F487393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 364 | 1962 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10000738|Ga0316579_100007384 |
| Length | 247 |
| Sequence | MNTNLGSEPAVDAHNPQRTIRVLIVDDHAVVRQGLRTFLELQDDVSHGDLSALPIQVVGEATTGLEAVDLARRLQPDVVLLDLVMPEMDGIEATPRIIEESPGSRVLILTSFGDEDKVFPAIRAGAQGYLLKDIAPGDLVQAVRAAHLDQVQLHPEVARKLMSAVAAKEEPAAASQAALPDELTGRELEVLRLIAEGLNNREIAERLVISDKTVKTHVSSILGKLHLEDRTQAAIYALRHGLAPDDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 99 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 100 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 363 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 364 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0.92 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.02 |
| Nodule | 0 |
| Rhizoplane | 10.91 |
| Rhizosphere | 85.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316579_10000738 | 3300031691 | Bacteria | 11205 |
| 2 | JGI24743J22301_10002892 | 3300001991 | Bacteria | 2651 |
| 3 | JGI25407J50210_10000692 | 3300003373 | Bacteria | 6993 |
| 4 | JGI25407J50210_10014402 | 3300003373 | Bacteria | 2037 |
| 5 | JGI25407J50210_10025306 | 3300003373 | Bacteria | 1539 |
| 6 | Ga0058863_11604478 | 3300004799 | Bacteria | 1042 |
| 7 | Ga0070658_10004524 | 3300005327 | Bacteria | 11308 |
| 8 | Ga0070658_10309951 | 3300005327 | Bacteria | 1347 |
| 9 | Ga0070683_100001072 | 3300005329 | Bacteria | 20539 |
| 10 | Ga0070683_100022724 | 3300005329 | Bacteria | 5609 |
| 11 | Ga0070683_100027093 | 3300005329 | Bacteria | 5166 |
| 12 | Ga0070683_100108694 | 3300005329 | Bacteria | 2616 |
| 13 | Ga0070683_100285013 | 3300005329 | Bacteria | 1571 |
| 14 | Ga0070683_100346078 | 3300005329 | Bacteria | 1416 |
| 15 | Ga0070683_101002896 | 3300005329 | Bacteria | 802 |
| 16 | Ga0070670_100000651 | 3300005331 | Bacteria | 26944 |
| 17 | Ga0068869_100512161 | 3300005334 | Bacteria | 1003 |
| 18 | Ga0070680_100004355 | 3300005336 | Bacteria | 10644 |
| 19 | Ga0070680_100055736 | 3300005336 | Bacteria | 3230 |
| 20 | Ga0070680_100083473 | 3300005336 | Bacteria | 2638 |
| 21 | Ga0070680_100159047 | 3300005336 | Bacteria | 1898 |
| 22 | Ga0070682_100003614 | 3300005337 | Bacteria | 8571 |
| 23 | Ga0070682_100096396 | 3300005337 | Bacteria | 1944 |
| 24 | Ga0070682_100234580 | 3300005337 | Bacteria | 1314 |
| 25 | Ga0070682_100300854 | 3300005337 | Bacteria | 1177 |
| 26 | Ga0070682_100733754 | 3300005337 | Bacteria | 795 |
| 27 | Ga0068868_100028978 | 3300005338 | Bacteria | 4238 |
| 28 | Ga0068868_100038286 | 3300005338 | Bacteria | 3722 |
| 29 | Ga0068868_100076841 | 3300005338 | Bacteria | 2670 |
| 30 | Ga0070660_100013711 | 3300005339 | Bacteria | 5827 |
| 31 | Ga0070660_100022332 | 3300005339 | Bacteria | 4677 |
| 32 | Ga0070691_10010107 | 3300005341 | Bacteria | 4302 |
| 33 | Ga0070661_100001663 | 3300005344 | Bacteria | 15407 |
| 34 | Ga0070661_100212167 | 3300005344 | Bacteria | 1482 |
| 35 | Ga0070661_100212400 | 3300005344 | Bacteria | 1482 |
| 36 | Ga0070668_100650319 | 3300005347 | Bacteria | 926 |
| 37 | Ga0070669_100717812 | 3300005353 | Bacteria | 845 |
| 38 | Ga0070675_100018947 | 3300005354 | Bacteria | 5482 |
| 39 | Ga0070671_100247017 | 3300005355 | Bacteria | 1515 |
| 40 | Ga0070674_100096841 | 3300005356 | Bacteria | 2142 |
| 41 | Ga0070673_100014741 | 3300005364 | Bacteria | 5461 |
| 42 | Ga0070688_100210139 | 3300005365 | Bacteria | 1366 |
| 43 | Ga0070659_100012504 | 3300005366 | Bacteria | 6294 |
| 44 | Ga0070659_100099209 | 3300005366 | Bacteria | 2342 |
| 45 | Ga0070667_101108954 | 3300005367 | Bacteria | 740 |
| 46 | Ga0070703_10091429 | 3300005406 | Bacteria | 1056 |
| 47 | Ga0070703_10107038 | 3300005406 | Bacteria | 994 |
| 48 | Ga0070709_10033603 | 3300005434 | Bacteria | 3103 |
| 49 | Ga0070709_10130585 | 3300005434 | Bacteria | 1714 |
| 50 | Ga0070709_10146305 | 3300005434 | Bacteria | 1628 |
| 51 | Ga0070714_100003431 | 3300005435 | Bacteria | 11807 |
| 52 | Ga0070714_100012472 | 3300005435 | Bacteria | 6786 |
| 53 | Ga0070714_100013021 | 3300005435 | Bacteria | 6654 |
| 54 | Ga0070714_100022982 | 3300005435 | Bacteria | 5117 |
| 55 | Ga0070714_100023663 | 3300005435 | Bacteria | 5049 |
| 56 | Ga0070714_100072935 | 3300005435 | Bacteria | 2973 |
| 57 | Ga0070714_100093558 | 3300005435 | Bacteria | 2636 |
| 58 | Ga0070714_100098834 | 3300005435 | Bacteria | 2568 |
| 59 | Ga0070714_100249923 | 3300005435 | Bacteria | 1639 |
| 60 | Ga0070714_100407043 | 3300005435 | Bacteria | 1287 |
| 61 | Ga0070714_101099593 | 3300005435 | Bacteria | 775 |
| 62 | Ga0070713_100009826 | 3300005436 | Bacteria | 6880 |
| 63 | Ga0070713_100028317 | 3300005436 | Bacteria | 4423 |
| 64 | Ga0070713_100069396 | 3300005436 | Bacteria | 2972 |
| 65 | Ga0070713_100130978 | 3300005436 | Bacteria | 2212 |
| 66 | Ga0070713_100152537 | 3300005436 | Bacteria | 2057 |
| 67 | Ga0070713_100382475 | 3300005436 | Bacteria | 1312 |
| 68 | Ga0070713_100462941 | 3300005436 | Bacteria | 1192 |
| 69 | Ga0070713_100472698 | 3300005436 | Bacteria | 1180 |
| 70 | Ga0070713_100687147 | 3300005436 | Bacteria | 976 |
| 71 | Ga0070713_100801909 | 3300005436 | Bacteria | 903 |
| 72 | Ga0070710_10002596 | 3300005437 | Bacteria | 8583 |
| 73 | Ga0070710_10034679 | 3300005437 | Bacteria | 2747 |
| 74 | Ga0070710_10121563 | 3300005437 | Bacteria | 1581 |
| 75 | Ga0070710_10192027 | 3300005437 | Bacteria | 1285 |
| 76 | Ga0070710_10296298 | 3300005437 | Bacteria | 1054 |
| 77 | Ga0070710_10381367 | 3300005437 | Bacteria | 940 |
| 78 | Ga0070711_100097164 | 3300005439 | Bacteria | 2135 |
| 79 | Ga0070711_100099236 | 3300005439 | Bacteria | 2115 |
| 80 | Ga0070711_100508293 | 3300005439 | Bacteria | 994 |
| 81 | Ga0070705_100879240 | 3300005440 | Bacteria | 719 |
| 82 | Ga0070700_100668785 | 3300005441 | Bacteria | 822 |
| 83 | Ga0070694_100608614 | 3300005444 | Bacteria | 881 |
| 84 | Ga0070708_100007755 | 3300005445 | Bacteria | 8601 |
| 85 | Ga0070708_100027221 | 3300005445 | Bacteria | 4904 |
| 86 | Ga0070708_100219305 | 3300005445 | Unclassified | 1783 |
| 87 | Ga0070663_100189549 | 3300005455 | Bacteria | 1599 |
| 88 | Ga0070663_100672338 | 3300005455 | Bacteria | 878 |
| 89 | Ga0070678_100608973 | 3300005456 | Bacteria | 976 |
| 90 | Ga0070662_100013266 | 3300005457 | Bacteria | 5480 |
| 91 | Ga0070681_10008799 | 3300005458 | Bacteria | 9910 |
| 92 | Ga0070681_10009501 | 3300005458 | Bacteria | 9573 |
| 93 | Ga0070681_10036757 | 3300005458 | Bacteria | 4917 |
| 94 | Ga0070681_10047068 | 3300005458 | Bacteria | 4311 |
| 95 | Ga0070681_10296276 | 3300005458 | Bacteria | 1527 |
| 96 | Ga0070685_10019843 | 3300005466 | Bacteria | 3632 |
| 97 | Ga0070706_100001406 | 3300005467 | Bacteria | 25463 |
| 98 | Ga0070706_100001959 | 3300005467 | Bacteria | 21215 |
| 99 | Ga0070706_100013388 | 3300005467 | Bacteria | 7583 |
| 100 | Ga0070706_100024862 | 3300005467 | Bacteria | 5514 |
| 101 | Ga0070706_100124531 | 3300005467 | Bacteria | 2403 |
| 102 | Ga0070707_100074594 | 3300005468 | Bacteria | 3271 |
| 103 | Ga0070707_100102594 | 3300005468 | Bacteria | 2772 |
| 104 | Ga0070707_100108578 | 3300005468 | Bacteria | 2691 |
| 105 | Ga0070707_100209095 | 3300005468 | Bacteria | 1902 |
| 106 | Ga0070707_100700376 | 3300005468 | Bacteria | 976 |
| 107 | Ga0070698_100013778 | 3300005471 | Bacteria | 8556 |
| 108 | Ga0070698_100063993 | 3300005471 | Bacteria | 3707 |
| 109 | Ga0070698_100295048 | 3300005471 | Bacteria | 1552 |
| 110 | Ga0070698_100330357 | 3300005471 | Bacteria | 1456 |
| 111 | Ga0070699_100676770 | 3300005518 | Bacteria | 942 |
| 112 | Ga0070679_100014336 | 3300005530 | Bacteria | 7612 |
| 113 | Ga0070679_100060986 | 3300005530 | Bacteria | 3759 |
| 114 | Ga0070679_100236953 | 3300005530 | Bacteria | 1783 |
| 115 | Ga0070679_100310939 | 3300005530 | Bacteria | 1525 |
| 116 | Ga0070679_100373131 | 3300005530 | Bacteria | 1373 |
| 117 | Ga0070679_100596428 | 3300005530 | Bacteria | 1048 |
| 118 | Ga0070684_100113676 | 3300005535 | Bacteria | 2430 |
| 119 | Ga0070684_100122950 | 3300005535 | Bacteria | 2336 |
| 120 | Ga0070684_100190841 | 3300005535 | Bacteria | 1864 |
| 121 | Ga0070684_100317147 | 3300005535 | Bacteria | 1432 |
| 122 | Ga0070697_100248531 | 3300005536 | Bacteria | 1520 |
| 123 | Ga0068853_100309700 | 3300005539 | Bacteria | 1461 |
| 124 | Ga0068853_100524797 | 3300005539 | Bacteria | 1120 |
| 125 | Ga0070686_100023518 | 3300005544 | Bacteria | 3683 |
| 126 | Ga0070686_100036151 | 3300005544 | Bacteria | 3056 |
| 127 | Ga0070695_100167463 | 3300005545 | Bacteria | 1548 |
| 128 | Ga0070665_100668716 | 3300005548 | Bacteria | 1051 |
| 129 | Ga0070665_100879363 | 3300005548 | Bacteria | 909 |
| 130 | Ga0070704_100738507 | 3300005549 | Bacteria | 875 |
| 131 | Ga0068855_100061255 | 3300005563 | Bacteria | 4397 |
| 132 | Ga0068855_100150783 | 3300005563 | Unclassified | 2644 |
| 133 | Ga0068855_100201091 | 3300005563 | Bacteria | 2243 |
| 134 | Ga0068855_100246737 | 3300005563 | Bacteria | 1993 |
| 135 | Ga0068855_100627923 | 3300005563 | Bacteria | 1156 |
| 136 | Ga0070664_100059613 | 3300005564 | Bacteria | 3248 |
| 137 | Ga0068857_100410793 | 3300005577 | Bacteria | 1261 |
| 138 | Ga0068857_101216401 | 3300005577 | Bacteria | 730 |
| 139 | Ga0068854_100006171 | 3300005578 | Bacteria | 7607 |
| 140 | Ga0068854_100194497 | 3300005578 | Bacteria | 1591 |
| 141 | Ga0068854_100400417 | 3300005578 | Bacteria | 1136 |
| 142 | Ga0068856_100127598 | 3300005614 | Bacteria | 2547 |
| 143 | Ga0068856_100159420 | 3300005614 | Bacteria | 2266 |
| 144 | Ga0068856_100222549 | 3300005614 | Bacteria | 1903 |
| 145 | Ga0070702_100029003 | 3300005615 | Bacteria | 3004 |
| 146 | Ga0068852_100009988 | 3300005616 | Bacteria | 7062 |
| 147 | Ga0068852_100149768 | 3300005616 | Bacteria | 2169 |
| 148 | Ga0068852_100400784 | 3300005616 | Bacteria | 1349 |
| 149 | Ga0068852_100592031 | 3300005616 | Bacteria | 1113 |
| 150 | Ga0068866_10250549 | 3300005718 | Bacteria | 1083 |
| 151 | Ga0068861_100212639 | 3300005719 | Bacteria | 1630 |
| 152 | Ga0068870_10006900 | 3300005840 | Bacteria | 5037 |
| 153 | Ga0068863_100434753 | 3300005841 | Bacteria | 1286 |
| 154 | Ga0068858_100045462 | 3300005842 | Bacteria | 4069 |
| 155 | Ga0068860_100883308 | 3300005843 | Bacteria | 909 |
| 156 | Ga0081455_10002591 | 3300005937 | Bacteria | 21441 |
| 157 | Ga0081455_10011260 | 3300005937 | Bacteria | 9000 |
| 158 | Ga0081455_10028974 | 3300005937 | Bacteria | 5053 |
| 159 | Ga0081455_10031658 | 3300005937 | Bacteria | 4779 |
| 160 | Ga0081455_10060858 | 3300005937 | Bacteria | 3181 |
| 161 | Ga0081455_10205651 | 3300005937 | Bacteria | 1471 |
| 162 | Ga0081538_10000063 | 3300005981 | Bacteria | 99624 |
| 163 | Ga0081538_10001198 | 3300005981 | Bacteria | 27247 |
| 164 | Ga0081538_10002074 | 3300005981 | Bacteria | 19975 |
| 165 | Ga0081538_10002606 | 3300005981 | Bacteria | 17484 |
| 166 | Ga0081538_10004853 | 3300005981 | Bacteria | 12244 |
| 167 | Ga0081538_10004890 | 3300005981 | Bacteria | 12198 |
| 168 | Ga0081538_10006605 | 3300005981 | Bacteria | 10171 |
| 169 | Ga0081538_10009141 | 3300005981 | Bacteria | 8310 |
| 170 | Ga0081538_10074257 | 3300005981 | Bacteria | 1852 |
| 171 | Ga0081538_10101851 | 3300005981 | Bacteria | 1443 |
| 172 | Ga0081538_10154764 | 3300005981 | Bacteria | 1031 |
| 173 | Ga0081538_10158237 | 3300005981 | Bacteria | 1012 |
| 174 | Ga0081538_10164263 | 3300005981 | Bacteria | 981 |
| 175 | Ga0081540_1001536 | 3300005983 | Bacteria | 19829 |
| 176 | Ga0081539_10020696 | 3300005985 | Bacteria | 4431 |
| 177 | Ga0081539_10028730 | 3300005985 | Bacteria | 3492 |
| 178 | Ga0081539_10067162 | 3300005985 | Bacteria | 1940 |
| 179 | Ga0081539_10076577 | 3300005985 | Bacteria | 1772 |
| 180 | Ga0070717_10003113 | 3300006028 | Bacteria | 11833 |
| 181 | Ga0070717_10005654 | 3300006028 | Bacteria | 9133 |
