 3300025927 | Ga0207687_10050927 | Ga0207687_100509272 | 144 |
| 586 | 3300025927 | Ga0207687_10211193 | Ga0207687_102111932 | 144 |
| 587 | 3300025927 | Ga0207687_10341195 | Ga0207687_103411951 | 144 |
| 588 | 3300025927 | Ga0207687_10474474 | Ga0207687_104744741 | 144 |
| 589 | 3300025927 | Ga0207687_10523915 | Ga0207687_105239152 | 144 |
| 590 | 3300025928 | Ga0207700_10039800 | Ga0207700_100398005 | 144 |
| 591 | 3300025928 | Ga0207700_10400851 | Ga0207700_104008512 | 144 |
| 592 | 3300025929 | Ga0207664_10015153 | Ga0207664_100151535 | 144 |
| 593 | 3300025929 | Ga0207664_10050563 | Ga0207664_100505632 | 144 |
| 594 | 3300025929 | Ga0207664_10059772 | Ga0207664_100597725 | 144 |
| 595 | 3300025929 | Ga0207664_10166709 | Ga0207664_101667093 | 144 |
| 596 | 3300025929 | Ga0207664_10205090 | Ga0207664_102050902 | 144 |
| 597 | 3300025929 | Ga0207664_10383241 | Ga0207664_103832412 | 144 |
| 598 | 3300025929 | Ga0207664_10431408 | Ga0207664_104314082 | 144 |
| 599 | 3300025931 | Ga0207644_10326362 | Ga0207644_103263622 | 144 |
| 600 | 3300025932 | Ga0207690_10174389 | Ga0207690_101743893 | 144 |
| 601 | 3300025934 | Ga0207686_10047158 | Ga0207686_100471583 | 144 |
| 602 | 3300025934 | Ga0207686_10344699 | Ga0207686_103446992 | 144 |
| 603 | 3300025934 | Ga0207686_10605421 | Ga0207686_106054211 | 144 |
| 604 | 3300025935 | Ga0207709_10001472 | Ga0207709_1000147215 | 144 |
| 605 | 3300025935 | Ga0207709_10633159 | Ga0207709_106331592 | 144 |
| 606 | 3300025936 | Ga0207670_10500729 | Ga0207670_105007292 | 144 |
| 607 | 3300025936 | Ga0207670_10781250 | Ga0207670_107812502 | 144 |
| 608 | 3300025937 | Ga0207669_10262640 | Ga0207669_102626403 | 144 |
| 609 | 3300025938 | Ga0207704_10009369 | Ga0207704_100093692 | 144 |
| 610 | 3300025938 | Ga0207704_10030898 | Ga0207704_100308982 | 144 |
| 611 | 3300025939 | Ga0207665_10000070 | Ga0207665_1000007063 | 144 |
| 612 | 3300025939 | Ga0207665_10383881 | Ga0207665_103838812 | 144 |
| 613 | 3300025939 | Ga0207665_11155525 | Ga0207665_111555251 | 144 |
| 614 | 3300025940 | Ga0207691_10026395 | Ga0207691_100263953 | 144 |
| 615 | 3300025941 | Ga0207711_10341355 | Ga0207711_103413551 | 144 |
| 616 | 3300025944 | Ga0207661_10039266 | Ga0207661_100392662 | 144 |
| 617 | 3300025944 | Ga0207661_10050622 | Ga0207661_100506223 | 144 |
| 618 | 3300025944 | Ga0207661_10204434 | Ga0207661_102044341 | 144 |
| 619 | 3300025945 | Ga0207679_10035943 | Ga0207679_100359435 | 144 |
| 620 | 3300025949 | Ga0207667_10241656 | Ga0207667_102416563 | 144 |
| 621 | 3300025949 | Ga0207667_10473051 | Ga0207667_104730512 | 144 |
| 622 | 3300025949 | Ga0207667_10960821 | Ga0207667_109608212 | 144 |
| 623 | 3300025949 | Ga0207667_11112171 | Ga0207667_111121712 | 144 |
| 624 | 3300025961 | Ga0207712_10109438 | Ga0207712_101094382 | 144 |
| 625 | 3300025972 | Ga0207668_11119590 | Ga0207668_111195901 | 144 |
| 626 | 3300026023 | Ga0207677_10018592 | Ga0207677_100185925 | 144 |
| 627 | 3300026023 | Ga0207677_10231400 | Ga0207677_102314002 | 144 |
| 628 | 3300026023 | Ga0207677_11446935 | Ga0207677_114469352 | 144 |
| 629 | 3300026041 | Ga0207639_10163601 | Ga0207639_101636011 | 144 |
| 630 | 3300026041 | Ga0207639_10539286 | Ga0207639_105392861 | 144 |
| 631 | 3300026067 | Ga0207678_10047021 | Ga0207678_100470213 | 144 |
| 632 | 3300026067 | Ga0207678_10246409 | Ga0207678_102464091 | 144 |
| 633 | 3300026075 | Ga0207708_10000913 | Ga0207708_1000091317 | 144 |
| 634 | 3300026078 | Ga0207702_10081538 | Ga0207702_100815382 | 144 |
| 635 | 3300026078 | Ga0207702_10301959 | Ga0207702_103019592 | 144 |
| 636 | 3300026078 | Ga0207702_10717867 | Ga0207702_107178672 | 144 |
| 637 | 3300026078 | Ga0207702_11541908 | Ga0207702_115419082 | 144 |
| 638 | 3300026088 | Ga0207641_10207834 | Ga0207641_102078343 | 144 |
| 639 | 3300026088 | Ga0207641_10286333 | Ga0207641_102863332 | 144 |
| 640 | 3300026089 | Ga0207648_10000540 | Ga0207648_1000054028 | 144 |
