F487393

General Info

Members Datasets Scaffolds Average Seq Length
981 364 1962 216

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10000738|Ga0316579_100007384
Length 247
Sequence MNTNLGSEPAVDAHNPQRTIRVLIVDDHAVVRQGLRTFLELQDDVSHGDLSALPIQVVGEATTGLEAVDLARRLQPDVVLLDLVMPEMDGIEATPRIIEESPGSRVLILTSFGDEDKVFPAIRAGAQGYLLKDIAPGDLVQAVRAAHLDQVQLHPEVARKLMSAVAAKEEPAAASQAALPDELTGRELEVLRLIAEGLNNREIAERLVISDKTVKTHVSSILGKLHLEDRTQAAIYALRHGLAPDDA

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
99 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
100 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
364 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.92
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 10.91
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10000738 3300031691 Bacteria 11205
2 JGI24743J22301_10002892 3300001991 Bacteria 2651
3 JGI25407J50210_10000692 3300003373 Bacteria 6993
4 JGI25407J50210_10014402 3300003373 Bacteria 2037
5 JGI25407J50210_10025306 3300003373 Bacteria 1539
6 Ga0058863_11604478 3300004799 Bacteria 1042
7 Ga0070658_10004524 3300005327 Bacteria 11308
8 Ga0070658_10309951 3300005327 Bacteria 1347
9 Ga0070683_100001072 3300005329 Bacteria 20539
10 Ga0070683_100022724 3300005329 Bacteria 5609
11 Ga0070683_100027093 3300005329 Bacteria 5166
12 Ga0070683_100108694 3300005329 Bacteria 2616
13 Ga0070683_100285013 3300005329 Bacteria 1571
14 Ga0070683_100346078 3300005329 Bacteria 1416
15 Ga0070683_101002896 3300005329 Bacteria 802
16 Ga0070670_100000651 3300005331 Bacteria 26944
17 Ga0068869_100512161 3300005334 Bacteria 1003
18 Ga0070680_100004355 3300005336 Bacteria 10644
19 Ga0070680_100055736 3300005336 Bacteria 3230
20 Ga0070680_100083473 3300005336 Bacteria 2638
21 Ga0070680_100159047 3300005336 Bacteria 1898
22 Ga0070682_100003614 3300005337 Bacteria 8571
23 Ga0070682_100096396 3300005337 Bacteria 1944
24 Ga0070682_100234580 3300005337 Bacteria 1314
25 Ga0070682_100300854 3300005337 Bacteria 1177
26 Ga0070682_100733754 3300005337 Bacteria 795
27 Ga0068868_100028978 3300005338 Bacteria 4238
28 Ga0068868_100038286 3300005338 Bacteria 3722
29 Ga0068868_100076841 3300005338 Bacteria 2670
30 Ga0070660_100013711 3300005339 Bacteria 5827
31 Ga0070660_100022332 3300005339 Bacteria 4677
32 Ga0070691_10010107 3300005341 Bacteria 4302
33 Ga0070661_100001663 3300005344 Bacteria 15407
34 Ga0070661_100212167 3300005344 Bacteria 1482
35 Ga0070661_100212400 3300005344 Bacteria 1482
36 Ga0070668_100650319 3300005347 Bacteria 926
37 Ga0070669_100717812 3300005353 Bacteria 845
38 Ga0070675_100018947 3300005354 Bacteria 5482
39 Ga0070671_100247017 3300005355 Bacteria 1515
40 Ga0070674_100096841 3300005356 Bacteria 2142
41 Ga0070673_100014741 3300005364 Bacteria 5461
42 Ga0070688_100210139 3300005365 Bacteria 1366
43 Ga0070659_100012504 3300005366 Bacteria 6294
44 Ga0070659_100099209 3300005366 Bacteria 2342
45 Ga0070667_101108954 3300005367 Bacteria 740
46 Ga0070703_10091429 3300005406 Bacteria 1056
47 Ga0070703_10107038 3300005406 Bacteria 994
48 Ga0070709_10033603 3300005434 Bacteria 3103
49 Ga0070709_10130585 3300005434 Bacteria 1714
50 Ga0070709_10146305 3300005434 Bacteria 1628
51 Ga0070714_100003431 3300005435 Bacteria 11807
52 Ga0070714_100012472 3300005435 Bacteria 6786
53 Ga0070714_100013021 3300005435 Bacteria 6654
54 Ga0070714_100022982 3300005435 Bacteria 5117
55 Ga0070714_100023663 3300005435 Bacteria 5049
56 Ga0070714_100072935 3300005435 Bacteria 2973
57 Ga0070714_100093558 3300005435 Bacteria 2636
58 Ga0070714_100098834 3300005435 Bacteria 2568
59 Ga0070714_100249923 3300005435 Bacteria 1639
60 Ga0070714_100407043 3300005435 Bacteria 1287
61 Ga0070714_101099593 3300005435 Bacteria 775
62 Ga0070713_100009826 3300005436 Bacteria 6880
63 Ga0070713_100028317 3300005436 Bacteria 4423
64 Ga0070713_100069396 3300005436 Bacteria 2972
65 Ga0070713_100130978 3300005436 Bacteria 2212
66 Ga0070713_100152537 3300005436 Bacteria 2057
67 Ga0070713_100382475 3300005436 Bacteria 1312
68 Ga0070713_100462941 3300005436 Bacteria 1192
69 Ga0070713_100472698 3300005436 Bacteria 1180
70 Ga0070713_100687147 3300005436 Bacteria 976
71 Ga0070713_100801909 3300005436 Bacteria 903
72 Ga0070710_10002596 3300005437 Bacteria 8583
73 Ga0070710_10034679 3300005437 Bacteria 2747
74 Ga0070710_10121563 3300005437 Bacteria 1581
75 Ga0070710_10192027 3300005437 Bacteria 1285
76 Ga0070710_10296298 3300005437 Bacteria 1054
77 Ga0070710_10381367 3300005437 Bacteria 940
78 Ga0070711_100097164 3300005439 Bacteria 2135
79 Ga0070711_100099236 3300005439 Bacteria 2115
80 Ga0070711_100508293 3300005439 Bacteria 994
81 Ga0070705_100879240 3300005440 Bacteria 719
82 Ga0070700_100668785 3300005441 Bacteria 822
83 Ga0070694_100608614 3300005444 Bacteria 881
84 Ga0070708_100007755 3300005445 Bacteria 8601
85 Ga0070708_100027221 3300005445 Bacteria 4904
86 Ga0070708_100219305 3300005445 Unclassified 1783
87 Ga0070663_100189549 3300005455 Bacteria 1599
88 Ga0070663_100672338 3300005455 Bacteria 878
89 Ga0070678_100608973 3300005456 Bacteria 976
90 Ga0070662_100013266 3300005457 Bacteria 5480
91 Ga0070681_10008799 3300005458 Bacteria 9910
92 Ga0070681_10009501 3300005458 Bacteria 9573
93 Ga0070681_10036757 3300005458 Bacteria 4917
94 Ga0070681_10047068 3300005458 Bacteria 4311
95 Ga0070681_10296276 3300005458 Bacteria 1527
96 Ga0070685_10019843 3300005466 Bacteria 3632
97 Ga0070706_100001406 3300005467 Bacteria 25463
98 Ga0070706_100001959 3300005467 Bacteria 21215
99 Ga0070706_100013388 3300005467 Bacteria 7583
100 Ga0070706_100024862 3300005467 Bacteria 5514
101 Ga0070706_100124531 3300005467 Bacteria 2403
102 Ga0070707_100074594 3300005468 Bacteria 3271
103 Ga0070707_100102594 3300005468 Bacteria 2772
104 Ga0070707_100108578 3300005468 Bacteria 2691
105 Ga0070707_100209095 3300005468 Bacteria 1902
106 Ga0070707_100700376 3300005468 Bacteria 976
107 Ga0070698_100013778 3300005471 Bacteria 8556
108 Ga0070698_100063993 3300005471 Bacteria 3707
109 Ga0070698_100295048 3300005471 Bacteria 1552
110 Ga0070698_100330357 3300005471 Bacteria 1456
111 Ga0070699_100676770 3300005518 Bacteria 942
112 Ga0070679_100014336 3300005530 Bacteria 7612
113 Ga0070679_100060986 3300005530 Bacteria 3759
114 Ga0070679_100236953 3300005530 Bacteria 1783
115 Ga0070679_100310939 3300005530 Bacteria 1525
116 Ga0070679_100373131 3300005530 Bacteria 1373
117 Ga0070679_100596428 3300005530 Bacteria 1048
118 Ga0070684_100113676 3300005535 Bacteria 2430
119 Ga0070684_100122950 3300005535 Bacteria 2336
120 Ga0070684_100190841 3300005535 Bacteria 1864
121 Ga0070684_100317147 3300005535 Bacteria 1432
122 Ga0070697_100248531 3300005536 Bacteria 1520
123 Ga0068853_100309700 3300005539 Bacteria 1461
124 Ga0068853_100524797 3300005539 Bacteria 1120
125 Ga0070686_100023518 3300005544 Bacteria 3683
126 Ga0070686_100036151 3300005544 Bacteria 3056
127 Ga0070695_100167463 3300005545 Bacteria 1548
128 Ga0070665_100668716 3300005548 Bacteria 1051
129 Ga0070665_100879363 3300005548 Bacteria 909
130 Ga0070704_100738507 3300005549 Bacteria 875
131 Ga0068855_100061255 3300005563 Bacteria 4397
132 Ga0068855_100150783 3300005563 Unclassified 2644
133 Ga0068855_100201091 3300005563 Bacteria 2243
134 Ga0068855_100246737 3300005563 Bacteria 1993
135 Ga0068855_100627923 3300005563 Bacteria 1156
136 Ga0070664_100059613 3300005564 Bacteria 3248
137 Ga0068857_100410793 3300005577 Bacteria 1261
138 Ga0068857_101216401 3300005577 Bacteria 730
139 Ga0068854_100006171 3300005578 Bacteria 7607
140 Ga0068854_100194497 3300005578 Bacteria 1591
141 Ga0068854_100400417 3300005578 Bacteria 1136
142 Ga0068856_100127598 3300005614 Bacteria 2547
143 Ga0068856_100159420 3300005614 Bacteria 2266
144 Ga0068856_100222549 3300005614 Bacteria 1903
145 Ga0070702_100029003 3300005615 Bacteria 3004
146 Ga0068852_100009988 3300005616 Bacteria 7062
147 Ga0068852_100149768 3300005616 Bacteria 2169
148 Ga0068852_100400784 3300005616 Bacteria 1349
149 Ga0068852_100592031 3300005616 Bacteria 1113
150 Ga0068866_10250549 3300005718 Bacteria 1083
151 Ga0068861_100212639 3300005719 Bacteria 1630
152 Ga0068870_10006900 3300005840 Bacteria 5037
153 Ga0068863_100434753 3300005841 Bacteria 1286
154 Ga0068858_100045462 3300005842 Bacteria 4069
155 Ga0068860_100883308 3300005843 Bacteria 909
156 Ga0081455_10002591 3300005937 Bacteria 21441
157 Ga0081455_10011260 3300005937 Bacteria 9000
158 Ga0081455_10028974 3300005937 Bacteria 5053
159 Ga0081455_10031658 3300005937 Bacteria 4779
160 Ga0081455_10060858 3300005937 Bacteria 3181
161 Ga0081455_10205651 3300005937 Bacteria 1471
162 Ga0081538_10000063 3300005981 Bacteria 99624
163 Ga0081538_10001198 3300005981 Bacteria 27247
164 Ga0081538_10002074 3300005981 Bacteria 19975
165 Ga0081538_10002606 3300005981 Bacteria 17484
166 Ga0081538_10004853 3300005981 Bacteria 12244
167 Ga0081538_10004890 3300005981 Bacteria 12198
168 Ga0081538_10006605 3300005981 Bacteria 10171
169 Ga0081538_10009141 3300005981 Bacteria 8310
170 Ga0081538_10074257 3300005981 Bacteria 1852
171 Ga0081538_10101851 3300005981 Bacteria 1443