| 182 | Ga0070717_10016240 | 3300006028 | Bacteria | 5768 |
| 183 | Ga0070717_10018875 | 3300006028 | Bacteria | 5395 |
| 184 | Ga0070717_10022410 | 3300006028 | Bacteria | 4990 |
| 185 | Ga0070717_10048957 | 3300006028 | Bacteria | 3468 |
| 186 | Ga0070717_10062424 | 3300006028 | Bacteria | 3089 |
| 187 | Ga0070717_10121965 | 3300006028 | Bacteria | 2234 |
| 188 | Ga0070717_10245113 | 3300006028 | Bacteria | 1581 |
| 189 | Ga0070717_10271676 | 3300006028 | Bacteria | 1502 |
| 190 | Ga0070717_10368491 | 3300006028 | Bacteria | 1287 |
| 191 | Ga0070717_10511922 | 3300006028 | Bacteria | 1085 |
| 192 | Ga0075365_10009199 | 3300006038 | Bacteria | 5665 |
| 193 | Ga0075364_10048459 | 3300006051 | Bacteria | 2768 |
| 194 | Ga0070715_10015404 | 3300006163 | Bacteria | 2850 |
| 195 | Ga0070716_100014385 | 3300006173 | Bacteria | 4052 |
| 196 | Ga0070716_100175440 | 3300006173 | Bacteria | 1402 |
| 197 | Ga0070712_100032228 | 3300006175 | Bacteria | 3536 |
| 198 | Ga0070712_100045302 | 3300006175 | Bacteria | 3036 |
| 199 | Ga0070712_100093786 | 3300006175 | Bacteria | 2204 |
| 200 | Ga0070712_100122238 | 3300006175 | Bacteria | 1960 |
| 201 | Ga0070712_100139446 | 3300006175 | Bacteria | 1848 |
| 202 | Ga0070712_100280851 | 3300006175 | Bacteria | 1341 |
| 203 | Ga0070712_100322703 | 3300006175 | Bacteria | 1256 |
| 204 | Ga0070712_100364235 | 3300006175 | Unclassified | 1186 |
| 205 | Ga0070712_100390397 | 3300006175 | Bacteria | 1147 |
| 206 | Ga0070712_100466821 | 3300006175 | Bacteria | 1053 |
| 207 | Ga0070712_100594984 | 3300006175 | Bacteria | 936 |
| 208 | Ga0070712_100646122 | 3300006175 | Bacteria | 898 |
| 209 | Ga0075362_10005721 | 3300006177 | Bacteria | 4575 |
| 210 | Ga0075427_10006907 | 3300006194 | Bacteria | 1658 |
| 211 | Ga0097621_100152985 | 3300006237 | Bacteria | 1979 |
| 212 | Ga0097621_100197309 | 3300006237 | Bacteria | 1746 |
| 213 | Ga0097621_100829905 | 3300006237 | Bacteria | 858 |
| 214 | Ga0068871_100069520 | 3300006358 | Bacteria | 2892 |
| 215 | Ga0075428_100163716 | 3300006844 | Bacteria | 2413 |
| 216 | Ga0075428_100777962 | 3300006844 | Bacteria | 1018 |
| 217 | Ga0075428_100908493 | 3300006844 | Bacteria | 934 |
| 218 | Ga0075430_100008389 | 3300006846 | Bacteria | 8727 |
| 219 | Ga0075431_100226209 | 3300006847 | Bacteria | 1907 |
| 220 | Ga0075431_100227095 | 3300006847 | Bacteria | 1903 |
| 221 | Ga0075431_100236483 | 3300006847 | Bacteria | 1859 |
| 222 | Ga0075434_100013809 | 3300006871 | Bacteria | 7701 |
| 223 | Ga0075434_100127523 | 3300006871 | Bacteria | 2562 |
| 224 | Ga0075434_100171301 | 3300006871 | Bacteria | 2191 |
| 225 | Ga0075434_100838183 | 3300006871 | Bacteria | 935 |
| 226 | Ga0075429_100044747 | 3300006880 | Bacteria | 3850 |
| 227 | Ga0075429_100096284 | 3300006880 | Bacteria | 2582 |
| 228 | Ga0068865_100074004 | 3300006881 | Bacteria | 2425 |
| 229 | Ga0068865_100234693 | 3300006881 | Bacteria | 1441 |
| 230 | Ga0068865_100278430 | 3300006881 | Bacteria | 1331 |
| 231 | Ga0075436_100711676 | 3300006914 | Bacteria | 744 |
| 232 | Ga0075435_100010431 | 3300007076 | Bacteria | 6796 |
| 233 | Ga0075435_100423139 | 3300007076 | Bacteria | 1147 |
| 234 | Ga0075435_100691037 | 3300007076 | Bacteria | 886 |
| 235 | Ga0105240_10034380 | 3300009093 | Bacteria | 6537 |
| 236 | Ga0105240_10126692 | 3300009093 | Bacteria | 3067 |
| 237 | Ga0111539_10000875 | 3300009094 | Bacteria | 39347 |
| 238 | Ga0111539_10186914 | 3300009094 | Bacteria | 2419 |
| 239 | Ga0111539_10324042 | 3300009094 | Bacteria | 1793 |
| 240 | Ga0111539_10358324 | 3300009094 | Bacteria | 1698 |
| 241 | Ga0105245_10034516 | 3300009098 | Bacteria | 4488 |
| 242 | Ga0105245_10309280 | 3300009098 | Bacteria | 1553 |
| 243 | Ga0105245_10510580 | 3300009098 | Bacteria | 1219 |
| 244 | Ga0105245_10572732 | 3300009098 | Bacteria | 1153 |
| 245 | Ga0105245_10876756 | 3300009098 | Bacteria | 938 |
| 246 | Ga0105247_10073575 | 3300009101 | Bacteria | 2142 |
| 247 | Ga0114129_10004181 | 3300009147 | Bacteria | 20393 |
| 248 | Ga0114129_10053451 | 3300009147 | Bacteria | 5664 |
| 249 | Ga0114129_10139709 | 3300009147 | Bacteria | 3321 |
| 250 | Ga0114129_10169736 | 3300009147 | Bacteria | 2975 |
| 251 | Ga0114129_10239014 | 3300009147 | Bacteria | 2442 |
| 252 | Ga0105243_10010885 | 3300009148 | Bacteria | 6881 |
| 253 | Ga0105243_10336373 | 3300009148 | Bacteria | 1381 |
| 254 | Ga0105243_10773313 | 3300009148 | Bacteria | 944 |
| 255 | Ga0105242_10036676 | 3300009176 | Bacteria | 3935 |
| 256 | Ga0105242_10558023 | 3300009176 | Bacteria | 1099 |
| 257 | Ga0105242_10685975 | 3300009176 | Bacteria | 1000 |
| 258 | Ga0105242_11072800 | 3300009176 | Bacteria | 818 |
| 259 | Ga0105248_10350693 | 3300009177 | Bacteria | 1661 |
| 260 | Ga0105237_10029633 | 3300009545 | Bacteria | 5561 |
| 261 | Ga0105237_10457409 | 3300009545 | Bacteria | 1282 |
| 262 | Ga0105238_10041276 | 3300009551 | Bacteria | 4673 |
| 263 | Ga0105238_10235365 | 3300009551 | Bacteria | 1809 |
| 264 | Ga0105238_10272508 | 3300009551 | Bacteria | 1673 |
| 265 | Ga0105238_10317030 | 3300009551 | Bacteria | 1545 |
| 266 | Ga0105238_10647727 | 3300009551 | Bacteria | 1066 |
| 267 | Ga0105239_10042156 | 3300010375 | Bacteria | 5001 |
| 268 | Ga0105239_10193155 | 3300010375 | Bacteria | 2279 |
| 269 | Ga0105239_10351589 | 3300010375 | Bacteria | 1664 |
| 270 | Ga0105239_10973815 | 3300010375 | Bacteria | 975 |
| 271 | Ga0105246_10186142 | 3300011119 | Bacteria | 1603 |
| 272 | Ga0157340_1011268 | 3300012473 | Bacteria | 641 |
| 273 | Ga0157339_1009323 | 3300012505 | Bacteria | 866 |
| 274 | Ga0157338_1002793 | 3300012515 | Bacteria | 1399 |
| 275 | Ga0157371_10020393 | 3300013102 | Bacteria | 4877 |
| 276 | Ga0157371_10105538 | 3300013102 | Bacteria | 1999 |
| 277 | Ga0157371_10648044 | 3300013102 | Bacteria | 788 |
| 278 | Ga0157370_10030220 | 3300013104 | Bacteria | 5310 |
| 279 | Ga0157370_10141222 | 3300013104 | Bacteria | 2244 |
| 280 | Ga0157370_10204311 | 3300013104 | Bacteria | 1832 |
| 281 | Ga0157370_10427703 | 3300013104 | Bacteria | 1218 |
| 282 | Ga0157369_10011850 | 3300013105 | Bacteria | 9904 |
| 283 | Ga0157369_10042363 | 3300013105 | Bacteria | 4966 |
| 284 | Ga0157369_10105314 | 3300013105 | Bacteria | 3003 |
| 285 | Ga0157374_10127115 | 3300013296 | Bacteria | 2464 |
| 286 | Ga0157374_10145230 | 3300013296 | Bacteria | 2304 |
| 287 | Ga0163162_10189610 | 3300013306 | Bacteria | 2183 |
| 288 | Ga0157372_10006405 | 3300013307 | Bacteria | 12526 |
| 289 | Ga0157372_10056942 | 3300013307 | Bacteria | 4369 |
| 290 | Ga0157372_10554386 | 3300013307 | Bacteria | 1340 |
| 291 | Ga0157372_10598967 | 3300013307 | Bacteria | 1285 |
| 292 | Ga0157372_10683935 | 3300013307 | Bacteria | 1194 |
| 293 | Ga0157372_10737980 | 3300013307 | Bacteria | 1145 |
| 294 | Ga0157375_10300813 | 3300013308 | Bacteria | 1768 |
| 295 | Ga0157375_10329666 | 3300013308 | Bacteria | 1691 |
| 296 | Ga0157380_10682993 | 3300014326 | Bacteria | 1029 |
| 297 | Ga0157380_10715459 | 3300014326 | Bacteria | 1008 |
| 298 | Ga0182008_10001160 | 3300014497 | Bacteria | 18146 |
| 299 | Ga0157377_10020642 | 3300014745 | Bacteria | 3454 |
| 300 | Ga0157377_10078377 | 3300014745 | Bacteria | 1926 |
| 301 | Ga0157377_10271874 | 3300014745 | Bacteria | 1107 |
| 302 | Ga0157377_10622780 | 3300014745 | Bacteria | 773 |
| 303 | Ga0157379_10149724 | 3300014968 | Bacteria | 2105 |
| 304 | Ga0157379_10276392 | 3300014968 | Bacteria | 1528 |
| 305 | Ga0157379_10429041 | 3300014968 | Bacteria | 1218 |
| 306 | Ga0157376_10017065 | 3300014969 | Bacteria | 5529 |
| 307 | Ga0157376_10308742 | 3300014969 | Bacteria | 1500 |
| 308 | Ga0206356_11795030 | 3300020070 | Bacteria | 3790 |
| 309 | Ga0206354_10312155 | 3300020081 | Bacteria | 2323 |
| 310 | Ga0206353_10251350 | 3300020082 | Bacteria | 966 |
| 311 | Ga0213874_10065631 | 3300021377 | Bacteria | 1147 |
| 312 | Ga0213876_10011794 | 3300021384 | Bacteria | 4660 |
| 313 | Ga0213876_10103288 | 3300021384 | Bacteria | 1511 |
| 314 | Ga0213875_10031653 | 3300021388 | Bacteria | 2502 |
| 315 | Ga0224712_10151072 | 3300022467 | Bacteria | 1029 |
| 316 | Ga0224572_1002517 | 3300024225 | Bacteria | 2976 |
| 317 | Ga0207692_10016955 | 3300025898 | Bacteria | 3238 |
| 318 | Ga0207692_10037041 | 3300025898 | Bacteria | 2383 |
| 319 | Ga0207642_10189393 | 3300025899 | Bacteria | 1128 |
| 320 | Ga0207710_10060736 | 3300025900 | Bacteria | 1714 |
| 321 | Ga0207710_10126449 | 3300025900 | Bacteria | 1225 |
| 322 | Ga0207688_10015385 | 3300025901 | Bacteria | 4150 |
| 323 | Ga0207688_10154157 | 3300025901 | Bacteria | 1359 |
| 324 | Ga0207685_10011131 | 3300025905 | Bacteria | 2691 |
| 325 | Ga0207685_10011459 | 3300025905 | Bacteria | 2666 |
| 326 | Ga0207699_10092973 | 3300025906 | Bacteria | 1897 |
| 327 | Ga0207699_10220468 | 3300025906 | Bacteria | 1294 |
| 328 | Ga0207643_10007140 | 3300025908 | Bacteria | 5993 |
| 329 | Ga0207643_10009105 | 3300025908 | Bacteria | 5332 |
| 330 | Ga0207705_10156396 | 3300025909 | Bacteria | 1710 |
| 331 | Ga0207684_10004905 | 3300025910 | Bacteria | 12487 |
| 332 | Ga0207684_10025177 | 3300025910 | Bacteria | 5072 |
| 333 | Ga0207684_10058735 | 3300025910 | Bacteria | 3264 |
| 334 | Ga0207684_10126969 | 3300025910 | Bacteria | 2189 |
| 335 | Ga0207654_10111649 | 3300025911 | Bacteria | 1702 |
| 336 | Ga0207654_10300926 | 3300025911 | Bacteria | 1091 |
| 337 | Ga0207707_10014798 | 3300025912 | Bacteria | 6796 |
| 338 | Ga0207707_10271591 | 3300025912 | Bacteria | 1469 |
| 339 | Ga0207707_10395945 | 3300025912 | Bacteria | 1186 |
| 340 | Ga0207707_10435238 | 3300025912 | Bacteria | 1123 |
| 341 | Ga0207695_10024882 | 3300025913 | Bacteria | 6719 |
| 342 | Ga0207695_10648554 | 3300025913 | Bacteria | 937 |
| 343 | Ga0207671_10155125 | 3300025914 | Bacteria | 1771 |
| 344 | Ga0207693_10061471 | 3300025915 | Bacteria | 2942 |
| 345 | Ga0207693_10326144 | 3300025915 | Bacteria | 1202 |
| 346 | Ga0207693_10534866 | 3300025915 | Bacteria | 914 |
| 347 | Ga0207663_10017491 | 3300025916 | Bacteria | 3996 |
| 348 | Ga0207663_10201984 | 3300025916 | Bacteria | 1434 |
| 349 | Ga0207663_10248784 | 3300025916 | Bacteria | 1307 |
| 350 | Ga0207660_10070428 | 3300025917 | Bacteria | 2542 |
| 351 | Ga0207660_10167477 | 3300025917 | Bacteria | 1699 |
| 352 | Ga0207660_10179822 | 3300025917 | Bacteria | 1642 |
| 353 | Ga0207660_10184771 | 3300025917 | Bacteria | 1621 |
| 354 | Ga0207660_10251654 | 3300025917 | Bacteria | 1394 |
| 355 | Ga0207662_10102698 | 3300025918 | Bacteria | 1773 |
| 356 | Ga0207657_10014748 | 3300025919 | Bacteria | 7609 |
| 357 | Ga0207657_10033988 | 3300025919 | Bacteria | 4591 |
| 358 | Ga0207657_10494150 | 3300025919 | Bacteria | 959 |
| 359 | Ga0207649_10101978 | 3300025920 | Bacteria | 1901 |
| 360 | Ga0207649_10206450 | 3300025920 | Bacteria | 1391 |
| 361 | Ga0207652_10135241 | 3300025921 | Bacteria | 2201 |
| 362 | Ga0207652_10474144 | 3300025921 | Bacteria | 1127 |
| 363 | Ga0207652_10534564 | 3300025921 | Bacteria | 1054 |
| 364 | Ga0207652_10965432 | 3300025921 | Bacteria | 750 |
| 365 | Ga0207646_10190041 | 3300025922 | Bacteria | 1854 |
| 366 | Ga0207646_10248008 | 3300025922 | Bacteria | 1608 |
| 367 | Ga0207694_10040285 | 3300025924 | Bacteria | 3596 |
| 368 | Ga0207694_10393126 | 3300025924 | Bacteria | 1152 |
| 369 | Ga0207650_10005497 | 3300025925 | Bacteria | 8649 |
| 370 | Ga0207659_10139413 | 3300025926 | Bacteria | 1881 |
| 371 | Ga0207659_10260783 | 3300025926 | Bacteria | 1410 |
| 372 | Ga0207687_10030778 | 3300025927 | Bacteria | 3621 |
| 373 | Ga0207687_10095592 | 3300025927 | Bacteria | 2176 |
| 374 | Ga0207687_10132320 | 3300025927 | Bacteria | 1882 |
| 375 | Ga0207687_10696348 | 3300025927 | Bacteria | 862 |
| 376 | Ga0207700_10053854 | 3300025928 | Bacteria | 3017 |
| 377 | Ga0207700_10088976 | 3300025928 | Bacteria | 2433 |