| 641 | 3300026095 | Ga0207676_10551968 | Ga0207676_105519682 | 144 |
| 642 | 3300026118 | Ga0207675_100015908 | Ga0207675_1000159086 | 144 |
| 643 | 3300026121 | Ga0207683_10000587 | Ga0207683_1000058728 | 144 |
| 644 | 3300026121 | Ga0207683_10008984 | Ga0207683_100089841 | 144 |
| 645 | 3300026121 | Ga0207683_10067372 | Ga0207683_100673722 | 144 |
| 646 | 3300026121 | Ga0207683_10580500 | Ga0207683_105805002 | 144 |
| 647 | 3300026121 | Ga0207683_10802018 | Ga0207683_108020182 | 144 |
| 648 | 3300026142 | Ga0207698_10051379 | Ga0207698_100513795 | 144 |
| 649 | 3300026142 | Ga0207698_10464943 | Ga0207698_104649432 | 144 |
| 650 | 3300026142 | Ga0207698_10916821 | Ga0207698_109168212 | 144 |
| 651 | 3300027907 | Ga0207428_10356841 | Ga0207428_103568412 | 144 |
| 652 | 3300028381 | Ga0268264_10048639 | Ga0268264_100486396 | 144 |
| 653 | 3300028563 | Ga0265319_1053860 | Ga0265319_10538602 | 144 |
| 654 | 3300028573 | Ga0265334_10022996 | Ga0265334_100229962 | 144 |
| 655 | 3300028577 | Ga0265318_10023055 | Ga0265318_100230552 | 144 |
| 656 | 3300028654 | Ga0265322_10037177 | Ga0265322_100371772 | 144 |
| 657 | 3300028800 | Ga0265338_10008321 | Ga0265338_100083215 | 144 |
| 658 | 3300028800 | Ga0265338_10015365 | Ga0265338_100153656 | 144 |
| 659 | 3300028800 | Ga0265338_10325964 | Ga0265338_103259642 | 144 |
| 660 | 3300031240 | Ga0265320_10004939 | Ga0265320_100049396 | 144 |
| 661 | 3300031241 | Ga0265325_10072684 | Ga0265325_100726841 | 144 |
| 662 | 3300031242 | Ga0265329_10016002 | Ga0265329_100160023 | 144 |
| 663 | 3300031247 | Ga0265340_10012337 | Ga0265340_100123375 | 144 |
| 664 | 3300031247 | Ga0265340_10230654 | Ga0265340_102306542 | 144 |
| 665 | 3300031251 | Ga0265327_10098284 | Ga0265327_100982842 | 144 |
| 666 | 3300031251 | Ga0265327_10121281 | Ga0265327_101212812 | 144 |
| 667 | 3300031344 | Ga0265316_10010660 | Ga0265316_100106603 | 144 |
| 668 | 3300031711 | Ga0265314_10006499 | Ga0265314_100064996 | 144 |
| 669 | 3300031712 | Ga0265342_10033203 | Ga0265342_100332033 | 144 |
| 670 | 3300035115 | Ga0373941_0307850 | Ga0373941_0307850_134_571 | 144 |
| 671 | 3300035117 | Ga0373953_0547168 | Ga0373953_0547168_32_469 | 144 |
| 672 | 3300035119 | Ga0373956_0056197 | Ga0373956_0056197_1313_1753 | 144 |
| 673 | 3300035242 | Ga0373962_0092917 | Ga0373962_0092917_340_777 | 144 |
| 674 | 3300035410 | Ga0373924_0230442 | Ga0373924_0230442_205_642 | 144 |
| 675 | 3300035691 | Ga0373931_0280972 | Ga0373931_0280972_359_796 | 144 |
| 676 | 3300035691 | Ga0373931_0676639 | Ga0373931_0676639_217_657 | 144 |
| 677 | 3300035695 | Ga0373927_0801886 | Ga0373927_0801886_106_543 | 144 |
| 678 | 3300035725 | Ga0373947_0079127 | Ga0373947_0079127_180_614 | 144 |
| 679 | 3300035725 | Ga0373947_0115982 | Ga0373947_0115982_395_832 | 144 |
| 680 | 3300035725 | Ga0373947_0777108 | Ga0373947_0777108_204_641 | 144 |
| 681 | 3300036401 | Ga0373937_0032363 | Ga0373937_0032363_2349_2786 | 144 |
| 682 | 3300036401 | Ga0373937_0122282 | Ga0373937_0122282_23_463 | 144 |
| 683 | 3300037312 | Ga0395899_0020210 | Ga0395899_0020210_1100_1534 | 144 |
| 684 | 3300037312 | Ga0395899_0098323 | Ga0395899_0098323_833_1267 | 144 |
| 685 | 3300037312 | Ga0395899_0241490 | Ga0395899_0241490_100_534 | 144 |
| 686 | 3300037312 | Ga0395899_0329322 | Ga0395899_0329322_316_750 | 144 |
| 687 | 3300037312 | Ga0395899_0492201 | Ga0395899_0492201_73_507 | 144 |
| 688 | 3300037312 | Ga0395899_0527732 | Ga0395899_0527732_161_595 | 144 |
| 689 | 3300037312 | Ga0395899_0652548 | Ga0395899_0652548_80_514 | 144 |
| 690 | 3300037418 | Ga0395900_0001846 | Ga0395900_0001846_14537_14971 | 144 |
| 691 | 3300037418 | Ga0395900_0008531 | Ga0395900_0008531_1388_1822 | 144 |
| 692 | 3300037418 | Ga0395900_0014289 | Ga0395900_0014289_7508_7942 | 144 |
| 693 | 3300037418 | Ga0395900_0027207 | Ga0395900_0027207_4609_5046 | 144 |
| 694 | 3300037418 | Ga0395900_0043023 | Ga0395900_0043023_2173_2607 | 144 |
