F487273

General Info

Members Datasets Scaffolds Average Seq Length
977 454 954 321

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100281237|Ga0070708_1002812371
Length 371
Sequence MLTRLVLAALLAAAALAHAQTQNYPAKSIRIVLPLAEGGLDASSEQGSRLRDANVRESAAATWMIAQATISREQYPTRAIRIILPFAPGGGADIIARMLGQKMTDSWGQQVVVDNRAGASGNIGAEIVAKSAPDGYTLLITSSALAINPSVFRSVPYDLNRDFAPITQPGLLPNILVVHPSLPVKTVKDLIALARSQPGKLAYASAGXXXXTHLAAEMFKLLAGIDMVHVPYKGGGALISDLLGGQVALTFATLPSVMPYVKVGRLRAVAMTTTKRWPGLPAVPTIAESGFPGFEMSTWIGLLAPAGTPKDVIGKLHQEVVRILHLSDVRERFDGLGIEPVGDTPEQFAQYIKSELVKYAKVVKQSGARAE

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2818991446 Variovorax sp. 1180 Isolate Unclassified
8 2855730933 Achromobacter sp. HZ28 Isolate Nodule
9 2855767633 Achromobacter sp. HZ34 Isolate Nodule
10 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
14 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
15 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
16 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
17 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
18 2941479691
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
240 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
244 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
301 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
312 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
399 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
400 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
401 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
402 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
423 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
430 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
433 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
434 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
435 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
436 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
437 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
444 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
445 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
446 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
447 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
448 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
453 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
454 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.59
Nodule 0.61
Rhizoplane 5.94
Rhizosphere 75.44
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10023389 3300001991 Bacteria 1189
2 JGI24738J21930_10022534 3300002075 Bacteria 1302
3 JGI24749J21850_1012853 3300002076 Bacteria 1176
4 JGI25152J39213_1000010 3300002773 Bacteria 134529
5 JGI25150J39212_1000490 3300002774 Bacteria 16621
6 JGI25159J45721_1000381 3300002987 Bacteria 20524
7 JGI25151J46595_10000262 3300003187 Bacteria 61170
8 JGI25151J46595_10001355 3300003187 Bacteria 16973
9 JGI25151J46595_10002847 3300003187 Bacteria 9962
10 JGI25406J46586_10000542 3300003203 Bacteria 17685
11 JGI25153J46596_10002775 3300003215 Bacteria 9962
12 JGI25160J50197_1000583 3300003354 Bacteria 20524
13 JGI25161J50226_1000654 3300003374 Bacteria 13897
14 JGI25161J50226_1000922 3300003374 Bacteria 10544
15 Ga0055535_1000241 3300003761 Bacteria 57946
16 Ga0055542_1000126 3300003762 Bacteria 100388
17 Ga0055526_1001018 3300003771 Bacteria 20524
18 Ga0055526_1001146 3300003771 Bacteria 19207
19 Ga0055526_1005040 3300003771 Bacteria 7716
20 Ga0055526_1012011 3300003771 Bacteria 3828
21 Ga0055526_1019127 3300003771 Bacteria 2510
22 Ga0055537_1000873 3300003773 Bacteria 14427
23 Ga0055537_1001439 3300003773 Bacteria 9286
24 Ga0055524_1000248 3300003775 Bacteria 56071
25 Ga0055524_1000823 3300003775 Bacteria 20524
26 Ga0055536_1034912 3300003781 Bacteria 1264
27 Ga0055534_1000341 3300003784 Bacteria 30179
28 Ga0055534_1000531 3300003784 Bacteria 20524
29 Ga0055534_1000661 3300003784 Bacteria 17379
30 Ga0055528_1000865 3300003790 Bacteria 20524
31 Ga0055540_1015526 3300003792 Bacteria 2211
32 Ga0055540_1015703 3300003792 Bacteria 2188
33 Ga0055531_10004697 3300003794 Bacteria 8176
34 Ga0055543_1000539 3300004625 Bacteria 21302
35 Ga0065165_1001314 3300005262 Bacteria 27751
36 Ga0070676_10220100 3300005328 Bacteria 1253
37 Ga0070683_100018484 3300005329 Bacteria 6176
38 Ga0070690_100019584 3300005330 Bacteria 4111
39 Ga0070690_100056022 3300005330 Bacteria 2526
40 Ga0070690_100238515 3300005330 Bacteria 1281
41 Ga0070670_100042837 3300005331 Bacteria 3892
42 Ga0070670_100123402 3300005331 Bacteria 2235
43 Ga0070670_100277701 3300005331 Bacteria 1463
44 Ga0070677_10047287 3300005333 Bacteria 1724
45 Ga0068869_100017953 3300005334 Bacteria 4808
46 Ga0068869_100102400 3300005334 Bacteria 2167
47 Ga0068869_100192724 3300005334 Bacteria 1603
48 Ga0070666_10285834 3300005335 Bacteria 1173
49 Ga0070680_100011245 3300005336 Bacteria 6920
50 Ga0070680_100227620 3300005336 Bacteria 1574
51 Ga0070682_100046709 3300005337 Bacteria 2688
52 Ga0068868_100001010 3300005338 Bacteria 19254
53 Ga0068868_100139607 3300005338 Bacteria 1988
54 Ga0068868_100291653 3300005338 Bacteria 1383
55 Ga0070689_100008032 3300005340 Bacteria 7408
56 Ga0070689_100055638 3300005340 Bacteria 3066
57 Ga0070689_100114513 3300005340 Bacteria 2148
58 Ga0070689_100210663 3300005340 Bacteria 1590
59 Ga0070689_100230355 3300005340 Bacteria 1523
60 Ga0070687_100000472 3300005343 Bacteria 13540
61 Ga0070687_100079239 3300005343 Bacteria 1787
62 Ga0070692_10012681 3300005345 Bacteria 3911
63 Ga0070668_100019524 3300005347 Bacteria 5101
64 Ga0070668_100067479 3300005347 Bacteria 2779
65 Ga0070669_100073390 3300005353 Bacteria 2535
66 Ga0070669_100146514 3300005353 Bacteria 1825
67 Ga0070675_100045107 3300005354 Bacteria 3606
68 Ga0070675_100071179 3300005354 Bacteria 2884
69 Ga0070675_100081169 3300005354 Bacteria 2704
70 Ga0070671_100037790 3300005355 Bacteria 4006
71 Ga0070671_100084181 3300005355 Bacteria 2660
72 Ga0070671_100116982 3300005355 Bacteria 2241
73 Ga0070671_100167541 3300005355 Bacteria 1858
74 Ga0070674_100105194 3300005356 Bacteria 2063
75 Ga0070674_100127626 3300005356 Bacteria 1892
76 Ga0070673_100060127 3300005364 Bacteria 3010
77 Ga0070673_100163593 3300005364 Bacteria 1894
78 Ga0070673_100209369 3300005364 Bacteria 1683
79 Ga0070688_100007930 3300005365 Bacteria 5743
80 Ga0070688_100061466 3300005365 Bacteria 2375
81 Ga0070667_100041279 3300005367 Bacteria 3871
82 Ga0070667_100141322 3300005367 Bacteria 2108
83 Ga0070667_100165424 3300005367 Bacteria 1951
84 Ga0070667_100210054 3300005367 Bacteria 1730
85 Ga0070667_100345258 3300005367 Bacteria 1347
86 Ga0070714_100155983 3300005435 Bacteria 2061
87 Ga0070713_100000019 3300005436 Bacteria 110100
88 Ga0070713_100013794 3300005436 Bacteria 5980
89 Ga0070713_100067932 3300005436 Bacteria 3003
90 Ga0070710_10072573 3300005437 Bacteria 1988
91 Ga0070701_10010189 3300005438 Bacteria 4146
92 Ga0070705_100000043 3300005440 Bacteria 63978
93 Ga0070705_100090944 3300005440 Bacteria 1901
94 Ga0070705_100155137 3300005440 Bacteria 1524
95 Ga0070700_100003779 3300005441 Bacteria 7837
96 Ga0070700_100138422 3300005441 Bacteria 1651
97 Ga0070694_100006344 3300005444 Bacteria 7174
98 Ga0070694_100084540 3300005444 Bacteria 2214
99 Ga0070708_100281237 3300005445 Bacteria 1566
100 Ga0070678_100014403 3300005456 Bacteria 4989
101 Ga0070662_100240262 3300005457 Bacteria 1452
102 Ga0070681_10000685 3300005458 Bacteria 28045
103 Ga0070681_10047234 3300005458 Bacteria 4303
104 Ga0068867_100000225 3300005459 Bacteria 37110
105 Ga0068867_100214314 3300005459 Bacteria 1549
106 Ga0070685_10015443 3300005466 Bacteria 4056
107 Ga0070706_100006414 3300005467 Bacteria 11119
108 Ga0070706_100292218 3300005467 Bacteria 1521
109 Ga0070707_100179645 3300005468 Bacteria 2063
110 Ga0070679_100050267 3300005530 Bacteria 4153
111 Ga0070684_100267382 3300005535 Bacteria 1565
112 Ga0070684_100351647 3300005535 Bacteria 1355
113 Ga0068853_100021309 3300005539 Bacteria 5402
114 Ga0068853_100038292 3300005539 Bacteria 4084
115 Ga0068853_100049105 3300005539 Bacteria 3625
116 Ga0070672_100033355 3300005543 Bacteria 3898
117 Ga0070672_100036428 3300005543 Bacteria 3748
118 Ga0070672_100230977 3300005543 Bacteria 1554
119 Ga0070686_100064113 3300005544 Bacteria 2382
120 Ga0070686_100098164 3300005544 Bacteria 1973
121 Ga0070686_100098988 3300005544 Bacteria 1966
122 Ga0070686_100112039 3300005544 Bacteria 1860
123 Ga0070686_100175083 3300005544 Bacteria 1520
124 Ga0070686_100201730 3300005544 Bacteria 1426
125 Ga0070695_100033205 3300005545 Bacteria 3228
126 Ga0070695_100055626 3300005545 Bacteria 2551
127 Ga0070696_100003112 3300005546 Bacteria 11038
128 Ga0070696_100020591 3300005546 Bacteria 4468
129 Ga0070693_100000016 3300005547 Bacteria 63019
130 Ga0070704_100000837 3300005549 Bacteria 15281
131 Ga0070704_100065286 3300005549 Bacteria 2619
132 Ga0070704_100072778 3300005549 Bacteria 2501
133 Ga0070704_100141823 3300005549 Bacteria 1877
134 Ga0068855_100012963 3300005563 Bacteria 10058
135 Ga0070664_100139169 3300005564 Bacteria 2136
136 Ga0070664_100311573 3300005564 Bacteria 1424
137 Ga0070664_100347762 3300005564 Bacteria 1348
138 Ga0068857_100464610 3300005577 Bacteria 1185
139 Ga0068856_100683449 3300005614 Bacteria 1047
140 Ga0070702_100000017 3300005615 Bacteria 47208
141 Ga0070702_100094968 3300005615 Bacteria 1816
142 Ga0070702_100161664 3300005615 Bacteria 1448
143 Ga0070702_100186014 3300005615 Bacteria 1363
144 Ga0068852_100016862 3300005616 Bacteria 5712
145 Ga0068852_100224587 3300005616 Bacteria 1787
146 Ga0068852_100334792 3300005616 Bacteria 1474
147 Ga0068852_100494472 3300005616 Bacteria 1217
148 Ga0068859_100018784 3300005617 Bacteria 6947
149 Ga0068859_100138373 3300005617 Bacteria 2509
150 Ga0068859_100163787 3300005617 Bacteria 2303
151 Ga0068864_100018789 3300005618 Bacteria 5777
152 Ga0068864_100029246 3300005618 Bacteria 4663
153 Ga0068864_100037951 3300005618 Bacteria 4112
154 Ga0068864_100088907 3300005618 Bacteria 2721
155 Ga0068864_100283198 3300005618 Bacteria 1548
156 Ga0068866_10016800 3300005718 Bacteria 3278
157 Ga0068861_100000496 3300005719 Bacteria 22901
158 Ga0068861_100019728 3300005719 Bacteria 4817
159 Ga0068861_100061114 3300005719 Bacteria 2890
160 Ga0068861_100267540 3300005719 Bacteria 1466
161 Ga0068861_100373273 3300005719 Bacteria 1258
162 Ga0068870_10003235 3300005840 Bacteria 6876
163 Ga0068870_10089499 3300005840 Bacteria 1718
164 Ga0068863_100145229 3300005841 Bacteria 2269
165 Ga0068863_100177149 3300005841 Bacteria 2046
166 Ga0068858_100001011 3300005842 Bacteria 28980
167 Ga0068858_100002315 3300005842 Bacteria 19249
168 Ga0068858_100107316 3300005842 Bacteria 2606
169 Ga0068858_100184476 3300005842 Bacteria 1971
170 Ga0068858_100291891 3300005842 Bacteria 1555
171 Ga0068858_100330901 3300005842 Bacteria 1457
172 Ga0068860_100017045 3300005843 Bacteria 7081
173 Ga0068860_100023020 3300005843 Bacteria 6025
174 Ga0068860_100074316 3300005843 Bacteria 3232
175 Ga0068860_100285616 3300005843 Bacteria 1613
176 Ga0068862_100119071 3300005844 Bacteria 2325
177 Ga0081455_10014492 3300005937 Bacteria 7723
178 Ga0081455_10028957 3300005937 Bacteria 5055
179 Ga0081455_10041286 3300005937 Bacteria 4059
180 Ga0081539_10000847 3300005985 Bacteria 58528
181 Ga0070717_10093279 3300006028 Bacteria 2545
182 Ga0075365_10045375 3300006038 Bacteria 2883
183 Ga0075365_10086763 3300006038 Bacteria 2127
184 Ga0075365_10157232 3300006038 Bacteria 1582
185 Ga0075363_100005216 3300006048 Bacteria 5756
186 Ga0075363_100063798 3300006048 Bacteria 1989
187 Ga0075364_10011199 3300006051 Bacteria 5445
188 Ga0075364_10032938 3300006051 Bacteria 3334
189 Ga0075364_10100238 3300006051 Bacteria 1928
190 Ga0075364_10115861 3300006051 Bacteria 1791
191 Ga0075364_10231932 3300006051 Bacteria 1253
192 Ga0070716_100084483 3300006173 Bacteria 1904
193 Ga0070716_100109793 3300006173 Bacteria 1707
194 Ga0070716_100208567 3300006173 Unclassified 1304
195 Ga0070712_100034989 3300006175 Bacteria 3407
196 Ga0075362_10024056 3300006177 Bacteria 2581
197 Ga0075362_10090042 3300006177 Bacteria 1423
198 Ga0075367_10070103 3300006178 Bacteria 2106
199 Ga0075367_10084814 3300006178 Bacteria 1921
200 Ga0075367_10108334 3300006178 Bacteria 1703
201 Ga0075369_10004234 3300006186 Bacteria 5287
202 Ga0075366_10001589 3300006195 Bacteria 11365
203 Ga0075366_10025588 3300006195 Bacteria 3449
204 Ga0075366_10095398 3300006195 Bacteria 1783
205 Ga0097621_100001049 3300006237 Bacteria 19393
206 Ga0097621_100007640 3300006237 Bacteria 7749
207 Ga0097621_100205373 3300006237 Bacteria 1712
208 Ga0068871_100004173 3300006358 Bacteria 10001
209 Ga0068871_100031226 3300006358 Bacteria 4199
210 Ga0068871_100152558 3300006358 Bacteria 1971
211 Ga0075428_100004582 3300006844 Bacteria 15289
212 Ga0075428_100013933 3300006844 Bacteria 8953
213 Ga0075428_100023614 3300006844 Bacteria 6807
214 Ga0075428_100028423 3300006844 Bacteria 6186
215 Ga0075430_100068042 3300006846 Bacteria 2988
216 Ga0075431_100004337 3300006847 Bacteria 13900
217 Ga0075431_100107621 3300006847 Bacteria 2877
218 Ga0075431_100216103 3300006847 Unclassified 1957
219 Ga0075431_100236014 3300006847 Bacteria 1862
220 Ga0075433_10001240 3300006852 Bacteria 18606
221 Ga0075433_10016219 3300006852 Bacteria 6129
222 Ga0075433_10069944 3300006852 Bacteria 3083
223 Ga0075433_10511373 3300006852 Bacteria 1057
224 Ga0075434_100000017 3300006871 Bacteria 74154
225 Ga0075434_100000549 3300006871 Bacteria 28671
226 Ga0075434_100005820 3300006871 Bacteria 11258
227 Ga0075434_100034296 3300006871 Bacteria 5011
228 Ga0075434_100037443 3300006871 Bacteria 4802
229 Ga0075434_100132341 3300006871 Bacteria 2514
230 Ga0075434_100390409 3300006871 Bacteria 1413
231 Ga0075429_100000506 3300006880 Bacteria 29418