| 378 | Ga0207700_10096013 | 3300025928 | Bacteria | 2352 |
| 379 | Ga0207700_10096744 | 3300025928 | Bacteria | 2345 |
| 380 | Ga0207700_10283946 | 3300025928 | Bacteria | 1425 |
| 381 | Ga0207700_10321358 | 3300025928 | Bacteria | 1341 |
| 382 | Ga0207664_10012616 | 3300025929 | Bacteria | 6046 |
| 383 | Ga0207664_10015287 | 3300025929 | Bacteria | 5565 |
| 384 | Ga0207664_10019040 | 3300025929 | Bacteria | 5067 |
| 385 | Ga0207664_10020106 | 3300025929 | Bacteria | 4943 |
| 386 | Ga0207664_10040672 | 3300025929 | Bacteria | 3617 |
| 387 | Ga0207664_10108970 | 3300025929 | Bacteria | 2300 |
| 388 | Ga0207664_10216709 | 3300025929 | Bacteria | 1658 |
| 389 | Ga0207664_10291111 | 3300025929 | Bacteria | 1435 |
| 390 | Ga0207664_10454055 | 3300025929 | Bacteria | 1144 |
| 391 | Ga0207690_10021019 | 3300025932 | Bacteria | 4042 |
| 392 | Ga0207706_10001708 | 3300025933 | Bacteria | 21650 |
| 393 | Ga0207686_10284109 | 3300025934 | Bacteria | 1223 |
| 394 | Ga0207709_10158391 | 3300025935 | Bacteria | 1576 |
| 395 | Ga0207709_10270368 | 3300025935 | Bacteria | 1251 |
| 396 | Ga0207709_10321604 | 3300025935 | Bacteria | 1158 |
| 397 | Ga0207669_10024084 | 3300025937 | Bacteria | 3265 |
| 398 | Ga0207704_10010480 | 3300025938 | Bacteria | 4526 |
| 399 | Ga0207704_10113212 | 3300025938 | Bacteria | 1839 |
| 400 | Ga0207665_10201861 | 3300025939 | Bacteria | 1449 |
| 401 | Ga0207711_10427649 | 3300025941 | Bacteria | 1232 |
| 402 | Ga0207689_10008051 | 3300025942 | Bacteria | 9200 |
| 403 | Ga0207689_10045248 | 3300025942 | Bacteria | 3640 |
| 404 | Ga0207661_10057950 | 3300025944 | Bacteria | 3116 |
| 405 | Ga0207661_10083978 | 3300025944 | Bacteria | 2636 |
| 406 | Ga0207661_10101387 | 3300025944 | Bacteria | 2418 |
| 407 | Ga0207661_10173120 | 3300025944 | Bacteria | 1880 |
| 408 | Ga0207661_10344392 | 3300025944 | Bacteria | 1344 |
| 409 | Ga0207661_10958996 | 3300025944 | Bacteria | 788 |
| 410 | Ga0207679_10149123 | 3300025945 | Bacteria | 1901 |
| 411 | Ga0207667_10046064 | 3300025949 | Bacteria | 4617 |
| 412 | Ga0207651_10021119 | 3300025960 | Bacteria | 3948 |
| 413 | Ga0207640_10015284 | 3300025981 | Bacteria | 4440 |
| 414 | Ga0207640_10050866 | 3300025981 | Bacteria | 2690 |
| 415 | Ga0207640_10105216 | 3300025981 | Bacteria | 1988 |
| 416 | Ga0207640_10136062 | 3300025981 | Bacteria | 1784 |
| 417 | Ga0207640_10945265 | 3300025981 | Bacteria | 755 |
| 418 | Ga0207677_10060971 | 3300026023 | Bacteria | 2610 |
| 419 | Ga0207677_10242627 | 3300026023 | Bacteria | 1459 |
| 420 | Ga0207703_10108140 | 3300026035 | Bacteria | 2368 |
| 421 | Ga0207703_10404338 | 3300026035 | Bacteria | 1267 |
| 422 | Ga0207703_10901518 | 3300026035 | Bacteria | 846 |
| 423 | Ga0207639_10017717 | 3300026041 | Bacteria | 5051 |
| 424 | Ga0207639_10103927 | 3300026041 | Unclassified | 2302 |
| 425 | Ga0207639_10504220 | 3300026041 | Bacteria | 1106 |
| 426 | Ga0207639_10803645 | 3300026041 | Bacteria | 876 |
| 427 | Ga0207708_10738336 | 3300026075 | Bacteria | 844 |
| 428 | Ga0207702_10019420 | 3300026078 | Bacteria | 5623 |
| 429 | Ga0207702_10100171 | 3300026078 | Bacteria | 2555 |
| 430 | Ga0207702_10121343 | 3300026078 | Bacteria | 2340 |
| 431 | Ga0207702_10136692 | 3300026078 | Bacteria | 2212 |
| 432 | Ga0207702_10152371 | 3300026078 | Bacteria | 2104 |
| 433 | Ga0207702_10225602 | 3300026078 | Bacteria | 1748 |
| 434 | Ga0207702_10658471 | 3300026078 | Bacteria | 1030 |
| 435 | Ga0207641_10057603 | 3300026088 | Bacteria | 3305 |
| 436 | Ga0207641_10131369 | 3300026088 | Bacteria | 2249 |
| 437 | Ga0207648_10247535 | 3300026089 | Bacteria | 1589 |
| 438 | Ga0207676_10400419 | 3300026095 | Bacteria | 1283 |
| 439 | Ga0207676_10889832 | 3300026095 | Bacteria | 873 |
| 440 | Ga0207674_10043768 | 3300026116 | Bacteria | 4615 |
| 441 | Ga0207674_10068041 | 3300026116 | Bacteria | 3585 |
| 442 | Ga0207674_10078878 | 3300026116 | Bacteria | 3298 |
| 443 | Ga0207674_10242877 | 3300026116 | Bacteria | 1748 |
| 444 | Ga0207675_100764814 | 3300026118 | Bacteria | 978 |
| 445 | Ga0207683_10306535 | 3300026121 | Bacteria | 1453 |
| 446 | Ga0207698_10010798 | 3300026142 | Bacteria | 5891 |
| 447 | Ga0207698_10412888 | 3300026142 | Bacteria | 1293 |
| 448 | Ga0207698_10626475 | 3300026142 | Bacteria | 1063 |
| 449 | Ga0207698_11105044 | 3300026142 | Bacteria | 806 |
| 450 | Ga0207428_10004529 | 3300027907 | Bacteria | 13182 |
| 451 | Ga0207428_10010924 | 3300027907 | Bacteria | 8082 |
| 452 | Ga0265762_1024003 | 3300030760 | Bacteria | 1132 |
| 453 | Ga0265760_10035877 | 3300031090 | Bacteria | 1469 |
| 454 | Ga0307408_100159000 | 3300031548 | Bacteria | 1792 |
| 455 | Ga0316575_10056557 | 3300031665 | Bacteria | 1563 |
| 456 | Ga0316576_10029789 | 3300031727 | Bacteria | 3861 |
| 457 | Ga0316576_10042306 | 3300031727 | Bacteria | 3283 |
| 458 | Ga0316578_10242410 | 3300031728 | Bacteria | 1082 |
| 459 | Ga0307405_10098997 | 3300031731 | Bacteria | 1951 |
| 460 | Ga0307405_10135322 | 3300031731 | Bacteria | 1710 |
| 461 | Ga0307405_10223811 | 3300031731 | Bacteria | 1382 |
| 462 | Ga0316577_10007320 | 3300031733 | Bacteria | 5890 |
| 463 | Ga0316577_10009957 | 3300031733 | Bacteria | 5126 |
| 464 | Ga0316577_10023035 | 3300031733 | Bacteria | 3459 |
| 465 | Ga0316577_10040667 | 3300031733 | Bacteria | 2600 |
| 466 | Ga0316577_10058853 | 3300031733 | Bacteria | 2145 |
| 467 | Ga0316577_10121501 | 3300031733 | Bacteria | 1468 |
| 468 | Ga0316577_10210201 | 3300031733 | Bacteria | 1100 |
| 469 | Ga0307413_10518096 | 3300031824 | Bacteria | 961 |
| 470 | Ga0307410_10147517 | 3300031852 | Bacteria | 1747 |
| 471 | Ga0307410_10763226 | 3300031852 | Bacteria | 820 |
| 472 | Ga0307406_10040316 | 3300031901 | Bacteria | 2903 |
| 473 | Ga0307406_10158274 | 3300031901 | Bacteria | 1625 |
| 474 | Ga0307406_10813966 | 3300031901 | Bacteria | 789 |
| 475 | Ga0307407_10059094 | 3300031903 | Bacteria | 2231 |
| 476 | Ga0307407_10142511 | 3300031903 | Bacteria | 1548 |
| 477 | Ga0307412_10335332 | 3300031911 | Bacteria | 1208 |
| 478 | Ga0307409_100019324 | 3300031995 | Bacteria | 4609 |
| 479 | Ga0307409_100093422 | 3300031995 | Bacteria | 2472 |
| 480 | Ga0307409_100099348 | 3300031995 | Bacteria | 2410 |
| 481 | Ga0307409_100388815 | 3300031995 | Bacteria | 1329 |
| 482 | Ga0307409_100546299 | 3300031995 | Bacteria | 1136 |
| 483 | Ga0307409_100785905 | 3300031995 | Bacteria | 958 |
| 484 | Ga0307409_101521272 | 3300031995 | Bacteria | 697 |
| 485 | Ga0307416_100081850 | 3300032002 | Bacteria | 2732 |
| 486 | Ga0307416_100090626 | 3300032002 | Bacteria | 2623 |
| 487 | Ga0307416_100185296 | 3300032002 | Bacteria | 1956 |
| 488 | Ga0307416_100451406 | 3300032002 | Bacteria | 1338 |
| 489 | Ga0307416_100499388 | 3300032002 | Bacteria | 1280 |
| 490 | Ga0307414_10257448 | 3300032004 | Bacteria | 1454 |
| 491 | Ga0307411_10581153 | 3300032005 | Bacteria | 960 |
| 492 | Ga0307415_100191437 | 3300032126 | Bacteria | 1614 |
| 493 | Ga0307415_100416588 | 3300032126 | Bacteria | 1151 |
| 494 | Ga0307415_100479016 | 3300032126 | Bacteria | 1083 |
| 495 | Ga0307415_100499803 | 3300032126 | Bacteria | 1063 |
| 496 | Ga0307415_100784094 | 3300032126 | Bacteria | 868 |
| 497 | Ga0316593_10127385 | 3300032168 | Bacteria | 917 |
| 498 | Ga0373930_0040628 | 3300034816 | Bacteria | 990 |
| 499 | Ga0373926_0000850 | 3300035083 | Bacteria | 8708 |
| 500 | Ga0373944_0000427 | 3300035089 | Bacteria | 9635 |
| 501 | Ga0373923_0071602 | 3300035111 | Bacteria | 1489 |
| 502 | Ga0373923_0201338 | 3300035111 | Bacteria | 920 |
| 503 | Ga0373936_0000725 | 3300035113 | Bacteria | 11524 |
| 504 | Ga0373936_0087869 | 3300035113 | Bacteria | 1300 |
| 505 | Ga0373939_0079959 | 3300035114 | Bacteria | 1084 |
| 506 | Ga0373945_0000016 | 3300035116 | Bacteria | 34712 |
| 507 | Ga0373953_0014461 | 3300035117 | Bacteria | 2839 |
| 508 | Ga0373954_0294302 | 3300035118 | Bacteria | 801 |
| 509 | Ga0373956_0088111 | 3300035119 | Bacteria | 1430 |
| 510 | Ga0373956_0100846 | 3300035119 | Bacteria | 1339 |
| 511 | Ga0373957_0069290 | 3300035120 | Bacteria | 1377 |
| 512 | Ga0373960_0008112 | 3300035121 | Bacteria | 2509 |
| 513 | Ga0373943_0003777 | 3300035170 | Bacteria | 6877 |
| 514 | Ga0373946_0002742 | 3300035171 | Bacteria | 6227 |
| 515 | Ga0373955_0024987 | 3300035172 | Bacteria | 3062 |
| 516 | Ga0373955_0090468 | 3300035172 | Bacteria | 1743 |
| 517 | Ga0373955_0183880 | 3300035172 | Bacteria | 1241 |
| 518 | Ga0373931_0079397 | 3300035691 | Bacteria | 1807 |
| 519 | Ga0373935_0049972 | 3300035692 | Bacteria | 2652 |
| 520 | Ga0373927_0000603 | 3300035695 | Bacteria | 27426 |
| 521 | Ga0373933_0017769 | 3300035724 | Bacteria | 3990 |
| 522 | Ga0373933_0047517 | 3300035724 | Bacteria | 2553 |
| 523 | Ga0373947_0005652 | 3300035725 | Bacteria | 7298 |
| 524 | Ga0373937_0323460 | 3300036401 | Bacteria | 1459 |
| 525 | Ga0373937_0370964 | 3300036401 | Bacteria | 1357 |
| 526 | Ga0373937_0655759 | 3300036401 | Bacteria | 995 |
| 527 | Ga0373937_0774104 | 3300036401 | Bacteria | 907 |
| 528 | Ga0372808_018167 | 3300036459 | Bacteria | 1010 |
| 529 | Ga0316582_0003740 | 3300036647 | Bacteria | 7538 |
| 530 | Ga0316582_0009839 | 3300036647 | Bacteria | 5206 |
| 531 | Ga0316582_0022693 | 3300036647 | Bacteria | 3730 |
| 532 | Ga0316582_0040653 | 3300036647 | Bacteria | 2903 |
| 533 | Ga0316582_0076245 | 3300036647 | Bacteria | 2180 |
| 534 | Ga0316582_0128240 | 3300036647 | Unclassified | 1702 |
| 535 | Ga0316582_0649400 | 3300036647 | Bacteria | 725 |
| 536 | Ga0316582_0728194 | 3300036647 | Bacteria | 681 |
| 537 | Ga0316584_0002012 | 3300036712 | Bacteria | 12709 |
| 538 | Ga0316584_0002431 | 3300036712 | Bacteria | 11784 |
| 539 | Ga0316584_0006499 | 3300036712 | Bacteria | 7916 |
| 540 | Ga0316584_0043912 | 3300036712 | Bacteria | 3333 |
| 541 | Ga0316584_0110346 | 3300036712 | Bacteria | 2059 |
| 542 | Ga0316584_0167913 | 3300036712 | Bacteria | 1629 |
| 543 | Ga0373925_0013934 | 3300037068 | Bacteria | 5819 |
| 544 | Ga0373925_0365475 | 3300037068 | Bacteria | 1173 |
| 545 | Ga0373925_0735365 | 3300037068 | Bacteria | 813 |
| 546 | Ga0395899_0002678 | 3300037312 | Bacteria | 14361 |
| 547 | Ga0395899_0009721 | 3300037312 | Bacteria | 7381 |
| 548 | Ga0395899_0012401 | 3300037312 | Bacteria | 6528 |
| 549 | Ga0395899_0032840 | 3300037312 | Bacteria | 3900 |
| 550 | Ga0395899_0040952 | 3300037312 | Bacteria | 3463 |
| 551 | Ga0395899_0170517 | 3300037312 | Bacteria | 1533 |
| 552 | Ga0395900_0001398 | 3300037418 | Bacteria | 28860 |
| 553 | Ga0395900_0001553 | 3300037418 | Bacteria | 27276 |
| 554 | Ga0395900_0015596 | 3300037418 | Bacteria | 7745 |
| 555 | Ga0395900_0030269 | 3300037418 | Bacteria | 5556 |
| 556 | Ga0395900_0036974 | 3300037418 | Bacteria | 5033 |
| 557 | Ga0395900_0168383 | 3300037418 | Bacteria | 2232 |
| 558 | Ga0395900_0196178 | 3300037418 | Bacteria | 2045 |
| 559 | Ga0395900_0304109 | 3300037418 | Bacteria | 1580 |
| 560 | Ga0395900_0926296 | 3300037418 | Bacteria | 794 |
| 561 | Ga0395898_0006056 | 3300037466 | Bacteria | 12983 |
| 562 | Ga0395898_0011885 | 3300037466 | Bacteria | 9014 |
| 563 | Ga0395898_0011908 | 3300037466 | Bacteria | 9008 |
| 564 | Ga0395898_0037487 | 3300037466 | Bacteria | 4808 |
| 565 | Ga0395898_0054109 | 3300037466 | Bacteria | 3917 |
| 566 | Ga0395898_0085276 | 3300037466 | Bacteria | 3044 |
| 567 | Ga0395898_0335494 | 3300037466 | Bacteria | 1442 |
| 568 | Ga0395898_0624861 | 3300037466 | Bacteria | 1020 |
| 569 | Ga0395905_0005069 | 3300037471 | Bacteria | 13555 |
| 570 | Ga0395905_0005379 | 3300037471 | Bacteria | 13089 |
| 571 | Ga0395905_0019192 | 3300037471 | Bacteria | 6483 |
| 572 | Ga0395905_0019785 | 3300037471 | Bacteria | 6381 |
| 573 | Ga0395905_0107499 | 3300037471 | Bacteria | 2619 |
| 574 | Ga0316581_0003136 | 3300037588 | Bacteria | 4079 |