| 695 | 3300037418 | Ga0395900_0115199 | Ga0395900_0115199_1178_1612 | 144 |
| 696 | 3300037418 | Ga0395900_0243644 | Ga0395900_0243644_1249_1683 | 144 |
| 697 | 3300037418 | Ga0395900_0300856 | Ga0395900_0300856_437_871 | 144 |
| 698 | 3300037418 | Ga0395900_0814163 | Ga0395900_0814163_79_513 | 144 |
| 699 | 3300037466 | Ga0395898_0002591 | Ga0395898_0002591_15551_15985 | 144 |
| 700 | 3300037466 | Ga0395898_0006502 | Ga0395898_0006502_1594_2028 | 144 |
| 701 | 3300037466 | Ga0395898_0011007 | Ga0395898_0011007_4690_5127 | 144 |
| 702 | 3300037466 | Ga0395898_0013777 | Ga0395898_0013777_1018_1452 | 144 |
| 703 | 3300037466 | Ga0395898_0021795 | Ga0395898_0021795_3381_3815 | 144 |
| 704 | 3300037466 | Ga0395898_0044897 | Ga0395898_0044897_2126_2560 | 144 |
| 705 | 3300037466 | Ga0395898_0076736 | Ga0395898_0076736_275_709 | 144 |
| 706 | 3300037466 | Ga0395898_0290322 | Ga0395898_0290322_154_588 | 144 |
| 707 | 3300037466 | Ga0395898_1140795 | Ga0395898_1140795_120_554 | 144 |
| 708 | 3300037466 | Ga0395898_1393963 | Ga0395898_1393963_150_584 | 144 |
| 709 | 3300037471 | Ga0395905_0011076 | Ga0395905_0011076_7097_7531 | 144 |
| 710 | 3300037471 | Ga0395905_0011571 | Ga0395905_0011571_3082_3519 | 144 |
| 711 | 3300037471 | Ga0395905_0012069 | Ga0395905_0012069_2058_2492 | 144 |
| 712 | 3300037471 | Ga0395905_0025234 | Ga0395905_0025234_2205_2639 | 144 |
| 713 | 3300037471 | Ga0395905_0036388 | Ga0395905_0036388_3748_4182 | 144 |
| 714 | 3300037471 | Ga0395905_0058801 | Ga0395905_0058801_1169_1603 | 144 |
| 715 | 3300037471 | Ga0395905_0107338 | Ga0395905_0107338_973_1407 | 144 |
| 716 | 3300037471 | Ga0395905_1225302 | Ga0395905_1225302_136_570 | 144 |
| 717 | 3300037471 | Ga0395905_1394936 | Ga0395905_1394936_13_447 | 144 |
| 718 | 3300038443 | Ga0395901_0009419 | Ga0395901_0009419_5248_5682 | 144 |
| 719 | 3300038443 | Ga0395901_0035205 | Ga0395901_0035205_192_626 | 144 |
| 720 | 3300038443 | Ga0395901_0045082 | Ga0395901_0045082_2804_3238 | 144 |
| 721 | 3300038443 | Ga0395901_0056424 | Ga0395901_0056424_919_1353 | 144 |
| 722 | 3300038443 | Ga0395901_0072296 | Ga0395901_0072296_1085_1519 | 144 |
| 723 | 3300038443 | Ga0395901_0099220 | Ga0395901_0099220_1232_1666 | 144 |
| 724 | 3300038443 | Ga0395901_0138437 | Ga0395901_0138437_1307_1744 | 144 |
| 725 | 3300038443 | Ga0395901_0387994 | Ga0395901_0387994_763_1197 | 144 |
| 726 | 3300038443 | Ga0395901_0403445 | Ga0395901_0403445_541_975 | 144 |
| 727 | 3300038443 | Ga0395901_0971202 | Ga0395901_0971202_64_501 | 144 |
| 728 | 3300038443 | Ga0395901_1097619 | Ga0395901_1097619_22_456 | 144 |
| 729 | 3300038443 | Ga0395901_1646324 | Ga0395901_1646324_77_511 | 144 |
| 730 | 3300044656 | Ga0466969_0000426 | Ga0466969_0000426_1827_2264 | 144 |
| 731 | 3300044658 | Ga0466972_0415790 | Ga0466972_0415790_158_595 | 144 |
| 732 | 3300044683 | Ga0466965_0037696 | Ga0466965_0037696_830_1267 | 144 |
| 733 | 3300044693 | Ga0466961_0049628 | Ga0466961_0049628_1673_2110 | 144 |
| 734 | 3300044693 | Ga0466961_0051433 | Ga0466961_0051433_1388_1825 | 144 |
| 735 | 3300044694 | Ga0466963_0002057 | Ga0466963_0002057_8090_8527 | 144 |
| 736 | 3300044694 | Ga0466963_0007214 | Ga0466963_0007214_3418_3855 | 144 |
| 737 | 3300044694 | Ga0466963_0025653 | Ga0466963_0025653_2252_2689 | 144 |
| 738 | 3300044694 | Ga0466963_0119688 | Ga0466963_0119688_1004_1441 | 144 |
| 739 | 3300044694 | Ga0466963_0188851 | Ga0466963_0188851_416_850 | 144 |
| 740 | 3300044694 | Ga0466963_0940072 | Ga0466963_0940072_158_592 | 144 |
| 741 | 3300044706 | Ga0466964_0003099 | Ga0466964_0003099_2579_3016 | 144 |
| 742 | 3300044706 | Ga0466964_0046814 | Ga0466964_0046814_1308_1745 | 144 |
| 743 | 3300044706 | Ga0466964_0068356 | Ga0466964_0068356_305_775 | 144 |
| 744 | 3300044719 | Ga0466971_0047179 | Ga0466971_0047179_1306_1743 | 144 |
| 745 | 3300044719 | Ga0466971_0055987 | Ga0466971_0055987_850_1287 | 144 |
| 746 | 3300044719 | Ga0466971_0327410 | Ga0466971_0327410_163_597 | 144 |