172 Ga0081538_10154764 3300005981 Bacteria 1031
173 Ga0081538_10158237 3300005981 Bacteria 1012
174 Ga0081538_10164263 3300005981 Bacteria 981
175 Ga0081540_1001536 3300005983 Bacteria 19829
176 Ga0081539_10020696 3300005985 Bacteria 4431
177 Ga0081539_10028730 3300005985 Bacteria 3492
178 Ga0081539_10067162 3300005985 Bacteria 1940
179 Ga0081539_10076577 3300005985 Bacteria 1772
180 Ga0070717_10003113 3300006028 Bacteria 11833
181 Ga0070717_10005654 3300006028 Bacteria 9133
182 Ga0070717_10016240 3300006028 Bacteria 5768
183 Ga0070717_10018875 3300006028 Bacteria 5395
184 Ga0070717_10022410 3300006028 Bacteria 4990
185 Ga0070717_10048957 3300006028 Bacteria 3468
186 Ga0070717_10062424 3300006028 Bacteria 3089
187 Ga0070717_10121965 3300006028 Bacteria 2234
188 Ga0070717_10245113 3300006028 Bacteria 1581
189 Ga0070717_10271676 3300006028 Bacteria 1502
190 Ga0070717_10368491 3300006028 Bacteria 1287
191 Ga0070717_10511922 3300006028 Bacteria 1085
192 Ga0075365_10009199 3300006038 Bacteria 5665
193 Ga0075364_10048459 3300006051 Bacteria 2768
194 Ga0070715_10015404 3300006163 Bacteria 2850
195 Ga0070716_100014385 3300006173 Bacteria 4052
196 Ga0070716_100175440 3300006173 Bacteria 1402
197 Ga0070712_100032228 3300006175 Bacteria 3536
198 Ga0070712_100045302 3300006175 Bacteria 3036
199 Ga0070712_100093786 3300006175 Bacteria 2204
200 Ga0070712_100122238 3300006175 Bacteria 1960
201 Ga0070712_100139446 3300006175 Bacteria 1848
202 Ga0070712_100280851 3300006175 Bacteria 1341
203 Ga0070712_100322703 3300006175 Bacteria 1256
204 Ga0070712_100364235 3300006175 Unclassified 1186
205 Ga0070712_100390397 3300006175 Bacteria 1147
206 Ga0070712_100466821 3300006175 Bacteria 1053
207 Ga0070712_100594984 3300006175 Bacteria 936
208 Ga0070712_100646122 3300006175 Bacteria 898
209 Ga0075362_10005721 3300006177 Bacteria 4575
210 Ga0075427_10006907 3300006194 Bacteria 1658
211 Ga0097621_100152985 3300006237 Bacteria 1979
212 Ga0097621_100197309 3300006237 Bacteria 1746
213 Ga0097621_100829905 3300006237 Bacteria 858
214 Ga0068871_100069520 3300006358 Bacteria 2892
215 Ga0075428_100163716 3300006844 Bacteria 2413
216 Ga0075428_100777962 3300006844 Bacteria 1018
217 Ga0075428_100908493 3300006844 Bacteria 934
218 Ga0075430_100008389 3300006846 Bacteria 8727
219 Ga0075431_100226209 3300006847 Bacteria 1907
220 Ga0075431_100227095 3300006847 Bacteria 1903
221 Ga0075431_100236483 3300006847 Bacteria 1859
222 Ga0075434_100013809 3300006871 Bacteria 7701
223 Ga0075434_100127523 3300006871 Bacteria 2562
224 Ga0075434_100171301 3300006871 Bacteria 2191
225 Ga0075434_100838183 3300006871 Bacteria 935
226 Ga0075429_100044747 3300006880 Bacteria 3850
227 Ga0075429_100096284 3300006880 Bacteria 2582
228 Ga0068865_100074004 3300006881 Bacteria 2425
229 Ga0068865_100234693 3300006881 Bacteria 1441
230 Ga0068865_100278430 3300006881 Bacteria 1331
231 Ga0075436_100711676 3300006914 Bacteria 744
232 Ga0075435_100010431 3300007076 Bacteria 6796
233 Ga0075435_100423139 3300007076 Bacteria 1147
234 Ga0075435_100691037 3300007076 Bacteria 886
235 Ga0105240_10034380 3300009093 Bacteria 6537
236 Ga0105240_10126692 3300009093 Bacteria 3067
237 Ga0111539_10000875 3300009094 Bacteria 39347
238 Ga0111539_10186914 3300009094 Bacteria 2419
239 Ga0111539_10324042 3300009094 Bacteria 1793
240 Ga0111539_10358324 3300009094 Bacteria 1698
241 Ga0105245_10034516 3300009098 Bacteria 4488
242 Ga0105245_10309280 3300009098 Bacteria 1553
243 Ga0105245_10510580 3300009098 Bacteria 1219
244 Ga0105245_10572732 3300009098 Bacteria 1153
245 Ga0105245_10876756 3300009098 Bacteria 938
246 Ga0105247_10073575 3300009101 Bacteria 2142
247 Ga0114129_10004181 3300009147 Bacteria 20393
248 Ga0114129_10053451 3300009147 Bacteria 5664
249 Ga0114129_10139709 3300009147 Bacteria 3321
250 Ga0114129_10169736 3300009147 Bacteria 2975
251 Ga0114129_10239014 3300009147 Bacteria 2442
252 Ga0105243_10010885 3300009148 Bacteria 6881
253 Ga0105243_10336373 3300009148 Bacteria 1381
254 Ga0105243_10773313 3300009148 Bacteria 944
255 Ga0105242_10036676 3300009176 Bacteria 3935
256 Ga0105242_10558023 3300009176 Bacteria 1099
257 Ga0105242_10685975 3300009176 Bacteria 1000
258 Ga0105242_11072800 3300009176 Bacteria 818
259 Ga0105248_10350693 3300009177 Bacteria 1661
260 Ga0105237_10029633 3300009545 Bacteria 5561
261 Ga0105237_10457409 3300009545 Bacteria 1282
262 Ga0105238_10041276 3300009551 Bacteria 4673
263 Ga0105238_10235365 3300009551 Bacteria 1809
264 Ga0105238_10272508 3300009551 Bacteria 1673
265 Ga0105238_10317030 3300009551 Bacteria 1545
266 Ga0105238_10647727 3300009551 Bacteria 1066
267 Ga0105239_10042156 3300010375 Bacteria 5001
268 Ga0105239_10193155 3300010375 Bacteria 2279
269 Ga0105239_10351589 3300010375 Bacteria 1664
270 Ga0105239_10973815 3300010375 Bacteria 975
271 Ga0105246_10186142 3300011119 Bacteria 1603
272 Ga0157340_1011268 3300012473 Bacteria 641
273 Ga0157339_1009323 3300012505 Bacteria 866
274 Ga0157338_1002793 3300012515 Bacteria 1399
275 Ga0157371_10020393 3300013102 Bacteria 4877
276 Ga0157371_10105538 3300013102 Bacteria 1999
277 Ga0157371_10648044 3300013102 Bacteria 788
278 Ga0157370_10030220 3300013104 Bacteria 5310
279 Ga0157370_10141222 3300013104 Bacteria 2244
280 Ga0157370_10204311 3300013104 Bacteria 1832
281 Ga0157370_10427703 3300013104 Bacteria 1218
282 Ga0157369_10011850 3300013105 Bacteria 9904
283 Ga0157369_10042363 3300013105 Bacteria 4966
284 Ga0157369_10105314 3300013105 Bacteria 3003
285 Ga0157374_10127115 3300013296 Bacteria 2464
286 Ga0157374_10145230 3300013296 Bacteria 2304
287 Ga0163162_10189610 3300013306 Bacteria 2183
288 Ga0157372_10006405 3300013307 Bacteria 12526
289 Ga0157372_10056942 3300013307 Bacteria 4369
290 Ga0157372_10554386 3300013307 Bacteria 1340
291 Ga0157372_10598967 3300013307 Bacteria 1285
292 Ga0157372_10683935 3300013307 Bacteria 1194
293 Ga0157372_10737980 3300013307 Bacteria 1145
294 Ga0157375_10300813 3300013308 Bacteria 1768
295 Ga0157375_10329666 3300013308 Bacteria 1691
296 Ga0157380_10682993 3300014326 Bacteria 1029
297 Ga0157380_10715459 3300014326 Bacteria 1008
298 Ga0182008_10001160 3300014497 Bacteria 18146
299 Ga0157377_10020642 3300014745 Bacteria 3454
300 Ga0157377_10078377 3300014745 Bacteria 1926
301 Ga0157377_10271874 3300014745 Bacteria 1107
302 Ga0157377_10622780 3300014745 Bacteria 773
303 Ga0157379_10149724 3300014968 Bacteria 2105
304 Ga0157379_10276392 3300014968 Bacteria 1528
305 Ga0157379_10429041 3300014968 Bacteria 1218
306 Ga0157376_10017065 3300014969 Bacteria 5529
307 Ga0157376_10308742 3300014969 Bacteria 1500
308 Ga0206356_11795030 3300020070 Bacteria 3790
309 Ga0206354_10312155 3300020081 Bacteria 2323
310 Ga0206353_10251350 3300020082 Bacteria 966
311 Ga0213874_10065631 3300021377 Bacteria 1147
312 Ga0213876_10011794 3300021384 Bacteria 4660
313 Ga0213876_10103288 3300021384 Bacteria 1511
314 Ga0213875_10031653 3300021388 Bacteria 2502
315 Ga0224712_10151072 3300022467 Bacteria 1029
316 Ga0224572_1002517 3300024225 Bacteria 2976
317 Ga0207692_10016955 3300025898 Bacteria 3238
318 Ga0207692_10037041 3300025898 Bacteria 2383
319 Ga0207642_10189393 3300025899 Bacteria 1128
320 Ga0207710_10060736 3300025900 Bacteria 1714
321 Ga0207710_10126449 3300025900 Bacteria 1225
322 Ga0207688_10015385 3300025901 Bacteria 4150
323 Ga0207688_10154157 3300025901 Bacteria 1359
324 Ga0207685_10011131 3300025905 Bacteria 2691
325 Ga0207685_10011459 3300025905 Bacteria 2666
326 Ga0207699_10092973 3300025906 Bacteria 1897
327 Ga0207699_10220468 3300025906 Bacteria 1294
328 Ga0207643_10007140 3300025908 Bacteria 5993
329 Ga0207643_10009105 3300025908 Bacteria 5332
330 Ga0207705_10156396 3300025909 Bacteria 1710
331 Ga0207684_10004905 3300025910 Bacteria 12487
332 Ga0207684_10025177 3300025910 Bacteria 5072
333 Ga0207684_10058735 3300025910 Bacteria 3264
334 Ga0207684_10126969 3300025910 Bacteria 2189
335 Ga0207654_10111649 3300025911 Bacteria 1702
336 Ga0207654_10300926 3300025911 Bacteria 1091
337 Ga0207707_10014798 3300025912 Bacteria 6796
338 Ga0207707_10271591 3300025912 Bacteria 1469
339 Ga0207707_10395945 3300025912 Bacteria 1186
340 Ga0207707_10435238 3300025912 Bacteria 1123
341 Ga0207695_10024882 3300025913 Bacteria 6719
342 Ga0207695_10648554 3300025913 Bacteria 937
343 Ga0207671_10155125 3300025914 Bacteria 1771
344 Ga0207693_10061471 3300025915 Bacteria 2942
345 Ga0207693_10326144 3300025915 Bacteria 1202
346 Ga0207693_10534866 3300025915 Bacteria 914
347 Ga0207663_10017491 3300025916 Bacteria 3996
348 Ga0207663_10201984 3300025916 Bacteria 1434
349 Ga0207663_10248784 3300025916 Bacteria 1307
350 Ga0207660_10070428 3300025917 Bacteria 2542
351 Ga0207660_10167477 3300025917 Bacteria 1699
352 Ga0207660_10179822 3300025917 Bacteria 1642
353 Ga0207660_10184771 3300025917 Bacteria 1621
354 Ga0207660_10251654 3300025917 Bacteria 1394
355 Ga0207662_10102698 3300025918 Bacteria 1773
356 Ga0207657_10014748 3300025919 Bacteria 7609
357 Ga0207657_10033988 3300025919 Bacteria 4591
358 Ga0207657_10494150 3300025919 Bacteria 959
359 Ga0207649_10101978 3300025920 Bacteria 1901