| 575 | Ga0316581_0006601 | 3300037588 | Bacteria | 3078 |
| 576 | Ga0316581_0047903 | 3300037588 | Bacteria | 1308 |
| 577 | Ga0316581_0052532 | 3300037588 | Bacteria | 1249 |
| 578 | Ga0436364_0008721 | 3300037853 | Bacteria | 2943 |
| 579 | Ga0436364_0267484 | 3300037853 | Bacteria | 859 |
| 580 | Ga0436364_1142277 | 3300037853 | Bacteria | 3039 |
| 581 | Ga0436364_1209434 | 3300037853 | Bacteria | 1935 |
| 582 | Ga0436364_1288039 | 3300037853 | Bacteria | 4203 |
| 583 | Ga0436364_1403969 | 3300037853 | Bacteria | 3691 |
| 584 | Ga0436364_1409644 | 3300037853 | Bacteria | 3116 |
| 585 | Ga0436364_1538459 | 3300037853 | Bacteria | 3734 |
| 586 | Ga0395901_0000717 | 3300038443 | Bacteria | 37735 |
| 587 | Ga0395901_0000739 | 3300038443 | Bacteria | 36910 |
| 588 | Ga0395901_0003414 | 3300038443 | Bacteria | 16004 |
| 589 | Ga0395901_0008492 | 3300038443 | Bacteria | 10380 |
| 590 | Ga0395901_0035478 | 3300038443 | Bacteria | 5152 |
| 591 | Ga0395901_0052750 | 3300038443 | Bacteria | 4227 |
| 592 | Ga0395901_0085519 | 3300038443 | Bacteria | 3297 |
| 593 | Ga0395901_0159342 | 3300038443 | Bacteria | 2370 |
| 594 | Ga0436365_0072895 | 3300039437 | Bacteria | 53725 |
| 595 | Ga0436365_0158783 | 3300039437 | Bacteria | 16629 |
| 596 | Ga0436365_0376109 | 3300039437 | Bacteria | 2162 |
| 597 | Ga0436365_0412674 | 3300039437 | Bacteria | 2955 |
| 598 | Ga0436365_0686913 | 3300039437 | Bacteria | 4450 |
| 599 | Ga0436365_0783550 | 3300039437 | Bacteria | 2193 |
| 600 | Ga0436365_0892906 | 3300039437 | Bacteria | 2473 |
| 601 | Ga0436365_1088316 | 3300039437 | Bacteria | 5578 |
| 602 | Ga0436365_1674485 | 3300039437 | Bacteria | 6787 |
| 603 | Ga0436360_0139542 | 3300039438 | Bacteria | 964 |
| 604 | Ga0436363_0535202 | 3300039450 | Bacteria | 1047 |
| 605 | Ga0436362_0583696 | 3300039453 | Bacteria | 1330 |
| 606 | Ga0451855_1240075 | 3300041511 | Bacteria | 1685 |
| 607 | Ga0451853_1781216 | 3300041512 | Bacteria | 4609 |
| 608 | Ga0439460_0023712 | 3300042461 | Bacteria | 1694 |
| 609 | Ga0451577_0642771 | 3300042876 | Bacteria | 962 |
| 610 | Ga0453683_0469580 | 3300044673 | Bacteria | 815 |
| 611 | Ga0466965_0449008 | 3300044683 | Bacteria | 718 |
| 612 | Ga0466961_0035163 | 3300044693 | Bacteria | 3217 |
| 613 | Ga0466961_0058716 | 3300044693 | Bacteria | 2447 |
| 614 | Ga0466961_0251301 | 3300044693 | Bacteria | 1086 |
| 615 | Ga0466961_0300690 | 3300044693 | Bacteria | 980 |
| 616 | Ga0466963_0000393 | 3300044694 | Bacteria | 19938 |
| 617 | Ga0466963_0001530 | 3300044694 | Bacteria | 12527 |
| 618 | Ga0466963_0009403 | 3300044694 | Bacteria | 5886 |
| 619 | Ga0466963_0150068 | 3300044694 | Bacteria | 1618 |
| 620 | Ga0466963_0767051 | 3300044694 | Bacteria | 680 |
| 621 | Ga0466964_0080937 | 3300044706 | Bacteria | 1394 |
| 622 | Ga0466971_0031658 | 3300044719 | Bacteria | 2369 |
| 623 | Ga0466971_0078005 | 3300044719 | Bacteria | 1509 |
| 624 | Ga0466957_0003328 | 3300044842 | Bacteria | 8810 |
| 625 | Ga0466957_0023118 | 3300044842 | Bacteria | 3672 |
| 626 | Ga0466957_0069155 | 3300044842 | Bacteria | 2181 |
| 627 | Ga0466957_0183013 | 3300044842 | Bacteria | 1369 |
| 628 | Ga0466957_0617008 | 3300044842 | Bacteria | 760 |
| 629 | Ga0466960_0015922 | 3300044901 | Bacteria | 3250 |
| 630 | Ga0466960_0020023 | 3300044901 | Bacteria | 2957 |
| 631 | Ga0466960_0060694 | 3300044901 | Bacteria | 1854 |
| 632 | Ga0466959_0000356 | 3300045049 | Bacteria | 26996 |
| 633 | Ga0466959_0048231 | 3300045049 | Bacteria | 3130 |
| 634 | Ga0466959_0090391 | 3300045049 | Bacteria | 2199 |
| 635 | Ga0466959_0406392 | 3300045049 | Bacteria | 925 |
| 636 | Ga0466958_0000216 | 3300045836 | Bacteria | 21669 |
| 637 | Ga0466958_0014864 | 3300045836 | Bacteria | 4449 |
| 638 | Ga0466958_0016646 | 3300045836 | Bacteria | 4237 |
| 639 | Ga0466958_0151815 | 3300045836 | Bacteria | 1461 |
| 640 | Ga0466958_0188805 | 3300045836 | Bacteria | 1309 |
| 641 | Ga0466958_0271671 | 3300045836 | Bacteria | 1086 |
| 642 | Ga0466967_0002039 | 3300045976 | Bacteria | 12328 |
| 643 | Ga0466967_0004347 | 3300045976 | Bacteria | 9536 |
| 644 | Ga0466967_0043158 | 3300045976 | Bacteria | 3903 |
| 645 | Ga0466967_0062597 | 3300045976 | Bacteria | 3303 |
| 646 | Ga0466967_0067051 | 3300045976 | Bacteria | 3200 |
| 647 | Ga0466967_0076948 | 3300045976 | Bacteria | 3002 |
| 648 | Ga0466967_0088111 | 3300045976 | Bacteria | 2815 |
| 649 | Ga0466967_0091524 | 3300045976 | Bacteria | 2764 |
| 650 | Ga0466967_0130075 | 3300045976 | Bacteria | 2336 |
| 651 | Ga0466967_0154634 | 3300045976 | Bacteria | 2147 |
| 652 | Ga0466967_0220423 | 3300045976 | Bacteria | 1802 |
| 653 | Ga0466967_0612740 | 3300045976 | Bacteria | 1075 |
| 654 | Ga0466967_0779832 | 3300045976 | Bacteria | 949 |
| 655 | Ga0466967_0903951 | 3300045976 | Bacteria | 878 |
| 656 | Ga0495592_0000671 | 3300046454 | Bacteria | 23792 |
| 657 | Ga0495592_0152210 | 3300046454 | Bacteria | 1599 |
| 658 | Ga0495603_0049672 | 3300046455 | Bacteria | 2497 |
| 659 | Ga0495629_0130807 | 3300046459 | Bacteria | 1748 |
| 660 | Ga0495629_0209159 | 3300046459 | Bacteria | 1347 |
| 661 | Ga0495629_0277700 | 3300046459 | Bacteria | 1150 |
| 662 | Ga0495641_0016479 | 3300046461 | Bacteria | 3894 |
| 663 | Ga0495641_0140390 | 3300046461 | Bacteria | 1079 |
| 664 | Ga0495651_0000343 | 3300046462 | Bacteria | 36011 |
| 665 | Ga0495651_0029312 | 3300046462 | Bacteria | 4291 |
| 666 | Ga0495653_0000660 | 3300046463 | Bacteria | 26383 |
| 667 | Ga0495653_0001368 | 3300046463 | Bacteria | 18935 |
| 668 | Ga0495653_0007461 | 3300046463 | Bacteria | 8945 |
| 669 | Ga0495653_0341169 | 3300046463 | Bacteria | 966 |
| 670 | Ga0495580_0561173 | 3300046472 | Bacteria | 757 |
| 671 | Ga0495582_0048478 | 3300046473 | Bacteria | 2339 |
| 672 | Ga0495582_0294863 | 3300046473 | Bacteria | 932 |
| 673 | Ga0495605_0143874 | 3300046474 | Bacteria | 1068 |
| 674 | Ga0495662_0068529 | 3300046476 | Bacteria | 1718 |
| 675 | Ga0495664_0002456 | 3300046477 | Bacteria | 9974 |
| 676 | Ga0495664_0095117 | 3300046477 | Bacteria | 1793 |
| 677 | Ga0495664_0132459 | 3300046477 | Bacteria | 1510 |
| 678 | Ga0495664_0208780 | 3300046477 | Bacteria | 1183 |
| 679 | Ga0495596_0145402 | 3300046500 | Bacteria | 921 |
| 680 | Ga0495608_0035402 | 3300046511 | Bacteria | 3367 |
| 681 | Ga0495608_0083535 | 3300046511 | Bacteria | 2073 |
| 682 | Ga0495608_0229771 | 3300046511 | Bacteria | 1162 |
| 683 | Ga0495618_0157017 | 3300046514 | Bacteria | 1451 |
| 684 | Ga0495628_0182654 | 3300046516 | Bacteria | 1586 |
| 685 | Ga0495630_0000068 | 3300046517 | Bacteria | 82887 |
| 686 | Ga0495630_0012662 | 3300046517 | Bacteria | 6129 |
| 687 | Ga0495630_0021778 | 3300046517 | Bacteria | 4734 |
| 688 | Ga0495630_0217614 | 3300046517 | Bacteria | 1458 |
| 689 | Ga0495630_0780919 | 3300046517 | Bacteria | 729 |
| 690 | Ga0495631_0050761 | 3300046518 | Bacteria | 1814 |
| 691 | Ga0495666_0009191 | 3300046526 | Bacteria | 4943 |
| 692 | Ga0495652_0001806 | 3300046529 | Bacteria | 22778 |
| 693 | Ga0495652_0017563 | 3300046529 | Bacteria | 6383 |
| 694 | Ga0495652_0282252 | 3300046529 | Bacteria | 1215 |
| 695 | Ga0495665_0056122 | 3300046531 | Bacteria | 2079 |
| 696 | Ga0495640_0001702 | 3300046533 | Bacteria | 17428 |
| 697 | Ga0495640_0015158 | 3300046533 | Bacteria | 5806 |
| 698 | Ga0495640_0097486 | 3300046533 | Bacteria | 1933 |
| 699 | Ga0495586_0000424 | 3300046535 | Bacteria | 25680 |
| 700 | Ga0495586_0145547 | 3300046535 | Bacteria | 1331 |
| 701 | Ga0495587_0000910 | 3300046536 | Bacteria | 19549 |
| 702 | Ga0495609_0231489 | 3300046538 | Bacteria | 765 |
| 703 | Ga0495645_0002232 | 3300046543 | Bacteria | 13172 |
| 704 | Ga0495645_0031437 | 3300046543 | Bacteria | 3869 |
| 705 | Ga0495645_0249631 | 3300046543 | Bacteria | 1180 |
| 706 | Ga0495667_0001093 | 3300046559 | Bacteria | 17603 |
| 707 | Ga0495667_0004696 | 3300046559 | Bacteria | 9236 |
| 708 | Ga0495667_0044457 | 3300046559 | Bacteria | 2942 |
| 709 | Ga0495667_0053223 | 3300046559 | Bacteria | 2666 |
| 710 | Ga0495667_0272828 | 3300046559 | Bacteria | 1074 |
| 711 | Ga0495656_0127312 | 3300046615 | Bacteria | 1209 |
| 712 | Ga0495668_0141436 | 3300046616 | Bacteria | 1317 |
| 713 | Ga0495634_0030756 | 3300046642 | Unclassified | 3704 |
| 714 | Ga0495634_0072491 | 3300046642 | Bacteria | 2265 |
| 715 | Ga0495634_0209748 | 3300046642 | Bacteria | 1206 |
| 716 | Ga0495635_0006235 | 3300046663 | Bacteria | 8307 |
| 717 | Ga0495635_0061335 | 3300046663 | Bacteria | 2583 |
| 718 | Ga0495657_0014780 | 3300046675 | Bacteria | 5728 |
| 719 | Ga0495657_0034955 | 3300046675 | Bacteria | 3487 |
| 720 | Ga0495657_0067922 | 3300046675 | Bacteria | 2338 |
| 721 | Ga0495657_0232577 | 3300046675 | Bacteria | 1114 |
| 722 | Ga0495599_0000322 | 3300046678 | Bacteria | 28608 |
| 723 | Ga0495599_0015298 | 3300046678 | Bacteria | 4760 |
| 724 | Ga0495599_0091129 | 3300046678 | Bacteria | 1902 |
| 725 | Ga0495623_0016946 | 3300046679 | Bacteria | 4706 |
| 726 | Ga0495646_0007879 | 3300046680 | Bacteria | 6763 |
| 727 | Ga0495647_0096139 | 3300046681 | Bacteria | 1221 |
| 728 | Ga0495658_0104845 | 3300046683 | Bacteria | 1693 |
| 729 | Ga0495613_0148439 | 3300046689 | Bacteria | 1673 |
| 730 | Ga0495613_0209167 | 3300046689 | Bacteria | 1372 |
| 731 | Ga0495613_0227944 | 3300046689 | Bacteria | 1306 |
| 732 | Ga0495624_0017865 | 3300046690 | Bacteria | 4752 |
| 733 | Ga0495624_0361275 | 3300046690 | Bacteria | 873 |
| 734 | Ga0495670_0272293 | 3300046691 | Bacteria | 905 |
| 735 | Ga0495589_0131922 | 3300046794 | Bacteria | 1199 |
| 736 | Ga0495589_0215258 | 3300046794 | Bacteria | 904 |
| 737 | Ga0495600_0003060 | 3300046809 | Bacteria | 9770 |
| 738 | Ga0495600_0044953 | 3300046809 | Bacteria | 2881 |
| 739 | Ga0495581_0017834 | 3300047315 | Bacteria | 4125 |
| 740 | Ga0495604_0003558 | 3300047317 | Bacteria | 12433 |
| 741 | Ga0495604_0297070 | 3300047317 | Bacteria | 1086 |
| 742 | Ga0495674_0012698 | 3300047319 | Bacteria | 7937 |
| 743 | Ga0495674_0035554 | 3300047319 | Bacteria | 4492 |
| 744 | Ga0495674_0172764 | 3300047319 | Bacteria | 1803 |
| 745 | Ga0495674_0187628 | 3300047319 | Bacteria | 1720 |
| 746 | Ga0495674_0240744 | 3300047319 | Bacteria | 1491 |
| 747 | Ga0495676_0003229 | 3300047321 | Bacteria | 14734 |
| 748 | Ga0495680_0007542 | 3300047322 | Bacteria | 9949 |
| 749 | Ga0495680_0010294 | 3300047322 | Bacteria | 8343 |
| 750 | Ga0495680_0047943 | 3300047322 | Bacteria | 3357 |
| 751 | Ga0495675_0021210 | 3300047444 | Bacteria | 4136 |
| 752 | Ga0495684_0001092 | 3300047471 | Bacteria | 21874 |
| 753 | Ga0495684_0022777 | 3300047471 | Bacteria | 4817 |
| 754 | Ga0495684_0032181 | 3300047471 | Bacteria | 4025 |
| 755 | Ga0495593_0262462 | 3300047673 | Bacteria | 864 |
| 756 | Ga0495602_0049528 | 3300048088 | Bacteria | 3762 |
| 757 | Ga0495602_0155188 | 3300048088 | Bacteria | 1793 |
| 758 | Ga0496100_0041686 | 3300048903 | Bacteria | 2928 |
| 759 | Ga0496100_0059632 | 3300048903 | Bacteria | 2508 |
| 760 | Ga0496100_0063457 | 3300048903 | Bacteria | 2441 |
| 761 | Ga0496100_0080117 | 3300048903 | Bacteria | 2202 |
| 762 | Ga0496100_0893422 | 3300048903 | Bacteria | 698 |
| 763 | Ga0496101_0017483 | 3300048904 | Bacteria | 4865 |
| 764 | Ga0496101_0027637 | 3300048904 | Bacteria | 3954 |
| 765 | Ga0496101_0038850 | 3300048904 | Bacteria | 3382 |
| 766 | Ga0496101_0116070 | 3300048904 | Bacteria | 2020 |
| 767 | Ga0496101_0127698 | 3300048904 | Bacteria | 1928 |
| 768 | Ga0496101_0186635 | 3300048904 | Bacteria | 1599 |
| 769 | Ga0496102_0076065 | 3300048905 | Bacteria | 3087 |
| 770 | Ga0496102_0080572 | 3300048905 | Bacteria | 2999 |
| 771 | Ga0496102_0125444 | 3300048905 | Bacteria | 2399 |
| 772 | Ga0496102_0421004 | 3300048905 | Bacteria | 1255 |
| 773 | Ga0496102_0545626 | 3300048905 | Bacteria | 1082 |