| 747 | 3300044719 | Ga0466971_0416333 | Ga0466971_0416333_147_584 | 144 |
| 748 | 3300044735 | Ga0466968_0001254 | Ga0466968_0001254_4193_4630 | 144 |
| 749 | 3300044735 | Ga0466968_0024225 | Ga0466968_0024225_127_564 | 144 |
| 750 | 3300044735 | Ga0466968_0069422 | Ga0466968_0069422_367_804 | 144 |
| 751 | 3300044765 | Ga0466970_0060959 | Ga0466970_0060959_863_1300 | 144 |
| 752 | 3300044842 | Ga0466957_0003337 | Ga0466957_0003337_6067_6504 | 144 |
| 753 | 3300044842 | Ga0466957_0194949 | Ga0466957_0194949_285_722 | 144 |
| 754 | 3300045049 | Ga0466959_0003554 | Ga0466959_0003554_3283_3720 | 144 |
| 755 | 3300045049 | Ga0466959_0238404 | Ga0466959_0238404_697_1134 | 144 |
| 756 | 3300045836 | Ga0466958_0005596 | Ga0466958_0005596_4507_4944 | 144 |
| 757 | 3300045836 | Ga0466958_0030443 | Ga0466958_0030443_1200_1637 | 144 |
| 758 | 3300045836 | Ga0466958_0143179 | Ga0466958_0143179_115_549 | 144 |
| 759 | 3300045976 | Ga0466967_0003895 | Ga0466967_0003895_9053_9490 | 144 |
| 760 | 3300045976 | Ga0466967_0007111 | Ga0466967_0007111_5963_6400 | 144 |
| 761 | 3300045976 | Ga0466967_0011497 | Ga0466967_0011497_4286_4720 | 144 |
| 762 | 3300045976 | Ga0466967_0056803 | Ga0466967_0056803_2259_2696 | 144 |
| 763 | 3300045976 | Ga0466967_0086292 | Ga0466967_0086292_1686_2156 | 144 |
| 764 | 3300045976 | Ga0466967_0117327 | Ga0466967_0117327_1837_2274 | 144 |
| 765 | 3300045976 | Ga0466967_0207794 | Ga0466967_0207794_310_747 | 144 |
| 766 | 3300045976 | Ga0466967_0246677 | Ga0466967_0246677_399_836 | 144 |
| 767 | 3300045976 | Ga0466967_1002852 | Ga0466967_1002852_306_743 | 144 |
| 768 | 3300046454 | Ga0495592_0000660 | Ga0495592_0000660_10560_10997 | 144 |
| 769 | 3300046454 | Ga0495592_0593767 | Ga0495592_0593767_156_590 | 144 |
| 770 | 3300046459 | Ga0495629_1071117 | Ga0495629_1071117_12_449 | 144 |
| 771 | 3300046461 | Ga0495641_0316249 | Ga0495641_0316249_14_451 | 144 |
| 772 | 3300046462 | Ga0495651_0000034 | Ga0495651_0000034_10578_11015 | 144 |
| 773 | 3300046462 | Ga0495651_0092884 | Ga0495651_0092884_626_1066 | 144 |
| 774 | 3300046463 | Ga0495653_0004267 | Ga0495653_0004267_591_1028 | 144 |
| 775 | 3300046463 | Ga0495653_0078694 | Ga0495653_0078694_1496_1936 | 144 |
| 776 | 3300046472 | Ga0495580_0176297 | Ga0495580_0176297_411_845 | 144 |
| 777 | 3300046473 | Ga0495582_0191143 | Ga0495582_0191143_302_736 | 144 |
| 778 | 3300046473 | Ga0495582_0409476 | Ga0495582_0409476_54_491 | 144 |
| 779 | 3300046473 | Ga0495582_0478393 | Ga0495582_0478393_166_603 | 144 |
| 780 | 3300046475 | Ga0495639_0019026 | Ga0495639_0019026_916_1350 | 144 |
| 781 | 3300046477 | Ga0495664_0686478 | Ga0495664_0686478_56_493 | 144 |
| 782 | 3300046511 | Ga0495608_0003358 | Ga0495608_0003358_464_901 | 144 |
| 783 | 3300046511 | Ga0495608_0035925 | Ga0495608_0035925_1312_1752 | 144 |
| 784 | 3300046514 | Ga0495618_0002980 | Ga0495618_0002980_6871_7308 | 144 |
| 785 | 3300046516 | Ga0495628_0000184 | Ga0495628_0000184_43818_44255 | 144 |
| 786 | 3300046517 | Ga0495630_0309735 | Ga0495630_0309735_383_817 | 144 |
| 787 | 3300046517 | Ga0495630_0465347 | Ga0495630_0465347_420_854 | 144 |
| 788 | 3300046523 | Ga0495644_0002395 | Ga0495644_0002395_3146_3583 | 144 |
| 789 | 3300046523 | Ga0495644_0054024 | Ga0495644_0054024_549_983 | 144 |
| 790 | 3300046525 | Ga0495663_0056215 | Ga0495663_0056215_130_564 | 144 |
| 791 | 3300046528 | Ga0495642_0009669 | Ga0495642_0009669_3106_3540 | 144 |
| 792 | 3300046528 | Ga0495642_0041870 | Ga0495642_0041870_92_526 | 144 |
| 793 | 3300046529 | Ga0495652_0000319 | Ga0495652_0000319_45833_46270 | 144 |
| 794 | 3300046533 | Ga0495640_0278178 | Ga0495640_0278178_116_553 | 144 |
| 795 | 3300046535 | Ga0495586_0337734 | Ga0495586_0337734_195_632 | 144 |
| 796 | 3300046536 | Ga0495587_0001086 | Ga0495587_0001086_10578_11015 | 144 |
| 797 | 3300046543 | Ga0495645_0000646 | Ga0495645_0000646_10578_11015 | 144 |