232 Ga0075429_100007303 3300006880 Bacteria 9589
233 Ga0075429_100166865 3300006880 Bacteria 1929
234 Ga0068865_100016551 3300006881 Bacteria 4721
235 Ga0075436_100000896 3300006914 Bacteria 19786
236 Ga0075436_100001337 3300006914 Bacteria 16769
237 Ga0075436_100009262 3300006914 Bacteria 6737
238 Ga0075436_100015208 3300006914 Bacteria 5271
239 Ga0075436_100036090 3300006914 Bacteria 3411
240 Ga0075436_100130099 3300006914 Bacteria 1765
241 Ga0097620_100018783 3300006931 Bacteria 6947
242 Ga0097620_100138368 3300006931 Bacteria 2509
243 Ga0097620_100163771 3300006931 Bacteria 2303
244 Ga0099826_10000019 3300006948 Bacteria 188386
245 Ga0075435_100000241 3300007076 Bacteria 33718
246 Ga0075435_100001546 3300007076 Bacteria 14830
247 Ga0075435_100075757 3300007076 Bacteria 2756
248 Ga0075435_100119638 3300007076 Bacteria 2197
249 Ga0099795_10042805 3300007788 Bacteria 1618
250 Ga0105240_10007572 3300009093 Bacteria 15732
251 Ga0111539_10020771 3300009094 Bacteria 8083
252 Ga0111539_10026228 3300009094 Bacteria 7130
253 Ga0111539_10035923 3300009094 Bacteria 5998
254 Ga0111539_10048183 3300009094 Bacteria 5089
255 Ga0111539_10139578 3300009094 Bacteria 2838
256 Ga0111539_10669351 3300009094 Bacteria 1209
257 Ga0105245_10085899 3300009098 Bacteria 2885
258 Ga0105245_10102244 3300009098 Bacteria 2654
259 Ga0105245_10250114 3300009098 Bacteria 1722
260 Ga0105245_10798775 3300009098 Bacteria 981
261 Ga0105247_10012451 3300009101 Bacteria 5108
262 Ga0114129_10000534 3300009147 Bacteria 46594
263 Ga0114129_10001202 3300009147 Bacteria 34348
264 Ga0114129_10024407 3300009147 Bacteria 8567
265 Ga0114129_10042156 3300009147 Bacteria 6427
266 Ga0105243_10000743 3300009148 Bacteria 31200
267 Ga0105243_10036148 3300009148 Bacteria 3832
268 Ga0105243_10172997 3300009148 Bacteria 1872
269 Ga0105243_10188739 3300009148 Bacteria 1798
270 Ga0105243_10191090 3300009148 Bacteria 1788
271 Ga0105243_10201300 3300009148 Bacteria 1746
272 Ga0105241_10133962 3300009174 Bacteria 2009
273 Ga0105242_10337902 3300009176 Bacteria 1387
274 Ga0105248_10251964 3300009177 Bacteria 1987
275 Ga0105248_10300618 3300009177 Bacteria 1807
276 Ga0105248_10543404 3300009177 Bacteria 1311
277 Ga0105237_10405381 3300009545 Bacteria 1368
278 Ga0105238_10138160 3300009551 Bacteria 2414
279 Ga0105238_10476566 3300009551 Bacteria 1247
280 Ga0105249_10057924 3300009553 Bacteria 3550
281 Ga0105246_10123763 3300011119 Bacteria 1921
282 Ga0105246_10197654 3300011119 Bacteria 1561
283 Ga0157371_10109606 3300013102 Bacteria 1960
284 Ga0157374_10085143 3300013296 Bacteria 3005
285 Ga0157374_10102708 3300013296 Bacteria 2742
286 Ga0157374_10217492 3300013296 Bacteria 1874
287 Ga0157378_10046757 3300013297 Bacteria 3847
288 Ga0157378_10058354 3300013297 Bacteria 3442
289 Ga0157378_10285305 3300013297 Bacteria 1593
290 Ga0163162_10099076 3300013306 Bacteria 3005
291 Ga0163162_10387645 3300013306 Bacteria 1530
292 Ga0157372_10262757 3300013307 Bacteria 2004
293 Ga0157375_10471632 3300013308 Bacteria 1420
294 Ga0157375_10604962 3300013308 Bacteria 1255
295 Ga0163163_10027646 3300014325 Bacteria 5436
296 Ga0163163_10030887 3300014325 Bacteria 5165
297 Ga0163163_10051329 3300014325 Bacteria 4067
298 Ga0163163_10172110 3300014325 Bacteria 2212
299 Ga0163163_10251300 3300014325 Bacteria 1819
300 Ga0163163_10309182 3300014325 Bacteria 1633
301 Ga0157380_10069201 3300014326 Bacteria 2847
302 Ga0182008_10042415 3300014497 Bacteria 2266
303 Ga0157377_10007048 3300014745 Bacteria 5399
304 Ga0157377_10240015 3300014745 Bacteria 1169
305 Ga0157379_10006399 3300014968 Bacteria 10146
306 Ga0157379_10146350 3300014968 Bacteria 2131
307 Ga0157379_10239821 3300014968 Bacteria 1644
308 Ga0157376_10050117 3300014969 Bacteria 3462
309 Ga0163161_10088396 3300017792 Bacteria 2290
310 Ga0213876_10003512 3300021384 Bacteria 8949
311 Ga0213876_10004235 3300021384 Bacteria 8049
312 Ga0209436_101676 3300025208 Bacteria 7350
313 Ga0209672_100550 3300025228 Bacteria 20292
314 Ga0209147_100805 3300025229 Bacteria 15154
315 Ga0209258_100018 3300025242 Bacteria 567561
316 Ga0207425_1000057 3300025245 Bacteria 149738
317 Ga0209148_1000030 3300025254 Bacteria 567582
318 Ga0209129_1000030 3300025258 Bacteria 391958
319 Ga0209565_1000019 3300025263 Bacteria 438920
320 Ga0209565_1000255 3300025263 Bacteria 56576
321 Ga0209565_1018952 3300025263 Bacteria 1477
322 Ga0209673_1000155 3300025273 Bacteria 145667
323 Ga0209673_1009186 3300025273 Bacteria 4313
324 Ga0209130_1000011 3300025284 Bacteria 431723
325 Ga0209675_1000031 3300025291 Bacteria 273599
326 Ga0209675_1000457 3300025291 Bacteria 31374
327 Ga0209675_1000510 3300025291 Bacteria 28831
328 Ga0209675_1002115 3300025291 Bacteria 10517
329 Ga0209676_1004622 3300025292 Bacteria 7582
330 Ga0209676_1006264 3300025292 Bacteria 5921
331 Ga0209676_1009204 3300025292 Bacteria 4295
332 Ga0209025_1000057 3300025294 Bacteria 314601
333 Ga0209025_1000078 3300025294 Bacteria 271683
334 Ga0209025_1002582 3300025294 Bacteria 18768
335 Ga0209025_1028513 3300025294 Bacteria 2732
336 Ga0209564_1000056 3300025295 Bacteria 340873
337 Ga0209564_1000546 3300025295 Bacteria 60886
338 Ga0209564_1000600 3300025295 Bacteria 56188
339 Ga0209564_1002095 3300025295 Bacteria 17070
340 Ga0209758_1000037 3300025297 Bacteria 439101
341 Ga0209758_1019878 3300025297 Bacteria 3210
342 Ga0209050_1001259 3300025298 Bacteria 29240
343 Ga0209050_1007505 3300025298 Bacteria 6089
344 Ga0209256_1000043 3300025299 Bacteria 340873
345 Ga0209256_1000518 3300025299 Bacteria 56459
346 Ga0209256_1000661 3300025299 Bacteria 46620
347 Ga0207426_1000029 3300025302 Bacteria 473835
348 Ga0209051_1000804 3300025303 Bacteria 32919
349 Ga0209051_1006197 3300025303 Bacteria 6781
350 Ga0209257_1001647 3300025304 Bacteria 25488
351 Ga0207682_10068119 3300025893 Bacteria 1503
352 Ga0207682_10079540 3300025893 Bacteria 1402
353 Ga0207692_10113619 3300025898 Bacteria 1505
354 Ga0207642_10034515 3300025899 Bacteria 2152
355 Ga0207710_10032070 3300025900 Bacteria 2301
356 Ga0207688_10000077 3300025901 Bacteria 37350
357 Ga0207688_10009054 3300025901 Bacteria 5420
358 Ga0207688_10078236 3300025901 Bacteria 1885
359 Ga0207688_10116738 3300025901 Bacteria 1554
360 Ga0207680_10070700 3300025903 Bacteria 2161
361 Ga0207647_10014714 3300025904 Bacteria 5388
362 Ga0207647_10030672 3300025904 Bacteria 3466
363 Ga0207645_10012169 3300025907 Bacteria 5843
364 Ga0207645_10020137 3300025907 Bacteria 4368
365 Ga0207643_10060781 3300025908 Bacteria 2158
366 Ga0207643_10106289 3300025908 Bacteria 1650
367 Ga0207643_10124687 3300025908 Bacteria 1528
368 Ga0207684_10000788 3300025910 Bacteria 36846
369 Ga0207684_10252761 3300025910 Bacteria 1521
370 Ga0207707_10096778 3300025912 Bacteria 2579
371 Ga0207695_10016654 3300025913 Bacteria 8591
372 Ga0207671_10113150 3300025914 Bacteria 2067
373 Ga0207671_10417824 3300025914 Bacteria 1067
374 Ga0207693_10010472 3300025915 Bacteria 7525
375 Ga0207693_10015493 3300025915 Bacteria 6116
376 Ga0207663_10044643 3300025916 Bacteria 2722
377 Ga0207663_10316611 3300025916 Bacteria 1171
378 Ga0207660_10173589 3300025917 Bacteria 1670
379 Ga0207662_10002112 3300025918 Bacteria 9875
380 Ga0207662_10004898 3300025918 Bacteria 7082
381 Ga0207662_10027735 3300025918 Bacteria 3270
382 Ga0207662_10131049 3300025918 Bacteria 1581
383 Ga0207657_10158746 3300025919 Bacteria 1838
384 Ga0207657_10206919 3300025919 Bacteria 1576
385 Ga0207652_10035230 3300025921 Bacteria 4223
386 Ga0207646_10055525 3300025922 Bacteria 3541
387 Ga0207646_10063874 3300025922 Bacteria 3286
388 Ga0207681_10042080 3300025923 Bacteria 3049
389 Ga0207694_10124355 3300025924 Bacteria 2062
390 Ga0207650_10041764 3300025925 Bacteria 3362
391 Ga0207650_10085284 3300025925 Bacteria 2402
392 Ga0207650_10114738 3300025925 Bacteria 2090
393 Ga0207659_10011421 3300025926 Bacteria 5610
394 Ga0207659_10103002 3300025926 Bacteria 2156
395 Ga0207687_10071957 3300025927 Bacteria 2472
396 Ga0207687_10101226 3300025927 Bacteria 2121
397 Ga0207687_10152212 3300025927 Bacteria 1766
398 Ga0207700_10000035 3300025928 Bacteria 119648
399 Ga0207644_10051645 3300025931 Bacteria 2952
400 Ga0207644_10079951 3300025931 Bacteria 2413
401 Ga0207706_10001566 3300025933 Bacteria 22667
402 Ga0207706_10034208 3300025933 Bacteria 4521
403 Ga0207709_10000085 3300025935 Bacteria 160514
404 Ga0207709_10030284 3300025935 Bacteria 3147
405 Ga0207709_10170271 3300025935 Bacteria 1528
406 Ga0207709_10355480 3300025935 Bacteria 1107
407 Ga0207670_10019546 3300025936 Bacteria 4139
408 Ga0207670_10109838 3300025936 Bacteria 1985
409 Ga0207670_10111609 3300025936 Bacteria 1971
410 Ga0207670_10197380 3300025936 Bacteria 1526
411 Ga0207704_10006104 3300025938 Bacteria 5588
412 Ga0207704_10224899 3300025938 Bacteria 1391
413 Ga0207665_10088026 3300025939 Bacteria 2148
414 Ga0207665_10155183 3300025939 Bacteria 1642
415 Ga0207691_10019431 3300025940 Bacteria 6428
416 Ga0207691_10050211 3300025940 Bacteria 3820
417 Ga0207691_10104303 3300025940 Bacteria 2527
418 Ga0207711_10069681 3300025941 Bacteria 3049
419 Ga0207711_10118617 3300025941 Bacteria 2361
420 Ga0207689_10000079 3300025942 Bacteria 78891
421 Ga0207689_10093130 3300025942 Bacteria 2475
422 Ga0207689_10105965 3300025942 Bacteria 2309
423 Ga0207661_10247906 3300025944 Bacteria 1582
424 Ga0207679_10016937 3300025945 Bacteria 4847
425 Ga0207679_10062953 3300025945 Bacteria 2767
426 Ga0207679_10108065 3300025945 Bacteria 2190
427 Ga0207679_10317385 3300025945 Bacteria 1348
428 Ga0207667_10277003 3300025949 Bacteria 1715
429 Ga0207667_10284195 3300025949 Bacteria 1691
430 Ga0207651_10021125 3300025960 Bacteria 3948
431 Ga0207651_10143638 3300025960 Bacteria 1847
432 Ga0207651_10312147 3300025960 Bacteria 1311
433 Ga0207712_10075917 3300025961 Bacteria 2431
434 Ga0207668_10033345 3300025972 Bacteria 3410
435 Ga0207668_10075903 3300025972 Bacteria 2418
436 Ga0207668_10204983 3300025972 Bacteria 1573
437 Ga0207658_10079628 3300025986 Bacteria 2507
438 Ga0207658_10113890 3300025986 Bacteria 2144
439 Ga0207658_10133023 3300025986 Bacteria 2001
440 Ga0207677_10008782 3300026023 Bacteria 5661
441 Ga0207703_10015337 3300026035 Bacteria 5977
442 Ga0207703_10027651 3300026035 Bacteria 4466
443 Ga0207703_10077644 3300026035 Bacteria 2757
444 Ga0207703_10127140 3300026035 Bacteria 2196
445 Ga0207703_10199565 3300026035 Bacteria 1777
446 Ga0207639_10067489 3300026041 Bacteria 2783
447 Ga0207708_10000155 3300026075 Bacteria 54651
448 Ga0207708_10005791 3300026075 Bacteria 9136
449 Ga0207708_10181617 3300026075 Bacteria 1671
450 Ga0207702_10281415 3300026078 Bacteria 1573
451 Ga0207641_10011199 3300026088 Bacteria 7358
452 Ga0207648_10000018 3300026089 Bacteria 148157
453 Ga0207648_10000071 3300026089 Bacteria 95176
454 Ga0207648_10027150 3300026089 Bacteria 5084
455 Ga0207648_10063126 3300026089 Bacteria 3229
456 Ga0207648_10136026 3300026089 Bacteria 2165
457 Ga0207676_10009920 3300026095 Bacteria 6773
458 Ga0207676_10024356 3300026095 Bacteria 4478
459 Ga0207676_10078295 3300026095 Bacteria 2677
460 Ga0207676_10218588 3300026095 Bacteria 1695
461 Ga0207674_10241548 3300026116 Bacteria 1753
462 Ga0207675_100036493 3300026118 Bacteria 4585
463 Ga0207675_100047119 3300026118 Bacteria 4025
464 Ga0207675_100050720 3300026118 Bacteria 3872
465 Ga0207675_100065835 3300026118 Bacteria 3387
466 Ga0207675_100314024 3300026118 Bacteria 1529
467 Ga0207675_100372204 3300026118 Bacteria 1403
468 Ga0207683_10008847 3300026121 Bacteria 8590
469 Ga0207683_10017801 3300026121 Bacteria 6060
470 Ga0207698_10165456 3300026142 Bacteria 1940
471 Ga0207698_10228424 3300026142 Bacteria 1688
472 Ga0207698_10242347 3300026142 Bacteria 1644
473 Ga0207698_10370702 3300026142 Bacteria 1359
474 Ga0209371_1006207 3300027312 Bacteria 4491
475 Ga0209969_1010345 3300027360 Bacteria 1334
476 Ga0209179_1005804 3300027512 Bacteria 1953
477 Ga0209282_1000148 3300027666 Bacteria 41213
478 Ga0209971_1021659 3300027682 Bacteria 1529
479 Ga0209813_10019746 3300027866 Bacteria 1877
480 Ga0209974_10021683 3300027876 Bacteria 2129
481 Ga0207428_10000758 3300027907 Bacteria 36770
482 Ga0207428_10011171 3300027907 Bacteria 7964
483 Ga0207428_10066049 3300027907 Bacteria 2851
484 Ga0268265_10010174 3300028380 Bacteria 6348
485 Ga0268265_10045598 3300028380 Bacteria 3272
486 Ga0268265_10090411 3300028380 Bacteria 2445
487 Ga0268264_10004862 3300028381 Bacteria 11383
488 Ga0268264_10082221 3300028381 Bacteria 2755
489 Ga0268264_10222351 3300028381 Bacteria 1739
490 Ga0265334_10004160 3300028573 Bacteria 6480
491 Ga0265318_10010718 3300028577 Bacteria 3981
492 Ga0307515_10036166 3300028794 Bacteria 8000
493 Ga0307515_10044146 3300028794 Bacteria 6898
494 Ga0268256_1006209 3300030500 Bacteria 4491
495 Ga0307511_10000003 3300030521 Bacteria 193269
496 Ga0307511_10000291 3300030521 Bacteria 52887
497 Ga0307511_10004074 3300030521 Bacteria 14943
498 Ga0265330_10036161 3300031235 Bacteria 2201
499 Ga0265332_10000918 3300031238 Bacteria 17669
500 Ga0265328_10005428 3300031239 Bacteria 5458
501 Ga0265325_10001565 3300031241 Bacteria 15956
502 Ga0265340_10018193 3300031247 Bacteria 3627
503 Ga0265340_10019823 3300031247 Bacteria 3461
504 Ga0265339_10039003 3300031249 Bacteria 2646
505 Ga0265331_10013032 3300031250 Bacteria 4480
506 Ga0265327_10032700 3300031251 Bacteria 2908
507 Ga0265327_10033246 3300031251 Bacteria 2877
508 Ga0265327_10050585 3300031251 Bacteria 2173
509 Ga0265327_10079765 3300031251 Bacteria 1620
510 Ga0307513_10017907 3300031456 Bacteria 8482
511 Ga0307408_100032375 3300031548 Bacteria 3645
512 Ga0265314_10039949 3300031711 Bacteria 3373
513 Ga0265314_10158732 3300031711 Bacteria 1379
514 Ga0265342_10013002 3300031712 Bacteria 5611
515 Ga0265342_10038213 3300031712 Bacteria 2924
516 Ga0307405_10078016 3300031731 Bacteria 2154