360 Ga0207649_10206450 3300025920 Bacteria 1391
361 Ga0207652_10135241 3300025921 Bacteria 2201
362 Ga0207652_10474144 3300025921 Bacteria 1127
363 Ga0207652_10534564 3300025921 Bacteria 1054
364 Ga0207652_10965432 3300025921 Bacteria 750
365 Ga0207646_10190041 3300025922 Bacteria 1854
366 Ga0207646_10248008 3300025922 Bacteria 1608
367 Ga0207694_10040285 3300025924 Bacteria 3596
368 Ga0207694_10393126 3300025924 Bacteria 1152
369 Ga0207650_10005497 3300025925 Bacteria 8649
370 Ga0207659_10139413 3300025926 Bacteria 1881
371 Ga0207659_10260783 3300025926 Bacteria 1410
372 Ga0207687_10030778 3300025927 Bacteria 3621
373 Ga0207687_10095592 3300025927 Bacteria 2176
374 Ga0207687_10132320 3300025927 Bacteria 1882
375 Ga0207687_10696348 3300025927 Bacteria 862
376 Ga0207700_10053854 3300025928 Bacteria 3017
377 Ga0207700_10088976 3300025928 Bacteria 2433
378 Ga0207700_10096013 3300025928 Bacteria 2352
379 Ga0207700_10096744 3300025928 Bacteria 2345
380 Ga0207700_10283946 3300025928 Bacteria 1425
381 Ga0207700_10321358 3300025928 Bacteria 1341
382 Ga0207664_10012616 3300025929 Bacteria 6046
383 Ga0207664_10015287 3300025929 Bacteria 5565
384 Ga0207664_10019040 3300025929 Bacteria 5067
385 Ga0207664_10020106 3300025929 Bacteria 4943
386 Ga0207664_10040672 3300025929 Bacteria 3617
387 Ga0207664_10108970 3300025929 Bacteria 2300
388 Ga0207664_10216709 3300025929 Bacteria 1658
389 Ga0207664_10291111 3300025929 Bacteria 1435
390 Ga0207664_10454055 3300025929 Bacteria 1144
391 Ga0207690_10021019 3300025932 Bacteria 4042
392 Ga0207706_10001708 3300025933 Bacteria 21650
393 Ga0207686_10284109 3300025934 Bacteria 1223
394 Ga0207709_10158391 3300025935 Bacteria 1576
395 Ga0207709_10270368 3300025935 Bacteria 1251
396 Ga0207709_10321604 3300025935 Bacteria 1158
397 Ga0207669_10024084 3300025937 Bacteria 3265
398 Ga0207704_10010480 3300025938 Bacteria 4526
399 Ga0207704_10113212 3300025938 Bacteria 1839
400 Ga0207665_10201861 3300025939 Bacteria 1449
401 Ga0207711_10427649 3300025941 Bacteria 1232
402 Ga0207689_10008051 3300025942 Bacteria 9200
403 Ga0207689_10045248 3300025942 Bacteria 3640
404 Ga0207661_10057950 3300025944 Bacteria 3116
405 Ga0207661_10083978 3300025944 Bacteria 2636
406 Ga0207661_10101387 3300025944 Bacteria 2418
407 Ga0207661_10173120 3300025944 Bacteria 1880
408 Ga0207661_10344392 3300025944 Bacteria 1344
409 Ga0207661_10958996 3300025944 Bacteria 788
410 Ga0207679_10149123 3300025945 Bacteria 1901
411 Ga0207667_10046064 3300025949 Bacteria 4617
412 Ga0207651_10021119 3300025960 Bacteria 3948
413 Ga0207640_10015284 3300025981 Bacteria 4440
414 Ga0207640_10050866 3300025981 Bacteria 2690
415 Ga0207640_10105216 3300025981 Bacteria 1988
416 Ga0207640_10136062 3300025981 Bacteria 1784
417 Ga0207640_10945265 3300025981 Bacteria 755
418 Ga0207677_10060971 3300026023 Bacteria 2610
419 Ga0207677_10242627 3300026023 Bacteria 1459
420 Ga0207703_10108140 3300026035 Bacteria 2368
421 Ga0207703_10404338 3300026035 Bacteria 1267
422 Ga0207703_10901518 3300026035 Bacteria 846
423 Ga0207639_10017717 3300026041 Bacteria 5051
424 Ga0207639_10103927 3300026041 Unclassified 2302
425 Ga0207639_10504220 3300026041 Bacteria 1106
426 Ga0207639_10803645 3300026041 Bacteria 876
427 Ga0207708_10738336 3300026075 Bacteria 844
428 Ga0207702_10019420 3300026078 Bacteria 5623
429 Ga0207702_10100171 3300026078 Bacteria 2555
430 Ga0207702_10121343 3300026078 Bacteria 2340
431 Ga0207702_10136692 3300026078 Bacteria 2212
432 Ga0207702_10152371 3300026078 Bacteria 2104
433 Ga0207702_10225602 3300026078 Bacteria 1748
434 Ga0207702_10658471 3300026078 Bacteria 1030
435 Ga0207641_10057603 3300026088 Bacteria 3305
436 Ga0207641_10131369 3300026088 Bacteria 2249
437 Ga0207648_10247535 3300026089 Bacteria 1589
438 Ga0207676_10400419 3300026095 Bacteria 1283
439 Ga0207676_10889832 3300026095 Bacteria 873
440 Ga0207674_10043768 3300026116 Bacteria 4615
441 Ga0207674_10068041 3300026116 Bacteria 3585
442 Ga0207674_10078878 3300026116 Bacteria 3298
443 Ga0207674_10242877 3300026116 Bacteria 1748
444 Ga0207675_100764814 3300026118 Bacteria 978
445 Ga0207683_10306535 3300026121 Bacteria 1453
446 Ga0207698_10010798 3300026142 Bacteria 5891
447 Ga0207698_10412888 3300026142 Bacteria 1293
448 Ga0207698_10626475 3300026142 Bacteria 1063
449 Ga0207698_11105044 3300026142 Bacteria 806
450 Ga0207428_10004529 3300027907 Bacteria 13182
451 Ga0207428_10010924 3300027907 Bacteria 8082
452 Ga0265762_1024003 3300030760 Bacteria 1132
453 Ga0265760_10035877 3300031090 Bacteria 1469
454 Ga0307408_100159000 3300031548 Bacteria 1792
455 Ga0316575_10056557 3300031665 Bacteria 1563
456 Ga0316576_10029789 3300031727 Bacteria 3861
457 Ga0316576_10042306 3300031727 Bacteria 3283
458 Ga0316578_10242410 3300031728 Bacteria 1082
459 Ga0307405_10098997 3300031731 Bacteria 1951
460 Ga0307405_10135322 3300031731 Bacteria 1710
461 Ga0307405_10223811 3300031731 Bacteria 1382
462 Ga0316577_10007320 3300031733 Bacteria 5890
463 Ga0316577_10009957 3300031733 Bacteria 5126
464 Ga0316577_10023035 3300031733 Bacteria 3459
465 Ga0316577_10040667 3300031733 Bacteria 2600
466 Ga0316577_10058853 3300031733 Bacteria 2145
467 Ga0316577_10121501 3300031733 Bacteria 1468
468 Ga0316577_10210201 3300031733 Bacteria 1100
469 Ga0307413_10518096 3300031824 Bacteria 961
470 Ga0307410_10147517 3300031852 Bacteria 1747
471 Ga0307410_10763226 3300031852 Bacteria 820
472 Ga0307406_10040316 3300031901 Bacteria 2903
473 Ga0307406_10158274 3300031901 Bacteria 1625
474 Ga0307406_10813966 3300031901 Bacteria 789
475 Ga0307407_10059094 3300031903 Bacteria 2231
476 Ga0307407_10142511 3300031903 Bacteria 1548
477 Ga0307412_10335332 3300031911 Bacteria 1208
478 Ga0307409_100019324 3300031995 Bacteria 4609
479 Ga0307409_100093422 3300031995 Bacteria 2472
480 Ga0307409_100099348 3300031995 Bacteria 2410
481 Ga0307409_100388815 3300031995 Bacteria 1329
482 Ga0307409_100546299 3300031995 Bacteria 1136
483 Ga0307409_100785905 3300031995 Bacteria 958
484 Ga0307409_101521272 3300031995 Bacteria 697
485 Ga0307416_100081850 3300032002 Bacteria 2732
486 Ga0307416_100090626 3300032002 Bacteria 2623
487 Ga0307416_100185296 3300032002 Bacteria 1956
488 Ga0307416_100451406 3300032002 Bacteria 1338
489 Ga0307416_100499388 3300032002 Bacteria 1280
490 Ga0307414_10257448 3300032004 Bacteria 1454
491 Ga0307411_10581153 3300032005 Bacteria 960
492 Ga0307415_100191437 3300032126 Bacteria 1614
493 Ga0307415_100416588 3300032126 Bacteria 1151
494 Ga0307415_100479016 3300032126 Bacteria 1083
495 Ga0307415_100499803 3300032126 Bacteria 1063
496 Ga0307415_100784094 3300032126 Bacteria 868
497 Ga0316593_10127385 3300032168 Bacteria 917
498 Ga0373930_0040628 3300034816 Bacteria 990
499 Ga0373926_0000850 3300035083 Bacteria 8708
500 Ga0373944_0000427 3300035089 Bacteria 9635
501 Ga0373923_0071602 3300035111 Bacteria 1489
502 Ga0373923_0201338 3300035111 Bacteria 920
503 Ga0373936_0000725 3300035113 Bacteria 11524
504 Ga0373936_0087869 3300035113 Bacteria 1300
505 Ga0373939_0079959 3300035114 Bacteria 1084
506 Ga0373945_0000016 3300035116 Bacteria 34712
507 Ga0373953_0014461 3300035117 Bacteria 2839
508 Ga0373954_0294302 3300035118 Bacteria 801
509 Ga0373956_0088111 3300035119 Bacteria 1430
510 Ga0373956_0100846 3300035119 Bacteria 1339
511 Ga0373957_0069290 3300035120 Bacteria 1377
512 Ga0373960_0008112 3300035121 Bacteria 2509
513 Ga0373943_0003777 3300035170 Bacteria 6877
514 Ga0373946_0002742 3300035171 Bacteria 6227
515 Ga0373955_0024987 3300035172 Bacteria 3062
516 Ga0373955_0090468 3300035172 Bacteria 1743
517 Ga0373955_0183880 3300035172 Bacteria 1241
518 Ga0373931_0079397 3300035691 Bacteria 1807
519 Ga0373935_0049972 3300035692 Bacteria 2652
520 Ga0373927_0000603 3300035695 Bacteria 27426
521 Ga0373933_0017769 3300035724 Bacteria 3990
522 Ga0373933_0047517 3300035724 Bacteria 2553
523 Ga0373947_0005652 3300035725 Bacteria 7298
524 Ga0373937_0323460 3300036401 Bacteria 1459
525 Ga0373937_0370964 3300036401 Bacteria 1357
526 Ga0373937_0655759 3300036401 Bacteria 995
527 Ga0373937_0774104 3300036401 Bacteria 907
528 Ga0372808_018167 3300036459 Bacteria 1010
529 Ga0316582_0003740 3300036647 Bacteria 7538
530 Ga0316582_0009839 3300036647 Bacteria 5206
531 Ga0316582_0022693 3300036647 Bacteria 3730
532 Ga0316582_0040653 3300036647 Bacteria 2903
533 Ga0316582_0076245 3300036647 Bacteria 2180
534 Ga0316582_0128240 3300036647 Unclassified 1702
535 Ga0316582_0649400 3300036647 Bacteria 725
536 Ga0316582_0728194 3300036647 Bacteria 681
537 Ga0316584_0002012 3300036712 Bacteria 12709
538 Ga0316584_0002431 3300036712 Bacteria 11784
539 Ga0316584_0006499 3300036712 Bacteria 7916
540 Ga0316584_0043912 3300036712 Bacteria 3333
541 Ga0316584_0110346 3300036712 Bacteria 2059
542 Ga0316584_0167913 3300036712 Bacteria 1629
543 Ga0373925_0013934 3300037068 Bacteria 5819
544 Ga0373925_0365475 3300037068 Bacteria 1173
545 Ga0373925_0735365 3300037068 Bacteria 813
546 Ga0395899_0002678 3300037312 Bacteria 14361
547 Ga0395899_0009721 3300037312 Bacteria 7381
548 Ga0395899_0012401 3300037312 Bacteria 6528
549 Ga0395899_0032840 3300037312 Bacteria 3900
550 Ga0395899_0040952 3300037312 Bacteria 3463
551 Ga0395899_0170517 3300037312 Bacteria 1533
552 Ga0395900_0001398 3300037418 Bacteria 28860
553 Ga0395900_0001553 3300037418 Bacteria 27276
554 Ga0395900_0015596 3300037418 Bacteria 7745
555 Ga0395900_0030269 3300037418 Bacteria 5556
556 Ga0395900_0036974 3300037418 Bacteria 5033
557 Ga0395900_0168383 3300037418 Bacteria 2232
558 Ga0395900_0196178 3300037418 Bacteria 2045
559 Ga0395900_0304109 3300037418 Bacteria 1580
560 Ga0395900_0926296 3300037418 Bacteria 794
561 Ga0395898_0006056 3300037466 Bacteria 12983
562 Ga0395898_0011885 3300037466 Bacteria 9014
563 Ga0395898_0011908 3300037466 Bacteria 9008
564 Ga0395898_0037487 3300037466 Bacteria 4808
565 Ga0395898_0054109 3300037466 Bacteria 3917
566 Ga0395898_0085276 3300037466 Bacteria 3044
567 Ga0395898_0335494 3300037466 Bacteria 1442
568 Ga0395898_0624861 3300037466 Bacteria 1020
569 Ga0395905_0005069 3300037471 Bacteria 13555
570 Ga0395905_0005379 3300037471 Bacteria 13089
571 Ga0395905_0019192 3300037471 Bacteria 6483
572 Ga0395905_0019785 3300037471 Bacteria 6381
573 Ga0395905_0107499 3300037471 Bacteria 2619
574 Ga0316581_0003136 3300037588 Bacteria 4079
575 Ga0316581_0006601 3300037588 Bacteria 3078
576 Ga0316581_0047903 3300037588 Bacteria 1308
577 Ga0316581_0052532 3300037588 Bacteria 1249
578 Ga0436364_0008721 3300037853 Bacteria 2943
579 Ga0436364_0267484 3300037853 Bacteria 859
580 Ga0436364_1142277 3300037853 Bacteria 3039
581 Ga0436364_1209434 3300037853 Bacteria 1935
582 Ga0436364_1288039 3300037853 Bacteria 4203
583 Ga0436364_1403969 3300037853 Bacteria 3691
584 Ga0436364_1409644 3300037853 Bacteria 3116
585 Ga0436364_1538459 3300037853 Bacteria 3734
586 Ga0395901_0000717 3300038443 Bacteria 37735
587 Ga0395901_0000739 3300038443 Bacteria 36910
588 Ga0395901_0003414 3300038443 Bacteria 16004
589 Ga0395901_0008492 3300038443 Bacteria 10380
590 Ga0395901_0035478 3300038443 Bacteria 5152
591 Ga0395901_0052750 3300038443 Bacteria 4227
592 Ga0395901_0085519 3300038443 Bacteria 3297
593 Ga0395901_0159342 3300038443 Bacteria 2370
594 Ga0436365_0072895 3300039437 Bacteria 53725
595 Ga0436365_0158783 3300039437 Bacteria 16629
596 Ga0436365_0376109 3300039437 Bacteria 2162
597 Ga0436365_0412674 3300039437 Bacteria 2955
598 Ga0436365_0686913 3300039437 Bacteria 4450
599 Ga0436365_0783550 3300039437 Bacteria 2193
600 Ga0436365_0892906 3300039437 Bacteria 2473
601 Ga0436365_1088316 3300039437 Bacteria 5578
602 Ga0436365_1674485 3300039437 Bacteria 6787
603 Ga0436360_0139542 3300039438 Bacteria 964
604 Ga0436363_0535202 3300039450 Bacteria 1047
605 Ga0436362_0583696 3300039453 Bacteria 1330
606 Ga0451855_1240075 3300041511 Bacteria 1685
607 Ga0451853_1781216 3300041512 Bacteria 4609
608 Ga0439460_0023712 3300042461 Bacteria 1694
609 Ga0451577_0642771 3300042876 Bacteria 962
610 Ga0453683_0469580 3300044673 Bacteria 815
611 Ga0466965_0449008 3300044683 Bacteria 718
612 Ga0466961_0035163 3300044693 Bacteria 3217
613 Ga0466961_0058716 3300044693 Bacteria 2447
614 Ga0466961_0251301 3300044693 Bacteria 1086
615 Ga0466961_0300690 3300044693 Bacteria 980
616 Ga0466963_0000393 3300044694 Bacteria 19938
617 Ga0466963_0001530 3300044694 Bacteria 12527
618 Ga0466963_0009403 3300044694 Bacteria 5886
619 Ga0466963_0150068 3300044694 Bacteria 1618
620 Ga0466963_0767051 3300044694 Bacteria 680
621 Ga0466964_0080937 3300044706 Bacteria 1394
622 Ga0466971_0031658 3300044719 Bacteria 2369
623 Ga0466971_0078005 3300044719 Bacteria 1509
624 Ga0466957_0003328 3300044842 Bacteria 8810
625 Ga0466957_0023118 3300044842 Bacteria 3672
626 Ga0466957_0069155 3300044842 Bacteria 2181
627 Ga0466957_0183013 3300044842 Bacteria 1369
628 Ga0466957_0617008 3300044842 Bacteria 760
629 Ga0466960_0015922 3300044901 Bacteria 3250
630 Ga0466960_0020023 3300044901 Bacteria 2957
631 Ga0466960_0060694 3300044901 Bacteria 1854
632 Ga0466959_0000356 3300045049 Bacteria 26996
633 Ga0466959_0048231 3300045049 Bacteria 3130
634 Ga0466959_0090391 3300045049 Bacteria 2199
635 Ga0466959_0406392 3300045049 Bacteria 925
636 Ga0466958_0000216 3300045836 Bacteria 21669
637 Ga0466958_0014864 3300045836 Bacteria 4449
638 Ga0466958_0016646 3300045836 Bacteria 4237
639 Ga0466958_0151815 3300045836 Bacteria 1461
640 Ga0466958_0188805 3300045836 Bacteria 1309
641 Ga0466958_0271671 3300045836 Bacteria 1086
642 Ga0466967_0002039 3300045976 Bacteria 12328
643 Ga0466967_0004347 3300045976 Bacteria 9536
644 Ga0466967_0043158 3300045976 Bacteria 3903
645 Ga0466967_0062597 3300045976 Bacteria 3303
646 Ga0466967_0067051 3300045976 Bacteria 3200
647 Ga0466967_0076948 3300045976 Bacteria 3002
648 Ga0466967_0088111 3300045976 Bacteria 2815
649 Ga0466967_0091524 3300045976 Bacteria 2764
650 Ga0466967_0130075 3300045976 Bacteria 2336
651 Ga0466967_0154634 3300045976 Bacteria 2147
652 Ga0466967_0220423 3300045976 Bacteria 1802
653 Ga0466967_0612740 3300045976 Bacteria 1075
654 Ga0466967_0779832 3300045976 Bacteria 949
655 Ga0466967_0903951 3300045976 Bacteria 878
656 Ga0495592_0000671 3300046454 Bacteria 23792
657 Ga0495592_0152210 3300046454 Bacteria 1599
658 Ga0495603_0049672 3300046455 Bacteria 2497
659 Ga0495629_0130807 3300046459 Bacteria 1748
660 Ga0495629_0209159 3300046459 Bacteria 1347
661 Ga0495629_0277700 3300046459 Bacteria 1150
662 Ga0495641_0016479 3300046461 Bacteria 3894
663 Ga0495641_0140390 3300046461 Bacteria 1079
664 Ga0495651_0000343 3300046462 Bacteria 36011
665 Ga0495651_0029312 3300046462 Bacteria 4291
666 Ga0495653_0000660 3300046463 Bacteria 26383
667 Ga0495653_0001368 3300046463 Bacteria 18935
668 Ga0495653_0007461 3300046463 Bacteria 8945
669 Ga0495653_0341169 3300046463 Bacteria 966
670 Ga0495580_0561173 3300046472 Bacteria 757
671 Ga0495582_0048478 3300046473 Bacteria 2339
672 Ga0495582_0294863 3300046473 Bacteria 932
673 Ga0495605_0143874 3300046474 Bacteria 1068
674 Ga0495662_0068529 3300046476 Bacteria 1718
675 Ga0495664_0002456 3300046477 Bacteria 9974
676 Ga0495664_0095117 3300046477 Bacteria 1793
677 Ga0495664_0132459 3300046477 Bacteria 1510
678 Ga0495664_0208780 3300046477 Bacteria 1183
679 Ga0495596_0145402 3300046500 Bacteria 921
680 Ga0495608_0035402 3300046511 Bacteria 3367
681 Ga0495608_0083535 3300046511 Bacteria 2073
682 Ga0495608_0229771 3300046511 Bacteria 1162
683 Ga0495618_0157017 3300046514 Bacteria 1451
684 Ga0495628_0182654 3300046516 Bacteria 1586
685 Ga0495630_0000068 3300046517 Bacteria 82887
686 Ga0495630_0012662 3300046517 Bacteria 6129
687 Ga0495630_0021778 3300046517 Bacteria 4734
688 Ga0495630_0217614 3300046517 Bacteria 1458
689 Ga0495630_0780919 3300046517 Bacteria 729
690 Ga0495631_0050761 3300046518 Bacteria 1814
691 Ga0495666_0009191 3300046526 Bacteria 4943
692 Ga0495652_0001806 3300046529 Bacteria 22778
693 Ga0495652_0017563 3300046529 Bacteria 6383
694 Ga0495652_0282252 3300046529 Bacteria 1215
695 Ga0495665_0056122 3300046531 Bacteria 2079
696 Ga0495640_0001702 3300046533 Bacteria 17428
697 Ga0495640_0015158 3300046533 Bacteria 5806
698 Ga0495640_0097486 3300046533 Bacteria 1933
699 Ga0495586_0000424 3300046535 Bacteria 25680
700 Ga0495586_0145547 3300046535 Bacteria 1331
701 Ga0495587_0000910 3300046536 Bacteria 19549
702 Ga0495609_0231489 3300046538 Bacteria 765
703 Ga0495645_0002232 3300046543 Bacteria 13172
704 Ga0495645_0031437 3300046543 Bacteria 3869
705 Ga0495645_0249631 3300046543 Bacteria 1180
706 Ga0495667_0001093 3300046559 Bacteria 17603
707 Ga0495667_0004696 3300046559 Bacteria 9236
708 Ga0495667_0044457 3300046559 Bacteria 2942
709 Ga0495667_0053223 3300046559 Bacteria 2666
710 Ga0495667_0272828 3300046559 Bacteria 1074
711 Ga0495656_0127312 3300046615 Bacteria 1209
712 Ga0495668_0141436 3300046616 Bacteria 1317
713 Ga0495634_0030756 3300046642 Unclassified 3704
714 Ga0495634_0072491 3300046642 Bacteria 2265
715 Ga0495634_0209748 3300046642 Bacteria 1206
716 Ga0495635_0006235 3300046663 Bacteria 8307
717 Ga0495635_0061335 3300046663 Bacteria 2583
718 Ga0495657_0014780 3300046675 Bacteria 5728
719 Ga0495657_0034955 3300046675 Bacteria 3487
720 Ga0495657_0067922 3300046675 Bacteria 2338
721 Ga0495657_0232577 3300046675 Bacteria 1114
722 Ga0495599_0000322 3300046678 Bacteria 28608
723 Ga0495599_0015298 3300046678 Bacteria 4760
724 Ga0495599_0091129 3300046678 Bacteria 1902
725 Ga0495623_0016946 3300046679 Bacteria 4706
726 Ga0495646_0007879 3300046680 Bacteria 6763
727 Ga0495647_0096139 3300046681 Bacteria 1221
728 Ga0495658_0104845 3300046683 Bacteria 1693
729 Ga0495613_0148439 3300046689 Bacteria 1673
730 Ga0495613_0209167 3300046689 Bacteria 1372
731 Ga0495613_0227944 3300046689 Bacteria 1306
732 Ga0495624_0017865 3300046690 Bacteria 4752
733 Ga0495624_0361275 3300046690 Bacteria 873
734 Ga0495670_0272293 3300046691 Bacteria 905
735 Ga0495589_0131922 3300046794 Bacteria 1199
736 Ga0495589_0215258 3300046794 Bacteria 904
737 Ga0495600_0003060 3300046809 Bacteria 9770
738 Ga0495600_0044953 3300046809 Bacteria 2881
739 Ga0495581_0017834 3300047315 Bacteria 4125
740 Ga0495604_0003558 3300047317 Bacteria 12433
741 Ga0495604_0297070 3300047317 Bacteria 1086
742 Ga0495674_0012698 3300047319 Bacteria 7937
743 Ga0495674_0035554 3300047319 Bacteria 4492
744 Ga0495674_0172764 3300047319 Bacteria 1803
745 Ga0495674_0187628 3300047319 Bacteria 1720
746 Ga0495674_0240744 3300047319 Bacteria 1491
747 Ga0495676_0003229 3300047321 Bacteria 14734
748 Ga0495680_0007542 3300047322 Bacteria 9949
749 Ga0495680_0010294 3300047322 Bacteria 8343
750 Ga0495680_0047943 3300047322 Bacteria 3357
751 Ga0495675_0021210 3300047444 Bacteria 4136
752 Ga0495684_0001092 3300047471 Bacteria 21874
753 Ga0495684_0022777 3300047471 Bacteria 4817
754 Ga0495684_0032181 3300047471 Bacteria 4025
755 Ga0495593_0262462 3300047673 Bacteria 864
756 Ga0495602_0049528 3300048088 Bacteria 3762
757 Ga0495602_0155188 3300048088 Bacteria 1793
758 Ga0496100_0041686 3300048903 Bacteria 2928
759 Ga0496100_0059632 3300048903 Bacteria 2508
760 Ga0496100_0063457 3300048903 Bacteria 2441
761 Ga0496100_0080117 3300048903 Bacteria 2202
762 Ga0496100_0893422 3300048903 Bacteria 698
763 Ga0496101_0017483 3300048904 Bacteria 4865
764 Ga0496101_0027637 3300048904 Bacteria 3954
765 Ga0496101_0038850 3300048904 Bacteria 3382
766 Ga0496101_0116070 3300048904 Bacteria 2020
767 Ga0496101_0127698 3300048904 Bacteria 1928
768 Ga0496101_0186635 3300048904 Bacteria 1599
769 Ga0496102_0076065 3300048905 Bacteria 3087
770 Ga0496102_0080572 3300048905 Bacteria 2999
771 Ga0496102_0125444 3300048905 Bacteria 2399
772 Ga0496102_0421004 3300048905 Bacteria 1255
773 Ga0496102_0545626 3300048905 Bacteria 1082
774 Ga0496102_0785338 3300048905 Bacteria 875
775 Ga0496103_0026668 3300048906 Bacteria 3498
776 Ga0496103_0162758 3300048906 Bacteria 1431
777 Ga0496103_0169681 3300048906 Bacteria 1401
778 Ga0496103_0192825 3300048906 Bacteria 1310
779 Ga0496103_0216923 3300048906 Bacteria 1230
780 Ga0496104_0002448 3300048907 Bacteria 15981
781 Ga0496104_0032830 3300048907 Bacteria 4832
782 Ga0496104_0062634 3300048907 Bacteria 3527
783 Ga0496104_0210703 3300048907 Bacteria 1855
784 Ga0496104_0217998 3300048907 Bacteria 1820
785 Ga0496104_0219401 3300048907 Bacteria 1814
786 Ga0496104_0629700 3300048907 Bacteria 982
787 Ga0496104_0677055 3300048907 Bacteria 940
788 Ga0496104_0988260 3300048907 Bacteria 746
789 Ga0496104_1206526 3300048907 Bacteria 660
790 Ga0496105_0024543 3300048908 Bacteria 4899
791 Ga0496105_0068611 3300048908 Bacteria 2929
792 Ga0496105_0108652 3300048908 Bacteria 2290
793 Ga0496105_0439884 3300048908 Bacteria 1030
794 Ga0496105_0514030 3300048908 Bacteria 939
795 Ga0496105_0681904 3300048908 Bacteria 790
796 Ga0496106_0005498 3300048909 Bacteria 9368
797 Ga0496106_0035181 3300048909 Bacteria 3745
798 Ga0496106_0039724 3300048909 Bacteria 3524
799 Ga0496106_0146001 3300048909 Bacteria 1863
800 Ga0496106_0269644 3300048909 Bacteria 1363
801 Ga0496106_0358576 3300048909 Bacteria 1171
802 Ga0496106_0710939 3300048909 Bacteria 800
803 Ga0496107_0014815 3300048910 Bacteria 5458
804 Ga0496107_0016122 3300048910 Bacteria 5243
805 Ga0496107_0035843 3300048910 Bacteria 3558
806 Ga0496107_0194154 3300048910 Bacteria 1509
807 Ga0496107_0289950 3300048910 Bacteria 1218
808 Ga0496108_0001060 3300048911 Bacteria 21455
809 Ga0496108_0007206 3300048911 Bacteria 9014
810 Ga0496108_0019457 3300048911 Bacteria 5576
811 Ga0496108_0020163 3300048911 Bacteria 5479
812 Ga0496108_0264516 3300048911 Bacteria 1497
813 Ga0496108_0286891 3300048911 Bacteria 1433
814 Ga0496108_0682466 3300048911 Bacteria 891
815 Ga0496108_0687773 3300048911 Bacteria 888
816 Ga0496109_0018823 3300048912 Bacteria 6075
817 Ga0496109_0048979 3300048912 Bacteria 3845
818 Ga0496109_0052245 3300048912 Bacteria 3724
819 Ga0496109_0080760 3300048912 Bacteria 2996
820 Ga0496109_0103630 3300048912 Bacteria 2641
821 Ga0496109_0111883 3300048912 Bacteria 2539
822 Ga0496109_0154180 3300048912 Bacteria 2151
823 Ga0496109_0182500 3300048912 Bacteria 1971
824 Ga0496109_0195902 3300048912 Bacteria 1899
825 Ga0496109_0208888 3300048912 Bacteria 1836
826 Ga0496109_0210320 3300048912 Bacteria 1829
827 Ga0496109_0326049 3300048912 Bacteria 1449
828 Ga0496109_0450058 3300048912 Bacteria 1216
829 Ga0496109_0456984 3300048912 Bacteria 1206
830 Ga0496109_0556368 3300048912 Bacteria 1082
831 Ga0496109_0640772 3300048912 Bacteria 999
832 Ga0496109_0990666 3300048912 Bacteria 778
833 Ga0496110_0068322 3300048913 Bacteria 3145
834 Ga0496110_0079875 3300048913 Bacteria 2913
835 Ga0496110_0130740 3300048913 Bacteria 2267
836 Ga0496110_0186664 3300048913 Bacteria 1883
837 Ga0496110_0215065 3300048913 Bacteria 1748
838 Ga0496110_0744282 3300048913 Bacteria 883
839 Ga0496111_0063357 3300048914 Bacteria 2681
840 Ga0496111_0325329 3300048914 Bacteria 1138
841 Ga0496111_0658351 3300048914 Bacteria 764
842 Ga0496112_0003576 3300048915 Bacteria 12917
843 Ga0496112_0009272 3300048915 Bacteria 8849
844 Ga0496112_0058888 3300048915 Bacteria 3784
845 Ga0496112_0159954 3300048915 Bacteria 2219
846 Ga0496112_0288621 3300048915 Bacteria 1587
847 Ga0496112_0411940 3300048915 Bacteria 1291
848 Ga0496112_0611899 3300048915 Bacteria 1021
849 Ga0496112_0622222 3300048915 Bacteria 1011
850 Ga0496112_0937325 3300048915 Bacteria 787
851 Ga0496113_0004264 3300048916 Bacteria 8760
852 Ga0496113_0056538 3300048916 Bacteria 2946
853 Ga0496113_0127393 3300048916 Bacteria 1995
854 Ga0496113_0158349 3300048916 Bacteria 1789
855 Ga0496113_0162212 3300048916 Bacteria 1767
856 Ga0496113_0450043 3300048916 Bacteria 1035
857 Ga0496114_0045290 3300048917 Bacteria 3654
858 Ga0496114_0134296 3300048917 Bacteria 2139
859 Ga0496114_0478269 3300048917 Bacteria 1102
860 Ga0496115_0006516 3300048918 Bacteria 8559
861 Ga0496115_0062587 3300048918 Bacteria 3002
862 Ga0496115_0086716 3300048918 Bacteria 2554
863 Ga0496115_0193330 3300048918 Bacteria 1681
864 Ga0496115_0252182 3300048918 Bacteria 1453
865 Ga0501031_0000063 3300049568 Bacteria 57266
866 Ga0501031_0293090 3300049568 Bacteria 1055
867 Ga0501031_0571606 3300049568 Bacteria 728
868 Ga0501032_0003604 3300049569 Bacteria 11794
869 Ga0501033_0000871 3300049570 Bacteria 27583
870 Ga0501034_0408569 3300049571 Bacteria 1280
871 Ga0501036_0002119 3300049572 Bacteria 15495
872 Ga0501036_0029451 3300049572 Bacteria 4637
873 Ga0501036_0264016 3300049572 Bacteria 1442
874 Ga0501036_0491844 3300049572 Bacteria 1021
875 Ga0501037_0008933 3300049573 Bacteria 7342
876 Ga0501038_0004494 3300049574 Bacteria 12972
877 Ga0501039_0000075 3300049575 Bacteria 74491
878 Ga0501039_0056778 3300049575 Bacteria 3033
879 Ga0501040_0013292 3300049576 Bacteria 5414
880 Ga0501040_0026672 3300049576 Bacteria 3887
881 Ga0501040_0109887 3300049576 Bacteria 1928
882 Ga0501041_0291684 3300049577 Bacteria 1027
883 Ga0501042_0084119 3300049578 Bacteria 2281
884 Ga0501043_0004209 3300049579 Bacteria 11746
885 Ga0501046_0001429 3300049580 Bacteria 22955
886 Ga0501047_0016589 3300049581 Bacteria 7031
887 Ga0501047_0237817 3300049581 Bacteria 1673
888 Ga0501048_0001098 3300049582 Bacteria 20306
889 Ga0501067_0009560 3300049583 Bacteria 5372
890 Ga0501067_0123535 3300049583 Bacteria 1441
891 Ga0501068_0175824 3300049584 Bacteria 1352
892 Ga0501068_0179548 3300049584 Bacteria 1338
893 Ga0501068_0267041 3300049584 Bacteria 1092
894 Ga0501069_0005707 3300049585 Bacteria 6484
895 Ga0501069_0040125 3300049585 Bacteria 2587
896 Ga0501069_0313880 3300049585 Bacteria 920
897 Ga0501070_0001223 3300049586 Bacteria 22991
898 Ga0501071_0201962 3300049587 Bacteria 1493
899 Ga0501071_0491798 3300049587 Bacteria 941
900 Ga0501072_0023198 3300049588 Bacteria 4819
901 Ga0501072_0027608 3300049588 Bacteria 4428
902 Ga0501072_0042615 3300049588 Bacteria 3565
903 Ga0501072_0179081 3300049588 Bacteria 1691
904 Ga0501073_0004877 3300049589 Bacteria 10071
905 Ga0501074_0000308 3300049590 Bacteria 28286
906 Ga0501074_0510393 3300049590 Bacteria 852
907 Ga0501074_0592922 3300049590 Bacteria 784
908 Ga0501075_0011725 3300049591 Bacteria 6212
909 Ga0501075_0094604 3300049591 Bacteria 2268
910 Ga0501075_0434711 3300049591 Bacteria 1001
911 Ga0501075_0476636 3300049591 Bacteria 952
912 Ga0501076_0054865 3300049592 Bacteria 3159
913 Ga0501076_0112492 3300049592 Bacteria 2202
914 Ga0501076_0123882 3300049592 Bacteria 2093
915 Ga0501076_0278338 3300049592 Bacteria 1371
916 Ga0501076_0307952 3300049592 Bacteria 1299
917 Ga0501077_0010472 3300049593 Bacteria 5771
918 Ga0501233_189021 3300049668 Unclassified 594
919 Ga0501079_0077786 3300049741 Bacteria 2566
920 Ga0501079_0113193 3300049741 Bacteria 2109
921 Ga0501079_0173001 3300049741 Bacteria 1684
922 Ga0501079_0266889 3300049741 Bacteria 1338
923 Ga0501080_0000212 3300049742 Bacteria 43139
924 Ga0501083_0136930 3300049744 Bacteria 1604
925 Ga0501083_0360945 3300049744 Bacteria 945
926 Ga0501035_0009419 3300049822 Bacteria 9080
927 Ga0501044_0018094 3300049823 Bacteria 7556
928 Ga0501045_0022231 3300049824 Bacteria 4539
929 Ga0501045_0024470 3300049824 Bacteria 4336
930 Ga0501045_0240115 3300049824 Bacteria 1349
931 Ga0501045_0288724 3300049824 Bacteria 1221
932 Ga0501045_0298973 3300049824 Bacteria 1198
933 nmdc:mga03683_88519_c1 3300050489 Bacteria 1347
934 nmdc:mga00v17_12882_c1 3300050491 Bacteria 4627
935 nmdc:mga00v17_471648_c1 3300050491 Bacteria 814
936 nmdc:mga0yw44_19049_c1 3300050492 Bacteria 3776
937 nmdc:mga0yw44_3539_c1 3300050492 Bacteria 6960
938 nmdc:mga06z11_126523_c1 3300050494 Bacteria 1430
939 nmdc:mga05p37_101832_c1 3300050507 Bacteria 3537
940 nmdc:mga05p37_114437_c1 3300050507 Bacteria 3316
941 nmdc:mga05p37_156393_c1 3300050507 Bacteria 2786
942 nmdc:mga05p37_864712_c1 3300050507 Bacteria 980
943 nmdc:mga05p37_9080_c1 3300050507 Bacteria 11748
944 nmdc:mga09592_45988_c1 3300050508 Bacteria 3677
945 nmdc:mga0qj67_7035_c1 3300050509 Bacteria 8294
946 nmdc:mga08y16_18764_c1 3300050511 Bacteria 7287
947 nmdc:mga08y16_206790_c1 3300050511 Bacteria 2033
948 nmdc:mga08y16_4867_c1 3300050511 Bacteria 14021
949 nmdc:mga0n895_1097876_c1 3300050512 Bacteria 773
950 nmdc:mga0n895_202053_c1 3300050512 Bacteria 2018
951 nmdc:mga0n895_202703_c1 3300050512 Bacteria 2014
952 nmdc:mga0n895_327641_c1 3300050512 Bacteria 1552
953 nmdc:mga0n895_924163_c1 3300050512 Bacteria 857
954 nmdc:mga0rr50_194419_c1 3300050513 Bacteria 1664
955 nmdc:mga0rr50_417963_c1 3300050513 Bacteria 1134
956 nmdc:mga0rr50_463513_c1 3300050513 Bacteria 1075
957 nmdc:mga0rr50_782695_c1 3300050513 Bacteria 814
958 nmdc:mga08x19_70293_c1 3300050514 Bacteria 2281
959 nmdc:mga0a205_927073_c1 3300050515 Bacteria 718
960 Ga0495601_0011985 3300053077 Bacteria 5194
961 Ga0495601_0147656 3300053077 Bacteria 1535
962 Ga0495601_0243940 3300053077 Bacteria 1173
963 Ga0495612_0081359 3300053078 Bacteria 1361
964 Ga0495612_0129170 3300053078 Bacteria 1091
965 Ga0495619_0080609 3300053085 Bacteria 2191
966 Ga0495619_0140698 3300053085 Bacteria 1661
967 Ga0500660_083868 3300053100 Bacteria 1449
968 Ga0501084_0002422 3300054114 Bacteria 15014
969 Ga0501084_0068348 3300054114 Bacteria 2974
970 Ga0501084_0104327 3300054114 Bacteria 2381
971 Ga0501084_0156861 3300054114 Bacteria 1920
972 Ga0501084_0167692 3300054114 Bacteria 1853
973 Ga0466962_0092214 3300061719 Bacteria 1452
974 Ga0466962_0125328 3300061719 Bacteria 1240
975 Ga0466962_0187106 3300061719 Bacteria 1010
976 Ga0530510_0043590 3300061734 Bacteria 3241
977 Ga0530510_0262821 3300061734 Bacteria 1287
978 Ga0530510_0320375 3300061734 Bacteria 1162
979 Ga0530510_0608927 3300061734 Bacteria 831
980 2891554891 2891554331 Bacteria 8812224
981 2895431004 2895427314 Bacteria 13147766
982 Ga0316579_10000738
983 JGI24743J22301_10002892
984 JGI25407J50210_10000692
985 JGI25407J50210_10014402
986 JGI25407J50210_10025306
987 Ga0058863_11604478
988 Ga0070658_10004524
989 Ga0070658_10309951
990 Ga0070683_100001072
991 Ga0070683_100022724
992 Ga0070683_100027093
993 Ga0070683_100108694
994 Ga0070683_100285013
995 Ga0070683_100346078
996 Ga0070683_101002896
997 Ga0070670_100000651
998 Ga0068869_100512161
999 Ga0070680_100004355
1000 Ga0070680_100055736
1001 Ga0070680_100083473
1002 Ga0070680_100159047
1003 Ga0070682_100003614
1004 Ga0070682_100096396
1005 Ga0070682_100234580
1006 Ga0070682_100300854
1007 Ga0070682_100733754
1008 Ga0068868_100028978
1009 Ga0068868_100038286
1010 Ga0068868_100076841
1011 Ga0070660_100013711
1012 Ga0070660_100022332
1013 Ga0070691_10010107
1014 Ga0070661_100001663
1015 Ga0070661_100212167
1016 Ga0070661_100212400
1017 Ga0070668_100650319
1018 Ga0070669_100717812
1019 Ga0070675_100018947
1020 Ga0070671_100247017
1021 Ga0070674_100096841
1022 Ga0070673_100014741
1023 Ga0070688_100210139
1024 Ga0070659_100012504
1025 Ga0070659_100099209
1026 Ga0070667_101108954
1027 Ga0070703_10091429
1028 Ga0070703_10107038
1029 Ga0070709_10033603
1030 Ga0070709_10130585
1031 Ga0070709_10146305
1032 Ga0070714_100003431
1033 Ga0070714_100012472
1034 Ga0070714_100013021
1035 Ga0070714_100022982
1036 Ga0070714_100023663
1037 Ga0070714_100072935
1038 Ga0070714_100093558
1039 Ga0070714_100098834
1040 Ga0070714_100249923
1041 Ga0070714_100407043
1042 Ga0070714_101099593
1043 Ga0070713_100009826
1044 Ga0070713_100028317
1045 Ga0070713_100069396
1046 Ga0070713_100130978
1047 Ga0070713_100152537
1048 Ga0070713_100382475
1049 Ga0070713_100462941
1050 Ga0070713_100472698
1051 Ga0070713_100687147
1052 Ga0070713_100801909
1053 Ga0070710_10002596
1054 Ga0070710_10034679
1055 Ga0070710_10121563
1056 Ga0070710_10192027
1057 Ga0070710_10296298
1058 Ga0070710_10381367
1059 Ga0070711_100097164
1060 Ga0070711_100099236
1061 Ga0070711_100508293
1062 Ga0070705_100879240
1063 Ga0070700_100668785
1064 Ga0070694_100608614
1065 Ga0070708_100007755
1066 Ga0070708_100027221
1067 Ga0070708_100219305
1068 Ga0070663_100189549
1069 Ga0070663_100672338
1070 Ga0070678_100608973
1071 Ga0070662_100013266
1072 Ga0070681_10008799
1073 Ga0070681_10009501
1074 Ga0070681_10036757
1075 Ga0070681_10047068
1076 Ga0070681_10296276
1077 Ga0070685_10019843
1078 Ga0070706_100001406
1079 Ga0070706_100001959
1080 Ga0070706_100013388
1081 Ga0070706_100024862
1082 Ga0070706_100124531
1083 Ga0070707_100074594
1084 Ga0070707_100102594
1085 Ga0070707_100108578
1086 Ga0070707_100209095
1087 Ga0070707_100700376
1088 Ga0070698_100013778
1089 Ga0070698_100063993
1090 Ga0070698_100295048
1091 Ga0070698_100330357
1092 Ga0070699_100676770
1093 Ga0070679_100014336
1094 Ga0070679_100060986
1095 Ga0070679_100236953
1096 Ga0070679_100310939
1097 Ga0070679_100373131
1098 Ga0070679_100596428
1099 Ga0070684_100113676
1100 Ga0070684_100122950
1101 Ga0070684_100190841
1102 Ga0070684_100317147
1103 Ga0070697_100248531
1104 Ga0068853_100309700
1105 Ga0068853_100524797
1106 Ga0070686_100023518
1107 Ga0070686_100036151
1108 Ga0070695_100167463
1109 Ga0070665_100668716
1110 Ga0070665_100879363
1111 Ga0070704_100738507
1112 Ga0068855_100061255
1113 Ga0068855_100150783
1114 Ga0068855_100201091
1115 Ga0068855_100246737
1116 Ga0068855_100627923
1117 Ga0070664_100059613
1118 Ga0068857_100410793
1119 Ga0068857_101216401
1120 Ga0068854_100006171
1121 Ga0068854_100194497
1122 Ga0068854_100400417
1123 Ga0068856_100127598
1124 Ga0068856_100159420
1125 Ga0068856_100222549
1126 Ga0070702_100029003
1127 Ga0068852_100009988
1128 Ga0068852_100149768
1129 Ga0068852_100400784
1130 Ga0068852_100592031
1131 Ga0068866_10250549
1132 Ga0068861_100212639
1133 Ga0068870_10006900
1134 Ga0068863_100434753
1135 Ga0068858_100045462
1136 Ga0068860_100883308
1137 Ga0081455_10002591
1138 Ga0081455_10011260
1139 Ga0081455_10028974
1140 Ga0081455_10031658
1141 Ga0081455_10060858
1142 Ga0081455_10205651
1143 Ga0081538_10000063
1144 Ga0081538_10001198
1145 Ga0081538_10002074
1146 Ga0081538_10002606
1147 Ga0081538_10004853
1148 Ga0081538_10004890
1149 Ga0081538_10006605
1150 Ga0081538_10009141
1151 Ga0081538_10074257
1152 Ga0081538_10101851
1153 Ga0081538_10154764
1154 Ga0081538_10158237
1155 Ga0081538_10164263
1156 Ga0081540_1001536
1157 Ga0081539_10020696
1158 Ga0081539_10028730
1159 Ga0081539_10067162
1160 Ga0081539_10076577
1161 Ga0070717_10003113
1162 Ga0070717_10005654
1163 Ga0070717_10016240
1164 Ga0070717_10018875
1165 Ga0070717_10022410
1166 Ga0070717_10048957
1167 Ga0070717_10062424
1168 Ga0070717_10121965
1169 Ga0070717_10245113
1170 Ga0070717_10271676
1171 Ga0070717_10368491
1172 Ga0070717_10511922
1173 Ga0075365_10009199
1174 Ga0075364_10048459
1175 Ga0070715_10015404
1176 Ga0070716_100014385
1177 Ga0070716_100175440
1178 Ga0070712_100032228
1179 Ga0070712_100045302
1180 Ga0070712_100093786
1181 Ga0070712_100122238
1182 Ga0070712_100139446
1183 Ga0070712_100280851
1184 Ga0070712_100322703
1185 Ga0070712_100364235
1186 Ga0070712_100390397
1187 Ga0070712_100466821
1188 Ga0070712_100594984
1189 Ga0070712_100646122
1190 Ga0075362_10005721
1191 Ga0075427_10006907
1192 Ga0097621_100152985
1193 Ga0097621_100197309
1194 Ga0097621_100829905
1195 Ga0068871_100069520
1196 Ga0075428_100163716
1197 Ga0075428_100777962
1198 Ga0075428_100908493
1199 Ga0075430_100008389
1200 Ga0075431_100226209
1201 Ga0075431_100227095
1202 Ga0075431_100236483
1203 Ga0075434_100013809
1204 Ga0075434_100127523
1205 Ga0075434_100171301
1206 Ga0075434_100838183
1207 Ga0075429_100044747
1208 Ga0075429_100096284
1209 Ga0068865_100074004
1210 Ga0068865_100234693
1211 Ga0068865_100278430
1212 Ga0075436_100711676
1213 Ga0075435_100010431
1214 Ga0075435_100423139
1215 Ga0075435_100691037
1216 Ga0105240_10034380
1217 Ga0105240_10126692
1218 Ga0111539_10000875
1219 Ga0111539_10186914
1220 Ga0111539_10324042
1221 Ga0111539_10358324
1222 Ga0105245_10034516
1223 Ga0105245_10309280
1224 Ga0105245_10510580
1225 Ga0105245_10572732
1226 Ga0105245_10876756
1227 Ga0105247_10073575
1228 Ga0114129_10004181
1229 Ga0114129_10053451
1230 Ga0114129_10139709
1231 Ga0114129_10169736
1232 Ga0114129_10239014
1233 Ga0105243_10010885
1234 Ga0105243_10336373
1235 Ga0105243_10773313
1236 Ga0105242_10036676
1237 Ga0105242_10558023
1238 Ga0105242_10685975
1239 Ga0105242_11072800
1240 Ga0105248_10350693
1241 Ga0105237_10029633
1242 Ga0105237_10457409
1243 Ga0105238_10041276
1244 Ga0105238_10235365
1245 Ga0105238_10272508
1246 Ga0105238_10317030
1247 Ga0105238_10647727
1248 Ga0105239_10042156
1249 Ga0105239_10193155
1250 Ga0105239_10351589
1251 Ga0105239_10973815
1252 Ga0105246_10186142
1253 Ga0157340_1011268
1254 Ga0157339_1009323
1255 Ga0157338_1002793
1256 Ga0157371_10020393
1257 Ga0157371_10105538
1258 Ga0157371_10648044
1259 Ga0157370_10030220
1260 Ga0157370_10141222
1261 Ga0157370_10204311
1262 Ga0157370_10427703
1263 Ga0157369_10011850
1264 Ga0157369_10042363
1265 Ga0157369_10105314
1266 Ga0157374_10127115
1267 Ga0157374_10145230
1268 Ga0163162_10189610
1269 Ga0157372_10006405
1270 Ga0157372_10056942
1271 Ga0157372_10554386
1272 Ga0157372_10598967
1273 Ga0157372_10683935
1274 Ga0157372_10737980
1275 Ga0157375_10300813
1276 Ga0157375_10329666
1277 Ga0157380_10682993
1278 Ga0157380_10715459
1279 Ga0182008_10001160
1280 Ga0157377_10020642
1281 Ga0157377_10078377
1282 Ga0157377_10271874
1283 Ga0157377_10622780
1284 Ga0157379_10149724
1285 Ga0157379_10276392
1286 Ga0157379_10429041
1287 Ga0157376_10017065
1288 Ga0157376_10308742
1289 Ga0206356_11795030
1290 Ga0206354_10312155
1291 Ga0206353_10251350
1292 Ga0213874_10065631
1293 Ga0213876_10011794
1294 Ga0213876_10103288
1295 Ga0213875_10031653
1296 Ga0224712_10151072
1297 Ga0224572_1002517
1298 Ga0207692_10016955
1299 Ga0207692_10037041
1300 Ga0207642_10189393
1301 Ga0207710_10060736
1302 Ga0207710_10126449
1303 Ga0207688_10015385
1304 Ga0207688_10154157
1305 Ga0207685_10011131
1306 Ga0207685_10011459
1307 Ga0207699_10092973
1308 Ga0207699_10220468
1309 Ga0207643_10007140
1310 Ga0207643_10009105
1311 Ga0207705_10156396
1312 Ga0207684_10004905
1313 Ga0207684_10025177
1314 Ga0207684_10058735
1315 Ga0207684_10126969
1316 Ga0207654_10111649
1317 Ga0207654_10300926
1318 Ga0207707_10014798
1319 Ga0207707_10271591
1320 Ga0207707_10395945
1321 Ga0207707_10435238
1322 Ga0207695_10024882
1323 Ga0207695_10648554
1324 Ga0207671_10155125
1325 Ga0207693_10061471
1326 Ga0207693_10326144
1327 Ga0207693_10534866
1328 Ga0207663_10017491
1329 Ga0207663_10201984
1330 Ga0207663_10248784
1331 Ga0207660_10070428
1332 Ga0207660_10167477
1333 Ga0207660_10179822
1334 Ga0207660_10184771
1335 Ga0207660_10251654
1336 Ga0207662_10102698
1337 Ga0207657_10014748
1338 Ga0207657_10033988
1339 Ga0207657_10494150
1340 Ga0207649_10101978
1341 Ga0207649_10206450
1342 Ga0207652_10135241
1343 Ga0207652_10474144
1344 Ga0207652_10534564
1345 Ga0207652_10965432
1346 Ga0207646_10190041
1347 Ga0207646_10248008
1348 Ga0207694_10040285
1349 Ga0207694_10393126
1350 Ga0207650_10005497
1351 Ga0207659_10139413
1352 Ga0207659_10260783
1353 Ga0207687_10030778
1354 Ga0207687_10095592
1355 Ga0207687_10132320
1356 Ga0207687_10696348
1357 Ga0207700_10053854
1358 Ga0207700_10088976
1359 Ga0207700_10096013
1360 Ga0207700_10096744
1361 Ga0207700_10283946
1362 Ga0207700_10321358
1363 Ga0207664_10012616
1364 Ga0207664_10015287
1365 Ga0207664_10019040
1366 Ga0207664_10020106
1367 Ga0207664_10040672
1368 Ga0207664_10108970
1369 Ga0207664_10216709
1370 Ga0207664_10291111
1371 Ga0207664_10454055
1372 Ga0207690_10021019
1373 Ga0207706_10001708
1374 Ga0207686_10284109
1375 Ga0207709_10158391
1376 Ga0207709_10270368
1377 Ga0207709_10321604
1378 Ga0207669_10024084
1379 Ga0207704_10010480
1380 Ga0207704_10113212
1381 Ga0207665_10201861
1382 Ga0207711_10427649
1383 Ga0207689_10008051
1384 Ga0207689_10045248
1385 Ga0207661_10057950
1386 Ga0207661_10083978
1387 Ga0207661_10101387
1388 Ga0207661_10173120
1389 Ga0207661_10344392
1390 Ga0207661_10958996
1391 Ga0207679_10149123
1392 Ga0207667_10046064
1393 Ga0207651_10021119
1394 Ga0207640_10015284
1395 Ga0207640_10050866
1396 Ga0207640_10105216
1397 Ga0207640_10136062
1398 Ga0207640_10945265
1399 Ga0207677_10060971
1400 Ga0207677_10242627
1401 Ga0207703_10108140
1402 Ga0207703_10404338
1403 Ga0207703_10901518
1404 Ga0207639_10017717
1405 Ga0207639_10103927
1406 Ga0207639_10504220
1407 Ga0207639_10803645
1408 Ga0207708_10738336
1409 Ga0207702_10019420
1410 Ga0207702_10100171
1411 Ga0207702_10121343
1412 Ga0207702_10136692
1413 Ga0207702_10152371
1414 Ga0207702_10225602
1415 Ga0207702_10658471
1416 Ga0207641_10057603
1417 Ga0207641_10131369
1418 Ga0207648_10247535
1419 Ga0207676_10400419
1420 Ga0207676_10889832
1421 Ga0207674_10043768
1422 Ga0207674_10068041
1423 Ga0207674_10078878
1424 Ga0207674_10242877
1425 Ga0207675_100764814
1426 Ga0207683_10306535
1427 Ga0207698_10010798
1428 Ga0207698_10412888
1429 Ga0207698_10626475
1430 Ga0207698_11105044
1431 Ga0207428_10004529
1432 Ga0207428_10010924
1433 Ga0265762_1024003
1434 Ga0265760_10035877
1435 Ga0307408_100159000
1436 Ga0316575_10056557
1437 Ga0316576_10029789
1438 Ga0316576_10042306
1439 Ga0316578_10242410
1440 Ga0307405_10098997
1441 Ga0307405_10135322
1442 Ga0307405_10223811
1443 Ga0316577_10007320
1444 Ga0316577_10009957
1445 Ga0316577_10023035
1446 Ga0316577_10040667
1447 Ga0316577_10058853
1448 Ga0316577_10121501
1449 Ga0316577_10210201
1450 Ga0307413_10518096
1451 Ga0307410_10147517
1452 Ga0307410_10763226
1453 Ga0307406_10040316
1454 Ga0307406_10158274
1455 Ga0307406_10813966
1456 Ga0307407_10059094
1457 Ga0307407_10142511
1458 Ga0307412_10335332
1459 Ga0307409_100019324
1460 Ga0307409_100093422
1461 Ga0307409_100099348
1462 Ga0307409_100388815
1463 Ga0307409_100546299
1464 Ga0307409_100785905
1465 Ga0307409_101521272
1466 Ga0307416_100081850
1467 Ga0307416_100090626
1468 Ga0307416_100185296
1469 Ga0307416_100451406
1470 Ga0307416_100499388
1471 Ga0307414_10257448
1472 Ga0307411_10581153
1473 Ga0307415_100191437
1474 Ga0307415_100416588
1475 Ga0307415_100479016
1476 Ga0307415_100499803
1477 Ga0307415_100784094
1478 Ga0316593_10127385
1479 Ga0373930_0040628
1480 Ga0373926_0000850
1481 Ga0373944_0000427
1482 Ga0373923_0071602
1483 Ga0373923_0201338
1484 Ga0373936_0000725
1485 Ga0373936_0087869
1486 Ga0373939_0079959
1487 Ga0373945_0000016
1488 Ga0373953_0014461
1489 Ga0373954_0294302
1490 Ga0373956_0088111
1491 Ga0373956_0100846
1492 Ga0373957_0069290
1493 Ga0373960_0008112
1494 Ga0373943_0003777
1495 Ga0373946_0002742
1496 Ga0373955_0024987
1497 Ga0373955_0090468
1498 Ga0373955_0183880
1499 Ga0373931_0079397
1500 Ga0373935_0049972
1501 Ga0373927_0000603
1502 Ga0373933_0017769
1503 Ga0373933_0047517
1504 Ga0373947_0005652
1505 Ga0373937_0323460
1506 Ga0373937_0370964
1507 Ga0373937_0655759
1508 Ga0373937_0774104
1509 Ga0372808_018167
1510 Ga0316582_0003740
1511 Ga0316582_0009839
1512 Ga0316582_0022693
1513 Ga0316582_0040653
1514 Ga0316582_0076245
1515 Ga0316582_0128240
1516 Ga0316582_0649400
1517 Ga0316582_0728194
1518 Ga0316584_0002012
1519 Ga0316584_0002431
1520 Ga0316584_0006499
1521 Ga0316584_0043912
1522 Ga0316584_0110346
1523 Ga0316584_0167913
1524 Ga0373925_0013934
1525 Ga0373925_0365475
1526 Ga0373925_0735365
1527 Ga0395899_0002678
1528 Ga0395899_0009721
1529 Ga0395899_0012401
1530 Ga0395899_0032840
1531 Ga0395899_0040952
1532 Ga0395899_0170517
1533 Ga0395900_0001398
1534 Ga0395900_0001553
1535 Ga0395900_0015596
1536 Ga0395900_0030269
1537 Ga0395900_0036974
1538 Ga0395900_0168383
1539 Ga0395900_0196178
1540 Ga0395900_0304109
1541 Ga0395900_0926296
1542 Ga0395898_0006056
1543 Ga0395898_0011885
1544 Ga0395898_0011908
1545 Ga0395898_0037487
1546 Ga0395898_0054109
1547 Ga0395898_0085276
1548 Ga0395898_0335494
1549 Ga0395898_0624861
1550 Ga0395905_0005069
1551 Ga0395905_0005379
1552 Ga0395905_0019192
1553 Ga0395905_0019785
1554 Ga0395905_0107499
1555 Ga0316581_0003136
1556 Ga0316581_0006601
1557 Ga0316581_0047903
1558 Ga0316581_0052532
1559 Ga0436364_0008721
1560 Ga0436364_0267484
1561 Ga0436364_1142277
1562 Ga0436364_1209434
1563 Ga0436364_1288039
1564 Ga0436364_1403969
1565 Ga0436364_1409644
1566 Ga0436364_1538459
1567 Ga0395901_0000717
1568 Ga0395901_0000739
1569 Ga0395901_0003414
1570 Ga0395901_0008492
1571 Ga0395901_0035478
1572 Ga0395901_0052750
1573 Ga0395901_0085519
1574 Ga0395901_0159342
1575 Ga0436365_0072895
1576 Ga0436365_0158783
1577 Ga0436365_0376109
1578 Ga0436365_0412674
1579 Ga0436365_0686913
1580 Ga0436365_0783550
1581 Ga0436365_0892906
1582 Ga0436365_1088316
1583 Ga0436365_1674485
1584 Ga0436360_0139542
1585 Ga0436363_0535202
1586 Ga0436362_0583696
1587 Ga0451855_1240075
1588 Ga0451853_1781216
1589 Ga0439460_0023712
1590 Ga0451577_0642771
1591 Ga0453683_0469580
1592 Ga0466965_0449008
1593 Ga0466961_0035163
1594 Ga0466961_0058716
1595 Ga0466961_0251301
1596 Ga0466961_0300690
1597 Ga0466963_0000393
1598 Ga0466963_0001530
1599 Ga0466963_0009403
1600 Ga0466963_0150068
1601 Ga0466963_0767051
1602 Ga0466964_0080937
1603 Ga0466971_0031658
1604 Ga0466971_0078005
1605 Ga0466957_0003328
1606 Ga0466957_0023118
1607 Ga0466957_0069155
1608 Ga0466957_0183013
1609 Ga0466957_0617008
1610 Ga0466960_0015922
1611 Ga0466960_0020023
1612 Ga0466960_0060694
1613 Ga0466959_0000356
1614 Ga0466959_0048231
1615 Ga0466959_0090391
1616 Ga0466959_0406392
1617 Ga0466958_0000216
1618 Ga0466958_0014864
1619 Ga0466958_0016646
1620 Ga0466958_0151815
1621 Ga0466958_0188805
1622 Ga0466958_0271671
1623 Ga0466967_0002039
1624 Ga0466967_0004347
1625 Ga0466967_0043158
1626 Ga0466967_0062597
1627 Ga0466967_0067051
1628 Ga0466967_0076948
1629 Ga0466967_0088111
1630 Ga0466967_0091524
1631 Ga0466967_0130075
1632 Ga0466967_0154634