| 798 | 3300046559 | Ga0495667_0048661 | Ga0495667_0048661_1059_1499 | 144 |
| 799 | 3300046615 | Ga0495656_0216783 | Ga0495656_0216783_424_858 | 144 |
| 800 | 3300046642 | Ga0495634_0049222 | Ga0495634_0049222_1782_2222 | 144 |
| 801 | 3300046642 | Ga0495634_0057751 | Ga0495634_0057751_509_949 | 144 |
| 802 | 3300046648 | Ga0495611_0055720 | Ga0495611_0055720_721_1158 | 144 |
| 803 | 3300046663 | Ga0495635_0037446 | Ga0495635_0037446_180_620 | 144 |
| 804 | 3300046664 | Ga0495659_0330892 | Ga0495659_0330892_120_554 | 144 |
| 805 | 3300046674 | Ga0495588_0041289 | Ga0495588_0041289_1560_1994 | 144 |
| 806 | 3300046675 | Ga0495657_0081837 | Ga0495657_0081837_466_903 | 144 |
| 807 | 3300046678 | Ga0495599_0000227 | Ga0495599_0000227_3956_4393 | 144 |
| 808 | 3300046679 | Ga0495623_0000601 | Ga0495623_0000601_12966_13403 | 144 |
| 809 | 3300046679 | Ga0495623_0093757 | Ga0495623_0093757_49_489 | 144 |
| 810 | 3300046680 | Ga0495646_0005450 | Ga0495646_0005450_6942_7379 | 144 |
| 811 | 3300046683 | Ga0495658_0145090 | Ga0495658_0145090_59_496 | 144 |
| 812 | 3300046689 | Ga0495613_0098497 | Ga0495613_0098497_1018_1452 | 144 |
| 813 | 3300046689 | Ga0495613_0247154 | Ga0495613_0247154_421_858 | 144 |
| 814 | 3300046689 | Ga0495613_0560334 | Ga0495613_0560334_260_697 | 144 |
| 815 | 3300046690 | Ga0495624_0008996 | Ga0495624_0008996_5759_6196 | 144 |
| 816 | 3300046691 | Ga0495670_0029542 | Ga0495670_0029542_114_551 | 144 |
| 817 | 3300046794 | Ga0495589_0147151 | Ga0495589_0147151_514_948 | 144 |
| 818 | 3300046809 | Ga0495600_0084236 | Ga0495600_0084236_1258_1698 | 144 |
| 819 | 3300046809 | Ga0495600_0365923 | Ga0495600_0365923_423_860 | 144 |
| 820 | 3300046809 | Ga0495600_0702501 | Ga0495600_0702501_117_551 | 144 |
| 821 | 3300047315 | Ga0495581_0160630 | Ga0495581_0160630_186_620 | 144 |
| 822 | 3300047315 | Ga0495581_0222917 | Ga0495581_0222917_226_663 | 144 |
| 823 | 3300047317 | Ga0495604_0000194 | Ga0495604_0000194_10551_10988 | 144 |
| 824 | 3300047318 | Ga0495636_0159082 | Ga0495636_0159082_28_462 | 144 |
| 825 | 3300047319 | Ga0495674_1028982 | Ga0495674_1028982_50_490 | 144 |
| 826 | 3300047321 | Ga0495676_0097590 | Ga0495676_0097590_1480_1917 | 144 |
| 827 | 3300047321 | Ga0495676_0098405 | Ga0495676_0098405_827_1261 | 144 |
| 828 | 3300047444 | Ga0495675_0000224 | Ga0495675_0000224_10578_11015 | 144 |
| 829 | 3300047445 | Ga0495677_0024362 | Ga0495677_0024362_1522_1959 | 144 |
| 830 | 3300047471 | Ga0495684_0091036 | Ga0495684_0091036_123_563 | 144 |
| 831 | 3300048088 | Ga0495602_0001529 | Ga0495602_0001529_22282_22719 | 144 |
| 832 | 3300048088 | Ga0495602_0050029 | Ga0495602_0050029_688_1128 | 144 |
| 833 | 3300048903 | Ga0496100_0004406 | Ga0496100_0004406_3156_3593 | 144 |
| 834 | 3300048903 | Ga0496100_0010904 | Ga0496100_0010904_29_466 | 144 |
| 835 | 3300048903 | Ga0496100_0036671 | Ga0496100_0036671_1260_1697 | 144 |
| 836 | 3300048903 | Ga0496100_0096918 | Ga0496100_0096918_846_1280 | 144 |
| 837 | 3300048903 | Ga0496100_0261178 | Ga0496100_0261178_503_937 | 144 |
| 838 | 3300048903 | Ga0496100_0922441 | Ga0496100_0922441_104_538 | 144 |
| 839 | 3300048903 | Ga0496100_1338262 | Ga0496100_1338262_118_552 | 144 |
| 840 | 3300048904 | Ga0496101_0004655 | Ga0496101_0004655_4646_5083 | 144 |
| 841 | 3300048904 | Ga0496101_0013017 | Ga0496101_0013017_3044_3481 | 144 |
| 842 | 3300048904 | Ga0496101_0065400 | Ga0496101_0065400_1847_2281 | 144 |
| 843 | 3300048904 | Ga0496101_0070263 | Ga0496101_0070263_1267_1701 | 144 |
| 844 | 3300048904 | Ga0496101_0507036 | Ga0496101_0507036_304_741 | 144 |
| 845 | 3300048904 | Ga0496101_0703668 | Ga0496101_0703668_91_525 | 144 |
| 846 | 3300048904 | Ga0496101_1044518 | Ga0496101_1044518_189_626 | 144 |
| 847 | 3300048905 | Ga0496102_0015692 | Ga0496102_0015692_4574_5014 | 144 |
| 848 | 3300048905 | Ga0496102_0040396 | Ga0496102_0040396_1507_1941 | 144 |
| 849 | 3300048905 | Ga0496102_0087213 | Ga0496102_0087213_133_570 | 144 |