| 774 | Ga0496102_0785338 | 3300048905 | Bacteria | 875 |
| 775 | Ga0496103_0026668 | 3300048906 | Bacteria | 3498 |
| 776 | Ga0496103_0162758 | 3300048906 | Bacteria | 1431 |
| 777 | Ga0496103_0169681 | 3300048906 | Bacteria | 1401 |
| 778 | Ga0496103_0192825 | 3300048906 | Bacteria | 1310 |
| 779 | Ga0496103_0216923 | 3300048906 | Bacteria | 1230 |
| 780 | Ga0496104_0002448 | 3300048907 | Bacteria | 15981 |
| 781 | Ga0496104_0032830 | 3300048907 | Bacteria | 4832 |
| 782 | Ga0496104_0062634 | 3300048907 | Bacteria | 3527 |
| 783 | Ga0496104_0210703 | 3300048907 | Bacteria | 1855 |
| 784 | Ga0496104_0217998 | 3300048907 | Bacteria | 1820 |
| 785 | Ga0496104_0219401 | 3300048907 | Bacteria | 1814 |
| 786 | Ga0496104_0629700 | 3300048907 | Bacteria | 982 |
| 787 | Ga0496104_0677055 | 3300048907 | Bacteria | 940 |
| 788 | Ga0496104_0988260 | 3300048907 | Bacteria | 746 |
| 789 | Ga0496104_1206526 | 3300048907 | Bacteria | 660 |
| 790 | Ga0496105_0024543 | 3300048908 | Bacteria | 4899 |
| 791 | Ga0496105_0068611 | 3300048908 | Bacteria | 2929 |
| 792 | Ga0496105_0108652 | 3300048908 | Bacteria | 2290 |
| 793 | Ga0496105_0439884 | 3300048908 | Bacteria | 1030 |
| 794 | Ga0496105_0514030 | 3300048908 | Bacteria | 939 |
| 795 | Ga0496105_0681904 | 3300048908 | Bacteria | 790 |
| 796 | Ga0496106_0005498 | 3300048909 | Bacteria | 9368 |
| 797 | Ga0496106_0035181 | 3300048909 | Bacteria | 3745 |
| 798 | Ga0496106_0039724 | 3300048909 | Bacteria | 3524 |
| 799 | Ga0496106_0146001 | 3300048909 | Bacteria | 1863 |
| 800 | Ga0496106_0269644 | 3300048909 | Bacteria | 1363 |
| 801 | Ga0496106_0358576 | 3300048909 | Bacteria | 1171 |
| 802 | Ga0496106_0710939 | 3300048909 | Bacteria | 800 |
| 803 | Ga0496107_0014815 | 3300048910 | Bacteria | 5458 |
| 804 | Ga0496107_0016122 | 3300048910 | Bacteria | 5243 |
| 805 | Ga0496107_0035843 | 3300048910 | Bacteria | 3558 |
| 806 | Ga0496107_0194154 | 3300048910 | Bacteria | 1509 |
| 807 | Ga0496107_0289950 | 3300048910 | Bacteria | 1218 |
| 808 | Ga0496108_0001060 | 3300048911 | Bacteria | 21455 |
| 809 | Ga0496108_0007206 | 3300048911 | Bacteria | 9014 |
| 810 | Ga0496108_0019457 | 3300048911 | Bacteria | 5576 |
| 811 | Ga0496108_0020163 | 3300048911 | Bacteria | 5479 |
| 812 | Ga0496108_0264516 | 3300048911 | Bacteria | 1497 |
| 813 | Ga0496108_0286891 | 3300048911 | Bacteria | 1433 |
| 814 | Ga0496108_0682466 | 3300048911 | Bacteria | 891 |
| 815 | Ga0496108_0687773 | 3300048911 | Bacteria | 888 |
| 816 | Ga0496109_0018823 | 3300048912 | Bacteria | 6075 |
| 817 | Ga0496109_0048979 | 3300048912 | Bacteria | 3845 |
| 818 | Ga0496109_0052245 | 3300048912 | Bacteria | 3724 |
| 819 | Ga0496109_0080760 | 3300048912 | Bacteria | 2996 |
| 820 | Ga0496109_0103630 | 3300048912 | Bacteria | 2641 |
| 821 | Ga0496109_0111883 | 3300048912 | Bacteria | 2539 |
| 822 | Ga0496109_0154180 | 3300048912 | Bacteria | 2151 |
| 823 | Ga0496109_0182500 | 3300048912 | Bacteria | 1971 |
| 824 | Ga0496109_0195902 | 3300048912 | Bacteria | 1899 |
| 825 | Ga0496109_0208888 | 3300048912 | Bacteria | 1836 |
| 826 | Ga0496109_0210320 | 3300048912 | Bacteria | 1829 |
| 827 | Ga0496109_0326049 | 3300048912 | Bacteria | 1449 |
| 828 | Ga0496109_0450058 | 3300048912 | Bacteria | 1216 |
| 829 | Ga0496109_0456984 | 3300048912 | Bacteria | 1206 |
| 830 | Ga0496109_0556368 | 3300048912 | Bacteria | 1082 |
| 831 | Ga0496109_0640772 | 3300048912 | Bacteria | 999 |
| 832 | Ga0496109_0990666 | 3300048912 | Bacteria | 778 |
| 833 | Ga0496110_0068322 | 3300048913 | Bacteria | 3145 |
| 834 | Ga0496110_0079875 | 3300048913 | Bacteria | 2913 |
| 835 | Ga0496110_0130740 | 3300048913 | Bacteria | 2267 |
| 836 | Ga0496110_0186664 | 3300048913 | Bacteria | 1883 |
| 837 | Ga0496110_0215065 | 3300048913 | Bacteria | 1748 |
| 838 | Ga0496110_0744282 | 3300048913 | Bacteria | 883 |
| 839 | Ga0496111_0063357 | 3300048914 | Bacteria | 2681 |
| 840 | Ga0496111_0325329 | 3300048914 | Bacteria | 1138 |
| 841 | Ga0496111_0658351 | 3300048914 | Bacteria | 764 |
| 842 | Ga0496112_0003576 | 3300048915 | Bacteria | 12917 |
| 843 | Ga0496112_0009272 | 3300048915 | Bacteria | 8849 |
| 844 | Ga0496112_0058888 | 3300048915 | Bacteria | 3784 |
| 845 | Ga0496112_0159954 | 3300048915 | Bacteria | 2219 |
| 846 | Ga0496112_0288621 | 3300048915 | Bacteria | 1587 |
| 847 | Ga0496112_0411940 | 3300048915 | Bacteria | 1291 |
| 848 | Ga0496112_0611899 | 3300048915 | Bacteria | 1021 |
| 849 | Ga0496112_0622222 | 3300048915 | Bacteria | 1011 |
| 850 | Ga0496112_0937325 | 3300048915 | Bacteria | 787 |
| 851 | Ga0496113_0004264 | 3300048916 | Bacteria | 8760 |
| 852 | Ga0496113_0056538 | 3300048916 | Bacteria | 2946 |
| 853 | Ga0496113_0127393 | 3300048916 | Bacteria | 1995 |
| 854 | Ga0496113_0158349 | 3300048916 | Bacteria | 1789 |
| 855 | Ga0496113_0162212 | 3300048916 | Bacteria | 1767 |
| 856 | Ga0496113_0450043 | 3300048916 | Bacteria | 1035 |
| 857 | Ga0496114_0045290 | 3300048917 | Bacteria | 3654 |
| 858 | Ga0496114_0134296 | 3300048917 | Bacteria | 2139 |
| 859 | Ga0496114_0478269 | 3300048917 | Bacteria | 1102 |
| 860 | Ga0496115_0006516 | 3300048918 | Bacteria | 8559 |
| 861 | Ga0496115_0062587 | 3300048918 | Bacteria | 3002 |
| 862 | Ga0496115_0086716 | 3300048918 | Bacteria | 2554 |
| 863 | Ga0496115_0193330 | 3300048918 | Bacteria | 1681 |
| 864 | Ga0496115_0252182 | 3300048918 | Bacteria | 1453 |
| 865 | Ga0501031_0000063 | 3300049568 | Bacteria | 57266 |
| 866 | Ga0501031_0293090 | 3300049568 | Bacteria | 1055 |
| 867 | Ga0501031_0571606 | 3300049568 | Bacteria | 728 |
| 868 | Ga0501032_0003604 | 3300049569 | Bacteria | 11794 |
| 869 | Ga0501033_0000871 | 3300049570 | Bacteria | 27583 |
| 870 | Ga0501034_0408569 | 3300049571 | Bacteria | 1280 |
| 871 | Ga0501036_0002119 | 3300049572 | Bacteria | 15495 |
| 872 | Ga0501036_0029451 | 3300049572 | Bacteria | 4637 |
| 873 | Ga0501036_0264016 | 3300049572 | Bacteria | 1442 |
| 874 | Ga0501036_0491844 | 3300049572 | Bacteria | 1021 |
| 875 | Ga0501037_0008933 | 3300049573 | Bacteria | 7342 |
| 876 | Ga0501038_0004494 | 3300049574 | Bacteria | 12972 |
| 877 | Ga0501039_0000075 | 3300049575 | Bacteria | 74491 |
| 878 | Ga0501039_0056778 | 3300049575 | Bacteria | 3033 |
| 879 | Ga0501040_0013292 | 3300049576 | Bacteria | 5414 |
| 880 | Ga0501040_0026672 | 3300049576 | Bacteria | 3887 |
| 881 | Ga0501040_0109887 | 3300049576 | Bacteria | 1928 |
| 882 | Ga0501041_0291684 | 3300049577 | Bacteria | 1027 |
| 883 | Ga0501042_0084119 | 3300049578 | Bacteria | 2281 |
| 884 | Ga0501043_0004209 | 3300049579 | Bacteria | 11746 |
| 885 | Ga0501046_0001429 | 3300049580 | Bacteria | 22955 |
| 886 | Ga0501047_0016589 | 3300049581 | Bacteria | 7031 |
| 887 | Ga0501047_0237817 | 3300049581 | Bacteria | 1673 |
| 888 | Ga0501048_0001098 | 3300049582 | Bacteria | 20306 |
| 889 | Ga0501067_0009560 | 3300049583 | Bacteria | 5372 |
| 890 | Ga0501067_0123535 | 3300049583 | Bacteria | 1441 |
| 891 | Ga0501068_0175824 | 3300049584 | Bacteria | 1352 |
| 892 | Ga0501068_0179548 | 3300049584 | Bacteria | 1338 |
| 893 | Ga0501068_0267041 | 3300049584 | Bacteria | 1092 |
| 894 | Ga0501069_0005707 | 3300049585 | Bacteria | 6484 |
| 895 | Ga0501069_0040125 | 3300049585 | Bacteria | 2587 |
| 896 | Ga0501069_0313880 | 3300049585 | Bacteria | 920 |
| 897 | Ga0501070_0001223 | 3300049586 | Bacteria | 22991 |
| 898 | Ga0501071_0201962 | 3300049587 | Bacteria | 1493 |
| 899 | Ga0501071_0491798 | 3300049587 | Bacteria | 941 |
| 900 | Ga0501072_0023198 | 3300049588 | Bacteria | 4819 |
| 901 | Ga0501072_0027608 | 3300049588 | Bacteria | 4428 |
| 902 | Ga0501072_0042615 | 3300049588 | Bacteria | 3565 |
| 903 | Ga0501072_0179081 | 3300049588 | Bacteria | 1691 |
| 904 | Ga0501073_0004877 | 3300049589 | Bacteria | 10071 |
| 905 | Ga0501074_0000308 | 3300049590 | Bacteria | 28286 |
| 906 | Ga0501074_0510393 | 3300049590 | Bacteria | 852 |
| 907 | Ga0501074_0592922 | 3300049590 | Bacteria | 784 |
| 908 | Ga0501075_0011725 | 3300049591 | Bacteria | 6212 |
| 909 | Ga0501075_0094604 | 3300049591 | Bacteria | 2268 |
| 910 | Ga0501075_0434711 | 3300049591 | Bacteria | 1001 |
| 911 | Ga0501075_0476636 | 3300049591 | Bacteria | 952 |
| 912 | Ga0501076_0054865 | 3300049592 | Bacteria | 3159 |
| 913 | Ga0501076_0112492 | 3300049592 | Bacteria | 2202 |
| 914 | Ga0501076_0123882 | 3300049592 | Bacteria | 2093 |
| 915 | Ga0501076_0278338 | 3300049592 | Bacteria | 1371 |
| 916 | Ga0501076_0307952 | 3300049592 | Bacteria | 1299 |
| 917 | Ga0501077_0010472 | 3300049593 | Bacteria | 5771 |
| 918 | Ga0501233_189021 | 3300049668 | Unclassified | 594 |
| 919 | Ga0501079_0077786 | 3300049741 | Bacteria | 2566 |
| 920 | Ga0501079_0113193 | 3300049741 | Bacteria | 2109 |
| 921 | Ga0501079_0173001 | 3300049741 | Bacteria | 1684 |
| 922 | Ga0501079_0266889 | 3300049741 | Bacteria | 1338 |
| 923 | Ga0501080_0000212 | 3300049742 | Bacteria | 43139 |
| 924 | Ga0501083_0136930 | 3300049744 | Bacteria | 1604 |
| 925 | Ga0501083_0360945 | 3300049744 | Bacteria | 945 |
| 926 | Ga0501035_0009419 | 3300049822 | Bacteria | 9080 |
| 927 | Ga0501044_0018094 | 3300049823 | Bacteria | 7556 |
| 928 | Ga0501045_0022231 | 3300049824 | Bacteria | 4539 |
| 929 | Ga0501045_0024470 | 3300049824 | Bacteria | 4336 |
| 930 | Ga0501045_0240115 | 3300049824 | Bacteria | 1349 |
| 931 | Ga0501045_0288724 | 3300049824 | Bacteria | 1221 |
| 932 | Ga0501045_0298973 | 3300049824 | Bacteria | 1198 |
| 933 | nmdc:mga03683_88519_c1 | 3300050489 | Bacteria | 1347 |
| 934 | nmdc:mga00v17_12882_c1 | 3300050491 | Bacteria | 4627 |
| 935 | nmdc:mga00v17_471648_c1 | 3300050491 | Bacteria | 814 |
| 936 | nmdc:mga0yw44_19049_c1 | 3300050492 | Bacteria | 3776 |
| 937 | nmdc:mga0yw44_3539_c1 | 3300050492 | Bacteria | 6960 |
| 938 | nmdc:mga06z11_126523_c1 | 3300050494 | Bacteria | 1430 |
| 939 | nmdc:mga05p37_101832_c1 | 3300050507 | Bacteria | 3537 |
| 940 | nmdc:mga05p37_114437_c1 | 3300050507 | Bacteria | 3316 |
| 941 | nmdc:mga05p37_156393_c1 | 3300050507 | Bacteria | 2786 |
| 942 | nmdc:mga05p37_864712_c1 | 3300050507 | Bacteria | 980 |
| 943 | nmdc:mga05p37_9080_c1 | 3300050507 | Bacteria | 11748 |
| 944 | nmdc:mga09592_45988_c1 | 3300050508 | Bacteria | 3677 |
| 945 | nmdc:mga0qj67_7035_c1 | 3300050509 | Bacteria | 8294 |
| 946 | nmdc:mga08y16_18764_c1 | 3300050511 | Bacteria | 7287 |
| 947 | nmdc:mga08y16_206790_c1 | 3300050511 | Bacteria | 2033 |
| 948 | nmdc:mga08y16_4867_c1 | 3300050511 | Bacteria | 14021 |
| 949 | nmdc:mga0n895_1097876_c1 | 3300050512 | Bacteria | 773 |
| 950 | nmdc:mga0n895_202053_c1 | 3300050512 | Bacteria | 2018 |
| 951 | nmdc:mga0n895_202703_c1 | 3300050512 | Bacteria | 2014 |
| 952 | nmdc:mga0n895_327641_c1 | 3300050512 | Bacteria | 1552 |
| 953 | nmdc:mga0n895_924163_c1 | 3300050512 | Bacteria | 857 |
| 954 | nmdc:mga0rr50_194419_c1 | 3300050513 | Bacteria | 1664 |
| 955 | nmdc:mga0rr50_417963_c1 | 3300050513 | Bacteria | 1134 |
| 956 | nmdc:mga0rr50_463513_c1 | 3300050513 | Bacteria | 1075 |
| 957 | nmdc:mga0rr50_782695_c1 | 3300050513 | Bacteria | 814 |
| 958 | nmdc:mga08x19_70293_c1 | 3300050514 | Bacteria | 2281 |
| 959 | nmdc:mga0a205_927073_c1 | 3300050515 | Bacteria | 718 |
| 960 | Ga0495601_0011985 | 3300053077 | Bacteria | 5194 |
| 961 | Ga0495601_0147656 | 3300053077 | Bacteria | 1535 |
| 962 | Ga0495601_0243940 | 3300053077 | Bacteria | 1173 |
| 963 | Ga0495612_0081359 | 3300053078 | Bacteria | 1361 |
| 964 | Ga0495612_0129170 | 3300053078 | Bacteria | 1091 |
| 965 | Ga0495619_0080609 | 3300053085 | Bacteria | 2191 |
| 966 | Ga0495619_0140698 | 3300053085 | Bacteria | 1661 |
| 967 | Ga0500660_083868 | 3300053100 | Bacteria | 1449 |
| 968 | Ga0501084_0002422 | 3300054114 | Bacteria | 15014 |
| 969 | Ga0501084_0068348 | 3300054114 | Bacteria | 2974 |
| 970 | Ga0501084_0104327 | 3300054114 | Bacteria | 2381 |