1633 Ga0466967_0220423
1634 Ga0466967_0612740
1635 Ga0466967_0779832
1636 Ga0466967_0903951
1637 Ga0495592_0000671
1638 Ga0495592_0152210
1639 Ga0495603_0049672
1640 Ga0495629_0130807
1641 Ga0495629_0209159
1642 Ga0495629_0277700
1643 Ga0495641_0016479
1644 Ga0495641_0140390
1645 Ga0495651_0000343
1646 Ga0495651_0029312
1647 Ga0495653_0000660
1648 Ga0495653_0001368
1649 Ga0495653_0007461
1650 Ga0495653_0341169
1651 Ga0495580_0561173
1652 Ga0495582_0048478
1653 Ga0495582_0294863
1654 Ga0495605_0143874
1655 Ga0495662_0068529
1656 Ga0495664_0002456
1657 Ga0495664_0095117
1658 Ga0495664_0132459
1659 Ga0495664_0208780
1660 Ga0495596_0145402
1661 Ga0495608_0035402
1662 Ga0495608_0083535
1663 Ga0495608_0229771
1664 Ga0495618_0157017
1665 Ga0495628_0182654
1666 Ga0495630_0000068
1667 Ga0495630_0012662
1668 Ga0495630_0021778
1669 Ga0495630_0217614
1670 Ga0495630_0780919
1671 Ga0495631_0050761
1672 Ga0495666_0009191
1673 Ga0495652_0001806
1674 Ga0495652_0017563
1675 Ga0495652_0282252
1676 Ga0495665_0056122
1677 Ga0495640_0001702
1678 Ga0495640_0015158
1679 Ga0495640_0097486
1680 Ga0495586_0000424
1681 Ga0495586_0145547
1682 Ga0495587_0000910
1683 Ga0495609_0231489
1684 Ga0495645_0002232
1685 Ga0495645_0031437
1686 Ga0495645_0249631
1687 Ga0495667_0001093
1688 Ga0495667_0004696
1689 Ga0495667_0044457
1690 Ga0495667_0053223
1691 Ga0495667_0272828
1692 Ga0495656_0127312
1693 Ga0495668_0141436
1694 Ga0495634_0030756
1695 Ga0495634_0072491
1696 Ga0495634_0209748
1697 Ga0495635_0006235
1698 Ga0495635_0061335
1699 Ga0495657_0014780
1700 Ga0495657_0034955
1701 Ga0495657_0067922
1702 Ga0495657_0232577
1703 Ga0495599_0000322
1704 Ga0495599_0015298
1705 Ga0495599_0091129
1706 Ga0495623_0016946
1707 Ga0495646_0007879
1708 Ga0495647_0096139
1709 Ga0495658_0104845
1710 Ga0495613_0148439
1711 Ga0495613_0209167
1712 Ga0495613_0227944
1713 Ga0495624_0017865
1714 Ga0495624_0361275
1715 Ga0495670_0272293
1716 Ga0495589_0131922
1717 Ga0495589_0215258
1718 Ga0495600_0003060
1719 Ga0495600_0044953
1720 Ga0495581_0017834
1721 Ga0495604_0003558
1722 Ga0495604_0297070
1723 Ga0495674_0012698
1724 Ga0495674_0035554
1725 Ga0495674_0172764
1726 Ga0495674_0187628
1727 Ga0495674_0240744
1728 Ga0495676_0003229
1729 Ga0495680_0007542
1730 Ga0495680_0010294
1731 Ga0495680_0047943
1732 Ga0495675_0021210
1733 Ga0495684_0001092
1734 Ga0495684_0022777
1735 Ga0495684_0032181
1736 Ga0495593_0262462
1737 Ga0495602_0049528
1738 Ga0495602_0155188
1739 Ga0496100_0041686
1740 Ga0496100_0059632
1741 Ga0496100_0063457
1742 Ga0496100_0080117
1743 Ga0496100_0893422
1744 Ga0496101_0017483
1745 Ga0496101_0027637
1746 Ga0496101_0038850
1747 Ga0496101_0116070
1748 Ga0496101_0127698
1749 Ga0496101_0186635
1750 Ga0496102_0076065
1751 Ga0496102_0080572
1752 Ga0496102_0125444
1753 Ga0496102_0421004
1754 Ga0496102_0545626
1755 Ga0496102_0785338
1756 Ga0496103_0026668
1757 Ga0496103_0162758
1758 Ga0496103_0169681
1759 Ga0496103_0192825
1760 Ga0496103_0216923
1761 Ga0496104_0002448
1762 Ga0496104_0032830
1763 Ga0496104_0062634
1764 Ga0496104_0210703
1765 Ga0496104_0217998
1766 Ga0496104_0219401
1767 Ga0496104_0629700
1768 Ga0496104_0677055
1769 Ga0496104_0988260
1770 Ga0496104_1206526
1771 Ga0496105_0024543
1772 Ga0496105_0068611
1773 Ga0496105_0108652
1774 Ga0496105_0439884
1775 Ga0496105_0514030
1776 Ga0496105_0681904
1777 Ga0496106_0005498
1778 Ga0496106_0035181
1779 Ga0496106_0039724
1780 Ga0496106_0146001
1781 Ga0496106_0269644
1782 Ga0496106_0358576
1783 Ga0496106_0710939
1784 Ga0496107_0014815
1785 Ga0496107_0016122
1786 Ga0496107_0035843
1787 Ga0496107_0194154
1788 Ga0496107_0289950
1789 Ga0496108_0001060
1790 Ga0496108_0007206
1791 Ga0496108_0019457
1792 Ga0496108_0020163
1793 Ga0496108_0264516
1794 Ga0496108_0286891
1795 Ga0496108_0682466
1796 Ga0496108_0687773
1797 Ga0496109_0018823
1798 Ga0496109_0048979
1799 Ga0496109_0052245
1800 Ga0496109_0080760
1801 Ga0496109_0103630
1802 Ga0496109_0111883
1803 Ga0496109_0154180
1804 Ga0496109_0182500
1805 Ga0496109_0195902
1806 Ga0496109_0208888
1807 Ga0496109_0210320
1808 Ga0496109_0326049
1809 Ga0496109_0450058
1810 Ga0496109_0456984
1811 Ga0496109_0556368
1812 Ga0496109_0640772
1813 Ga0496109_0990666
1814 Ga0496110_0068322
1815 Ga0496110_0079875
1816 Ga0496110_0130740
1817 Ga0496110_0186664
1818 Ga0496110_0215065
1819 Ga0496110_0744282
1820 Ga0496111_0063357
1821 Ga0496111_0325329
1822 Ga0496111_0658351
1823 Ga0496112_0003576
1824 Ga0496112_0009272
1825 Ga0496112_0058888
1826 Ga0496112_0159954
1827 Ga0496112_0288621
1828 Ga0496112_0411940
1829 Ga0496112_0611899
1830 Ga0496112_0622222
1831 Ga0496112_0937325
1832 Ga0496113_0004264
1833 Ga0496113_0056538
1834 Ga0496113_0127393
1835 Ga0496113_0158349
1836 Ga0496113_0162212
1837 Ga0496113_0450043
1838 Ga0496114_0045290
1839 Ga0496114_0134296
1840 Ga0496114_0478269
1841 Ga0496115_0006516
1842 Ga0496115_0062587
1843 Ga0496115_0086716
1844 Ga0496115_0193330
1845 Ga0496115_0252182
1846 Ga0501031_0000063
1847 Ga0501031_0293090
1848 Ga0501031_0571606
1849 Ga0501032_0003604
1850 Ga0501033_0000871
1851 Ga0501034_0408569
1852 Ga0501036_0002119
1853 Ga0501036_0029451
1854 Ga0501036_0264016
1855 Ga0501036_0491844
1856 Ga0501037_0008933
1857 Ga0501038_0004494
1858 Ga0501039_0000075
1859 Ga0501039_0056778
1860 Ga0501040_0013292
1861 Ga0501040_0026672
1862 Ga0501040_0109887
1863 Ga0501041_0291684
1864 Ga0501042_0084119
1865 Ga0501043_0004209
1866 Ga0501046_0001429
1867 Ga0501047_0016589
1868 Ga0501047_0237817
1869 Ga0501048_0001098
1870 Ga0501067_0009560
1871 Ga0501067_0123535
1872 Ga0501068_0175824
1873 Ga0501068_0179548
1874 Ga0501068_0267041
1875 Ga0501069_0005707
1876 Ga0501069_0040125
1877 Ga0501069_0313880
1878 Ga0501070_0001223
1879 Ga0501071_0201962
1880 Ga0501071_0491798
1881 Ga0501072_0023198
1882 Ga0501072_0027608
1883 Ga0501072_0042615
1884 Ga0501072_0179081
1885 Ga0501073_0004877
1886 Ga0501074_0000308
1887 Ga0501074_0510393
1888 Ga0501074_0592922
1889 Ga0501075_0011725
1890 Ga0501075_0094604
1891 Ga0501075_0434711
1892 Ga0501075_0476636
1893 Ga0501076_0054865
1894 Ga0501076_0112492
1895 Ga0501076_0123882
1896 Ga0501076_0278338
1897 Ga0501076_0307952
1898 Ga0501077_0010472
1899 Ga0501233_189021
1900 Ga0501079_0077786
1901 Ga0501079_0113193
1902 Ga0501079_0173001
1903 Ga0501079_0266889
1904 Ga0501080_0000212
1905 Ga0501083_0136930
1906 Ga0501083_0360945
1907 Ga0501035_0009419
1908 Ga0501044_0018094
1909 Ga0501045_0022231
1910 Ga0501045_0024470
1911 Ga0501045_0240115
1912 Ga0501045_0288724
1913 Ga0501045_0298973
1914 nmdc:mga03683_88519_c1
1915 nmdc:mga00v17_12882_c1
1916 nmdc:mga00v17_471648_c1
1917 nmdc:mga0yw44_19049_c1
1918 nmdc:mga0yw44_3539_c1
1919 nmdc:mga06z11_126523_c1
1920 nmdc:mga05p37_101832_c1
1921 nmdc:mga05p37_114437_c1
1922 nmdc:mga05p37_156393_c1
1923 nmdc:mga05p37_864712_c1
1924 nmdc:mga05p37_9080_c1
1925 nmdc:mga09592_45988_c1
1926 nmdc:mga0qj67_7035_c1
1927 nmdc:mga08y16_18764_c1
1928 nmdc:mga08y16_206790_c1
1929 nmdc:mga08y16_4867_c1
1930 nmdc:mga0n895_1097876_c1
1931 nmdc:mga0n895_202053_c1
1932 nmdc:mga0n895_202703_c1
1933 nmdc:mga0n895_327641_c1
1934 nmdc:mga0n895_924163_c1
1935 nmdc:mga0rr50_194419_c1
1936 nmdc:mga0rr50_417963_c1
1937 nmdc:mga0rr50_463513_c1
1938 nmdc:mga0rr50_782695_c1
1939 nmdc:mga08x19_70293_c1
1940 nmdc:mga0a205_927073_c1
1941 Ga0495601_0011985
1942 Ga0495601_0147656
1943 Ga0495601_0243940
1944 Ga0495612_0081359
1945 Ga0495612_0129170
1946 Ga0495619_0080609
1947 Ga0495619_0140698
1948 Ga0500660_083868
1949 Ga0501084_0002422
1950 Ga0501084_0068348
1951 Ga0501084_0104327
1952 Ga0501084_0156861
1953 Ga0501084_0167692
1954 Ga0466962_0092214
1955 Ga0466962_0125328
1956 Ga0466962_0187106
1957 Ga0530510_0043590
1958 Ga0530510_0262821
1959 Ga0530510_0320375
1960 Ga0530510_0608927
1961 2891554891
1962 2895431004

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

181

237

0.97

PF00072

Response_reg

Response regulator receiver domain

22

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9856 150 213
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9835 149 212
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9794 149 212
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9792 151 211
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9771 149 213
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 153 209 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.975 153 208 1.10.10.10
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9577 151 211 1.10.10.10
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9574 4 119 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9566 2 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3A4WXB8-F1-model_v4 DNA-binding response regulator 0.9705 2 125 GO:0000160
GO:0003677
AF-B5GTH3-F1-model_v4 deleted 0.9665 2 212
AF-A0A5S4EYX3-F1-model_v4 Response regulator 0.9663 2 213 GO:0000155
GO:0003677
GO:0006355
GO:0016020
GO:0046983
AF-A0A5D0UMI1-F1-model_v4 Response regulator transcription factor 0.9607 1 213 GO:0000160
GO:0003677
GO:0006355
AF-W9GLQ1-F1-model_v4 LuxR family transcriptional regulator 0.9602 2 212 GO:0000160
GO:0003677
GO:0006355

Map