| 850 | 3300048905 | Ga0496102_0091032 | Ga0496102_0091032_2186_2623 | 144 |
| 851 | 3300048905 | Ga0496102_0222108 | Ga0496102_0222108_823_1260 | 144 |
| 852 | 3300048905 | Ga0496102_0325689 | Ga0496102_0325689_590_1024 | 144 |
| 853 | 3300048905 | Ga0496102_0607800 | Ga0496102_0607800_29_463 | 144 |
| 854 | 3300048905 | Ga0496102_0753810 | Ga0496102_0753810_185_619 | 144 |
| 855 | 3300048906 | Ga0496103_0005102 | Ga0496103_0005102_1841_2281 | 144 |
| 856 | 3300048906 | Ga0496103_0011172 | Ga0496103_0011172_2375_2812 | 144 |
| 857 | 3300048906 | Ga0496103_0131263 | Ga0496103_0131263_712_1149 | 144 |
| 858 | 3300048906 | Ga0496103_0145971 | Ga0496103_0145971_330_764 | 144 |
| 859 | 3300048906 | Ga0496103_0326406 | Ga0496103_0326406_465_902 | 144 |
| 860 | 3300048906 | Ga0496103_0330838 | Ga0496103_0330838_192_629 | 144 |
| 861 | 3300048907 | Ga0496104_0000224 | Ga0496104_0000224_48869_49306 | 144 |
| 862 | 3300048907 | Ga0496104_0098359 | Ga0496104_0098359_336_773 | 144 |
| 863 | 3300048907 | Ga0496104_0156538 | Ga0496104_0156538_987_1421 | 144 |
| 864 | 3300048907 | Ga0496104_0314481 | Ga0496104_0314481_432_869 | 144 |
| 865 | 3300048907 | Ga0496104_0700693 | Ga0496104_0700693_378_812 | 144 |
| 866 | 3300048907 | Ga0496104_1002596 | Ga0496104_1002596_96_533 | 144 |
| 867 | 3300048908 | Ga0496105_0000234 | Ga0496105_0000234_18454_18891 | 144 |
| 868 | 3300048908 | Ga0496105_0014369 | Ga0496105_0014369_3336_3770 | 144 |
| 869 | 3300048908 | Ga0496105_0034363 | Ga0496105_0034363_889_1323 | 144 |
| 870 | 3300048908 | Ga0496105_0067458 | Ga0496105_0067458_967_1404 | 144 |
| 871 | 3300048908 | Ga0496105_0082597 | Ga0496105_0082597_1993_2430 | 144 |
| 872 | 3300048908 | Ga0496105_0095628 | Ga0496105_0095628_1357_1797 | 144 |
| 873 | 3300048908 | Ga0496105_0851581 | Ga0496105_0851581_186_620 | 144 |
| 874 | 3300048909 | Ga0496106_0060402 | Ga0496106_0060402_1963_2397 | 144 |
| 875 | 3300048909 | Ga0496106_0088170 | Ga0496106_0088170_478_915 | 144 |
| 876 | 3300048909 | Ga0496106_0201229 | Ga0496106_0201229_404_841 | 144 |
| 877 | 3300048909 | Ga0496106_0235686 | Ga0496106_0235686_655_1089 | 144 |
| 878 | 3300048909 | Ga0496106_0524720 | Ga0496106_0524720_114_548 | 144 |
| 879 | 3300048909 | Ga0496106_1056270 | Ga0496106_1056270_101_538 | 144 |
| 880 | 3300048910 | Ga0496107_0000435 | Ga0496107_0000435_5807_6244 | 144 |
| 881 | 3300048910 | Ga0496107_0006765 | Ga0496107_0006765_7078_7512 | 144 |
| 882 | 3300048910 | Ga0496107_0045031 | Ga0496107_0045031_2527_2967 | 144 |
| 883 | 3300048910 | Ga0496107_0078783 | Ga0496107_0078783_751_1188 | 144 |
| 884 | 3300048910 | Ga0496107_0273643 | Ga0496107_0273643_569_1003 | 144 |
| 885 | 3300048910 | Ga0496107_0926941 | Ga0496107_0926941_26_460 | 144 |
| 886 | 3300048911 | Ga0496108_0007844 | Ga0496108_0007844_7675_8112 | 144 |
| 887 | 3300048911 | Ga0496108_0033148 | Ga0496108_0033148_2172_2609 | 144 |
| 888 | 3300048911 | Ga0496108_0052345 | Ga0496108_0052345_1268_1705 | 144 |
| 889 | 3300048911 | Ga0496108_0780557 | Ga0496108_0780557_240_677 | 144 |
| 890 | 3300048912 | Ga0496109_0004645 | Ga0496109_0004645_3670_4107 | 144 |
| 891 | 3300048912 | Ga0496109_0018197 | Ga0496109_0018197_2191_2625 | 144 |
| 892 | 3300048912 | Ga0496109_0027975 | Ga0496109_0027975_2260_2694 | 144 |
| 893 | 3300048912 | Ga0496109_0037958 | Ga0496109_0037958_1168_1605 | 144 |
| 894 | 3300048912 | Ga0496109_0046713 | Ga0496109_0046713_1151_1588 | 144 |
| 895 | 3300048912 | Ga0496109_0272445 | Ga0496109_0272445_183_617 | 144 |
| 896 | 3300048912 | Ga0496109_0585632 | Ga0496109_0585632_584_1021 | 144 |
| 897 | 3300048912 | Ga0496109_0616573 | Ga0496109_0616573_553_993 | 144 |
| 898 | 3300048912 | Ga0496109_1766047 | Ga0496109_1766047_67_501 | 144 |
| 899 | 3300048913 | Ga0496110_0000673 | Ga0496110_0000673_4712_5149 | 144 |
| 900 | 3300048913 | Ga0496110_0007404 | Ga0496110_0007404_242_679 | 144 |
| 901 | 3300048913 | Ga0496110_0313174 | Ga0496110_0313174_799_1233 | 144 |