517 Ga0307407_10156295 3300031903 Bacteria 1488
518 Ga0307412_10000837 3300031911 Bacteria 17678
519 Ga0307412_10096622 3300031911 Bacteria 2080
520 Ga0307412_10207387 3300031911 Bacteria 1493
521 Ga0307416_100061953 3300032002 Bacteria 3056
522 Ga0307416_100081311 3300032002 Bacteria 2739
523 Ga0307416_100309314 3300032002 Bacteria 1576
524 Ga0307411_10062082 3300032005 Bacteria 2491
525 Ga0307411_10120657 3300032005 Bacteria 1896
526 Ga0307507_10033219 3300033179 Bacteria 5361
527 Ga0307507_10170294 3300033179 Bacteria 1584
528 Ga0373948_0003025 3300034817 Bacteria 2546
529 Ga0373950_0010391 3300034818 Bacteria 1503
530 Ga0373959_0008868 3300034820 Bacteria 1722
531 Ga0373959_0020155 3300034820 Bacteria 1270
532 Ga0373926_0002597 3300035083 Bacteria 5737
533 Ga0373926_0023408 3300035083 Bacteria 2145
534 Ga0373928_0001062 3300035084 Bacteria 5431
535 Ga0373928_0008849 3300035084 Bacteria 1961
536 Ga0373929_0012240 3300035085 Unclassified 1628
537 Ga0373949_0003293 3300035090 Bacteria 3882
538 Ga0373949_0018958 3300035090 Unclassified 1563
539 Ga0373951_0011292 3300035091 Bacteria 2005
540 Ga0373951_0013523 3300035091 Unclassified 1835
541 Ga0373923_0000495 3300035111 Bacteria 9476
542 Ga0373923_0072545 3300035111 Bacteria 1481
543 Ga0373932_0001314 3300035112 Bacteria 6996
544 Ga0373932_0003182 3300035112 Bacteria 3991
545 Ga0373936_0002892 3300035113 Bacteria 6411
546 Ga0373936_0004697 3300035113 Bacteria 5162
547 Ga0373936_0010042 3300035113 Bacteria 3574
548 Ga0373936_0012815 3300035113 Bacteria 3195
549 Ga0373939_0012698 3300035114 Bacteria 2152
550 Ga0373939_0014135 3300035114 Bacteria 2066
551 Ga0373941_0001753 3300035115 Bacteria 4661
552 Ga0373941_0019039 3300035115 Bacteria 1905
553 Ga0373945_0012190 3300035116 Bacteria 2851
554 Ga0373953_0001502 3300035117 Bacteria 6766
555 Ga0373953_0002531 3300035117 Bacteria 5521
556 Ga0373954_0002119 3300035118 Bacteria 8234
557 Ga0373956_0007806 3300035119 Bacteria 4316
558 Ga0373960_0003865 3300035121 Bacteria 3410
559 Ga0373960_0009403 3300035121 Bacteria 2367
560 Ga0373943_0008697 3300035170 Bacteria 4552
561 Ga0373946_0006665 3300035171 Bacteria 4195
562 Ga0373946_0024813 3300035171 Bacteria 2353
563 Ga0373946_0027439 3300035171 Bacteria 2252
564 Ga0373955_0000114 3300035172 Bacteria 32465
565 Ga0373955_0183533 3300035172 Bacteria 1242
566 Ga0373942_0001366 3300035207 Bacteria 6305
567 Ga0373942_0006353 3300035207 Bacteria 2729
568 Ga0373961_0007738 3300035241 Bacteria 2603
569 Ga0373962_0008076 3300035242 Bacteria 2586
570 Ga0373962_0012009 3300035242 Bacteria 2178
571 Ga0373962_0057273 3300035242 Bacteria 1137
572 Ga0373962_0057477 3300035242 Bacteria 1135
573 Ga0373962_0059180 3300035242 Bacteria 1122
574 Ga0373924_0078273 3300035410 Bacteria 1403
575 Ga0373931_0000248 3300035691 Bacteria 22945
576 Ga0373931_0007632 3300035691 Bacteria 5100
577 Ga0373931_0021328 3300035691 Bacteria 3249
578 Ga0373931_0021482 3300035691 Bacteria 3239
579 Ga0373931_0051166 3300035691 Bacteria 2199
580 Ga0373931_0058671 3300035691 Bacteria 2068
581 Ga0373935_0000367 3300035692 Bacteria 23034
582 Ga0373935_0011448 3300035692 Bacteria 5325
583 Ga0373935_0038632 3300035692 Bacteria 2989
584 Ga0373935_0117403 3300035692 Bacteria 1773
585 Ga0373935_0178847 3300035692 Unclassified 1455
586 Ga0373927_0004943 3300035695 Bacteria 9248
587 Ga0373927_0016071 3300035695 Bacteria 4938
588 Ga0373927_0017712 3300035695 Bacteria 4686
589 Ga0373927_0018530 3300035695 Bacteria 4571
590 Ga0373927_0027947 3300035695 Bacteria 3681
591 Ga0373927_0042945 3300035695 Bacteria 2929
592 Ga0373933_0010246 3300035724 Bacteria 5135
593 Ga0373933_0099356 3300035724 Bacteria 1804
594 Ga0373947_0009271 3300035725 Bacteria 5655
595 Ga0373947_0017478 3300035725 Bacteria 4125
596 Ga0373947_0027599 3300035725 Bacteria 3323
597 Ga0373947_0193206 3300035725 Bacteria 1329
598 Ga0373937_0000079 3300036401 Bacteria 88626
599 Ga0373937_0098638 3300036401 Bacteria 2710
600 Ga0373937_0106150 3300036401 Bacteria 2611
601 Ga0373925_0000007 3300037068 Bacteria 257023
602 Ga0373925_0020792 3300037068 Bacteria 4782
603 Ga0373925_0023218 3300037068 Bacteria 4526
604 Ga0373925_0034905 3300037068 Bacteria 3708
605 Ga0373925_0384308 3300037068 Bacteria 1143
606 Ga0395899_0001158 3300037312 Bacteria 23306
607 Ga0395900_0156171 3300037418 Bacteria 2330
608 Ga0395900_0250587 3300037418 Bacteria 1772
609 Ga0395898_0005496 3300037466 Bacteria 13687
610 Ga0395898_0069032 3300037466 Bacteria 3420
611 Ga0395905_0139539 3300037471 Bacteria 2281
612 Ga0395905_0184678 3300037471 Bacteria 1957
613 Ga0395905_0236122 3300037471 Bacteria 1709
614 Ga0436365_1136772 3300039437 Bacteria 28283
615 Ga0436365_1284888 3300039437 Bacteria 16521
616 Ga0439436_0018312 3300041404 Bacteria 2094
617 Ga0450898_003691 3300042134 Bacteria 2212
618 Ga0439446_0031484 3300042156 Bacteria 1535
619 Ga0439435_0029294 3300042436 Bacteria 1485
620 Ga0451577_0178788 3300042876 Bacteria 1912
621 Ga0466963_0166135 3300044694 Bacteria 1537
622 Ga0466964_0078674 3300044706 Bacteria 1410
623 Ga0453684_0382226 3300044712 Bacteria 1581
624 Ga0466960_0003041 3300044901 Bacteria 6408
625 Ga0451576_0017934 3300045051 Bacteria 7770
626 Ga0451576_0018069 3300045051 Bacteria 7738
627 Ga0451576_0114121 3300045051 Bacteria 2812
628 Ga0451576_0119336 3300045051 Bacteria 2745
629 Ga0451576_0392362 3300045051 Bacteria 1455
630 Ga0466967_0007807 3300045976 Bacteria 7773
631 Ga0466967_0010524 3300045976 Bacteria 6946
632 Ga0466967_0376915 3300045976 Bacteria 1377
633 Ga0495592_0000254 3300046454 Bacteria 45710
634 Ga0495592_0054761 3300046454 Bacteria 2953
635 Ga0495592_0067041 3300046454 Bacteria 2624
636 Ga0495592_0107961 3300046454 Bacteria 1973
637 Ga0495603_0002597 3300046455 Bacteria 10664
638 Ga0495629_0004780 3300046459 Bacteria 10153
639 Ga0495629_0024258 3300046459 Bacteria 4319
640 Ga0495629_0157421 3300046459 Bacteria 1578
641 Ga0495629_0194134 3300046459 Bacteria 1404
642 Ga0495641_0025893 3300046461 Bacteria 2872
643 Ga0495641_0065905 3300046461 Bacteria 1630
644 Ga0495651_0000796 3300046462 Bacteria 24460
645 Ga0495651_0217757 3300046462 Bacteria 1324
646 Ga0495653_0000034 3300046463 Bacteria 131084
647 Ga0495653_0048552 3300046463 Bacteria 3275
648 Ga0495580_0004635 3300046472 Bacteria 11547
649 Ga0495580_0080896 3300046472 Bacteria 2264
650 Ga0495582_0008869 3300046473 Bacteria 5548
651 Ga0495582_0134511 3300046473 Bacteria 1398
652 Ga0495605_0005057 3300046474 Bacteria 7697
653 Ga0495639_0042446 3300046475 Bacteria 2051
654 Ga0495639_0047771 3300046475 Bacteria 1940
655 Ga0495662_0025763 3300046476 Bacteria 2840
656 Ga0495664_0000003 3300046477 Bacteria 551602
657 Ga0495664_0222677 3300046477 Bacteria 1142
658 Ga0495594_0020833 3300046499 Bacteria 3495
659 Ga0495594_0036814 3300046499 Bacteria 2670
660 Ga0495596_0001648 3300046500 Bacteria 12690
661 Ga0495607_0027444 3300046501 Bacteria 3520
662 Ga0495608_0000319 3300046511 Bacteria 33877
663 Ga0495608_0030250 3300046511 Bacteria 3667
664 Ga0495610_0002348 3300046512 Bacteria 15988
665 Ga0495616_0001459 3300046513 Bacteria 16445
666 Ga0495616_0006405 3300046513 Bacteria 7124
667 Ga0495618_0000018 3300046514 Bacteria 139407
668 Ga0495618_0042574 3300046514 Bacteria 2862
669 Ga0495628_0000001 3300046516 Bacteria 917742
670 Ga0495628_0043315 3300046516 Bacteria 3586
671 Ga0495628_0043898 3300046516 Bacteria 3558
672 Ga0495628_0128494 3300046516 Bacteria 1940
673 Ga0495630_0001309 3300046517 Bacteria 17126
674 Ga0495630_0003154 3300046517 Bacteria 11440
675 Ga0495631_0074624 3300046518 Bacteria 1464
676 Ga0495643_0000328 3300046522 Bacteria 65181
677 Ga0495643_0008336 3300046522 Bacteria 6574
678 Ga0495663_0017577 3300046525 Bacteria 2031
679 Ga0495666_0019454 3300046526 Bacteria 3369
680 Ga0495666_0045628 3300046526 Bacteria 2114
681 Ga0495642_0004946 3300046528 Bacteria 5139
682 Ga0495652_0000006 3300046529 Bacteria 459709
683 Ga0495652_0007326 3300046529 Bacteria 10175
684 Ga0495652_0219774 3300046529 Bacteria 1428
685 Ga0495652_0242698 3300046529 Bacteria 1339
686 Ga0495665_0035527 3300046531 Bacteria 2662
687 Ga0495640_0000002 3300046533 Bacteria 646434
688 Ga0495640_0038231 3300046533 Bacteria 3376
689 Ga0495640_0191522 3300046533 Bacteria 1300
690 Ga0495586_0012666 3300046535 Bacteria 4472
691 Ga0495586_0018239 3300046535 Bacteria 3736
692 Ga0495586_0144930 3300046535 Bacteria 1334
693 Ga0495587_0000001 3300046536 Bacteria 724132
694 Ga0495598_0026265 3300046537 Bacteria 1595
695 Ga0495598_0040998 3300046537 Bacteria 1353
696 Ga0495609_0003430 3300046538 Bacteria 9084
697 Ga0495609_0084838 3300046538 Bacteria 1382
698 Ga0495621_0008649 3300046539 Bacteria 3062
699 Ga0495621_0060168 3300046539 Bacteria 1377
700 Ga0495597_0028452 3300046542 Archaea 2558
701 Ga0495645_0000009 3300046543 Bacteria 239632
702 Ga0495645_0001560 3300046543 Bacteria 15521
703 Ga0495667_0000004 3300046559 Bacteria 295297
704 Ga0495656_0001315 3300046615 Bacteria 8082
705 Ga0495656_0085415 3300046615 Bacteria 1433
706 Ga0495668_0096430 3300046616 Unclassified 1618
707 Ga0495668_0123130 3300046616 Bacteria 1419
708 Ga0495634_0000014 3300046642 Bacteria 128091
709 Ga0495634_0019822 3300046642 Bacteria 4774
710 Ga0495634_0038522 3300046642 Bacteria 3259
711 Ga0495634_0103732 3300046642 Bacteria 1835
712 Ga0495635_0000001 3300046663 Bacteria 704901
713 Ga0495635_0336099 3300046663 Bacteria 1009
714 Ga0495661_0007293 3300046665 Bacteria 7709
715 Ga0495661_0175849 3300046665 Bacteria 1138
716 Ga0495661_0188946 3300046665 Bacteria 1086
717 Ga0495657_0000336 3300046675 Bacteria 43164
718 Ga0495657_0011703 3300046675 Bacteria 6544
719 Ga0495599_0000053 3300046678 Bacteria 80559
720 Ga0495599_0003895 3300046678 Bacteria 8780
721 Ga0495599_0174424 3300046678 Bacteria 1326
722 Ga0495623_0000091 3300046679 Bacteria 53677
723 Ga0495646_0000020 3300046680 Bacteria 117021
724 Ga0495646_0116993 3300046680 Bacteria 1512
725 Ga0495647_0000477 3300046681 Bacteria 11635
726 Ga0495647_0011475 3300046681 Bacteria 3037
727 Ga0495647_0069174 3300046681 Bacteria 1409
728 Ga0495658_0014860 3300046683 Bacteria 3985
729 Ga0495658_0119044 3300046683 Bacteria 1595
730 Ga0495613_0009581 3300046689 Bacteria 7196
731 Ga0495613_0132118 3300046689 Bacteria 1787
732 Ga0495613_0219694 3300046689 Bacteria 1334
733 Ga0495624_0081084 3300046690 Bacteria 2010
734 Ga0495670_0139606 3300046691 Bacteria 1267
735 Ga0495671_0019692 3300046692 Bacteria 3562
736 Ga0495649_0012031 3300046694 Bacteria 5054
737 Ga0495600_0000123 3300046809 Bacteria 43494
738 Ga0495600_0014825 3300046809 Bacteria 4916
739 Ga0495581_0111908 3300047315 Bacteria 1588
740 Ga0495604_0000008 3300047317 Bacteria 341160
741 Ga0495604_0121878 3300047317 Bacteria 1886
742 Ga0495636_0108300 3300047318 Bacteria 1221
743 Ga0495674_0000016 3300047319 Bacteria 216763
744 Ga0495674_0026636 3300047319 Bacteria 5290
745 Ga0495674_0092029 3300047319 Bacteria 2590
746 Ga0495674_0180261 3300047319 Bacteria 1759
747 Ga0495672_0013747 3300047320 Bacteria 5570
748 Ga0495672_0054522 3300047320 Bacteria 2336
749 Ga0495676_0007711 3300047321 Bacteria 9874
750 Ga0495676_0021776 3300047321 Bacteria 5590
751 Ga0495680_0024757 3300047322 Bacteria 4974
752 Ga0495680_0203478 3300047322 Bacteria 1419
753 Ga0495687_029483 3300047443 Bacteria 2538
754 Ga0495675_0014865 3300047444 Bacteria 4922
755 Ga0495675_0024425 3300047444 Bacteria 3852
756 Ga0495679_042683 3300047446 Bacteria 1398
757 Ga0495681_0114367 3300047470 Bacteria 1165
758 Ga0495684_0000002 3300047471 Bacteria 341216
759 Ga0495684_0028395 3300047471 Bacteria 4295
760 Ga0495684_0101229 3300047471 Bacteria 2178
761 Ga0495684_0329526 3300047471 Bacteria 1089
762 Ga0495593_0001468 3300047673 Bacteria 13846
763 Ga0495602_0000022 3300048088 Bacteria 163672
764 Ga0495602_0098310 3300048088 Bacteria 2409
765 Ga0495602_0103211 3300048088 Bacteria 2334
766 Ga0495602_0217112 3300048088 Bacteria 1446
767 Ga0495626_0000652 3300048091 Bacteria 33405
768 Ga0495626_0014553 3300048091 Bacteria 4053
769 Ga0496100_0088053 3300048903 Bacteria 2112
770 Ga0496100_0237526 3300048903 Bacteria 1343
771 Ga0496101_0004652 3300048904 Bacteria 8678
772 Ga0496101_0013711 3300048904 Bacteria 5436
773 Ga0496101_0072282 3300048904 Bacteria 2531
774 Ga0496102_0006819 3300048905 Bacteria 9746
775 Ga0496102_0019179 3300048905 Bacteria 6021
776 Ga0496102_0028178 3300048905 Bacteria 5017
777 Ga0496102_0621472 3300048905 Bacteria 1003
778 Ga0496103_0015056 3300048906 Bacteria 4598
779 Ga0496103_0020735 3300048906 Bacteria 3951
780 Ga0496103_0240574 3300048906 Bacteria 1164
781 Ga0496104_0000833 3300048907 Bacteria 26625
782 Ga0496104_0001498 3300048907 Bacteria 20143
783 Ga0496104_0014338 3300048907 Bacteria 7158
784 Ga0496105_0000355 3300048908 Bacteria 30230
785 Ga0496105_0006679 3300048908 Bacteria 8880
786 Ga0496105_0026794 3300048908 Bacteria 4705
787 Ga0496105_0045267 3300048908 Bacteria 3630
788 Ga0496105_0074093 3300048908 Bacteria 2812
789 Ga0496105_0084557 3300048908 Bacteria 2621
790 Ga0496106_0003706 3300048909 Bacteria 11402
791 Ga0496106_0050670 3300048909 Bacteria 3129
792 Ga0496106_0066422 3300048909 Bacteria 2747
793 Ga0496107_0017060 3300048910 Bacteria 5105
794 Ga0496107_0035525 3300048910 Bacteria 3572
795 Ga0496107_0071406 3300048910 Bacteria 2522
796 Ga0496108_0049181 3300048911 Bacteria 3526
797 Ga0496108_0109059 3300048911 Bacteria 2365
798 Ga0496109_0006773 3300048912 Bacteria 9650
799 Ga0496109_0014145 3300048912 Bacteria 6937
800 Ga0496109_0124796 3300048912 Bacteria 2400
801 Ga0496109_0184285 3300048912 Bacteria 1961
802 Ga0496109_0377269 3300048912 Bacteria 1340
803 Ga0496110_0006467 3300048913 Bacteria 9285
804 Ga0496110_0060655 3300048913 Bacteria 3337
805 Ga0496110_0151410 3300048913 Bacteria 2100