| 971 | Ga0501084_0156861 | 3300054114 | Bacteria | 1920 |
| 972 | Ga0501084_0167692 | 3300054114 | Bacteria | 1853 |
| 973 | Ga0466962_0092214 | 3300061719 | Bacteria | 1452 |
| 974 | Ga0466962_0125328 | 3300061719 | Bacteria | 1240 |
| 975 | Ga0466962_0187106 | 3300061719 | Bacteria | 1010 |
| 976 | Ga0530510_0043590 | 3300061734 | Bacteria | 3241 |
| 977 | Ga0530510_0262821 | 3300061734 | Bacteria | 1287 |
| 978 | Ga0530510_0320375 | 3300061734 | Bacteria | 1162 |
| 979 | Ga0530510_0608927 | 3300061734 | Bacteria | 831 |
| 980 | 2891554891 | 2891554331 | Bacteria | 8812224 |
| 981 | 2895431004 | 2895427314 | Bacteria | 13147766 |
| 982 | Ga0316579_10000738 | |||
| 983 | JGI24743J22301_10002892 | |||
| 984 | JGI25407J50210_10000692 | |||
| 985 | JGI25407J50210_10014402 | |||
| 986 | JGI25407J50210_10025306 | |||
| 987 | Ga0058863_11604478 | |||
| 988 | Ga0070658_10004524 | |||
| 989 | Ga0070658_10309951 | |||
| 990 | Ga0070683_100001072 | |||
| 991 | Ga0070683_100022724 | |||
| 992 | Ga0070683_100027093 | |||
| 993 | Ga0070683_100108694 | |||
| 994 | Ga0070683_100285013 | |||
| 995 | Ga0070683_100346078 | |||
| 996 | Ga0070683_101002896 | |||
| 997 | Ga0070670_100000651 | |||
| 998 | Ga0068869_100512161 | |||
| 999 | Ga0070680_100004355 | |||
| 1000 | Ga0070680_100055736 | |||
| 1001 | Ga0070680_100083473 | |||
| 1002 | Ga0070680_100159047 | |||
| 1003 | Ga0070682_100003614 | |||
| 1004 | Ga0070682_100096396 | |||
| 1005 | Ga0070682_100234580 | |||
| 1006 | Ga0070682_100300854 | |||
| 1007 | Ga0070682_100733754 | |||
| 1008 | Ga0068868_100028978 | |||
| 1009 | Ga0068868_100038286 | |||
| 1010 | Ga0068868_100076841 | |||
| 1011 | Ga0070660_100013711 | |||
| 1012 | Ga0070660_100022332 | |||
| 1013 | Ga0070691_10010107 | |||
| 1014 | Ga0070661_100001663 | |||
| 1015 | Ga0070661_100212167 | |||
| 1016 | Ga0070661_100212400 | |||
| 1017 | Ga0070668_100650319 | |||
| 1018 | Ga0070669_100717812 | |||
| 1019 | Ga0070675_100018947 | |||
| 1020 | Ga0070671_100247017 | |||
| 1021 | Ga0070674_100096841 | |||
| 1022 | Ga0070673_100014741 | |||
| 1023 | Ga0070688_100210139 | |||
| 1024 | Ga0070659_100012504 | |||
| 1025 | Ga0070659_100099209 | |||
| 1026 | Ga0070667_101108954 | |||
| 1027 | Ga0070703_10091429 | |||
| 1028 | Ga0070703_10107038 | |||
| 1029 | Ga0070709_10033603 | |||
| 1030 | Ga0070709_10130585 | |||
| 1031 | Ga0070709_10146305 | |||
| 1032 | Ga0070714_100003431 | |||
| 1033 | Ga0070714_100012472 | |||
| 1034 | Ga0070714_100013021 | |||
| 1035 | Ga0070714_100022982 | |||
| 1036 | Ga0070714_100023663 | |||
| 1037 | Ga0070714_100072935 | |||
| 1038 | Ga0070714_100093558 | |||
| 1039 | Ga0070714_100098834 | |||
| 1040 | Ga0070714_100249923 | |||
| 1041 | Ga0070714_100407043 | |||
| 1042 | Ga0070714_101099593 | |||
| 1043 | Ga0070713_100009826 | |||
| 1044 | Ga0070713_100028317 | |||
| 1045 | Ga0070713_100069396 | |||
| 1046 | Ga0070713_100130978 | |||
| 1047 | Ga0070713_100152537 | |||
| 1048 | Ga0070713_100382475 | |||
| 1049 | Ga0070713_100462941 | |||
| 1050 | Ga0070713_100472698 | |||
| 1051 | Ga0070713_100687147 | |||
| 1052 | Ga0070713_100801909 | |||
| 1053 | Ga0070710_10002596 | |||
| 1054 | Ga0070710_10034679 | |||
| 1055 | Ga0070710_10121563 | |||
| 1056 | Ga0070710_10192027 | |||
| 1057 | Ga0070710_10296298 | |||
| 1058 | Ga0070710_10381367 | |||
| 1059 | Ga0070711_100097164 | |||
| 1060 | Ga0070711_100099236 | |||
| 1061 | Ga0070711_100508293 | |||
| 1062 | Ga0070705_100879240 | |||
| 1063 | Ga0070700_100668785 | |||
| 1064 | Ga0070694_100608614 | |||
| 1065 | Ga0070708_100007755 | |||
| 1066 | Ga0070708_100027221 | |||
| 1067 | Ga0070708_100219305 | |||
| 1068 | Ga0070663_100189549 | |||
| 1069 | Ga0070663_100672338 | |||
| 1070 | Ga0070678_100608973 | |||
| 1071 | Ga0070662_100013266 | |||
| 1072 | Ga0070681_10008799 | |||
| 1073 | Ga0070681_10009501 | |||
| 1074 | Ga0070681_10036757 | |||
| 1075 | Ga0070681_10047068 | |||
| 1076 | Ga0070681_10296276 | |||
| 1077 | Ga0070685_10019843 | |||
| 1078 | Ga0070706_100001406 | |||
| 1079 | Ga0070706_100001959 | |||
| 1080 | Ga0070706_100013388 | |||
| 1081 | Ga0070706_100024862 | |||
| 1082 | Ga0070706_100124531 | |||
| 1083 | Ga0070707_100074594 | |||
| 1084 | Ga0070707_100102594 | |||
| 1085 | Ga0070707_100108578 | |||
| 1086 | Ga0070707_100209095 | |||
| 1087 | Ga0070707_100700376 | |||
| 1088 | Ga0070698_100013778 | |||
| 1089 | Ga0070698_100063993 | |||
| 1090 | Ga0070698_100295048 | |||
| 1091 | Ga0070698_100330357 | |||
| 1092 | Ga0070699_100676770 | |||
| 1093 | Ga0070679_100014336 | |||
| 1094 | Ga0070679_100060986 | |||
| 1095 | Ga0070679_100236953 | |||
| 1096 | Ga0070679_100310939 | |||
| 1097 | Ga0070679_100373131 | |||
| 1098 | Ga0070679_100596428 | |||
| 1099 | Ga0070684_100113676 | |||
| 1100 | Ga0070684_100122950 | |||
| 1101 | Ga0070684_100190841 | |||
| 1102 | Ga0070684_100317147 | |||
| 1103 | Ga0070697_100248531 | |||
| 1104 | Ga0068853_100309700 | |||
| 1105 | Ga0068853_100524797 | |||
| 1106 | Ga0070686_100023518 | |||
| 1107 | Ga0070686_100036151 | |||
| 1108 | Ga0070695_100167463 | |||
| 1109 | Ga0070665_100668716 | |||
| 1110 | Ga0070665_100879363 | |||
| 1111 | Ga0070704_100738507 | |||
| 1112 | Ga0068855_100061255 | |||
| 1113 | Ga0068855_100150783 | |||
| 1114 | Ga0068855_100201091 | |||
| 1115 | Ga0068855_100246737 | |||
| 1116 | Ga0068855_100627923 | |||
| 1117 | Ga0070664_100059613 | |||
| 1118 | Ga0068857_100410793 | |||
| 1119 | Ga0068857_101216401 | |||
| 1120 | Ga0068854_100006171 | |||
| 1121 | Ga0068854_100194497 | |||
| 1122 | Ga0068854_100400417 | |||
| 1123 | Ga0068856_100127598 | |||
| 1124 | Ga0068856_100159420 | |||
| 1125 | Ga0068856_100222549 | |||
| 1126 | Ga0070702_100029003 | |||
| 1127 | Ga0068852_100009988 | |||
| 1128 | Ga0068852_100149768 | |||
| 1129 | Ga0068852_100400784 | |||
| 1130 | Ga0068852_100592031 | |||
| 1131 | Ga0068866_10250549 | |||
| 1132 | Ga0068861_100212639 | |||
| 1133 | Ga0068870_10006900 | |||
| 1134 | Ga0068863_100434753 | |||
| 1135 | Ga0068858_100045462 | |||
| 1136 | Ga0068860_100883308 | |||
| 1137 | Ga0081455_10002591 | |||
| 1138 | Ga0081455_10011260 | |||
| 1139 | Ga0081455_10028974 | |||
| 1140 | Ga0081455_10031658 | |||
| 1141 | Ga0081455_10060858 | |||
| 1142 | Ga0081455_10205651 | |||
| 1143 | Ga0081538_10000063 | |||
| 1144 | Ga0081538_10001198 | |||
| 1145 | Ga0081538_10002074 | |||
| 1146 | Ga0081538_10002606 | |||
| 1147 | Ga0081538_10004853 | |||
| 1148 | Ga0081538_10004890 | |||
| 1149 | Ga0081538_10006605 | |||
| 1150 | Ga0081538_10009141 | |||
| 1151 | Ga0081538_10074257 | |||
| 1152 | Ga0081538_10101851 | |||
| 1153 | Ga0081538_10154764 | |||
| 1154 | Ga0081538_10158237 | |||
| 1155 | Ga0081538_10164263 | |||
| 1156 | Ga0081540_1001536 | |||
| 1157 | Ga0081539_10020696 | |||
| 1158 | Ga0081539_10028730 | |||
| 1159 | Ga0081539_10067162 | |||
| 1160 | Ga0081539_10076577 | |||
| 1161 | Ga0070717_10003113 | |||
| 1162 | Ga0070717_10005654 | |||
| 1163 | Ga0070717_10016240 | |||
| 1164 | Ga0070717_10018875 | |||
| 1165 | Ga0070717_10022410 | |||
| 1166 | Ga0070717_10048957 | |||
| 1167 | Ga0070717_10062424 | |||
| 1168 | Ga0070717_10121965 | |||
| 1169 | Ga0070717_10245113 | |||
| 1170 | Ga0070717_10271676 | |||
| 1171 | Ga0070717_10368491 | |||
| 1172 | Ga0070717_10511922 | |||
| 1173 | Ga0075365_10009199 | |||
| 1174 | Ga0075364_10048459 | |||
| 1175 | Ga0070715_10015404 | |||
| 1176 | Ga0070716_100014385 | |||
| 1177 | Ga0070716_100175440 | |||
| 1178 | Ga0070712_100032228 | |||
| 1179 | Ga0070712_100045302 | |||
| 1180 | Ga0070712_100093786 | |||
| 1181 | Ga0070712_100122238 | |||
| 1182 | Ga0070712_100139446 | |||
| 1183 | Ga0070712_100280851 | |||
| 1184 | Ga0070712_100322703 | |||
| 1185 | Ga0070712_100364235 | |||
| 1186 | Ga0070712_100390397 | |||
| 1187 | Ga0070712_100466821 | |||
| 1188 | Ga0070712_100594984 | |||
| 1189 | Ga0070712_100646122 | |||
| 1190 | Ga0075362_10005721 | |||
| 1191 | Ga0075427_10006907 | |||
| 1192 | Ga0097621_100152985 | |||
| 1193 | Ga0097621_100197309 | |||
| 1194 | Ga0097621_100829905 | |||
| 1195 | Ga0068871_100069520 | |||
| 1196 | Ga0075428_100163716 | |||
| 1197 | Ga0075428_100777962 | |||
| 1198 | Ga0075428_100908493 | |||
| 1199 | Ga0075430_100008389 | |||
| 1200 | Ga0075431_100226209 | |||
| 1201 | Ga0075431_100227095 | |||
| 1202 | Ga0075431_100236483 | |||
| 1203 | Ga0075434_100013809 | |||
| 1204 | Ga0075434_100127523 | |||
| 1205 | Ga0075434_100171301 | |||
| 1206 | Ga0075434_100838183 | |||
| 1207 | Ga0075429_100044747 | |||
| 1208 | Ga0075429_100096284 | |||
| 1209 | Ga0068865_100074004 | |||
| 1210 | Ga0068865_100234693 | |||
| 1211 | Ga0068865_100278430 | |||
| 1212 | Ga0075436_100711676 | |||
| 1213 | Ga0075435_100010431 | |||
| 1214 | Ga0075435_100423139 | |||
| 1215 | Ga0075435_100691037 | |||
| 1216 | Ga0105240_10034380 | |||
| 1217 | Ga0105240_10126692 | |||
| 1218 | Ga0111539_10000875 | |||
| 1219 | Ga0111539_10186914 | |||
| 1220 | Ga0111539_10324042 | |||
| 1221 | Ga0111539_10358324 | |||
| 1222 | Ga0105245_10034516 | |||
| 1223 | Ga0105245_10309280 | |||
| 1224 | Ga0105245_10510580 | |||
| 1225 | Ga0105245_10572732 | |||
| 1226 | Ga0105245_10876756 | |||
| 1227 | Ga0105247_10073575 | |||
| 1228 | Ga0114129_10004181 | |||
| 1229 | Ga0114129_10053451 | |||
| 1230 | Ga0114129_10139709 | |||
| 1231 | Ga0114129_10169736 | |||
| 1232 | Ga0114129_10239014 | |||
| 1233 | Ga0105243_10010885 | |||
| 1234 | Ga0105243_10336373 | |||
| 1235 | Ga0105243_10773313 | |||
| 1236 | Ga0105242_10036676 | |||
| 1237 | Ga0105242_10558023 | |||
| 1238 | Ga0105242_10685975 | |||
| 1239 | Ga0105242_11072800 | |||
| 1240 | Ga0105248_10350693 | |||
| 1241 | Ga0105237_10029633 | |||
| 1242 | Ga0105237_10457409 | |||
| 1243 | Ga0105238_10041276 | |||
| 1244 | Ga0105238_10235365 | |||
| 1245 | Ga0105238_10272508 | |||
| 1246 | Ga0105238_10317030 | |||
| 1247 | Ga0105238_10647727 | |||
| 1248 | Ga0105239_10042156 | |||
| 1249 | Ga0105239_10193155 | |||
| 1250 | Ga0105239_10351589 | |||
| 1251 | Ga0105239_10973815 | |||
| 1252 | Ga0105246_10186142 | |||
| 1253 | Ga0157340_1011268 | |||
| 1254 | Ga0157339_1009323 | |||
| 1255 | Ga0157338_1002793 | |||
| 1256 | Ga0157371_10020393 | |||
| 1257 | Ga0157371_10105538 | |||
| 1258 | Ga0157371_10648044 | |||
| 1259 | Ga0157370_10030220 | |||
| 1260 | Ga0157370_10141222 | |||
| 1261 | Ga0157370_10204311 | |||
| 1262 | Ga0157370_10427703 | |||
| 1263 | Ga0157369_10011850 | |||
| 1264 | Ga0157369_10042363 | |||
| 1265 | Ga0157369_10105314 | |||
| 1266 | Ga0157374_10127115 | |||
| 1267 | Ga0157374_10145230 | |||
| 1268 | Ga0163162_10189610 | |||
| 1269 | Ga0157372_10006405 | |||
| 1270 | Ga0157372_10056942 | |||
| 1271 | Ga0157372_10554386 | |||
| 1272 | Ga0157372_10598967 | |||
| 1273 | Ga0157372_10683935 | |||
| 1274 | Ga0157372_10737980 | |||
| 1275 | Ga0157375_10300813 | |||
| 1276 | Ga0157375_10329666 | |||
| 1277 | Ga0157380_10682993 | |||
| 1278 | Ga0157380_10715459 | |||
| 1279 | Ga0182008_10001160 | |||
| 1280 | Ga0157377_10020642 | |||
| 1281 | Ga0157377_10078377 | |||
| 1282 | Ga0157377_10271874 | |||
| 1283 | Ga0157377_10622780 | |||
| 1284 | Ga0157379_10149724 | |||
| 1285 | Ga0157379_10276392 | |||
| 1286 | Ga0157379_10429041 | |||
| 1287 | Ga0157376_10017065 | |||
| 1288 | Ga0157376_10308742 | |||
| 1289 | Ga0206356_11795030 | |||
| 1290 | Ga0206354_10312155 | |||
| 1291 | Ga0206353_10251350 | |||
| 1292 | Ga0213874_10065631 | |||
| 1293 | Ga0213876_10011794 | |||
| 1294 | Ga0213876_10103288 | |||
| 1295 | Ga0213875_10031653 | |||
| 1296 | Ga0224712_10151072 | |||
| 1297 | Ga0224572_1002517 | |||
| 1298 | Ga0207692_10016955 | |||
| 1299 | Ga0207692_10037041 | |||
| 1300 | Ga0207642_10189393 | |||
| 1301 | Ga0207710_10060736 | |||
| 1302 | Ga0207710_10126449 | |||
| 1303 | Ga0207688_10015385 | |||
| 1304 | Ga0207688_10154157 | |||
| 1305 | Ga0207685_10011131 | |||
| 1306 | Ga0207685_10011459 | |||
| 1307 | Ga0207699_10092973 | |||
| 1308 | Ga0207699_10220468 | |||
| 1309 | Ga0207643_10007140 | |||
| 1310 | Ga0207643_10009105 | |||
| 1311 | Ga0207705_10156396 | |||
| 1312 | Ga0207684_10004905 | |||
| 1313 | Ga0207684_10025177 | |||
| 1314 | Ga0207684_10058735 | |||
| 1315 | Ga0207684_10126969 | |||
| 1316 | Ga0207654_10111649 | |||
| 1317 | Ga0207654_10300926 | |||
| 1318 | Ga0207707_10014798 | |||
| 1319 | Ga0207707_10271591 | |||
| 1320 | Ga0207707_10395945 | |||
| 1321 | Ga0207707_10435238 | |||
| 1322 | Ga0207695_10024882 | |||
| 1323 | Ga0207695_10648554 | |||
| 1324 | Ga0207671_10155125 | |||
| 1325 | Ga0207693_10061471 | |||
| 1326 | Ga0207693_10326144 | |||
| 1327 | Ga0207693_10534866 | |||
| 1328 | Ga0207663_10017491 | |||
| 1329 | Ga0207663_10201984 | |||
| 1330 | Ga0207663_10248784 | |||
| 1331 | Ga0207660_10070428 | |||
| 1332 | Ga0207660_10167477 | |||
| 1333 | Ga0207660_10179822 | |||
| 1334 | Ga0207660_10184771 | |||
| 1335 | Ga0207660_10251654 | |||
| 1336 | Ga0207662_10102698 | |||
| 1337 | Ga0207657_10014748 | |||
| 1338 | Ga0207657_10033988 | |||
| 1339 | Ga0207657_10494150 | |||
| 1340 | Ga0207649_10101978 | |||
| 1341 | Ga0207649_10206450 | |||
| 1342 | Ga0207652_10135241 | |||
| 1343 | Ga0207652_10474144 | |||
| 1344 | Ga0207652_10534564 | |||
| 1345 | Ga0207652_10965432 | |||
| 1346 | Ga0207646_10190041 | |||
| 1347 | Ga0207646_10248008 | |||
| 1348 | Ga0207694_10040285 | |||
| 1349 | Ga0207694_10393126 | |||
| 1350 | Ga0207650_10005497 | |||
| 1351 | Ga0207659_10139413 | |||
| 1352 | Ga0207659_10260783 | |||
| 1353 | Ga0207687_10030778 | |||
| 1354 | Ga0207687_10095592 | |||
| 1355 | Ga0207687_10132320 | |||
| 1356 | Ga0207687_10696348 | |||
| 1357 | Ga0207700_10053854 | |||
| 1358 | Ga0207700_10088976 | |||
| 1359 | Ga0207700_10096013 | |||
| 1360 | Ga0207700_10096744 | |||
| 1361 | Ga0207700_10283946 | |||
| 1362 | Ga0207700_10321358 | |||
| 1363 | Ga0207664_10012616 | |||
| 1364 | Ga0207664_10015287 | |||
| 1365 | Ga0207664_10019040 | |||
| 1366 | Ga0207664_10020106 | |||
| 1367 | Ga0207664_10040672 | |||
| 1368 | Ga0207664_10108970 | |||
| 1369 | Ga0207664_10216709 | |||
| 1370 | Ga0207664_10291111 | |||
| 1371 | Ga0207664_10454055 | |||
| 1372 | Ga0207690_10021019 | |||
| 1373 | Ga0207706_10001708 | |||
| 1374 | Ga0207686_10284109 | |||
| 1375 | Ga0207709_10158391 | |||
| 1376 | Ga0207709_10270368 | |||
| 1377 | Ga0207709_10321604 | |||
| 1378 | Ga0207669_10024084 | |||
| 1379 | Ga0207704_10010480 | |||
| 1380 | Ga0207704_10113212 | |||
| 1381 | Ga0207665_10201861 | |||
| 1382 | Ga0207711_10427649 | |||
| 1383 | Ga0207689_10008051 | |||
| 1384 | Ga0207689_10045248 | |||
| 1385 | Ga0207661_10057950 | |||
| 1386 | Ga0207661_10083978 | |||
| 1387 | Ga0207661_10101387 | |||
| 1388 | Ga0207661_10173120 | |||
| 1389 | Ga0207661_10344392 | |||
| 1390 | Ga0207661_10958996 | |||
| 1391 | Ga0207679_10149123 | |||
| 1392 | Ga0207667_10046064 | |||
| 1393 | Ga0207651_10021119 | |||
| 1394 | Ga0207640_10015284 | |||
| 1395 | Ga0207640_10050866 | |||
| 1396 | Ga0207640_10105216 | |||
| 1397 | Ga0207640_10136062 | |||
| 1398 | Ga0207640_10945265 | |||
| 1399 | Ga0207677_10060971 | |||
| 1400 | Ga0207677_10242627 | |||
| 1401 | Ga0207703_10108140 | |||
| 1402 | Ga0207703_10404338 | |||
| 1403 | Ga0207703_10901518 | |||
| 1404 | Ga0207639_10017717 | |||
| 1405 | Ga0207639_10103927 | |||
| 1406 | Ga0207639_10504220 | |||
| 1407 | Ga0207639_10803645 | |||
| 1408 | Ga0207708_10738336 | |||
| 1409 | Ga0207702_10019420 | |||
| 1410 | Ga0207702_10100171 | |||
| 1411 | Ga0207702_10121343 | |||
| 1412 | Ga0207702_10136692 | |||
| 1413 | Ga0207702_10152371 | |||
| 1414 | Ga0207702_10225602 | |||
| 1415 | Ga0207702_10658471 | |||
| 1416 | Ga0207641_10057603 | |||
| 1417 | Ga0207641_10131369 | |||
| 1418 | Ga0207648_10247535 | |||
| 1419 | Ga0207676_10400419 | |||
| 1420 | Ga0207676_10889832 | |||
| 1421 | Ga0207674_10043768 | |||
| 1422 | Ga0207674_10068041 | |||
| 1423 | Ga0207674_10078878 | |||
| 1424 | Ga0207674_10242877 | |||
| 1425 | Ga0207675_100764814 | |||
| 1426 | Ga0207683_10306535 | |||
| 1427 | Ga0207698_10010798 | |||
| 1428 | Ga0207698_10412888 | |||
| 1429 | Ga0207698_10626475 | |||
| 1430 | Ga0207698_11105044 | |||
| 1431 | Ga0207428_10004529 | |||
| 1432 | Ga0207428_10010924 | |||
| 1433 | Ga0265762_1024003 | |||
| 1434 | Ga0265760_10035877 | |||
| 1435 | Ga0307408_100159000 | |||
| 1436 | Ga0316575_10056557 | |||
| 1437 | Ga0316576_10029789 | |||
| 1438 | Ga0316576_10042306 | |||
| 1439 | Ga0316578_10242410 | |||
| 1440 | Ga0307405_10098997 | |||
| 1441 | Ga0307405_10135322 | |||
| 1442 | Ga0307405_10223811 | |||
| 1443 | Ga0316577_10007320 | |||
| 1444 | Ga0316577_10009957 | |||
| 1445 | Ga0316577_10023035 | |||
| 1446 | Ga0316577_10040667 | |||
| 1447 | Ga0316577_10058853 | |||
| 1448 | Ga0316577_10121501 | |||
| 1449 | Ga0316577_10210201 | |||
| 1450 | Ga0307413_10518096 | |||
| 1451 | Ga0307410_10147517 | |||
| 1452 | Ga0307410_10763226 | |||
| 1453 | Ga0307406_10040316 | |||
| 1454 | Ga0307406_10158274 | |||
| 1455 | Ga0307406_10813966 | |||
| 1456 | Ga0307407_10059094 | |||
| 1457 | Ga0307407_10142511 | |||
| 1458 | Ga0307412_10335332 | |||
| 1459 | Ga0307409_100019324 | |||
| 1460 | Ga0307409_100093422 | |||
| 1461 | Ga0307409_100099348 | |||
| 1462 | Ga0307409_100388815 | |||
| 1463 | Ga0307409_100546299 | |||
| 1464 | Ga0307409_100785905 | |||
| 1465 | Ga0307409_101521272 | |||
| 1466 | Ga0307416_100081850 | |||
| 1467 | Ga0307416_100090626 | |||
| 1468 | Ga0307416_100185296 | |||
| 1469 | Ga0307416_100451406 | |||
| 1470 | Ga0307416_100499388 | |||
| 1471 | Ga0307414_10257448 | |||
| 1472 | Ga0307411_10581153 | |||
| 1473 | Ga0307415_100191437 | |||
| 1474 | Ga0307415_100416588 | |||
| 1475 | Ga0307415_100479016 | |||
| 1476 | Ga0307415_100499803 | |||
| 1477 | Ga0307415_100784094 | |||
| 1478 | Ga0316593_10127385 | |||
| 1479 | Ga0373930_0040628 | |||
| 1480 | Ga0373926_0000850 | |||
| 1481 | Ga0373944_0000427 | |||
| 1482 | Ga0373923_0071602 | |||
| 1483 | Ga0373923_0201338 | |||
| 1484 | Ga0373936_0000725 | |||
| 1485 | Ga0373936_0087869 | |||
| 1486 | Ga0373939_0079959 | |||
| 1487 | Ga0373945_0000016 | |||
| 1488 | Ga0373953_0014461 | |||
| 1489 | Ga0373954_0294302 | |||
| 1490 | Ga0373956_0088111 | |||
| 1491 | Ga0373956_0100846 | |||
| 1492 | Ga0373957_0069290 | |||
| 1493 | Ga0373960_0008112 | |||
| 1494 | Ga0373943_0003777 | |||
| 1495 | Ga0373946_0002742 | |||
| 1496 | Ga0373955_0024987 | |||
| 1497 | Ga0373955_0090468 | |||
| 1498 | Ga0373955_0183880 | |||
| 1499 | Ga0373931_0079397 | |||
| 1500 | Ga0373935_0049972 | |||
| 1501 | Ga0373927_0000603 | |||
| 1502 | Ga0373933_0017769 | |||
| 1503 | Ga0373933_0047517 | |||
| 1504 | Ga0373947_0005652 | |||
| 1505 | Ga0373937_0323460 | |||
| 1506 | Ga0373937_0370964 | |||
| 1507 | Ga0373937_0655759 | |||
| 1508 | Ga0373937_0774104 | |||
| 1509 | Ga0372808_018167 | |||
| 1510 | Ga0316582_0003740 | |||
| 1511 | Ga0316582_0009839 | |||
| 1512 | Ga0316582_0022693 | |||
| 1513 | Ga0316582_0040653 | |||
| 1514 | Ga0316582_0076245 | |||
| 1515 | Ga0316582_0128240 | |||
| 1516 | Ga0316582_0649400 | |||
| 1517 | Ga0316582_0728194 | |||
| 1518 | Ga0316584_0002012 | |||
| 1519 | Ga0316584_0002431 | |||
| 1520 | Ga0316584_0006499 | |||
| 1521 | Ga0316584_0043912 | |||
| 1522 | Ga0316584_0110346 | |||
| 1523 | Ga0316584_0167913 | |||
| 1524 | Ga0373925_0013934 | |||
| 1525 | Ga0373925_0365475 | |||
| 1526 | Ga0373925_0735365 | |||
| 1527 | Ga0395899_0002678 | |||
| 1528 | Ga0395899_0009721 | |||
| 1529 | Ga0395899_0012401 | |||
| 1530 | Ga0395899_0032840 | |||
| 1531 | Ga0395899_0040952 | |||
| 1532 | Ga0395899_0170517 | |||
| 1533 | Ga0395900_0001398 | |||
| 1534 | Ga0395900_0001553 | |||
| 1535 | Ga0395900_0015596 | |||
| 1536 | Ga0395900_0030269 | |||
| 1537 | Ga0395900_0036974 | |||
| 1538 | Ga0395900_0168383 | |||
| 1539 | Ga0395900_0196178 | |||
| 1540 | Ga0395900_0304109 | |||
| 1541 | Ga0395900_0926296 | |||
| 1542 | Ga0395898_0006056 | |||
| 1543 | Ga0395898_0011885 | |||
| 1544 | Ga0395898_0011908 | |||
| 1545 | Ga0395898_0037487 | |||
| 1546 | Ga0395898_0054109 | |||
| 1547 | Ga0395898_0085276 | |||
| 1548 | Ga0395898_0335494 | |||
| 1549 | Ga0395898_0624861 | |||
| 1550 | Ga0395905_0005069 | |||
| 1551 | Ga0395905_0005379 | |||
| 1552 | Ga0395905_0019192 | |||
| 1553 | Ga0395905_0019785 | |||
| 1554 | Ga0395905_0107499 | |||
| 1555 | Ga0316581_0003136 | |||
| 1556 | Ga0316581_0006601 | |||
| 1557 | Ga0316581_0047903 | |||
| 1558 | Ga0316581_0052532 | |||
| 1559 | Ga0436364_0008721 | |||
| 1560 | Ga0436364_0267484 | |||
| 1561 | Ga0436364_1142277 | |||
| 1562 | Ga0436364_1209434 | |||
| 1563 | Ga0436364_1288039 | |||
| 1564 | Ga0436364_1403969 | |||
| 1565 | Ga0436364_1409644 | |||
| 1566 | Ga0436364_1538459 | |||
| 1567 | Ga0395901_0000717 | |||
| 1568 | Ga0395901_0000739 | |||
| 1569 | Ga0395901_0003414 | |||
| 1570 | Ga0395901_0008492 | |||
| 1571 | Ga0395901_0035478 | |||
| 1572 | Ga0395901_0052750 | |||
| 1573 | Ga0395901_0085519 | |||
| 1574 | Ga0395901_0159342 | |||
| 1575 | Ga0436365_0072895 | |||
| 1576 | Ga0436365_0158783 | |||
| 1577 | Ga0436365_0376109 | |||
| 1578 | Ga0436365_0412674 | |||
| 1579 | Ga0436365_0686913 | |||
| 1580 | Ga0436365_0783550 | |||
| 1581 | Ga0436365_0892906 | |||
| 1582 | Ga0436365_1088316 | |||
| 1583 | Ga0436365_1674485 | |||
| 1584 | Ga0436360_0139542 | |||
| 1585 | Ga0436363_0535202 | |||
| 1586 | Ga0436362_0583696 | |||
| 1587 | Ga0451855_1240075 | |||
| 1588 | Ga0451853_1781216 | |||
| 1589 | Ga0439460_0023712 | |||
| 1590 | Ga0451577_0642771 | |||
| 1591 | Ga0453683_0469580 | |||
| 1592 | Ga0466965_0449008 | |||
| 1593 | Ga0466961_0035163 | |||
| 1594 | Ga0466961_0058716 | |||
| 1595 | Ga0466961_0251301 | |||
| 1596 | Ga0466961_0300690 | |||
| 1597 | Ga0466963_0000393 | |||
| 1598 | Ga0466963_0001530 | |||
| 1599 | Ga0466963_0009403 | |||
| 1600 | Ga0466963_0150068 | |||
| 1601 | Ga0466963_0767051 | |||
| 1602 | Ga0466964_0080937 | |||
| 1603 | Ga0466971_0031658 | |||
| 1604 | Ga0466971_0078005 | |||
| 1605 | Ga0466957_0003328 | |||
| 1606 | Ga0466957_0023118 | |||
| 1607 | Ga0466957_0069155 | |||
| 1608 | Ga0466957_0183013 | |||
| 1609 | Ga0466957_0617008 | |||
| 1610 | Ga0466960_0015922 | |||
| 1611 | Ga0466960_0020023 | |||
| 1612 | Ga0466960_0060694 | |||
| 1613 | Ga0466959_0000356 | |||
| 1614 | Ga0466959_0048231 | |||
| 1615 | Ga0466959_0090391 | |||
| 1616 | Ga0466959_0406392 | |||
| 1617 | Ga0466958_0000216 | |||
| 1618 | Ga0466958_0014864 | |||
| 1619 | Ga0466958_0016646 | |||
| 1620 | Ga0466958_0151815 | |||
| 1621 | Ga0466958_0188805 | |||
| 1622 | Ga0466958_0271671 | |||
| 1623 | Ga0466967_0002039 | |||
| 1624 | Ga0466967_0004347 | |||
| 1625 | Ga0466967_0043158 | |||
| 1626 | Ga0466967_0062597 | |||
| 1627 | Ga0466967_0067051 | |||
| 1628 | Ga0466967_0076948 | |||
| 1629 | Ga0466967_0088111 | |||
| 1630 | Ga0466967_0091524 | |||
| 1631 | Ga0466967_0130075 | |||
| 1632 | Ga0466967_0154634 | |||
| 1633 | Ga0466967_0220423 | |||
| 1634 | Ga0466967_0612740 | |||
| 1635 | Ga0466967_0779832 | |||
| 1636 | Ga0466967_0903951 | |||
| 1637 | Ga0495592_0000671 | |||
| 1638 | Ga0495592_0152210 | |||
| 1639 | Ga0495603_0049672 | |||
| 1640 | Ga0495629_0130807 | |||
| 1641 | Ga0495629_0209159 | |||
| 1642 | Ga0495629_0277700 | |||
| 1643 | Ga0495641_0016479 | |||
| 1644 | Ga0495641_0140390 | |||
| 1645 | Ga0495651_0000343 | |||
| 1646 | Ga0495651_0029312 | |||
| 1647 | Ga0495653_0000660 | |||
| 1648 | Ga0495653_0001368 | |||
| 1649 | Ga0495653_0007461 | |||
| 1650 | Ga0495653_0341169 | |||
| 1651 | Ga0495580_0561173 | |||
| 1652 | Ga0495582_0048478 | |||
| 1653 | Ga0495582_0294863 | |||
| 1654 | Ga0495605_0143874 | |||
| 1655 | Ga0495662_0068529 | |||
| 1656 | Ga0495664_0002456 | |||
| 1657 | Ga0495664_0095117 | |||
| 1658 | Ga0495664_0132459 | |||
| 1659 | Ga0495664_0208780 | |||
| 1660 | Ga0495596_0145402 | |||
| 1661 | Ga0495608_0035402 | |||
| 1662 | Ga0495608_0083535 | |||
| 1663 | Ga0495608_0229771 | |||
| 1664 | Ga0495618_0157017 | |||
| 1665 | Ga0495628_0182654 | |||
| 1666 | Ga0495630_0000068 | |||
| 1667 | Ga0495630_0012662 | |||
| 1668 | Ga0495630_0021778 | |||
| 1669 | Ga0495630_0217614 | |||
| 1670 | Ga0495630_0780919 | |||
| 1671 | Ga0495631_0050761 | |||
| 1672 | Ga0495666_0009191 | |||
| 1673 | Ga0495652_0001806 | |||
| 1674 | Ga0495652_0017563 | |||
| 1675 | Ga0495652_0282252 | |||
| 1676 | Ga0495665_0056122 | |||
| 1677 | Ga0495640_0001702 | |||
| 1678 | Ga0495640_0015158 | |||
| 1679 | Ga0495640_0097486 | |||
| 1680 | Ga0495586_0000424 | |||
| 1681 | Ga0495586_0145547 | |||
| 1682 | Ga0495587_0000910 | |||
| 1683 | Ga0495609_0231489 | |||
| 1684 | Ga0495645_0002232 | |||
| 1685 | Ga0495645_0031437 | |||
| 1686 | Ga0495645_0249631 | |||
| 1687 | Ga0495667_0001093 | |||
| 1688 | Ga0495667_0004696 | |||
| 1689 | Ga0495667_0044457 | |||
| 1690 | Ga0495667_0053223 | |||
| 1691 | Ga0495667_0272828 | |||
| 1692 | Ga0495656_0127312 | |||
| 1693 | Ga0495668_0141436 | |||
| 1694 | Ga0495634_0030756 | |||
| 1695 | Ga0495634_0072491 | |||
| 1696 | Ga0495634_0209748 | |||
| 1697 | Ga0495635_0006235 | |||
| 1698 | Ga0495635_0061335 | |||
| 1699 | Ga0495657_0014780 | |||
| 1700 | Ga0495657_0034955 | |||
| 1701 | Ga0495657_0067922 | |||
| 1702 | Ga0495657_0232577 | |||
| 1703 | Ga0495599_0000322 | |||
| 1704 | Ga0495599_0015298 | |||
| 1705 | Ga0495599_0091129 | |||
| 1706 | Ga0495623_0016946 | |||
| 1707 | Ga0495646_0007879 | |||
| 1708 | Ga0495647_0096139 | |||
| 1709 | Ga0495658_0104845 | |||
| 1710 | Ga0495613_0148439 | |||
| 1711 | Ga0495613_0209167 | |||
| 1712 | Ga0495613_0227944 | |||
| 1713 | Ga0495624_0017865 | |||
| 1714 | Ga0495624_0361275 | |||
| 1715 | Ga0495670_0272293 | |||
| 1716 | Ga0495589_0131922 | |||
| 1717 | Ga0495589_0215258 | |||
| 1718 | Ga0495600_0003060 | |||
| 1719 | Ga0495600_0044953 | |||
| 1720 | Ga0495581_0017834 | |||
| 1721 | Ga0495604_0003558 | |||
| 1722 | Ga0495604_0297070 | |||
| 1723 | Ga0495674_0012698 | |||
| 1724 | Ga0495674_0035554 | |||
| 1725 | Ga0495674_0172764 | |||
| 1726 | Ga0495674_0187628 | |||
| 1727 | Ga0495674_0240744 | |||
| 1728 | Ga0495676_0003229 | |||
| 1729 | Ga0495680_0007542 | |||
| 1730 | Ga0495680_0010294 | |||
| 1731 | Ga0495680_0047943 | |||
| 1732 | Ga0495675_0021210 | |||
| 1733 | Ga0495684_0001092 | |||
| 1734 | Ga0495684_0022777 | |||
| 1735 | Ga0495684_0032181 | |||
| 1736 | Ga0495593_0262462 | |||
| 1737 | Ga0495602_0049528 | |||
| 1738 | Ga0495602_0155188 | |||
| 1739 | Ga0496100_0041686 | |||
| 1740 | Ga0496100_0059632 | |||
| 1741 | Ga0496100_0063457 | |||
| 1742 | Ga0496100_0080117 | |||
| 1743 | Ga0496100_0893422 | |||
| 1744 | Ga0496101_0017483 | |||
| 1745 | Ga0496101_0027637 | |||
| 1746 | Ga0496101_0038850 | |||
| 1747 | Ga0496101_0116070 | |||
| 1748 | Ga0496101_0127698 | |||
| 1749 | Ga0496101_0186635 | |||
| 1750 | Ga0496102_0076065 | |||
| 1751 | Ga0496102_0080572 | |||
| 1752 | Ga0496102_0125444 | |||
| 1753 | Ga0496102_0421004 | |||
| 1754 | Ga0496102_0545626 | |||
| 1755 | Ga0496102_0785338 | |||
| 1756 | Ga0496103_0026668 | |||
| 1757 | Ga0496103_0162758 | |||
| 1758 | Ga0496103_0169681 | |||
| 1759 | Ga0496103_0192825 | |||
| 1760 | Ga0496103_0216923 | |||
| 1761 | Ga0496104_0002448 | |||
| 1762 | Ga0496104_0032830 | |||
| 1763 | Ga0496104_0062634 | |||
| 1764 | Ga0496104_0210703 | |||
| 1765 | Ga0496104_0217998 | |||
| 1766 | Ga0496104_0219401 | |||
| 1767 | Ga0496104_0629700 | |||
| 1768 | Ga0496104_0677055 | |||
| 1769 | Ga0496104_0988260 | |||
| 1770 | Ga0496104_1206526 | |||
| 1771 | Ga0496105_0024543 | |||
| 1772 | Ga0496105_0068611 | |||
| 1773 | Ga0496105_0108652 | |||
| 1774 | Ga0496105_0439884 | |||
| 1775 | Ga0496105_0514030 | |||
| 1776 | Ga0496105_0681904 | |||
| 1777 | Ga0496106_0005498 | |||
| 1778 | Ga0496106_0035181 | |||
| 1779 | Ga0496106_0039724 | |||
| 1780 | Ga0496106_0146001 | |||
| 1781 | Ga0496106_0269644 | |||
| 1782 | Ga0496106_0358576 | |||
| 1783 | Ga0496106_0710939 | |||
| 1784 | Ga0496107_0014815 | |||
| 1785 | Ga0496107_0016122 | |||
| 1786 | Ga0496107_0035843 | |||
| 1787 | Ga0496107_0194154 | |||
| 1788 | Ga0496107_0289950 | |||
| 1789 | Ga0496108_0001060 | |||
| 1790 | Ga0496108_0007206 | |||
| 1791 | Ga0496108_0019457 | |||
| 1792 | Ga0496108_0020163 | |||
| 1793 | Ga0496108_0264516 | |||
| 1794 | Ga0496108_0286891 | |||
| 1795 | Ga0496108_0682466 | |||
| 1796 | Ga0496108_0687773 | |||
| 1797 | Ga0496109_0018823 | |||
| 1798 | Ga0496109_0048979 | |||
| 1799 | Ga0496109_0052245 | |||
| 1800 | Ga0496109_0080760 | |||
| 1801 | Ga0496109_0103630 | |||
| 1802 | Ga0496109_0111883 | |||
| 1803 | Ga0496109_0154180 | |||
| 1804 | Ga0496109_0182500 | |||
| 1805 | Ga0496109_0195902 | |||
| 1806 | Ga0496109_0208888 | |||
| 1807 | Ga0496109_0210320 | |||
| 1808 | Ga0496109_0326049 | |||
| 1809 | Ga0496109_0450058 | |||
| 1810 | Ga0496109_0456984 | |||
| 1811 | Ga0496109_0556368 | |||
| 1812 | Ga0496109_0640772 | |||
| 1813 | Ga0496109_0990666 | |||
| 1814 | Ga0496110_0068322 | |||
| 1815 | Ga0496110_0079875 | |||
| 1816 | Ga0496110_0130740 | |||
| 1817 | Ga0496110_0186664 | |||
| 1818 | Ga0496110_0215065 | |||
| 1819 | Ga0496110_0744282 | |||
| 1820 | Ga0496111_0063357 | |||
| 1821 | Ga0496111_0325329 | |||
| 1822 | Ga0496111_0658351 | |||
| 1823 | Ga0496112_0003576 | |||
| 1824 | Ga0496112_0009272 | |||
| 1825 | Ga0496112_0058888 | |||
| 1826 | Ga0496112_0159954 | |||
| 1827 | Ga0496112_0288621 | |||
| 1828 | Ga0496112_0411940 | |||
| 1829 | Ga0496112_0611899 | |||
| 1830 | Ga0496112_0622222 | |||
| 1831 | Ga0496112_0937325 | |||
| 1832 | Ga0496113_0004264 | |||
| 1833 | Ga0496113_0056538 | |||
| 1834 | Ga0496113_0127393 | |||
| 1835 | Ga0496113_0158349 | |||
| 1836 | Ga0496113_0162212 | |||
| 1837 | Ga0496113_0450043 | |||
| 1838 | Ga0496114_0045290 | |||
| 1839 | Ga0496114_0134296 | |||
| 1840 | Ga0496114_0478269 | |||
| 1841 | Ga0496115_0006516 | |||
| 1842 | Ga0496115_0062587 | |||
| 1843 | Ga0496115_0086716 | |||
| 1844 | Ga0496115_0193330 | |||
| 1845 | Ga0496115_0252182 | |||
| 1846 | Ga0501031_0000063 | |||
| 1847 | Ga0501031_0293090 | |||
| 1848 | Ga0501031_0571606 | |||
| 1849 | Ga0501032_0003604 | |||
| 1850 | Ga0501033_0000871 | |||
| 1851 | Ga0501034_0408569 | |||
| 1852 | Ga0501036_0002119 | |||
| 1853 | Ga0501036_0029451 | |||
| 1854 | Ga0501036_0264016 | |||
| 1855 | Ga0501036_0491844 | |||
| 1856 | Ga0501037_0008933 | |||
| 1857 | Ga0501038_0004494 | |||
| 1858 | Ga0501039_0000075 | |||
| 1859 | Ga0501039_0056778 | |||
| 1860 | Ga0501040_0013292 | |||
| 1861 | Ga0501040_0026672 | |||
| 1862 | Ga0501040_0109887 | |||
| 1863 | Ga0501041_0291684 | |||
| 1864 | Ga0501042_0084119 | |||
| 1865 | Ga0501043_0004209 | |||
| 1866 | Ga0501046_0001429 | |||
| 1867 | Ga0501047_0016589 | |||
| 1868 | Ga0501047_0237817 | |||
| 1869 | Ga0501048_0001098 | |||
| 1870 | Ga0501067_0009560 | |||
| 1871 | Ga0501067_0123535 | |||
| 1872 | Ga0501068_0175824 | |||
| 1873 | Ga0501068_0179548 | |||
| 1874 | Ga0501068_0267041 | |||
| 1875 | Ga0501069_0005707 | |||
| 1876 | Ga0501069_0040125 | |||
| 1877 | Ga0501069_0313880 | |||
| 1878 | Ga0501070_0001223 | |||
| 1879 | Ga0501071_0201962 | |||
| 1880 | Ga0501071_0491798 | |||
| 1881 | Ga0501072_0023198 | |||
| 1882 | Ga0501072_0027608 | |||
| 1883 | Ga0501072_0042615 | |||
| 1884 | Ga0501072_0179081 | |||
| 1885 | Ga0501073_0004877 | |||
| 1886 | Ga0501074_0000308 | |||
| 1887 | Ga0501074_0510393 | |||
| 1888 | Ga0501074_0592922 | |||
| 1889 | Ga0501075_0011725 | |||
| 1890 | Ga0501075_0094604 | |||
| 1891 | Ga0501075_0434711 | |||
| 1892 | Ga0501075_0476636 | |||
| 1893 | Ga0501076_0054865 | |||
| 1894 | Ga0501076_0112492 | |||
| 1895 | Ga0501076_0123882 | |||
| 1896 | Ga0501076_0278338 | |||
| 1897 | Ga0501076_0307952 | |||
| 1898 | Ga0501077_0010472 | |||
| 1899 | Ga0501233_189021 | |||
| 1900 | Ga0501079_0077786 | |||
| 1901 | Ga0501079_0113193 | |||
| 1902 | Ga0501079_0173001 | |||
| 1903 | Ga0501079_0266889 | |||
| 1904 | Ga0501080_0000212 | |||
| 1905 | Ga0501083_0136930 | |||
| 1906 | Ga0501083_0360945 | |||
| 1907 | Ga0501035_0009419 | |||
| 1908 | Ga0501044_0018094 | |||
| 1909 | Ga0501045_0022231 | |||
| 1910 | Ga0501045_0024470 | |||
| 1911 | Ga0501045_0240115 | |||
| 1912 | Ga0501045_0288724 | |||
| 1913 | Ga0501045_0298973 | |||
| 1914 | nmdc:mga03683_88519_c1 | |||
| 1915 | nmdc:mga00v17_12882_c1 | |||
| 1916 | nmdc:mga00v17_471648_c1 | |||
| 1917 | nmdc:mga0yw44_19049_c1 | |||
| 1918 | nmdc:mga0yw44_3539_c1 | |||
| 1919 | nmdc:mga06z11_126523_c1 | |||
| 1920 | nmdc:mga05p37_101832_c1 | |||
| 1921 | nmdc:mga05p37_114437_c1 | |||
| 1922 | nmdc:mga05p37_156393_c1 | |||
| 1923 | nmdc:mga05p37_864712_c1 | |||
| 1924 | nmdc:mga05p37_9080_c1 | |||
| 1925 | nmdc:mga09592_45988_c1 | |||
| 1926 | nmdc:mga0qj67_7035_c1 | |||
| 1927 | nmdc:mga08y16_18764_c1 | |||
| 1928 | nmdc:mga08y16_206790_c1 | |||
| 1929 | nmdc:mga08y16_4867_c1 | |||
| 1930 | nmdc:mga0n895_1097876_c1 | |||
| 1931 | nmdc:mga0n895_202053_c1 | |||
| 1932 | nmdc:mga0n895_202703_c1 | |||
| 1933 | nmdc:mga0n895_327641_c1 | |||
| 1934 | nmdc:mga0n895_924163_c1 | |||
| 1935 | nmdc:mga0rr50_194419_c1 | |||
| 1936 | nmdc:mga0rr50_417963_c1 | |||
| 1937 | nmdc:mga0rr50_463513_c1 | |||
| 1938 | nmdc:mga0rr50_782695_c1 | |||
| 1939 | nmdc:mga08x19_70293_c1 | |||
| 1940 | nmdc:mga0a205_927073_c1 | |||
| 1941 | Ga0495601_0011985 | |||
| 1942 | Ga0495601_0147656 | |||
| 1943 | Ga0495601_0243940 | |||
| 1944 | Ga0495612_0081359 | |||
| 1945 | Ga0495612_0129170 | |||
| 1946 | Ga0495619_0080609 | |||
| 1947 | Ga0495619_0140698 | |||
| 1948 | Ga0500660_083868 | |||
| 1949 | Ga0501084_0002422 | |||
| 1950 | Ga0501084_0068348 | |||
| 1951 | Ga0501084_0104327 | |||
| 1952 | Ga0501084_0156861 | |||
| 1953 | Ga0501084_0167692 | |||
| 1954 | Ga0466962_0092214 | |||
| 1955 | Ga0466962_0125328 | |||
| 1956 | Ga0466962_0187106 | |||
| 1957 | Ga0530510_0043590 | |||
| 1958 | Ga0530510_0262821 | |||
| 1959 | Ga0530510_0320375 | |||
| 1960 | Ga0530510_0608927 | |||
| 1961 | 2891554891 | |||
| 1962 | 2895431004 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1je8-assembly2.cif.gz_E | two-component response regulator narl/dna complex: dna bending found in a high affinity site | 0.9856 | 150 | 213 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9835 | 149 | 212 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9794 | 149 | 212 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9792 | 151 | 211 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9771 | 149 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.978 | 153 | 209 | 1.10.10.10 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.975 | 153 | 208 | 1.10.10.10 |
| af_O53213_1064_1134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9577 | 151 | 211 | 1.10.10.10 |
| 4tmyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9574 | 4 | 119 | 3.40.50.2300 |
| 3eulC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9566 | 2 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4WXB8-F1-model_v4 | DNA-binding response regulator | 0.9705 | 2 | 125 |
GO:0000160
GO:0003677 |
| AF-B5GTH3-F1-model_v4 | deleted | 0.9665 | 2 | 212 |
|
| AF-A0A5S4EYX3-F1-model_v4 | Response regulator | 0.9663 | 2 | 213 |
GO:0000155
GO:0003677 GO:0006355 GO:0016020 GO:0046983 |
| AF-A0A5D0UMI1-F1-model_v4 | Response regulator transcription factor | 0.9607 | 1 | 213 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-W9GLQ1-F1-model_v4 | LuxR family transcriptional regulator | 0.9602 | 2 | 212 |
GO:0000160
GO:0003677 GO:0006355 |