| 902 | 3300048913 | Ga0496110_0433791 | Ga0496110_0433791_88_525 | 144 |
| 903 | 3300048913 | Ga0496110_0578763 | Ga0496110_0578763_71_505 | 144 |
| 904 | 3300048913 | Ga0496110_0980618 | Ga0496110_0980618_260_697 | 144 |
| 905 | 3300048914 | Ga0496111_0000552 | Ga0496111_0000552_2835_3272 | 144 |
| 906 | 3300048914 | Ga0496111_0009530 | Ga0496111_0009530_5100_5537 | 144 |
| 907 | 3300048914 | Ga0496111_0029188 | Ga0496111_0029188_722_1156 | 144 |
| 908 | 3300048914 | Ga0496111_0064617 | Ga0496111_0064617_1304_1741 | 144 |
| 909 | 3300048914 | Ga0496111_0131371 | Ga0496111_0131371_323_757 | 144 |
| 910 | 3300048914 | Ga0496111_0142552 | Ga0496111_0142552_138_578 | 144 |
| 911 | 3300048914 | Ga0496111_0213972 | Ga0496111_0213972_616_1053 | 144 |
| 912 | 3300048914 | Ga0496111_0250445 | Ga0496111_0250445_787_1221 | 144 |
| 913 | 3300048914 | Ga0496111_0684799 | Ga0496111_0684799_177_611 | 144 |
| 914 | 3300048915 | Ga0496112_0003867 | Ga0496112_0003867_11302_11736 | 144 |
| 915 | 3300048915 | Ga0496112_0004943 | Ga0496112_0004943_8666_9100 | 144 |
| 916 | 3300048915 | Ga0496112_0049478 | Ga0496112_0049478_570_1007 | 144 |
| 917 | 3300048915 | Ga0496112_0143342 | Ga0496112_0143342_1000_1437 | 144 |
| 918 | 3300048915 | Ga0496112_0180748 | Ga0496112_0180748_1612_2049 | 144 |
| 919 | 3300048915 | Ga0496112_0213173 | Ga0496112_0213173_163_597 | 144 |
| 920 | 3300048915 | Ga0496112_0356507 | Ga0496112_0356507_326_760 | 144 |
| 921 | 3300048915 | Ga0496112_0513059 | Ga0496112_0513059_167_601 | 144 |
| 922 | 3300048915 | Ga0496112_0721121 | Ga0496112_0721121_247_687 | 144 |
| 923 | 3300048915 | Ga0496112_0964368 | Ga0496112_0964368_128_565 | 144 |
| 924 | 3300048916 | Ga0496113_0195875 | Ga0496113_0195875_542_979 | 144 |
| 925 | 3300048916 | Ga0496113_0264475 | Ga0496113_0264475_285_719 | 144 |
| 926 | 3300048916 | Ga0496113_0870221 | Ga0496113_0870221_164_598 | 144 |
| 927 | 3300048916 | Ga0496113_1350035 | Ga0496113_1350035_52_492 | 144 |
| 928 | 3300048917 | Ga0496114_0001528 | Ga0496114_0001528_15694_16131 | 144 |
| 929 | 3300048917 | Ga0496114_0004933 | Ga0496114_0004933_6812_7246 | 144 |
| 930 | 3300048917 | Ga0496114_0032392 | Ga0496114_0032392_669_1109 | 144 |
| 931 | 3300048917 | Ga0496114_0042955 | Ga0496114_0042955_2922_3359 | 144 |
| 932 | 3300048917 | Ga0496114_0137760 | Ga0496114_0137760_1281_1718 | 144 |
| 933 | 3300048917 | Ga0496114_0170497 | Ga0496114_0170497_781_1215 | 144 |
| 934 | 3300048918 | Ga0496115_0012226 | Ga0496115_0012226_4736_5170 | 144 |
| 935 | 3300048918 | Ga0496115_0014610 | Ga0496115_0014610_1922_2362 | 144 |
| 936 | 3300048918 | Ga0496115_0045147 | Ga0496115_0045147_2696_3133 | 144 |
| 937 | 3300048918 | Ga0496115_0402020 | Ga0496115_0402020_555_992 | 144 |
| 938 | 3300049568 | Ga0501031_0029292 | Ga0501031_0029292_704_1138 | 144 |
| 939 | 3300049572 | Ga0501036_0808932 | Ga0501036_0808932_193_627 | 144 |
| 940 | 3300049573 | Ga0501037_0147865 | Ga0501037_0147865_540_974 | 144 |
| 941 | 3300049575 | Ga0501039_0005439 | Ga0501039_0005439_8861_9295 | 144 |
| 942 | 3300049576 | Ga0501040_0029003 | Ga0501040_0029003_157_591 | 144 |
| 943 | 3300049578 | Ga0501042_0389243 | Ga0501042_0389243_74_508 | 144 |
| 944 | 3300049579 | Ga0501043_0416971 | Ga0501043_0416971_122_556 | 144 |
| 945 | 3300049580 | Ga0501046_0593892 | Ga0501046_0593892_308_742 | 144 |
| 946 | 3300049582 | Ga0501048_0040658 | Ga0501048_0040658_622_1056 | 144 |
| 947 | 3300049583 | Ga0501067_0080769 | Ga0501067_0080769_331_765 | 144 |
| 948 | 3300049583 | Ga0501067_0780233 | Ga0501067_0780233_18_452 | 144 |
| 949 | 3300049584 | Ga0501068_0070924 | Ga0501068_0070924_106_540 | 144 |
| 950 | 3300049586 | Ga0501070_0610159 | Ga0501070_0610159_333_767 | 144 |
| 951 | 3300049586 | Ga0501070_0913706 | Ga0501070_0913706_133_567 | 144 |
| 952 | 3300049587 | Ga0501071_0009020 | Ga0501071_0009020_3635_4069 | 144 |