806 Ga0496110_0406882 3300048913 Bacteria 1240
807 Ga0496110_0492800 3300048913 Bacteria 1116
808 Ga0496111_0004396 3300048914 Bacteria 8901
809 Ga0496111_0014603 3300048914 Bacteria 5371
810 Ga0496111_0069916 3300048914 Bacteria 2553
811 Ga0496112_0001747 3300048915 Bacteria 17023
812 Ga0496112_0011575 3300048915 Bacteria 8064
813 Ga0496112_0015894 3300048915 Bacteria 7033
814 Ga0496112_0073985 3300048915 Bacteria 3368
815 Ga0496113_0000322 3300048916 Bacteria 22806
816 Ga0496113_0000645 3300048916 Bacteria 17565
817 Ga0496113_0086728 3300048916 Bacteria 2405
818 Ga0496114_0020754 3300048917 Bacteria 5333
819 Ga0496114_0021866 3300048917 Bacteria 5206
820 Ga0496114_0050710 3300048917 Bacteria 3455
821 Ga0496114_0137361 3300048917 Bacteria 2114
822 Ga0496114_0157570 3300048917 Bacteria 1972
823 Ga0496115_0003546 3300048918 Bacteria 11224
824 Ga0496115_0081022 3300048918 Bacteria 2643
825 Ga0496116_0001838 3300048919 Bacteria 22937
826 Ga0496117_0019813 3300048920 Bacteria 5511
827 Ga0496117_0213509 3300048920 Bacteria 1080
828 Ga0496118_0010842 3300048921 Bacteria 8975
829 Ga0496118_0016901 3300048921 Bacteria 6665
830 Ga0496119_0012107 3300048922 Bacteria 7045
831 Ga0496119_0210570 3300048922 Bacteria 1000
832 Ga0496120_0106325 3300048923 Bacteria 1473
833 Ga0496121_0000127 3300048924 Bacteria 168545
834 Ga0496121_0026802 3300048924 Bacteria 5415
835 Ga0496121_0032233 3300048924 Bacteria 4768
836 Ga0496122_0000601 3300048925 Bacteria 74140
837 Ga0496122_0076019 3300048925 Bacteria 2365
838 Ga0496122_0082403 3300048925 Bacteria 2234
839 Ga0496123_0001435 3300048926 Bacteria 33260
840 Ga0496123_0002704 3300048926 Bacteria 21311
841 Ga0496123_0035472 3300048926 Bacteria 3553
842 Ga0496124_0000346 3300048927 Bacteria 84852
843 Ga0496124_0090623 3300048927 Bacteria 2493
844 Ga0496124_0107594 3300048927 Bacteria 2249
845 Ga0496124_0165800 3300048927 Bacteria 1717
846 Ga0496124_0168399 3300048927 Bacteria 1700
847 Ga0496125_0000011 3300048928 Bacteria 655895
848 Ga0496125_0002692 3300048928 Bacteria 22621
849 Ga0496125_0022861 3300048928 Bacteria 5792
850 Ga0496125_0045932 3300048928 Bacteria 3670
851 Ga0496126_0010507 3300048929 Bacteria 9695
852 Ga0501299_011371 3300049522 Bacteria 1503
853 Ga0501033_0045454 3300049570 Bacteria 3268
854 Ga0501034_0146215 3300049571 Bacteria 2341
855 Ga0501037_0367392 3300049573 Bacteria 990
856 Ga0501039_0177799 3300049575 Bacteria 1673
857 Ga0501042_0117158 3300049578 Bacteria 1918
858 Ga0501042_0262798 3300049578 Bacteria 1246
859 Ga0501043_0036204 3300049579 Bacteria 3882
860 Ga0501043_0180118 3300049579 Bacteria 1647
861 Ga0501047_0006619 3300049581 Bacteria 10900
862 Ga0501067_0012561 3300049583 Bacteria 4700
863 Ga0501071_0257645 3300049587 Bacteria 1317
864 Ga0501076_0073575 3300049592 Bacteria 2736
865 Ga0501077_0028385 3300049593 Bacteria 3557
866 Ga0501079_0012449 3300049741 Bacteria 6492
867 Ga0501080_0066635 3300049742 Bacteria 3349
868 Ga0501035_0010453 3300049822 Bacteria 8602
869 Ga0501044_0004409 3300049823 Bacteria 15749
870 Ga0501044_0256039 3300049823 Bacteria 1690
871 nmdc:mga03683_28381_c1 3300050489 Bacteria 2225
872 nmdc:mga03683_31875_c1 3300050489 Unclassified 2117
873 nmdc:mga03683_7685_c1 3300050489 Bacteria 3754
874 nmdc:mga00v17_43570_c1 3300050491 Bacteria 2703
875 nmdc:mga00v17_97219_c1 3300050491 Bacteria 1856
876 nmdc:mga0yw44_11367_c1 3300050492 Bacteria 4590
877 nmdc:mga0yw44_175562_c1 3300050492 Bacteria 1408
878 nmdc:mga0yw44_190996_c1 3300050492 Bacteria 1351
879 nmdc:mga0yw44_21483_c1 3300050492 Bacteria 3601
880 nmdc:mga0yw44_296007_c1 3300050492 Bacteria 1084
881 nmdc:mga0k408_15449_c1 3300050493 Bacteria 4223
882 nmdc:mga0k408_83582_c1 3300050493 Bacteria 1872
883 nmdc:mga06z11_35069_c1 3300050494 Bacteria 2467
884 nmdc:mga06z11_35616_c1 3300050494 Bacteria 2452
885 nmdc:mga07m45_10183_c1 3300050496 Bacteria 4903
886 nmdc:mga05p37_453_c1 3300050507 Bacteria 44606
887 nmdc:mga05p37_5672_c1 3300050507 Bacteria 14675
888 nmdc:mga09592_2036_c1 3300050508 Bacteria 16307
889 nmdc:mga09592_2477_c1 3300050508 Bacteria 14910
890 nmdc:mga0qj67_102839_c1 3300050509 Bacteria 2304
891 nmdc:mga06r32_101596_c1 3300050510 Bacteria 2822
892 nmdc:mga06r32_268879_c1 3300050510 Bacteria 1692
893 nmdc:mga06r32_58494_c1 3300050510 Bacteria 3704
894 nmdc:mga08y16_10655_c1 3300050511 Bacteria 9649
895 nmdc:mga08y16_11404_c1 3300050511 Bacteria 9339
896 nmdc:mga08y16_13184_c1 3300050511 Bacteria 8694
897 nmdc:mga08y16_168649_c1 3300050511 Bacteria 2274
898 nmdc:mga08y16_30147_c1 3300050511 Bacteria 5710
899 nmdc:mga08y16_51079_c1 3300050511 Bacteria 4325
900 nmdc:mga08y16_532970_c1 3300050511 Bacteria 1190
901 nmdc:mga08y16_81141_c1 3300050511 Bacteria 3381
902 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
903 nmdc:mga0n895_16155_c1 3300050512 Bacteria 6842
904 nmdc:mga0n895_2741_c1 3300050512 Bacteria 13912
905 nmdc:mga0n895_276122_c1 3300050512 Bacteria 1704
906 nmdc:mga0n895_287519_c1 3300050512 Bacteria 1667
907 nmdc:mga0n895_80247_c1 3300050512 Bacteria 3250
908 nmdc:mga0rr50_104989_c1 3300050513 Bacteria 2227
909 nmdc:mga0rr50_1131_c1 3300050513 Bacteria 14513
910 nmdc:mga0rr50_147293_c1 3300050513 Bacteria 1899
911 nmdc:mga0rr50_2318_c1 3300050513 Bacteria 10677
912 nmdc:mga0rr50_262381_c1 3300050513 Bacteria 1437
913 nmdc:mga08x19_11499_c1 3300050514 Bacteria 5326
914 nmdc:mga08x19_125760_c1 3300050514 Bacteria 1721
915 nmdc:mga08x19_37114_c1 3300050514 Bacteria 3091
916 nmdc:mga08x19_3775_c1 3300050514 Bacteria 9016
917 nmdc:mga08x19_548_c1 3300050514 Bacteria 24677
918 nmdc:mga08x19_7499_c1 3300050514 Bacteria 6480
919 nmdc:mga0a205_1935_c1 3300050515 Bacteria 17991
920 nmdc:mga0a205_284_c1 3300050515 Bacteria 37182
921 nmdc:mga0a205_39962_c1 3300050515 Bacteria 4516
922 nmdc:mga0sz30_20660_c1 3300050516 Bacteria 2657
923 nmdc:mga0sz30_62920_c1 3300050516 Bacteria 1588
924 nmdc:mga0sz30_85365_c1 3300050516 Bacteria 1370
925 Ga0495601_0000001 3300053077 Bacteria 549454
926 Ga0495601_0011988 3300053077 Bacteria 5194
927 Ga0495601_0030384 3300053077 Bacteria 3354
928 Ga0495601_0037851 3300053077 Bacteria 3015
929 Ga0495601_0097252 3300053077 Bacteria 1899
930 Ga0495601_0247841 3300053077 Bacteria 1163
931 Ga0495612_0000003 3300053078 Bacteria 303629
932 Ga0495612_0102124 3300053078 Bacteria 1221
933 Ga0495612_0176068 3300053078 Bacteria 938
934 Ga0500610_0000022 3300053079 Bacteria 60344
935 Ga0495595_0000082 3300053084 Bacteria 45698
936 Ga0495595_0005771 3300053084 Bacteria 5012
937 Ga0495619_0000004 3300053085 Bacteria 500068
938 Ga0495619_0015254 3300053085 Bacteria 4859
939 Ga0495619_0071972 3300053085 Bacteria 2314
940 Ga0500644_0047593 3300053088 Bacteria 1455
941 Ga0500646_0002103 3300053090 Bacteria 5191
942 Ga0500646_0007545 3300053090 Bacteria 2782
943 Ga0500646_0007754 3300053090 Bacteria 2743
944 Ga0500651_0081671 3300053093 Bacteria 2001
945 Ga0500566_0181016 3300053094 Bacteria 1081
946 Ga0500555_015627 3300053103 Bacteria 2189
947 Ga0500658_0025225 3300053134 Bacteria 2284
948 Ga0500568_0018098 3300053139 Bacteria 3093
949 Ga0500568_0074291 3300053139 Bacteria 1297
950 Ga0500604_0002634 3300053151 Bacteria 4883
951 Ga0500604_0008950 3300053151 Bacteria 2662
952 Ga0500616_0002390 3300053153 Bacteria 15675
953 Ga0500552_000160 3300053733 Bacteria 5869
954 Ga0530510_0171579 3300061734 Bacteria 1607

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0210570 Ga0496119_0210570_52_846 251
2 3300047317 Ga0495604_0121878 Ga0495604_0121878_10_795 255
3 3300049579 Ga0501043_0180118 Ga0501043_0180118_23_892 267
4 3300037068 Ga0373925_0384308 Ga0373925_0384308_18_842 268
5 3300025935 Ga0207709_10355480 Ga0207709_103554801 269
6 3300035242 Ga0373962_0057477 Ga0373962_0057477_252_1079 269
7 3300028794 Ga0307515_10044146 Ga0307515_100441462 271
8 3300014969 Ga0157376_10050117 Ga0157376_100501175 273
9 3300035115 Ga0373941_0019039 Ga0373941_0019039_605_1552 273
10 3300035691 Ga0373931_0021328 Ga0373931_0021328_1966_2913 273
11 3300047320 Ga0495672_0054522 Ga0495672_0054522_1112_2161 275
12 3300005330 Ga0070690_100056022 Ga0070690_1000560221 277
13 3300005535 Ga0070684_100267382 Ga0070684_1002673822 277
14 3300005544 Ga0070686_100175083 Ga0070686_1001750832 277
15 3300006237 Ga0097621_100001049 Ga0097621_1000010493 277
16 3300006358 Ga0068871_100004173 Ga0068871_1000041733 277
17 3300025898 Ga0207692_10113619 Ga0207692_101136192 277
18 3300025918 Ga0207662_10131049 Ga0207662_101310492 277
19 3300026035 Ga0207703_10199565 Ga0207703_101995651 277
20 3300025901 Ga0207688_10116738 Ga0207688_101167381 283
21 3300009098 Ga0105245_10798775 Ga0105245_107987751 284
22 3300053078 Ga0495612_0176068 Ga0495612_0176068_61_918 284
23 3300050492 nmdc:mga0yw44_296007_c1 nmdc:mga0yw44_296007_c1_195_1073 285
24 3300009176 Ga0105242_10337902 Ga0105242_103379022 287
25 3300013306 Ga0163162_10387645 Ga0163162_103876452 287
26 3300049587 Ga0501071_0257645 Ga0501071_0257645_11_889 287
27 3300053079 Ga0500610_0000022 Ga0500610_0000022_26131_27108 287
28 3300046642 Ga0495634_0038522 Ga0495634_0038522_510_1418 292
29 3300045051 Ga0451576_0392362 Ga0451576_0392362_544_1443 293
30 3300006914 Ga0075436_100130099 Ga0075436_1001300991 294
31 3300050514 nmdc:mga08x19_125760_c1 nmdc:mga08x19_125760_c1_491_1450 294
32 3300013296 Ga0157374_10102708 Ga0157374_101027083 295
33 3300005467 Ga0070706_100006414 Ga0070706_1000064146 296
34 3300025910 Ga0207684_10000788 Ga0207684_1000078824 296
35 3300025939 Ga0207665_10088026 Ga0207665_100880262 296
36 3300050516 nmdc:mga0sz30_20660_c1 nmdc:mga0sz30_20660_c1_402_1388 296
37 3300005347 Ga0070668_100019524 Ga0070668_1000195242 297
38 3300005356 Ga0070674_100127626 Ga0070674_1001276262 297
39 3300005543 Ga0070672_100230977 Ga0070672_1002309771 297
40 3300025986 Ga0207658_10113890 Ga0207658_101138902 297
41 3300006846 Ga0075430_100068042 Ga0075430_1000680422 298
42 3300025916 Ga0207663_10316611 Ga0207663_103166111 298
43 3300025918 Ga0207662_10027735 Ga0207662_100277354 298
44 3300037312 Ga0395899_0001158 Ga0395899_0001158_14357_15325 298
45 3300037466 Ga0395898_0005496 Ga0395898_0005496_1583_2551 298
46 3300037471 Ga0395905_0236122 Ga0395905_0236122_421_1389 298
47 3300044694 Ga0466963_0166135 Ga0466963_0166135_346_1257 298
48 3300045976 Ga0466967_0376915 Ga0466967_0376915_255_1166 298
49 3300048905 Ga0496102_0621472 Ga0496102_0621472_53_949 298
50 3300014745 Ga0157377_10240015 Ga0157377_102400151 299
51 3300046533 Ga0495640_0191522 Ga0495640_0191522_285_1184 299
52 3300048905 Ga0496102_0028178 Ga0496102_0028178_3852_4751 299
53 3300048908 Ga0496105_0074093 Ga0496105_0074093_1778_2677 299
54 3300049570 Ga0501033_0045454 Ga0501033_0045454_50_1024 299
55 3300049571 Ga0501034_0146215 Ga0501034_0146215_824_1798 299
56 3300049581 Ga0501047_0006619 Ga0501047_0006619_1987_2961 299
57 3300049822 Ga0501035_0010453 Ga0501035_0010453_692_1666 299
58 3300049823 Ga0501044_0004409 Ga0501044_0004409_3046_4020 299
59 3300050492 nmdc:mga0yw44_175562_c1 nmdc:mga0yw44_175562_c1_14_940 300
60 3300041404 Ga0439436_0018312 Ga0439436_0018312_59_994 301
61 3300046535 Ga0495586_0144930 Ga0495586_0144930_181_1155 301
62 3300050513 nmdc:mga0rr50_104989_c1 nmdc:mga0rr50_104989_c1_156_1085 301
63 3300050514 nmdc:mga08x19_548_c1 nmdc:mga08x19_548_c1_23422_24351 301
64 3300050515 nmdc:mga0a205_1935_c1 nmdc:mga0a205_1935_c1_1524_2453 301
65 3300053077 Ga0495601_0247841 Ga0495601_0247841_146_1120 301
66 3300053085 Ga0495619_0071972 Ga0495619_0071972_1117_2091 301
67 3300053088 Ga0500644_0047593 Ga0500644_0047593_209_1198 301
68 3300053090 Ga0500646_0007545 Ga0500646_0007545_343_1332 301
69 3300053103 Ga0500555_015627 Ga0500555_015627_1106_2095 301
70 3300053139 Ga0500568_0018098 Ga0500568_0018098_1445_2434 301
71 3300053151 Ga0500604_0008950 Ga0500604_0008950_1446_2435 301
72 3300049573 Ga0501037_0367392 Ga0501037_0367392_12_938 302
73 3300009148 Ga0105243_10000743 Ga0105243_100007435 303
74 3300025935 Ga0207709_10000085 Ga0207709_10000085140 303
75 3300048924 Ga0496121_0032233 Ga0496121_0032233_684_1625 303
76 3300005329 Ga0070683_100018484 Ga0070683_1000184846 304
77 3300005335 Ga0070666_10285834 Ga0070666_102858341 304
78 3300005353 Ga0070669_100146514 Ga0070669_1001465142 304
79 3300005354 Ga0070675_100071179 Ga0070675_1000711793 304
80 3300005356 Ga0070674_100105194 Ga0070674_1001051942 304
81 3300005365 Ga0070688_100061466 Ga0070688_1000614663 304
82 3300005367 Ga0070667_100141322 Ga0070667_1001413222 304
83 3300005438 Ga0070701_10010189 Ga0070701_100101892 304
84 3300005440 Ga0070705_100090944 Ga0070705_1000909441 304
85 3300005457 Ga0070662_100240262 Ga0070662_1002402621 304
86 3300005466 Ga0070685_10015443 Ga0070685_100154434 304
87 3300005544 Ga0070686_100098988 Ga0070686_1000989882 304
88 3300005564 Ga0070664_100139169 Ga0070664_1001391692 304
89 3300005616 Ga0068852_100016862 Ga0068852_1000168625 304
90 3300005618 Ga0068864_100088907 Ga0068864_1000889072 304
91 3300005719 Ga0068861_100019728 Ga0068861_1000197283 304
92 3300006051 Ga0075364_10231932 Ga0075364_102319321 304
93 3300006178 Ga0075367_10084814 Ga0075367_100848142 304
94 3300006358 Ga0068871_100031226 Ga0068871_1000312264 304
95 3300009094 Ga0111539_10139578 Ga0111539_101395783 304
96 3300009098 Ga0105245_10102244 Ga0105245_101022442 304
97 3300009101 Ga0105247_10012451 Ga0105247_100124513 304
98 3300009551 Ga0105238_10138160 Ga0105238_101381602 304
99 3300011119 Ga0105246_10197654 Ga0105246_101976542 304
100 3300013296 Ga0157374_10217492 Ga0157374_102174921 304
101 3300025901 Ga0207688_10000077 Ga0207688_100000776 304
102 3300025914 Ga0207671_10113150 Ga0207671_101131501 304
103 3300025918 Ga0207662_10002112 Ga0207662_1000211212 304
104 3300025919 Ga0207657_10158746 Ga0207657_101587462 304
105 3300025927 Ga0207687_10101226 Ga0207687_101012262 304
106 3300025933 Ga0207706_10001566 Ga0207706_100015666 304
107 3300025986 Ga0207658_10133023 Ga0207658_101330232 304
108 3300026035 Ga0207703_10127140 Ga0207703_101271402 304
109 3300026075 Ga0207708_10000155 Ga0207708_100001553 304
110 3300026116 Ga0207674_10241548 Ga0207674_102415482 304
111 3300026118 Ga0207675_100050720 Ga0207675_1000507202 304
112 3300046537 Ga0495598_0026265 Ga0495598_0026265_570_1538 304
113 3300046538 Ga0495609_0084838 Ga0495609_0084838_229_1197 304
114 3300046616 Ga0495668_0123130 Ga0495668_0123130_136_1104 304
115 3300047319 Ga0495674_0180261 Ga0495674_0180261_169_1152 304
116 3300048904 Ga0496101_0072282 Ga0496101_0072282_654_1622 304
117 3300048906 Ga0496103_0240574 Ga0496103_0240574_81_1049 304
118 3300048908 Ga0496105_0006679 Ga0496105_0006679_7184_8152 304
119 3300048909 Ga0496106_0050670 Ga0496106_0050670_1447_2415 304
120 3300048910 Ga0496107_0071406 Ga0496107_0071406_910_1878 304
121 3300048916 Ga0496113_0086728 Ga0496113_0086728_272_1240 304
122 3300048917 Ga0496114_0021866 Ga0496114_0021866_3379_4347 304
123 3300050511 nmdc:mga08y16_81141_c1 nmdc:mga08y16_81141_c1_1283_2251 304
124 3300005334 Ga0068869_100017953 Ga0068869_1000179531 305
125 3300005334 Ga0068869_100192724 Ga0068869_1001927242 305
126 3300005336 Ga0070680_100011245 Ga0070680_1000112459 305
127 3300005336 Ga0070680_100227620 Ga0070680_1002276202 305
128 3300005338 Ga0068868_100001010 Ga0068868_10000101011 305
129 3300005340 Ga0070689_100055638 Ga0070689_1000556382 305
130 3300005340 Ga0070689_100210663 Ga0070689_1002106632 305
131 3300005343 Ga0070687_100000472 Ga0070687_10000047214 305
132 3300005343 Ga0070687_100079239 Ga0070687_1000792391 305
133 3300005345 Ga0070692_10012681 Ga0070692_100126815 305
134 3300005355 Ga0070671_100116982 Ga0070671_1001169823 305
135 3300005364 Ga0070673_100163593 Ga0070673_1001635932 305
136 3300005367 Ga0070667_100345258 Ga0070667_1003452581 305
137 3300005440 Ga0070705_100000043 Ga0070705_10000004311 305
138 3300005440 Ga0070705_100155137 Ga0070705_1001551372 305
139 3300005441 Ga0070700_100003779 Ga0070700_1000037792 305
140 3300005444 Ga0070694_100006344 Ga0070694_1000063445 305
141 3300005459 Ga0068867_100000225 Ga0068867_10000022533 305
142 3300005459 Ga0068867_100214314 Ga0068867_1002143141 305
143 3300005530 Ga0070679_100050267 Ga0070679_1000502672 305
144 3300005544 Ga0070686_100098164 Ga0070686_1000981642 305
145 3300005545 Ga0070695_100033205 Ga0070695_1000332052 305
146 3300005546 Ga0070696_100003112 Ga0070696_1000031128 305
147 3300005546 Ga0070696_100020591 Ga0070696_1000205912 305
148 3300005547 Ga0070693_100000016 Ga0070693_10000001671 305
149 3300005549 Ga0070704_100000837 Ga0070704_1000008372 305
150 3300005563 Ga0068855_100012963 Ga0068855_10001296311 305
151 3300005615 Ga0070702_100000017 Ga0070702_10000001739 305
152 3300005615 Ga0070702_100161664 Ga0070702_1001616641 305
153 3300005616 Ga0068852_100494472 Ga0068852_1004944721 305
154 3300005718 Ga0068866_10016800 Ga0068866_100168002 305
155 3300005719 Ga0068861_100000496 Ga0068861_10000049615 305
156 3300005719 Ga0068861_100267540 Ga0068861_1002675402 305
157 3300005842 Ga0068858_100001011 Ga0068858_10000101110 305
158 3300005842 Ga0068858_100291891 Ga0068858_1002918912 305
159 3300005843 Ga0068860_100074316 Ga0068860_1000743162 305
160 3300005843 Ga0068860_100285616 Ga0068860_1002856162 305
161 3300005844 Ga0068862_100119071 Ga0068862_1001190712 305
162 3300006237 Ga0097621_100007640 Ga0097621_1000076401 305
163 3300006844 Ga0075428_100013933 Ga0075428_10001393311 305
164 3300006847 Ga0075431_100107621 Ga0075431_1001076212 305
165 3300006871 Ga0075434_100005820 Ga0075434_1000058202 305
166 3300006880 Ga0075429_100007303 Ga0075429_10000730311 305
167 3300006881 Ga0068865_100016551 Ga0068865_1000165516 305
168 3300006914 Ga0075436_100001337 Ga0075436_1000013376 305
169 3300007076 Ga0075435_100000241 Ga0075435_10000024125 305
170 3300009094 Ga0111539_10026228 Ga0111539_100262282 305
171 3300009094 Ga0111539_10035923 Ga0111539_100359236 305
172 3300009098 Ga0105245_10085899 Ga0105245_100858993 305
173 3300009098 Ga0105245_10250114 Ga0105245_102501142 305
174 3300009147 Ga0114129_10001202 Ga0114129_1000120211 305
175 3300009148 Ga0105243_10188739 Ga0105243_101887392 305
176 3300009148 Ga0105243_10191090 Ga0105243_101910902 305
177 3300009174 Ga0105241_10133962 Ga0105241_101339623 305
178 3300013297 Ga0157378_10058354 Ga0157378_100583544 305
179 3300025893 Ga0207682_10068119 Ga0207682_100681191 305
180 3300025899 Ga0207642_10034515 Ga0207642_100345152 305
181 3300025901 Ga0207688_10078236 Ga0207688_100782362 305
182 3300025908 Ga0207643_10106289 Ga0207643_101062892 305
183 3300025917 Ga0207660_10173589 Ga0207660_101735892 305
184 3300025918 Ga0207662_10004898 Ga0207662_100048981 305
185 3300025921 Ga0207652_10035230 Ga0207652_100352302 305
186 3300025927 Ga0207687_10071957 Ga0207687_100719572 305
187 3300025927 Ga0207687_10152212 Ga0207687_101522122 305
188 3300025931 Ga0207644_10051645 Ga0207644_100516453 305
189 3300025935 Ga0207709_10030284 Ga0207709_100302844 305
190 3300025936 Ga0207670_10111609 Ga0207670_101116092 305
191 3300025938 Ga0207704_10006104 Ga0207704_100061042 305
192 3300025942 Ga0207689_10000079 Ga0207689_1000007982 305
193 3300025949 Ga0207667_10277003 Ga0207667_102770032 305
194 3300025960 Ga0207651_10312147 Ga0207651_103121472 305
195 3300025961 Ga0207712_10075917 Ga0207712_100759173 305
196 3300026035 Ga0207703_10077644 Ga0207703_100776441 305
197 3300026075 Ga0207708_10181617 Ga0207708_101816172 305
198 3300026078 Ga0207702_10281415 Ga0207702_102814152 305
199 3300026089 Ga0207648_10000018 Ga0207648_10000018161 305
200 3300026089 Ga0207648_10000071 Ga0207648_100000712 305
201 3300026118 Ga0207675_100036493 Ga0207675_1000364935 305
202 3300026118 Ga0207675_100372204 Ga0207675_1003722042 305
203 3300026142 Ga0207698_10228424 Ga0207698_102284242 305
204 3300026142 Ga0207698_10370702 Ga0207698_103707022 305
205 3300027907 Ga0207428_10011171 Ga0207428_100111714 305
206 3300027907 Ga0207428_10066049 Ga0207428_100660493 305
207 3300028380 Ga0268265_10010174 Ga0268265_100101743 305
208 3300028381 Ga0268264_10004862 Ga0268264_100048623 305
209 3300028381 Ga0268264_10222351 Ga0268264_102223512 305
210 3300031247 Ga0265340_10019823 Ga0265340_100198232 305
211 3300034820 Ga0373959_0020155 Ga0373959_0020155_13_963 305
212 3300035083 Ga0373926_0023408 Ga0373926_0023408_534_1484 305
213 3300035084 Ga0373928_0001062 Ga0373928_0001062_793_1743 305
214 3300035085 Ga0373929_0012240 Ga0373929_0012240_299_1249 305
215 3300035090 Ga0373949_0018958 Ga0373949_0018958_599_1549 305
216 3300035112 Ga0373932_0001314 Ga0373932_0001314_5042_5992 305
217 3300035113 Ga0373936_0012815 Ga0373936_0012815_830_1780 305
218 3300035114 Ga0373939_0012698 Ga0373939_0012698_1041_1991 305
219 3300035115 Ga0373941_0001753 Ga0373941_0001753_3669_4619 305
220 3300035116 Ga0373945_0012190 Ga0373945_0012190_1747_2697 305
221 3300035242 Ga0373962_0008076 Ga0373962_0008076_822_1772 305
222 3300035692 Ga0373935_0011448 Ga0373935_0011448_1507_2457 305
223 3300035695 Ga0373927_0027947 Ga0373927_0027947_1528_2478 305
224 3300035725 Ga0373947_0017478 Ga0373947_0017478_807_1757 305
225 3300037068 Ga0373925_0020792 Ga0373925_0020792_1236_2186 305
226 3300046454 Ga0495592_0107961 Ga0495592_0107961_379_1326 305
227 3300046473 Ga0495582_0134511 Ga0495582_0134511_183_1133 305
228 3300046516 Ga0495628_0043315 Ga0495628_0043315_348_1295 305
229 3300046529 Ga0495652_0219774 Ga0495652_0219774_396_1343 305
230 3300046531 Ga0495665_0035527 Ga0495665_0035527_701_1651 305
231 3300046535 Ga0495586_0018239 Ga0495586_0018239_2207_3157 305
232 3300046615 Ga0495656_0085415 Ga0495656_0085415_154_1104 305
233 3300046681 Ga0495647_0011475 Ga0495647_0011475_1518_2468 305
234 3300046683 Ga0495658_0119044 Ga0495658_0119044_348_1298 305
235 3300048927 Ga0496124_0165800 Ga0496124_0165800_340_1347 305
236 3300050507 nmdc:mga05p37_5672_c1 nmdc:mga05p37_5672_c1_2114_3082 305
237 3300050508 nmdc:mga09592_2036_c1 nmdc:mga09592_2036_c1_137_1105 305
238 3300050510 nmdc:mga06r32_101596_c1 nmdc:mga06r32_101596_c1_1431_2399 305
239 3300050511 nmdc:mga08y16_10655_c1 nmdc:mga08y16_10655_c1_1542_2492 305
240 3300050511 nmdc:mga08y16_13184_c1 nmdc:mga08y16_13184_c1_5507_6475 305
241 3300050512 nmdc:mga0n895_2741_c1 nmdc:mga0n895_2741_c1_8426_9376 305
242 3300050514 nmdc:mga08x19_37114_c1 nmdc:mga08x19_37114_c1_1530_2480 305
243 3300050515 nmdc:mga0a205_284_c1 nmdc:mga0a205_284_c1_12505_13455 305
244 3300053077 Ga0495601_0030384 Ga0495601_0030384_2208_3155 305
245 3300006852 Ga0075433_10069944 Ga0075433_100699444 307
246 3300006914 Ga0075436_100015208 Ga0075436_1000152082 307
247 3300007076 Ga0075435_100075757 Ga0075435_1000757573 307
248 3300044706 Ga0466964_0078674 Ga0466964_0078674_441_1391 307
249 3300050514 nmdc:mga08x19_11499_c1 nmdc:mga08x19_11499_c1_1771_2715 307
250 iso_pu_bacteria 2881412998 2881414891 307
251 3300005436 Ga0070713_100013794 Ga0070713_1000137942 308
252 3300005544 Ga0070686_100112039 Ga0070686_1001120392 308
253 3300005549 Ga0070704_100065286 Ga0070704_1000652862 308
254 3300005617 Ga0068859_100018784 Ga0068859_1000187842 308
255 3300005937 Ga0081455_10014492 Ga0081455_100144928 308
256 3300006173 Ga0070716_100109793 Ga0070716_1001097932 308
257 3300006173 Ga0070716_100208567 Ga0070716_1002085672 308
258 3300006847 Ga0075431_100216103 Ga0075431_1002161032 308
259 3300006931 Ga0097620_100018783 Ga0097620_1000187832 308
260 3300009177 Ga0105248_10300618 Ga0105248_103006182 308
261 3300031731 Ga0307405_10078016 Ga0307405_100780162 308
262 3300031911 Ga0307412_10207387 Ga0307412_102073871 308
263 3300035691 Ga0373931_0058671 Ga0373931_0058671_563_1525 308
264 3300050492 nmdc:mga0yw44_21483_c1 nmdc:mga0yw44_21483_c1_708_1691 308
265 3300050510 nmdc:mga06r32_58494_c1 nmdc:mga06r32_58494_c1_1344_2306 308
266 iso_pu_bacteria 2894772417 2894773894 308
267 3300005458 Ga0070681_10000685 Ga0070681_1000068511 309
268 3300005617 Ga0068859_100163787 Ga0068859_1001637873 309
269 3300005618 Ga0068864_100029246 Ga0068864_1000292463 309
270 3300005840 Ga0068870_10089499 Ga0068870_100894993 309
271 3300005843 Ga0068860_100023020 Ga0068860_1000230203 309
272 3300006852 Ga0075433_10511373 Ga0075433_105113731 309
273 3300006871 Ga0075434_100037443 Ga0075434_1000374433 309
274 3300006931 Ga0097620_100163771 Ga0097620_1001637713 309
275 3300007076 Ga0075435_100001546 Ga0075435_1000015467 309
276 3300025949 Ga0207667_10284195 Ga0207667_102841952 309
277 3300026095 Ga0207676_10024356 Ga0207676_100243564 309
278 3300028381 Ga0268264_10082221 Ga0268264_100822212 309
279 3300028573 Ga0265334_10004160 Ga0265334_100041602 309
280 3300031251 Ga0265327_10032700 Ga0265327_100327001 309
281 3300032002 Ga0307416_100309314 Ga0307416_1003093142 309
282 3300046462 Ga0495651_0217757 Ga0495651_0217757_156_1115 309
283 3300049578 Ga0501042_0117158 Ga0501042_0117158_339_1295 309
284 3300049583 Ga0501067_0012561 Ga0501067_0012561_1449_2408 309
285 3300050512 nmdc:mga0n895_16155_c1 nmdc:mga0n895_16155_c1_3380_4333 309
286 3300005616 Ga0068852_100224587 Ga0068852_1002245872 310
287 3300005719 Ga0068861_100373273 Ga0068861_1003732731 310
288 3300005842 Ga0068858_100330901 Ga0068858_1003309012 310
289 3300006186 Ga0075369_10004234 Ga0075369_100042344 310
290 3300006844 Ga0075428_100004582 Ga0075428_1000045827 310
291 3300006852 Ga0075433_10001240 Ga0075433_100012405 310
292 3300006852 Ga0075433_10016219 Ga0075433_100162192 310
293 3300006871 Ga0075434_100000549 Ga0075434_10000054925 310
294 3300006880 Ga0075429_100000506 Ga0075429_10000050621 310
295 3300006914 Ga0075436_100000896 Ga0075436_1000008962 310
296 3300009147 Ga0114129_10000534 Ga0114129_1000053414 310
297 3300025936 Ga0207670_10019546 Ga0207670_100195463 310
298 3300026089 Ga0207648_10136026 Ga0207648_101360262 310
299 3300026118 Ga0207675_100314024 Ga0207675_1003140242 310
300 3300026142 Ga0207698_10165456 Ga0207698_101654562 310
301 3300027907 Ga0207428_10000758 Ga0207428_100007588 310
302 3300028380 Ga0268265_10090411 Ga0268265_100904112 310
303 3300031548 Ga0307408_100032375 Ga0307408_1000323753 310
304 3300032002 Ga0307416_100061953 Ga0307416_1000619532 310
305 3300034818 Ga0373950_0010391 Ga0373950_0010391_349_1314 310
306 3300035083 Ga0373926_0002597 Ga0373926_0002597_1141_2103 310
307 3300035084 Ga0373928_0008849 Ga0373928_0008849_800_1765 310
308 3300035090 Ga0373949_0003293 Ga0373949_0003293_2693_3658 310
309 3300035091 Ga0373951_0011292 Ga0373951_0011292_447_1412 310
310 3300035112 Ga0373932_0003182 Ga0373932_0003182_2028_2993 310
311 3300035113 Ga0373936_0004697 Ga0373936_0004697_3742_4704 310
312 3300035113 Ga0373936_0010042 Ga0373936_0010042_1865_2818 310
313 3300035114 Ga0373939_0014135 Ga0373939_0014135_818_1783 310
314 3300035171 Ga0373946_0027439 Ga0373946_0027439_381_1343 310
315 3300035207 Ga0373942_0006353 Ga0373942_0006353_328_1293 310
316 3300035241 Ga0373961_0007738 Ga0373961_0007738_1375_2340 310
317 3300035410 Ga0373924_0078273 Ga0373924_0078273_346_1308 310
318 3300035691 Ga0373931_0000248 Ga0373931_0000248_9713_10678 310
319 3300035691 Ga0373931_0051166 Ga0373931_0051166_151_1116 310
320 3300035692 Ga0373935_0178847 Ga0373935_0178847_431_1393 310
321 3300035695 Ga0373927_0017712 Ga0373927_0017712_885_1847 310
322 3300035725 Ga0373947_0009271 Ga0373947_0009271_2325_3287 310
323 3300037068 Ga0373925_0023218 Ga0373925_0023218_885_1847 310
324 3300044712 Ga0453684_0382226 Ga0453684_0382226_431_1402 310
325 3300045051 Ga0451576_0017934 Ga0451576_0017934_5210_6175 310
326 3300046455 Ga0495603_0002597 Ga0495603_0002597_6613_7575 310
327 3300046472 Ga0495580_0004635 Ga0495580_0004635_1399_2361 310
328 3300046473 Ga0495582_0008869 Ga0495582_0008869_1021_1983 310
329 3300046475 Ga0495639_0042446 Ga0495639_0042446_870_1832 310
330 3300046499 Ga0495594_0020833 Ga0495594_0020833_2005_2967 310
331 3300046681 Ga0495647_0000477 Ga0495647_0000477_1313_2275 310
332 3300046683 Ga0495658_0014860 Ga0495658_0014860_1954_2916 310
333 3300047321 Ga0495676_0007711 Ga0495676_0007711_5582_6544 310
334 3300049522 Ga0501299_011371 Ga0501299_011371_528_1484 310
335 3300050507 nmdc:mga05p37_453_c1 nmdc:mga05p37_453_c1_35915_36877 310
336 3300050508 nmdc:mga09592_2477_c1 nmdc:mga09592_2477_c1_5637_6599 310
337 3300050509 nmdc:mga0qj67_102839_c1 nmdc:mga0qj67_102839_c1_884_1843 310
338 3300050513 nmdc:mga0rr50_2318_c1 nmdc:mga0rr50_2318_c1_5251_6207 310
339 3300050515 nmdc:mga0a205_39962_c1 nmdc:mga0a205_39962_c1_2836_3792 310
340 3300050516 nmdc:mga0sz30_85365_c1 nmdc:mga0sz30_85365_c1_134_1144 310
341 3300053093 Ga0500651_0081671 Ga0500651_0081671_789_1745 310
342 iso_pu_bacteria 2857542790 2857546780 310
343 iso_pu_bacteria 2929199973 2929201930 310
344 iso_pu_bacteria 2939631187 2939635059 310
345 iso_pu_bacteria 8055909800 8055910918 310
346 3300005340 Ga0070689_100008032 Ga0070689_1000080322 311
347 3300005354 Ga0070675_100081169 Ga0070675_1000811693 311
348 3300005355 Ga0070671_100167541 Ga0070671_1001675412 311
349 3300005365 Ga0070688_100007930 Ga0070688_1000079302 311
350 3300005543 Ga0070672_100036428 Ga0070672_1000364282 311
351 3300005544 Ga0070686_100201730 Ga0070686_1002017302 311
352 3300005549 Ga0070704_100141823 Ga0070704_1001418231 311
353 3300005618 Ga0068864_100283198 Ga0068864_1002831982 311
354 3300006195 Ga0075366_10001589 Ga0075366_100015892 311
355 3300014325 Ga0163163_10027646 Ga0163163_100276462 311
356 3300025908 Ga0207643_10060781 Ga0207643_100607812 311
357 3300025922 Ga0207646_10063874 Ga0207646_100638742 311
358 3300025926 Ga0207659_10103002 Ga0207659_101030024 311
359 3300025938 Ga0207704_10224899 Ga0207704_102248991 311
360 3300025940 Ga0207691_10019431 Ga0207691_100194312 311
361 3300025960 Ga0207651_10021125 Ga0207651_100211252 311
362 3300025972 Ga0207668_10075903 Ga0207668_100759032 311
363 3300026089 Ga0207648_10063126 Ga0207648_100631262 311
364 3300026095 Ga0207676_10218588 Ga0207676_102185882 311
365 3300026118 Ga0207675_100065835 Ga0207675_1000658352 311
366 3300031903 Ga0307407_10156295 Ga0307407_101562951 311
367 3300031911 Ga0307412_10096622 Ga0307412_100966221 311
368 3300032002 Ga0307416_100081311 Ga0307416_1000813112 311
369 3300032005 Ga0307411_10062082 Ga0307411_100620822 311
370 3300032005 Ga0307411_10120657 Ga0307411_101206572 311
371 3300034817 Ga0373948_0003025 Ga0373948_0003025_1339_2319 311
372 3300035091 Ga0373951_0013523 Ga0373951_0013523_431_1411 311
373 3300035111 Ga0373923_0000495 Ga0373923_0000495_3091_4053 311
374 3300035117 Ga0373953_0001502 Ga0373953_0001502_5629_6591 311
375 3300035119 Ga0373956_0007806 Ga0373956_0007806_2523_3485 311
376 3300035172 Ga0373955_0183533 Ga0373955_0183533_86_1060 311
377 3300035207 Ga0373942_0001366 Ga0373942_0001366_1183_2142 311
378 3300035691 Ga0373931_0007632 Ga0373931_0007632_3985_4959 311
379 3300035692 Ga0373935_0038632 Ga0373935_0038632_445_1407 311
380 3300035695 Ga0373927_0042945 Ga0373927_0042945_1487_2449 311
381 3300035724 Ga0373933_0099356 Ga0373933_0099356_249_1217 311
382 3300044901 Ga0466960_0003041 Ga0466960_0003041_466_1431 311
383 3300045051 Ga0451576_0018069 Ga0451576_0018069_519_1499 311
384 3300045051 Ga0451576_0119336 Ga0451576_0119336_672_1652 311
385 3300045976 Ga0466967_0007807 Ga0466967_0007807_3560_4519 311
386 3300046454 Ga0495592_0054761 Ga0495592_0054761_478_1440 311
387 3300046454 Ga0495592_0067041 Ga0495592_0067041_226_1188 311
388 3300046459 Ga0495629_0024258 Ga0495629_0024258_1351_2313 311
389 3300046461 Ga0495641_0025893 Ga0495641_0025893_1576_2538 311
390 3300046463 Ga0495653_0048552 Ga0495653_0048552_970_1932 311
391 3300046476 Ga0495662_0025763 Ga0495662_0025763_47_1009 311
392 3300046477 Ga0495664_0222677 Ga0495664_0222677_49_1011 311
393 3300046514 Ga0495618_0042574 Ga0495618_0042574_134_1096 311
394 3300046516 Ga0495628_0043898 Ga0495628_0043898_1083_2045 311
395 3300046516 Ga0495628_0128494 Ga0495628_0128494_218_1192 311
396 3300046517 Ga0495630_0001309 Ga0495630_0001309_15325_16287 311
397 3300046529 Ga0495652_0007326 Ga0495652_0007326_4612_5574 311
398 3300046529 Ga0495652_0242698 Ga0495652_0242698_150_1112 311
399 3300046533 Ga0495640_0038231 Ga0495640_0038231_1109_2071 311
400 3300046535 Ga0495586_0012666 Ga0495586_0012666_1936_2898 311
401 3300046539 Ga0495621_0008649 Ga0495621_0008649_1081_2064 311
402 3300046543 Ga0495645_0001560 Ga0495645_0001560_3984_4946 311
403 3300046642 Ga0495634_0019822 Ga0495634_0019822_3566_4528 311
404 3300046663 Ga0495635_0336099 Ga0495635_0336099_28_990 311
405 3300046675 Ga0495657_0011703 Ga0495657_0011703_2560_3522 311
406 3300046678 Ga0495599_0003895 Ga0495599_0003895_3557_4519 311
407 3300046678 Ga0495599_0174424 Ga0495599_0174424_193_1155 311
408 3300046680 Ga0495646_0116993 Ga0495646_0116993_532_1494 311
409 3300046681 Ga0495647_0069174 Ga0495647_0069174_277_1239 311
410 3300046689 Ga0495613_0132118 Ga0495613_0132118_368_1330 311
411 3300046809 Ga0495600_0014825 Ga0495600_0014825_1999_2961 311
412 3300047319 Ga0495674_0026636 Ga0495674_0026636_4052_5014 311
413 3300047322 Ga0495680_0203478 Ga0495680_0203478_83_1045 311
414 3300047444 Ga0495675_0024425 Ga0495675_0024425_2547_3509 311
415 3300047471 Ga0495684_0028395 Ga0495684_0028395_2689_3651 311
416 3300048088 Ga0495602_0217112 Ga0495602_0217112_401_1375 311
417 3300048903 Ga0496100_0088053 Ga0496100_0088053_600_1535 311
418 3300048904 Ga0496101_0004652 Ga0496101_0004652_4160_5095 311
419 3300048905 Ga0496102_0019179 Ga0496102_0019179_4284_5219 311
420 3300048906 Ga0496103_0015056 Ga0496103_0015056_3643_4578 311
421 3300048908 Ga0496105_0026794 Ga0496105_0026794_3556_4491 311
422 3300048909 Ga0496106_0003706 Ga0496106_0003706_3965_4900 311
423 3300048910 Ga0496107_0035525 Ga0496107_0035525_103_1038 311
424 3300048911 Ga0496108_0049181 Ga0496108_0049181_996_1931 311
425 3300048912 Ga0496109_0014145 Ga0496109_0014145_529_1464 311
426 3300048913 Ga0496110_0406882 Ga0496110_0406882_21_956 311
427 3300048914 Ga0496111_0014603 Ga0496111_0014603_715_1650 311
428 3300048915 Ga0496112_0015894 Ga0496112_0015894_3408_4343 311
429 3300048917 Ga0496114_0020754 Ga0496114_0020754_527_1462 311
430 3300048918 Ga0496115_0003546 Ga0496115_0003546_3428_4363 311
431 3300050493 nmdc:mga0k408_15449_c1 nmdc:mga0k408_15449_c1_964_1923 311
432 3300050511 nmdc:mga08y16_532970_c1 nmdc:mga08y16_532970_c1_96_1031 311
433 3300053077 Ga0495601_0011988 Ga0495601_0011988_3451_4425 311
434 3300053077 Ga0495601_0037851 Ga0495601_0037851_377_1339 311
435 3300053077 Ga0495601_0097252 Ga0495601_0097252_556_1518 311
436 3300053078 Ga0495612_0102124 Ga0495612_0102124_194_1168 311
437 3300053084 Ga0495595_0005771 Ga0495595_0005771_1956_2918 311
438 3300053085 Ga0495619_0015254 Ga0495619_0015254_3041_4015 311
439 3300053090 Ga0500646_0002103 Ga0500646_0002103_2860_3819 311
440 3300053139 Ga0500568_0074291 Ga0500568_0074291_285_1244 311
441 iso_pu_bacteria 2818991446 2819600868 311
442 iso_pu_bacteria 2855730933 2855732517 311
443 iso_pu_bacteria 2855767633 2855769225 311
444 iso_pu_bacteria 2883577096 2883577154 311
445 3300005539 Ga0068853_100049105 Ga0068853_1000491052 312
446 3300006173 Ga0070716_100084483 Ga0070716_1000844832 312
447 3300009093 Ga0105240_10007572 Ga0105240_100075723 312
448 3300009553 Ga0105249_10057924 Ga0105249_100579243 312
449 3300021384 Ga0213876_10004235 Ga0213876_100042359 312
450 3300025893 Ga0207682_10079540 Ga0207682_100795401 312
451 3300025913 Ga0207695_10016654 Ga0207695_100166544 312
452 3300037418 Ga0395900_0156171 Ga0395900_0156171_383_1357 312
453 3300037466 Ga0395898_0069032 Ga0395898_0069032_1002_1976 312
454 3300039437 Ga0436365_1284888 Ga0436365_1284888_1975_2946 312
455 3300042134 Ga0450898_003691 Ga0450898_003691_341_1339 312
456 3300042156 Ga0439446_0031484 Ga0439446_0031484_317_1315 312
457 3300042876 Ga0451577_0178788 Ga0451577_0178788_239_1225 312
458 3300045051 Ga0451576_0114121 Ga0451576_0114121_584_1570 312
459 3300045976 Ga0466967_0010524 Ga0466967_0010524_738_1715 312
460 3300046522 Ga0495643_0008336 Ga0495643_0008336_4988_5962 312
461 3300046528 Ga0495642_0004946 Ga0495642_0004946_3023_3997 312
462 3300046542 Ga0495597_0028452 Ga0495597_0028452_837_1811 312
463 3300046616 Ga0495668_0096430 Ga0495668_0096430_242_1216 312
464 3300046665 Ga0495661_0007293 Ga0495661_0007293_5980_6954 312
465 3300047443 Ga0495687_029483 Ga0495687_029483_867_1841 312
466 3300050511 nmdc:mga08y16_11404_c1 nmdc:mga08y16_11404_c1_3561_4538 312
467 3300050514 nmdc:mga08x19_3775_c1 nmdc:mga08x19_3775_c1_6054_7019 312
468 3300053094 Ga0500566_0181016 Ga0500566_0181016_32_1018 312
469 iso_pu_bacteria 2599185292 2599906170 312
470 iso_pu_bacteria 2643221569 2643861952 312
471 iso_pu_bacteria 2643221594 2643981004 312
472 iso_pu_bacteria 2808606395 2809031670 312
473 iso_pu_bacteria 2858950400 2858956490 312
474 iso_pu_bacteria 2941479691 2941482330 312
475 3300003203 JGI25406J46586_10000542 JGI25406J46586_100005428 313
476 3300005444 Ga0070694_100084540 Ga0070694_1000845402 313
477 3300005445 Ga0070708_100281237 Ga0070708_1002812371 313
478 3300005458 Ga0070681_10047234 Ga0070681_100472343 313
479 3300005467 Ga0070706_100292218 Ga0070706_1002922182 313
480 3300005545 Ga0070695_100055626 Ga0070695_1000556262 313
481 3300005985 Ga0081539_10000847 Ga0081539_1000084732 313
482 3300006048 Ga0075363_100005216 Ga0075363_1000052168 313
483 3300006177 Ga0075362_10090042 Ga0075362_100900421 313
484 3300006195 Ga0075366_10025588 Ga0075366_100255883 313
485 3300006844 Ga0075428_100023614 Ga0075428_1000236144 313
486 3300006880 Ga0075429_100166865 Ga0075429_1001668652 313
487 3300009094 Ga0111539_10020771 Ga0111539_100207714 313
488 3300009094 Ga0111539_10048183 Ga0111539_100481832 313
489 3300014968 Ga0157379_10239821 Ga0157379_102398211 313
490 3300025910 Ga0207684_10252761 Ga0207684_102527612 313
491 3300025912 Ga0207707_10096778 Ga0207707_100967782 313
492 3300027360 Ga0209969_1010345 Ga0209969_10103451 313
493 3300027682 Ga0209971_1021659 Ga0209971_10216592 313
494 3300027866 Ga0209813_10019746 Ga0209813_100197462 313
495 3300027876 Ga0209974_10021683 Ga0209974_100216832 313
496 3300030521 Ga0307511_10004074 Ga0307511_100040744 313
497 3300033179 Ga0307507_10033219 Ga0307507_100332195 313
498 3300035242 Ga0373962_0059180 Ga0373962_0059180_42_1016 313
499 3300037471 Ga0395905_0139539 Ga0395905_0139539_990_1952 313
500 3300046615 Ga0495656_0001315 Ga0495656_0001315_1136_2122 313
501 3300048928 Ga0496125_0002692 Ga0496125_0002692_4422_5408 313
502 3300050489 nmdc:mga03683_28381_c1 nmdc:mga03683_28381_c1_563_1555 313
503 3300050494 nmdc:mga06z11_35616_c1 nmdc:mga06z11_35616_c1_195_1187 313
504 3300050511 nmdc:mga08y16_30147_c1 nmdc:mga08y16_30147_c1_2943_3935 313
505 3300050511 nmdc:mga08y16_51079_c1 nmdc:mga08y16_51079_c1_1654_2613 313
506 3300050516 nmdc:mga0sz30_62920_c1 nmdc:mga0sz30_62920_c1_194_1186 313
507 3300002773 JGI25152J39213_1000010 JGI25152J39213_100001016 314
508 3300002774 JGI25150J39212_1000490 JGI25150J39212_10004907 314
509 3300002987 JGI25159J45721_1000381 JGI25159J45721_100038116 314
510 3300003187 JGI25151J46595_10002847 JGI25151J46595_100028475 314
511 3300003215 JGI25153J46596_10002775 JGI25153J46596_100027755 314
512 3300003354 JGI25160J50197_1000583 JGI25160J50197_100058316 314
513 3300003374 JGI25161J50226_1000654 JGI25161J50226_10006542 314
514 3300003374 JGI25161J50226_1000922 JGI25161J50226_10009226 314
515 3300003761 Ga0055535_1000241 Ga0055535_100024115 314
516 3300003762 Ga0055542_1000126 Ga0055542_100012654 314
517 3300003771 Ga0055526_1001018 Ga0055526_100101816 314
518 3300003773 Ga0055537_1001439 Ga0055537_10014394 314
519 3300003775 Ga0055524_1000823 Ga0055524_100082316 314
520 3300003784 Ga0055534_1000531 Ga0055534_100053116 314
521 3300003790 Ga0055528_1000865 Ga0055528_10008655 314
522 3300003792 Ga0055540_1015526 Ga0055540_10155262 314
523 3300003792 Ga0055540_1015703 Ga0055540_10157032 314
524 3300003794 Ga0055531_10004697 Ga0055531_100046976 314
525 3300004625 Ga0055543_1000539 Ga0055543_100053916 314
526 3300005262 Ga0065165_1001314 Ga0065165_100131421 314
527 3300005435 Ga0070714_100155983 Ga0070714_1001559832 314
528 3300006177 Ga0075362_10024056 Ga0075362_100240563 314
529 3300006178 Ga0075367_10108334 Ga0075367_101083341 314
530 3300006847 Ga0075431_100004337 Ga0075431_1000043374 314
531 3300006948 Ga0099826_10000019 Ga0099826_1000001985 314
532 3300013308 Ga0157375_10471632 Ga0157375_104716321 314
533 3300025208 Ga0209436_101676 Ga0209436_1016763 314
534 3300025228 Ga0209672_100550 Ga0209672_10055010 314
535 3300025229 Ga0209147_100805 Ga0209147_1008059 314
536 3300025242 Ga0209258_100018 Ga0209258_10001897 314
537 3300025245 Ga0207425_1000057 Ga0207425_100005720 314
538 3300025254 Ga0209148_1000030 Ga0209148_100003097 314
539 3300025258 Ga0209129_1000030 Ga0209129_1000030319 314
540 3300025263 Ga0209565_1000019 Ga0209565_1000019391 314
541 3300025263 Ga0209565_1018952 Ga0209565_10189521 314
542 3300025273 Ga0209673_1000155 Ga0209673_1000155117 314
543 3300025273 Ga0209673_1009186 Ga0209673_10091862 314
544 3300025284 Ga0209130_1000011 Ga0209130_1000011383 314
545 3300025291 Ga0209675_1000031 Ga0209675_1000031241 314
546 3300025291 Ga0209675_1002115 Ga0209675_10021158 314
547 3300025292 Ga0209676_1004622 Ga0209676_10046222 314
548 3300025292 Ga0209676_1006264 Ga0209676_10062645 314
549 3300025294 Ga0209025_1000078 Ga0209025_1000078239 314
550 3300025294 Ga0209025_1028513 Ga0209025_10285132 314
551 3300025295 Ga0209564_1000056 Ga0209564_1000056306 314
552 3300025297 Ga0209758_1000037 Ga0209758_100003720 314
553 3300025298 Ga0209050_1001259 Ga0209050_100125910 314
554 3300025299 Ga0209256_1000043 Ga0209256_1000043306 314
555 3300025299 Ga0209256_1000661 Ga0209256_10006615 314
556 3300025302 Ga0207426_1000029 Ga0207426_100002920 314
557 3300025303 Ga0209051_1000804 Ga0209051_10008044 314
558 3300025303 Ga0209051_1006197 Ga0209051_10061973 314
559 3300025304 Ga0209257_1001647 Ga0209257_100164721 314
560 3300025945 Ga0207679_10108065 Ga0207679_101080652 314
561 3300027666 Ga0209282_1000148 Ga0209282_100014831 314
562 3300030521 Ga0307511_10000003 Ga0307511_1000000310 314
563 3300031235 Ga0265330_10036161 Ga0265330_100361612 314
564 3300031241 Ga0265325_10001565 Ga0265325_100015655 314
565 3300031247 Ga0265340_10018193 Ga0265340_100181933 314
566 3300031249 Ga0265339_10039003 Ga0265339_100390032 314
567 3300031251 Ga0265327_10079765 Ga0265327_100797651 314
568 3300031712 Ga0265342_10038213 Ga0265342_100382133 314
569 3300046474 Ga0495605_0005057 Ga0495605_0005057_851_1903 314
570 3300046499 Ga0495594_0036814 Ga0495594_0036814_195_1175 314
571 3300046500 Ga0495596_0001648 Ga0495596_0001648_5841_6893 314
572 3300046501 Ga0495607_0027444 Ga0495607_0027444_558_1610 314
573 3300046512 Ga0495610_0002348 Ga0495610_0002348_3731_4783 314
574 3300046513 Ga0495616_0001459 Ga0495616_0001459_14398_15369 314
575 3300046513 Ga0495616_0006405 Ga0495616_0006405_274_1326 314
576 3300046518 Ga0495631_0074624 Ga0495631_0074624_170_1222 314
577 3300046522 Ga0495643_0000328 Ga0495643_0000328_28087_29058 314
578 3300046526 Ga0495666_0019454 Ga0495666_0019454_1523_2503 314
579 3300046538 Ga0495609_0003430 Ga0495609_0003430_785_1837 314
580 3300046665 Ga0495661_0188946 Ga0495661_0188946_50_1021 314
581 3300046692 Ga0495671_0019692 Ga0495671_0019692_517_1569 314
582 3300046694 Ga0495649_0012031 Ga0495649_0012031_406_1458 314
583 3300047320 Ga0495672_0013747 Ga0495672_0013747_4410_5462 314
584 3300048088 Ga0495602_0103211 Ga0495602_0103211_125_1093 314
585 3300048091 Ga0495626_0000652 Ga0495626_0000652_1332_2303 314
586 3300048091 Ga0495626_0014553 Ga0495626_0014553_524_1495 314
587 3300048924 Ga0496121_0026802 Ga0496121_0026802_3649_4701 314
588 3300048925 Ga0496122_0076019 Ga0496122_0076019_551_1603 314
589 3300048926 Ga0496123_0002704 Ga0496123_0002704_19678_20730 314
590 3300048927 Ga0496124_0000346 Ga0496124_0000346_38219_39202 314
591 3300048927 Ga0496124_0168399 Ga0496124_0168399_51_1055 314
592 3300048928 Ga0496125_0045932 Ga0496125_0045932_2121_3173 314
593 3300049592 Ga0501076_0073575 Ga0501076_0073575_16_978 314
594 3300049742 Ga0501080_0066635 Ga0501080_0066635_1933_2898 314
595 3300050489 nmdc:mga03683_31875_c1 nmdc:mga03683_31875_c1_273_1262 314
596 3300053153 Ga0500616_0002390 Ga0500616_0002390_2754_3755 314
597 3300053733 Ga0500552_000160 Ga0500552_000160_1139_2128 314
598 iso_pu_bacteria 2643221569 2643859001 314
599 iso_pu_bacteria 2643221594 2643981822 314
600 iso_pu_bacteria 2775506901 2776265189 314
601 iso_pu_bacteria 2808606395 2809033882 314
602 3300003187 JGI25151J46595_10000262 JGI25151J46595_1000026235 315
603 3300003187 JGI25151J46595_10001355 JGI25151J46595_100013553 315
604 3300003771 Ga0055526_1001146 Ga0055526_10011463 315
605 3300003771 Ga0055526_1005040 Ga0055526_10050406 315
606 3300003771 Ga0055526_1012011 Ga0055526_10120112 315
607 3300003771 Ga0055526_1019127 Ga0055526_10191272 315
608 3300003773 Ga0055537_1000873 Ga0055537_100087310 315
609 3300003775 Ga0055524_1000248 Ga0055524_100024814 315
610 3300003784 Ga0055534_1000341 Ga0055534_10003418 315
611 3300003784 Ga0055534_1000661 Ga0055534_100066116 315
612 3300005331 Ga0070670_100042837 Ga0070670_1000428373 315
613 3300005337 Ga0070682_100046709 Ga0070682_1000467091 315
614 3300005338 Ga0068868_100291653 Ga0068868_1002916531 315
615 3300005340 Ga0070689_100114513 Ga0070689_1001145131 315
616 3300005436 Ga0070713_100067932 Ga0070713_1000679322 315
617 3300005539 Ga0068853_100038292 Ga0068853_1000382924 315
618 3300005564 Ga0070664_100347762 Ga0070664_1003477622 315
619 3300005615 Ga0070702_100094968 Ga0070702_1000949682 315
620 3300005841 Ga0068863_100177149 Ga0068863_1001771492 315
621 3300005843 Ga0068860_100017045 Ga0068860_1000170452 315
622 3300005937 Ga0081455_10028957 Ga0081455_100289576 315
623 3300005937 Ga0081455_10041286 Ga0081455_100412862 315
624 3300006038 Ga0075365_10045375 Ga0075365_100453752 315
625 3300006051 Ga0075364_10011199 Ga0075364_100111994 315
626 3300006051 Ga0075364_10032938 Ga0075364_100329381 315
627 3300006051 Ga0075364_10115861 Ga0075364_101158612 315
628 3300006844 Ga0075428_100028423 Ga0075428_1000284235 315
629 3300006847 Ga0075431_100236014 Ga0075431_1002360142 315
630 3300006871 Ga0075434_100034296 Ga0075434_1000342966 315
631 3300006914 Ga0075436_100036090 Ga0075436_1000360902 315
632 3300009148 Ga0105243_10201300 Ga0105243_102013002 315
633 3300009177 Ga0105248_10251964 Ga0105248_102519642 315
634 3300013297 Ga0157378_10285305 Ga0157378_102853051 315
635 3300014325 Ga0163163_10251300 Ga0163163_102513002 315
636 3300014497 Ga0182008_10042415 Ga0182008_100424152 315
637 3300025263 Ga0209565_1000255 Ga0209565_100025515 315
638 3300025291 Ga0209675_1000457 Ga0209675_100045722 315
639 3300025291 Ga0209675_1000510 Ga0209675_100051019 315
640 3300025294 Ga0209025_1000057 Ga0209025_1000057240 315
641 3300025294 Ga0209025_1002582 Ga0209025_100258211 315
642 3300025295 Ga0209564_1000546 Ga0209564_100054638 315
643 3300025295 Ga0209564_1000600 Ga0209564_100060015 315
644 3300025295 Ga0209564_1002095 Ga0209564_100209510 315
645 3300025297 Ga0209758_1019878 Ga0209758_10198783 315
646 3300025299 Ga0209256_1000518 Ga0209256_100051837 315
647 3300025904 Ga0207647_10014714 Ga0207647_100147142 315
648 3300025925 Ga0207650_10041764 Ga0207650_100417642 315
649 3300025925 Ga0207650_10085284 Ga0207650_100852841 315
650 3300025935 Ga0207709_10170271 Ga0207709_101702712 315
651 3300025936 Ga0207670_10109838 Ga0207670_101098382 315
652 3300025940 Ga0207691_10050211 Ga0207691_100502112 315
653 3300025941 Ga0207711_10069681 Ga0207711_100696812 315
654 3300025942 Ga0207689_10093130 Ga0207689_100931302 315
655 3300025945 Ga0207679_10317385 Ga0207679_103173852 315
656 3300027512 Ga0209179_1005804 Ga0209179_10058042 315
657 3300028794 Ga0307515_10036166 Ga0307515_100361665 315
658 3300031456 Ga0307513_10017907 Ga0307513_100179075 315
659 3300035111 Ga0373923_0072545 Ga0373923_0072545_369_1337 315
660 3300035171 Ga0373946_0006665 Ga0373946_0006665_153_1121 315
661 3300035242 Ga0373962_0012009 Ga0373962_0012009_1196_2164 315
662 3300035692 Ga0373935_0117403 Ga0373935_0117403_699_1667 315
663 3300035695 Ga0373927_0018530 Ga0373927_0018530_2549_3517 315
664 3300037068 Ga0373925_0034905 Ga0373925_0034905_2488_3456 315
665 3300037418 Ga0395900_0250587 Ga0395900_0250587_399_1364 315
666 3300037471 Ga0395905_0184678 Ga0395905_0184678_370_1335 315
667 3300042436 Ga0439435_0029294 Ga0439435_0029294_194_1192 315
668 3300046461 Ga0495641_0065905 Ga0495641_0065905_19_987 315
669 3300046475 Ga0495639_0047771 Ga0495639_0047771_336_1304 315
670 3300046525 Ga0495663_0017577 Ga0495663_0017577_13_981 315
671 3300046526 Ga0495666_0045628 Ga0495666_0045628_456_1424 315
672 3300046539 Ga0495621_0060168 Ga0495621_0060168_28_996 315
673 3300046689 Ga0495613_0219694 Ga0495613_0219694_209_1177 315
674 3300047315 Ga0495581_0111908 Ga0495581_0111908_422_1390 315
675 3300047318 Ga0495636_0108300 Ga0495636_0108300_66_1034 315
676 3300047321 Ga0495676_0021776 Ga0495676_0021776_1440_2408 315
677 3300047446 Ga0495679_042683 Ga0495679_042683_200_1168 315
678 3300047470 Ga0495681_0114367 Ga0495681_0114367_174_1142 315
679 3300047471 Ga0495684_0329526 Ga0495684_0329526_46_1014 315
680 3300048912 Ga0496109_0184285 Ga0496109_0184285_287_1255 315
681 3300048915 Ga0496112_0073985 Ga0496112_0073985_1017_1985 315
682 3300048918 Ga0496115_0081022 Ga0496115_0081022_721_1689 315
683 3300050489 nmdc:mga03683_7685_c1 nmdc:mga03683_7685_c1_541_1509 315
684 3300050491 nmdc:mga00v17_43570_c1 nmdc:mga00v17_43570_c1_1536_2504 315
685 3300050492 nmdc:mga0yw44_11367_c1 nmdc:mga0yw44_11367_c1_1520_2488 315
686 3300050511 nmdc:mga08y16_168649_c1 nmdc:mga08y16_168649_c1_1244_2212 315
687 3300050513 nmdc:mga0rr50_147293_c1 nmdc:mga0rr50_147293_c1_844_1812 315
688 iso_pu_bacteria 2513237165 2514042729 315
689 iso_pu_bacteria 2599185292 2599905993 315
690 3300003781 Ga0055536_1034912 Ga0055536_10349121 316
691 3300005367 Ga0070667_100041279 Ga0070667_1000412794 316
692 3300005367 Ga0070667_100210054 Ga0070667_1002100542 316
693 3300005436 Ga0070713_100000019 Ga0070713_10000001919 316
694 3300005468 Ga0070707_100179645 Ga0070707_1001796451 316
695 3300005842 Ga0068858_100002315 Ga0068858_10000231510 316
696 3300006028 Ga0070717_10093279 Ga0070717_100932792 316
697 3300006871 Ga0075434_100000017 Ga0075434_10000001757 316
698 3300006871 Ga0075434_100390409 Ga0075434_1003904091 316
699 3300006914 Ga0075436_100009262 Ga0075436_1000092623 316
700 3300007076 Ga0075435_100119638 Ga0075435_1001196383 316
701 3300007788 Ga0099795_10042805 Ga0099795_100428052 316
702 3300013102 Ga0157371_10109606 Ga0157371_101096062 316
703 3300013307 Ga0157372_10262757 Ga0157372_102627572 316
704 3300014968 Ga0157379_10006399 Ga0157379_100063994 316
705 3300021384 Ga0213876_10003512 Ga0213876_100035127 316
706 3300025292 Ga0209676_1009204 Ga0209676_10092044 316
707 3300025298 Ga0209050_1007505 Ga0209050_10075053 316
708 3300025915 Ga0207693_10015493 Ga0207693_100154935 316
709 3300025922 Ga0207646_10055525 Ga0207646_100555252 316
710 3300025928 Ga0207700_10000035 Ga0207700_1000003548 316
711 3300025939 Ga0207665_10155183 Ga0207665_101551832 316
712 3300027312 Ga0209371_1006207 Ga0209371_10062074 316
713 3300028577 Ga0265318_10010718 Ga0265318_100107184 316
714 3300030500 Ga0268256_1006209 Ga0268256_10062092 316
715 3300031238 Ga0265332_10000918 Ga0265332_100009181 316
716 3300031239 Ga0265328_10005428 Ga0265328_100054284 316
717 3300031250 Ga0265331_10013032 Ga0265331_100130322 316
718 3300031711 Ga0265314_10039949 Ga0265314_100399493 316
719 3300031711 Ga0265314_10158732 Ga0265314_101587322 316
720 3300031712 Ga0265342_10013002 Ga0265342_100130025 316
721 3300031911 Ga0307412_10000837 Ga0307412_1000083711 316
722 3300033179 Ga0307507_10170294 Ga0307507_101702941 316
723 3300035113 Ga0373936_0002892 Ga0373936_0002892_1079_2074 316
724 3300035117 Ga0373953_0002531 Ga0373953_0002531_1192_2187 316
725 3300035118 Ga0373954_0002119 Ga0373954_0002119_6339_7334 316
726 3300035170 Ga0373943_0008697 Ga0373943_0008697_649_1644 316
727 3300035171 Ga0373946_0024813 Ga0373946_0024813_185_1180 316
728 3300035172 Ga0373955_0000114 Ga0373955_0000114_7963_8958 316
729 3300035692 Ga0373935_0000367 Ga0373935_0000367_1103_2098 316
730 3300035695 Ga0373927_0004943 Ga0373927_0004943_6879_7868 316
731 3300035695 Ga0373927_0016071 Ga0373927_0016071_1034_2029 316
732 3300035724 Ga0373933_0010246 Ga0373933_0010246_1141_2136 316
733 3300035725 Ga0373947_0027599 Ga0373947_0027599_119_1114 316
734 3300035725 Ga0373947_0193206 Ga0373947_0193206_12_1103 316
735 3300036401 Ga0373937_0000079 Ga0373937_0000079_32888_33883 316
736 3300037068 Ga0373925_0000007 Ga0373925_0000007_254913_255908 316
737 3300039437 Ga0436365_1136772 Ga0436365_1136772_14347_15327 316
738 3300046454 Ga0495592_0000254 Ga0495592_0000254_1192_2187 316
739 3300046459 Ga0495629_0004780 Ga0495629_0004780_7915_8910 316
740 3300046462 Ga0495651_0000796 Ga0495651_0000796_1121_2116 316
741 3300046463 Ga0495653_0000034 Ga0495653_0000034_1156_2151 316
742 3300046472 Ga0495580_0080896 Ga0495580_0080896_950_1978 316
743 3300046477 Ga0495664_0000003 Ga0495664_0000003_303653_304648 316
744 3300046511 Ga0495608_0000319 Ga0495608_0000319_1193_2188 316
745 3300046514 Ga0495618_0000018 Ga0495618_0000018_114887_115882 316
746 3300046516 Ga0495628_0000001 Ga0495628_0000001_793054_794049 316
747 3300046517 Ga0495630_0003154 Ga0495630_0003154_9291_10286 316
748 3300046529 Ga0495652_0000006 Ga0495652_0000006_61126_62121 316
749 3300046533 Ga0495640_0000002 Ga0495640_0000002_247867_248862 316
750 3300046536 Ga0495587_0000001 Ga0495587_0000001_320323_321318 316
751 3300046543 Ga0495645_0000009 Ga0495645_0000009_161366_162361 316
752 3300046559 Ga0495667_0000004 Ga0495667_0000004_219970_220965 316
753 3300046642 Ga0495634_0000014 Ga0495634_0000014_115846_116841 316
754 3300046663 Ga0495635_0000001 Ga0495635_0000001_306134_307129 316
755 3300046675 Ga0495657_0000336 Ga0495657_0000336_1820_2815 316
756 3300046678 Ga0495599_0000053 Ga0495599_0000053_1159_2154 316
757 3300046679 Ga0495623_0000091 Ga0495623_0000091_43643_44638 316
758 3300046680 Ga0495646_0000020 Ga0495646_0000020_1164_2159 316
759 3300046689 Ga0495613_0009581 Ga0495613_0009581_1219_2214 316
760 3300046690 Ga0495624_0081084 Ga0495624_0081084_918_1913 316
761 3300046809 Ga0495600_0000123 Ga0495600_0000123_10694_11689 316
762 3300047317 Ga0495604_0000008 Ga0495604_0000008_198716_199711 316
763 3300047319 Ga0495674_0000016 Ga0495674_0000016_141564_142559 316
764 3300047322 Ga0495680_0024757 Ga0495680_0024757_1173_2168 316
765 3300047444 Ga0495675_0014865 Ga0495675_0014865_1120_2115 316
766 3300047471 Ga0495684_0000002 Ga0495684_0000002_198774_199769 316
767 3300047673 Ga0495593_0001468 Ga0495593_0001468_835_1830 316
768 3300048088 Ga0495602_0000022 Ga0495602_0000022_161379_162374 316
769 3300048919 Ga0496116_0001838 Ga0496116_0001838_7845_8834 316
770 3300048920 Ga0496117_0019813 Ga0496117_0019813_2656_3645 316
771 3300048920 Ga0496117_0213509 Ga0496117_0213509_14_1003 316
772 3300048921 Ga0496118_0010842 Ga0496118_0010842_1201_2190 316
773 3300048921 Ga0496118_0016901 Ga0496118_0016901_3589_4578 316
774 3300048922 Ga0496119_0012107 Ga0496119_0012107_2675_3664 316
775 3300048923 Ga0496120_0106325 Ga0496120_0106325_446_1435 316
776 3300048924 Ga0496121_0000127 Ga0496121_0000127_101452_102441 316
777 3300048925 Ga0496122_0000601 Ga0496122_0000601_29232_30221 316
778 3300048925 Ga0496122_0082403 Ga0496122_0082403_251_1240 316
779 3300048926 Ga0496123_0001435 Ga0496123_0001435_11416_12405 316
780 3300048926 Ga0496123_0035472 Ga0496123_0035472_2100_3089 316
781 3300048927 Ga0496124_0090623 Ga0496124_0090623_129_1118 316
782 3300048927 Ga0496124_0107594 Ga0496124_0107594_765_1754 316
783 3300048928 Ga0496125_0000011 Ga0496125_0000011_534024_535013 316
784 3300048928 Ga0496125_0022861 Ga0496125_0022861_3847_4836 316
785 3300048929 Ga0496126_0010507 Ga0496126_0010507_689_1678 316
786 3300050512 nmdc:mga0n895_151_c1 nmdc:mga0n895_151_c1_1636_2628 316
787 3300050512 nmdc:mga0n895_276122_c1 nmdc:mga0n895_276122_c1_384_1376 316
788 3300050513 nmdc:mga0rr50_1131_c1 nmdc:mga0rr50_1131_c1_1775_2767 316
789 3300050513 nmdc:mga0rr50_262381_c1 nmdc:mga0rr50_262381_c1_77_1069 316
790 3300050514 nmdc:mga08x19_7499_c1 nmdc:mga08x19_7499_c1_4265_5257 316
791 3300053077 Ga0495601_0000001 Ga0495601_0000001_238274_239269 316
792 3300053078 Ga0495612_0000003 Ga0495612_0000003_103836_104831 316
793 3300053084 Ga0495595_0000082 Ga0495595_0000082_1203_2198 316
794 3300053085 Ga0495619_0000004 Ga0495619_0000004_238305_239300 316
795 3300053134 Ga0500658_0025225 Ga0500658_0025225_38_1018 316
796 iso_pu_bacteria 2894023352 2894023573 316
797 3300009147 Ga0114129_10024407 Ga0114129_1002440711 317
798 3300014325 Ga0163163_10030887 Ga0163163_100308871 317
799 3300025916 Ga0207663_10044643 Ga0207663_100446432 317
800 3300030521 Ga0307511_10000291 Ga0307511_1000029133 317
801 3300036401 Ga0373937_0106150 Ga0373937_0106150_688_1659 317
802 3300046459 Ga0495629_0194134 Ga0495629_0194134_191_1165 317
803 3300046511 Ga0495608_0030250 Ga0495608_0030250_272_1243 317
804 3300047319 Ga0495674_0092029 Ga0495674_0092029_1110_2081 317
805 3300048088 Ga0495602_0098310 Ga0495602_0098310_1057_2028 317
806 3300048903 Ga0496100_0237526 Ga0496100_0237526_345_1319 317
807 3300048905 Ga0496102_0006819 Ga0496102_0006819_7966_8940 317
808 3300048906 Ga0496103_0020735 Ga0496103_0020735_109_1083 317
809 3300048907 Ga0496104_0001498 Ga0496104_0001498_11108_12082 317
810 3300048908 Ga0496105_0000355 Ga0496105_0000355_14161_15135 317
811 3300048910 Ga0496107_0017060 Ga0496107_0017060_1520_2494 317
812 3300048913 Ga0496110_0151410 Ga0496110_0151410_903_1877 317
813 3300048914 Ga0496111_0004396 Ga0496111_0004396_4904_5878 317
814 3300048915 Ga0496112_0011575 Ga0496112_0011575_6867_7841 317
815 3300048916 Ga0496113_0000322 Ga0496113_0000322_7043_8017 317
816 3300048917 Ga0496114_0157570 Ga0496114_0157570_177_1151 317
817 3300050510 nmdc:mga06r32_268879_c1 nmdc:mga06r32_268879_c1_590_1564 317
818 3300050512 nmdc:mga0n895_287519_c1 nmdc:mga0n895_287519_c1_261_1235 317
819 3300053090 Ga0500646_0007754 Ga0500646_0007754_517_1527 317
820 3300053151 Ga0500604_0002634 Ga0500604_0002634_3727_4737 317
821 3300005330 Ga0070690_100019584 Ga0070690_1000195843 318
822 3300005333 Ga0070677_10047287 Ga0070677_100472872 318
823 3300005347 Ga0070668_100067479 Ga0070668_1000674792 318
824 3300005355 Ga0070671_100084181 Ga0070671_1000841812 318
825 3300005364 Ga0070673_100209369 Ga0070673_1002093692 318
826 3300005367 Ga0070667_100165424 Ga0070667_1001654242 318
827 3300005456 Ga0070678_100014403 Ga0070678_1000144034 318
828 3300005544 Ga0070686_100064113 Ga0070686_1000641133 318
829 3300005615 Ga0070702_100186014 Ga0070702_1001860141 318
830 3300005618 Ga0068864_100037951 Ga0068864_1000379514 318
831 3300005842 Ga0068858_100184476 Ga0068858_1001844762 318
832 3300006048 Ga0075363_100063798 Ga0075363_1000637982 318
833 3300006051 Ga0075364_10100238 Ga0075364_101002382 318
834 3300006178 Ga0075367_10070103 Ga0075367_100701031 318
835 3300006195 Ga0075366_10095398 Ga0075366_100953981 318
836 3300006358 Ga0068871_100152558 Ga0068871_1001525582 318
837 3300009148 Ga0105243_10036148 Ga0105243_100361482 318
838 3300013308 Ga0157375_10604962 Ga0157375_106049622 318
839 3300014325 Ga0163163_10309182 Ga0163163_103091822 318
840 3300014326 Ga0157380_10069201 Ga0157380_100692014 318
841 3300025907 Ga0207645_10012169 Ga0207645_100121694 318
842 3300025931 Ga0207644_10079951 Ga0207644_100799512 318
843 3300025960 Ga0207651_10143638 Ga0207651_101436382 318
844 3300025972 Ga0207668_10204983 Ga0207668_102049831 318
845 3300025986 Ga0207658_10079628 Ga0207658_100796282 318
846 3300026035 Ga0207703_10027651 Ga0207703_100276515 318
847 3300026095 Ga0207676_10078295 Ga0207676_100782951 318
848 3300026121 Ga0207683_10017801 Ga0207683_100178014 318
849 3300031251 Ga0265327_10033246 Ga0265327_100332462 318
850 3300031251 Ga0265327_10050585 Ga0265327_100505853 318
851 3300034820 Ga0373959_0008868 Ga0373959_0008868_601_1557 318
852 3300035121 Ga0373960_0003865 Ga0373960_0003865_1633_2589 318
853 3300035121 Ga0373960_0009403 Ga0373960_0009403_563_1519 318
854 3300035242 Ga0373962_0057273 Ga0373962_0057273_100_1056 318
855 3300035691 Ga0373931_0021482 Ga0373931_0021482_987_1943 318
856 3300048904 Ga0496101_0013711 Ga0496101_0013711_935_1891 318
857 3300048908 Ga0496105_0084557 Ga0496105_0084557_678_1634 318
858 3300048909 Ga0496106_0066422 Ga0496106_0066422_1534_2490 318
859 3300048912 Ga0496109_0124796 Ga0496109_0124796_856_1812 318
860 3300048912 Ga0496109_0377269 Ga0496109_0377269_28_984 318
861 3300048914 Ga0496111_0069916 Ga0496111_0069916_975_1931 318
862 3300048917 Ga0496114_0137361 Ga0496114_0137361_541_1497 318
863 3300049575 Ga0501039_0177799 Ga0501039_0177799_16_1008 318
864 3300049578 Ga0501042_0262798 Ga0501042_0262798_179_1174 318
865 3300049593 Ga0501077_0028385 Ga0501077_0028385_2467_3459 318
866 3300049741 Ga0501079_0012449 Ga0501079_0012449_3590_4582 318
867 3300050491 nmdc:mga00v17_97219_c1 nmdc:mga00v17_97219_c1_550_1560 318
868 3300050493 nmdc:mga0k408_83582_c1 nmdc:mga0k408_83582_c1_26_1036 318
869 3300050494 nmdc:mga06z11_35069_c1 nmdc:mga06z11_35069_c1_1051_2061 318
870 3300050496 nmdc:mga07m45_10183_c1 nmdc:mga07m45_10183_c1_2851_3861 318
871 3300061734 Ga0530510_0171579 Ga0530510_0171579_223_1215 318
872 3300005437 Ga0070710_10072573 Ga0070710_100725731 319
873 3300005577 Ga0068857_100464610 Ga0068857_1004646101 319
874 3300006175 Ga0070712_100034989 Ga0070712_1000349894 319
875 3300048907 Ga0496104_0000833 Ga0496104_0000833_24001_24996 319
876 3300048908 Ga0496105_0045267 Ga0496105_0045267_337_1332 319
877 3300048911 Ga0496108_0109059 Ga0496108_0109059_644_1639 319
878 3300048913 Ga0496110_0060655 Ga0496110_0060655_2016_2975 319
879 3300048913 Ga0496110_0492800 Ga0496110_0492800_50_1045 319
880 3300049579 Ga0501043_0036204 Ga0501043_0036204_2770_3765 319
881 3300049823 Ga0501044_0256039 Ga0501044_0256039_658_1653 319
882 3300006038 Ga0075365_10086763 Ga0075365_100867632 320
883 3300025915 Ga0207693_10010472 Ga0207693_100104728 320
884 3300036401 Ga0373937_0098638 Ga0373937_0098638_483_1481 320
885 3300046459 Ga0495629_0157421 Ga0495629_0157421_174_1172 320
886 3300046642 Ga0495634_0103732 Ga0495634_0103732_217_1215 320
887 3300047471 Ga0495684_0101229 Ga0495684_0101229_177_1175 320
888 3300001991 JGI24743J22301_10023389 JGI24743J22301_100233891 321
889 3300002075 JGI24738J21930_10022534 JGI24738J21930_100225342 321
890 3300002076 JGI24749J21850_1012853 JGI24749J21850_10128531 321
891 3300005328 Ga0070676_10220100 Ga0070676_102201001 321
892 3300005330 Ga0070690_100238515 Ga0070690_1002385151 321
893 3300005331 Ga0070670_100123402 Ga0070670_1001234022 321
894 3300005331 Ga0070670_100277701 Ga0070670_1002777011 321
895 3300005334 Ga0068869_100102400 Ga0068869_1001024001 321
896 3300005338 Ga0068868_100139607 Ga0068868_1001396071 321
897 3300005340 Ga0070689_100230355 Ga0070689_1002303551 321
898 3300005353 Ga0070669_100073390 Ga0070669_1000733902 321
899 3300005354 Ga0070675_100045107 Ga0070675_1000451073 321
900 3300005355 Ga0070671_100037790 Ga0070671_1000377901 321
901 3300005364 Ga0070673_100060127 Ga0070673_1000601273 321
902 3300005441 Ga0070700_100138422 Ga0070700_1001384221 321
903 3300005535 Ga0070684_100351647 Ga0070684_1003516471 321
904 3300005539 Ga0068853_100021309 Ga0068853_1000213094 321
905 3300005543 Ga0070672_100033355 Ga0070672_1000333553 321
906 3300005549 Ga0070704_100072778 Ga0070704_1000727781 321
907 3300005564 Ga0070664_100311573 Ga0070664_1003115731 321
908 3300005614 Ga0068856_100683449 Ga0068856_1006834491 321
909 3300005616 Ga0068852_100334792 Ga0068852_1003347921 321
910 3300005617 Ga0068859_100138373 Ga0068859_1001383731 321
911 3300005618 Ga0068864_100018789 Ga0068864_1000187893 321
912 3300005719 Ga0068861_100061114 Ga0068861_1000611142 321
913 3300005840 Ga0068870_10003235 Ga0068870_100032356 321
914 3300005841 Ga0068863_100145229 Ga0068863_1001452292 321
915 3300005842 Ga0068858_100107316 Ga0068858_1001073161 321
916 3300006038 Ga0075365_10157232 Ga0075365_101572321 321
917 3300006237 Ga0097621_100205373 Ga0097621_1002053732 321
918 3300006871 Ga0075434_100132341 Ga0075434_1001323412 321
919 3300006931 Ga0097620_100138368 Ga0097620_1001383681 321
920 3300009094 Ga0111539_10669351 Ga0111539_106693512 321
921 3300009147 Ga0114129_10042156 Ga0114129_100421564 321
922 3300009148 Ga0105243_10172997 Ga0105243_101729971 321
923 3300009177 Ga0105248_10543404 Ga0105248_105434041 321
924 3300009545 Ga0105237_10405381 Ga0105237_104053811 321
925 3300009551 Ga0105238_10476566 Ga0105238_104765661 321
926 3300011119 Ga0105246_10123763 Ga0105246_101237631 321
927 3300013296 Ga0157374_10085143 Ga0157374_100851433 321
928 3300013297 Ga0157378_10046757 Ga0157378_100467571 321
929 3300013306 Ga0163162_10099076 Ga0163162_100990762 321
930 3300014325 Ga0163163_10051329 Ga0163163_100513292 321
931 3300014325 Ga0163163_10172110 Ga0163163_101721101 321
932 3300014745 Ga0157377_10007048 Ga0157377_100070482 321
933 3300014968 Ga0157379_10146350 Ga0157379_101463502 321
934 3300017792 Ga0163161_10088396 Ga0163161_100883962 321
935 3300025900 Ga0207710_10032070 Ga0207710_100320701 321
936 3300025901 Ga0207688_10009054 Ga0207688_100090544 321
937 3300025903 Ga0207680_10070700 Ga0207680_100707002 321
938 3300025904 Ga0207647_10030672 Ga0207647_100306721 321
939 3300025907 Ga0207645_10020137 Ga0207645_100201371 321
940 3300025908 Ga0207643_10124687 Ga0207643_101246871 321
941 3300025914 Ga0207671_10417824 Ga0207671_104178241 321
942 3300025919 Ga0207657_10206919 Ga0207657_102069191 321
943 3300025923 Ga0207681_10042080 Ga0207681_100420803 321
944 3300025924 Ga0207694_10124355 Ga0207694_101243552 321
945 3300025925 Ga0207650_10114738 Ga0207650_101147381 321
946 3300025926 Ga0207659_10011421 Ga0207659_100114213 321
947 3300025933 Ga0207706_10034208 Ga0207706_100342082 321
948 3300025936 Ga0207670_10197380 Ga0207670_101973801 321
949 3300025940 Ga0207691_10104303 Ga0207691_101043031 321
950 3300025941 Ga0207711_10118617 Ga0207711_101186172 321
951 3300025942 Ga0207689_10105965 Ga0207689_101059651 321
952 3300025944 Ga0207661_10247906 Ga0207661_102479061 321
953 3300025945 Ga0207679_10016937 Ga0207679_100169371 321
954 3300025945 Ga0207679_10062953 Ga0207679_100629532 321
955 3300025972 Ga0207668_10033345 Ga0207668_100333451 321
956 3300026023 Ga0207677_10008782 Ga0207677_100087824 321
957 3300026035 Ga0207703_10015337 Ga0207703_100153372 321
958 3300026041 Ga0207639_10067489 Ga0207639_100674892 321
959 3300026075 Ga0207708_10005791 Ga0207708_100057911 321
960 3300026088 Ga0207641_10011199 Ga0207641_100111994 321
961 3300026089 Ga0207648_10027150 Ga0207648_100271502 321
962 3300026095 Ga0207676_10009920 Ga0207676_100099201 321
963 3300026118 Ga0207675_100047119 Ga0207675_1000471193 321
964 3300026121 Ga0207683_10008847 Ga0207683_100088475 321
965 3300026142 Ga0207698_10242347 Ga0207698_102423471 321
966 3300028380 Ga0268265_10045598 Ga0268265_100455981 321
967 3300046537 Ga0495598_0040998 Ga0495598_0040998_268_1263 321
968 3300046665 Ga0495661_0175849 Ga0495661_0175849_32_1078 321
969 3300046691 Ga0495670_0139606 Ga0495670_0139606_203_1183 321
970 3300048907 Ga0496104_0014338 Ga0496104_0014338_3165_4145 321
971 3300048912 Ga0496109_0006773 Ga0496109_0006773_3399_4379 321
972 3300048913 Ga0496110_0006467 Ga0496110_0006467_3145_4125 321
973 3300048915 Ga0496112_0001747 Ga0496112_0001747_7153_8133 321
974 3300048916 Ga0496113_0000645 Ga0496113_0000645_4856_5836 321
975 3300048917 Ga0496114_0050710 Ga0496114_0050710_1514_2479 321
976 3300050492 nmdc:mga0yw44_190996_c1 nmdc:mga0yw44_190996_c1_356_1321 321
977 3300050512 nmdc:mga0n895_80247_c1 nmdc:mga0n895_80247_c1_472_1452 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

95

368

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9537 32 318
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9502 32 318
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.944 30 321
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9379 32 318
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9315 32 318
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9394 125 238 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9265 125 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9161 126 246 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9095 125 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9055 125 246 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5N7RLR6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9763 25 321
AF-A0A2N4SUF0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.969 37 321
AF-A0A1Q3XNW8-F1-model_v4 deleted 0.9687 25 321
AF-A0A5A8EZ22-F1-model_v4 deleted 0.9679 22 321
AF-A0A375FQQ0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9657 66 321

Feature Viewer

pLDDT pTM Quality
90.72 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map