| 953 | 3300049588 | Ga0501072_0270955 | Ga0501072_0270955_682_1116 | 144 |
| 954 | 3300049588 | Ga0501072_0423189 | Ga0501072_0423189_475_909 | 144 |
| 955 | 3300049590 | Ga0501074_0361816 | Ga0501074_0361816_260_694 | 144 |
| 956 | 3300049590 | Ga0501074_0916428 | Ga0501074_0916428_55_489 | 144 |
| 957 | 3300049591 | Ga0501075_0305852 | Ga0501075_0305852_698_1132 | 144 |
| 958 | 3300049592 | Ga0501076_0136331 | Ga0501076_0136331_1281_1715 | 144 |
| 959 | 3300049741 | Ga0501079_0342885 | Ga0501079_0342885_594_1028 | 144 |
| 960 | 3300049743 | Ga0501081_0085192 | Ga0501081_0085192_1483_1917 | 144 |
| 961 | 3300049744 | Ga0501083_0054058 | Ga0501083_0054058_1845_2279 | 144 |
| 962 | 3300049824 | Ga0501045_0022489 | Ga0501045_0022489_983_1417 | 144 |
| 963 | 3300050492 | nmdc:mga0yw44_168499_c1 | nmdc:mga0yw44_168499_c1_730_1164 | 144 |
| 964 | 3300050507 | nmdc:mga05p37_229997_c1 | nmdc:mga05p37_229997_c1_1179_1613 | 144 |
| 965 | 3300050507 | nmdc:mga05p37_65168_c1 | nmdc:mga05p37_65168_c1_2006_2440 | 144 |
| 966 | 3300050511 | nmdc:mga08y16_58178_c1 | nmdc:mga08y16_58178_c1_3335_3772 | 144 |
| 967 | 3300050512 | nmdc:mga0n895_157292_c1 | nmdc:mga0n895_157292_c1_294_731 | 144 |
| 968 | 3300050512 | nmdc:mga0n895_337963_c1 | nmdc:mga0n895_337963_c1_390_824 | 144 |
| 969 | 3300050512 | nmdc:mga0n895_687670_c1 | nmdc:mga0n895_687670_c1_269_706 | 144 |
| 970 | 3300050513 | nmdc:mga0rr50_305557_c1 | nmdc:mga0rr50_305557_c1_322_759 | 144 |
| 971 | 3300050513 | nmdc:mga0rr50_362333_c1 | nmdc:mga0rr50_362333_c1_222_659 | 144 |
| 972 | 3300050513 | nmdc:mga0rr50_97083_c1 | nmdc:mga0rr50_97083_c1_740_1174 | 144 |
| 973 | 3300050514 | nmdc:mga08x19_409862_c1 | nmdc:mga08x19_409862_c1_380_820 | 144 |
| 974 | 3300050515 | nmdc:mga0a205_214190_c1 | nmdc:mga0a205_214190_c1_853_1287 | 144 |
| 975 | 3300053077 | Ga0495601_0017330 | Ga0495601_0017330_1817_2254 | 144 |
| 976 | 3300053083 | Ga0495655_0012971 | Ga0495655_0012971_342_776 | 144 |
| 977 | 3300053084 | Ga0495595_0004475 | Ga0495595_0004475_277_714 | 144 |
| 978 | 3300053084 | Ga0495595_0136519 | Ga0495595_0136519_268_708 | 144 |
| 979 | 3300053085 | Ga0495619_0000370 | Ga0495619_0000370_6434_6871 | 144 |
| 980 | 3300054114 | Ga0501084_0044844 | Ga0501084_0044844_1559_1993 | 144 |
| 981 | 3300054114 | Ga0501084_0066420 | Ga0501084_0066420_1284_1718 | 144 |
| 982 | 3300061719 | Ga0466962_0017831 | Ga0466962_0017831_1455_1892 | 144 |
| 983 | 3300061719 | Ga0466962_0357879 | Ga0466962_0357879_192_626 | 144 |
| 984 | 3300061734 | Ga0530510_0084301 | Ga0530510_0084301_1603_2037 | 144 |
| 985 | 3300061734 | Ga0530510_0345962 | Ga0530510_0345962_363_797 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9197 | 3 | 143 |
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9135 | 3 | 143 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9046 | 1 | 144 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9046 | 2 | 144 |
| 1nye-assembly3.cif.gz_F | crystal structure of osmc from e. coli | 0.904 | 1 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9117 | 3 | 143 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9055 | 3 | 143 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.891 | 1 | 144 | 3.30.300.20 |
| af_Q55E30_8_160_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8848 | 4 | 142 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8848 | 6 | 143 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0QLY7-F1-model_v4 | OsmC family peroxiredoxin | 1.003 | 55 | 143 |
GO:0004601
GO:0006979 |
| AF-A0A6G3XRH8-F1-model_v4 | OsmC family peroxiredoxin | 0.9951 | 61 | 143 |
GO:0004601
GO:0006979 |
| AF-A0A538JYZ6-F1-model_v4 | OsmC family peroxiredoxin | 0.9884 | 1 | 144 |
GO:0004601
GO:0006979 |
| AF-A0A353ZMU4-F1-model_v4 | Peroxiredoxin | 0.9847 | 57 | 144 |
GO:0004601
GO:0006979 |
| AF-A0A6G3XRH8-F1-model_v4 | OsmC family peroxiredoxin | 0.9832 | 61 | 143 |
GO:0004601
GO:0006979 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar