F487251

General Info

Members Datasets Scaffolds Average Seq Length
976 389 1952 126

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101538938|Ga0070708_1015389382
Length 132
Sequence MARVKRAVNAHKKRRVVLERASGYRGQRSRMYRKAKEQTLHSMAYAYRDRKDRKGAFRRLWIQRINAAARADGLTYNRFIQGLKIAGVDIDRRMLAELAVDDPAAFSGLVDVARKALPDDLGGPSAADTAAA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
132 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
134 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
258 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
259 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
270 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
271 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
389 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.47
Metatranscriptomes 9.32
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 4.2
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101538938 3300005445 Bacteria 619
2 Ga0058862_10044764 3300004803 Bacteria 608
3 Ga0065707_10082794 3300005295 Bacteria 12061
4 Ga0070658_10816914 3300005327 Bacteria 810
5 Ga0070658_11003980 3300005327 Bacteria 726
6 Ga0070676_11262207 3300005328 Bacteria 563
7 Ga0070683_100573657 3300005329 Bacteria 1079
8 Ga0070670_101632167 3300005331 Bacteria 593
9 Ga0070677_10352690 3300005333 Bacteria 763
10 Ga0068869_100167989 3300005334 Bacteria 1712
11 Ga0068869_101579171 3300005334 Bacteria 584
12 Ga0070666_10175764 3300005335 Bacteria 1501
13 Ga0070666_10222099 3300005335 Bacteria 1333
14 Ga0070680_100218942 3300005336 Bacteria 1607
15 Ga0070680_101237863 3300005336 Bacteria 646
16 Ga0070682_100071490 3300005337 Bacteria 2221
17 Ga0070682_100325543 3300005337 Bacteria 1137
18 Ga0070682_101582171 3300005337 Bacteria 566
19 Ga0068868_102002229 3300005338 Bacteria 550
20 Ga0068868_102018053 3300005338 Bacteria 548
21 Ga0070660_100707123 3300005339 Bacteria 845
22 Ga0070660_100968934 3300005339 Unclassified 718
23 Ga0070660_101747887 3300005339 Bacteria 530
24 Ga0070689_101884571 3300005340 Bacteria 546
25 Ga0070691_10041703 3300005341 Bacteria 2171
26 Ga0070661_100024970 3300005344 Bacteria 4291
27 Ga0070669_100047826 3300005353 Bacteria 3121
28 Ga0070669_100130671 3300005353 Bacteria 1926
29 Ga0070675_100766646 3300005354 Bacteria 881
30 Ga0070675_100872775 3300005354 Bacteria 824
31 Ga0070671_100015641 3300005355 Bacteria 6132
32 Ga0070671_101464859 3300005355 Unclassified 604
33 Ga0070674_100019188 3300005356 Bacteria 4340
34 Ga0070674_100242849 3300005356 Bacteria 1411
35 Ga0070673_101417359 3300005364 Bacteria 654
36 Ga0070673_101512272 3300005364 Bacteria 633
37 Ga0070709_10014574 3300005434 Bacteria 4448
38 Ga0070709_10043900 3300005434 Bacteria 2767
39 Ga0070709_10044658 3300005434 Bacteria 2745
40 Ga0070709_10119093 3300005434 Bacteria 1786
41 Ga0070709_10140570 3300005434 Bacteria 1658
42 Ga0070709_10328443 3300005434 Bacteria 1124
43 Ga0070709_11047221 3300005434 Bacteria 651
44 Ga0070714_100000829 3300005435 Bacteria 21864
45 Ga0070714_100008120 3300005435 Bacteria 8181
46 Ga0070714_100022560 3300005435 Bacteria 5162
47 Ga0070714_100041831 3300005435 Bacteria 3869
48 Ga0070714_100094835 3300005435 Bacteria 2620
49 Ga0070714_100109886 3300005435 Bacteria 2440
50 Ga0070714_100156220 3300005435 Unclassified 2059
51 Ga0070714_100312851 3300005435 Bacteria 1467
52 Ga0070714_100322243 3300005435 Bacteria 1445
53 Ga0070714_100551550 3300005435 Bacteria 1103
54 Ga0070714_102442977 3300005435 Bacteria 507
55 Ga0070713_100000301 3300005436 Bacteria 32722
56 Ga0070713_100004793 3300005436 Bacteria 9160
57 Ga0070713_100102293 3300005436 Bacteria 2484
58 Ga0070713_100154458 3300005436 Bacteria 2044
59 Ga0070713_100214204 3300005436 Bacteria 1745
60 Ga0070713_100340933 3300005436 Bacteria 1388
61 Ga0070710_10000358 3300005437 Bacteria 21534
62 Ga0070710_10002036 3300005437 Bacteria 9574
63 Ga0070710_10009948 3300005437 Bacteria 4662
64 Ga0070710_10040181 3300005437 Bacteria 2578
65 Ga0070710_10066864 3300005437 Bacteria 2061
66 Ga0070710_10152031 3300005437 Bacteria 1428
67 Ga0070710_10309561 3300005437 Bacteria 1033
68 Ga0070711_100000638 3300005439 Bacteria 18273
69 Ga0070711_100032942 3300005439 Bacteria 3448
70 Ga0070711_100119441 3300005439 Bacteria 1947
71 Ga0070711_100229918 3300005439 Bacteria 1445
72 Ga0070711_100238893 3300005439 Bacteria 1420
73 Ga0070711_100675774 3300005439 Bacteria 868
74 Ga0070700_100045043 3300005441 Bacteria 2720
75 Ga0070694_101694240 3300005444 Bacteria 538
76 Ga0070708_100001321 3300005445 Bacteria 19006
77 Ga0070708_100061763 3300005445 Bacteria 3348
78 Ga0070708_100074283 3300005445 Bacteria 3066
79 Ga0070708_100377224 3300005445 Bacteria 1337
80 Ga0070663_101511412 3300005455 Bacteria 597
81 Ga0070678_100105427 3300005456 Bacteria 2194
82 Ga0070678_100905430 3300005456 Bacteria 807
83 Ga0070678_101276596 3300005456 Bacteria 683
84 Ga0070662_100775264 3300005457 Bacteria 814
85 Ga0070681_10833047 3300005458 Bacteria 840
86 Ga0068867_100017306 3300005459 Bacteria 5119
87 Ga0068867_100612074 3300005459 Bacteria 951
88 Ga0070706_100002905 3300005467 Bacteria 17059
89 Ga0070706_100005180 3300005467 Bacteria 12443
90 Ga0070706_100008719 3300005467 Bacteria 9449
91 Ga0070706_100012401 3300005467 Bacteria 7897
92 Ga0070706_100036657 3300005467 Bacteria 4530
93 Ga0070706_100060797 3300005467 Bacteria 3487
94 Ga0070706_100063225 3300005467 Bacteria 3420
95 Ga0070706_100099112 3300005467 Bacteria 2707
96 Ga0070706_100733835 3300005467 Bacteria 915
97 Ga0070706_100766845 3300005467 Bacteria 893
98 Ga0070707_100000300 3300005468 Bacteria 48384
99 Ga0070707_100011644 3300005468 Bacteria 8207
100 Ga0070707_100108861 3300005468 Bacteria 2687
101 Ga0070707_100131178 3300005468 Bacteria 2437
102 Ga0070707_100133287 3300005468 Bacteria 2416
103 Ga0070707_100234827 3300005468 Bacteria 1785
104 Ga0070707_100260045 3300005468 Bacteria 1689
105 Ga0070707_100272657 3300005468 Bacteria 1645
106 Ga0070698_100000801 3300005471 Bacteria 34248
107 Ga0070698_100002410 3300005471 Bacteria 20596
108 Ga0070698_100003145 3300005471 Bacteria 18190
109 Ga0070698_100003899 3300005471 Bacteria 16402
110 Ga0070698_100006066 3300005471 Bacteria 13162
111 Ga0070698_100065689 3300005471 Bacteria 3652
112 Ga0070698_100168910 3300005471 Bacteria 2129
113 Ga0070698_100246640 3300005471 Bacteria 1719
114 Ga0070699_100068826 3300005518 Bacteria 3075
115 Ga0070699_100070353 3300005518 Bacteria 3042
116 Ga0070699_100073117 3300005518 Bacteria 2983
117 Ga0070699_101072992 3300005518 Bacteria 739
118 Ga0070684_100115637 3300005535 Bacteria 2409
119 Ga0070684_100139985 3300005535 Bacteria 2187
120 Ga0070684_100928377 3300005535 Bacteria 816
121 Ga0070684_101058809 3300005535 Bacteria 762
122 Ga0070684_101367365 3300005535 Bacteria 667
123 Ga0070697_100030550 3300005536 Bacteria 4328
124 Ga0068853_100197912 3300005539 Bacteria 1828
125 Ga0068853_100586708 3300005539 Bacteria 1058
126 Ga0068853_100754483 3300005539 Bacteria 930
127 Ga0068853_100895824 3300005539 Bacteria 852
128 Ga0070672_100008328 3300005543 Bacteria 7085
129 Ga0070672_100011156 3300005543 Bacteria 6257
130 Ga0070672_101857696 3300005543 Bacteria 542
131 Ga0070672_101990517 3300005543 Bacteria 523
132 Ga0070695_100533938 3300005545 Bacteria 912
133 Ga0070695_101067195 3300005545 Bacteria 660
134 Ga0070665_100272775 3300005548 Bacteria 1693
135 Ga0070665_100567533 3300005548 Bacteria 1147
136 Ga0070704_100317062 3300005549 Bacteria 1305
137 Ga0068855_100043684 3300005563 Bacteria 5307
138 Ga0068855_100130053 3300005563 Bacteria 2876
139 Ga0068855_100146481 3300005563 Bacteria 2688
140 Ga0068855_101284481 3300005563 Bacteria 758
141 Ga0070664_100728856 3300005564 Bacteria 925
142 Ga0068857_100018116 3300005577 Bacteria 6177
143 Ga0068857_101478477 3300005577 Bacteria 662
144 Ga0068854_100887552 3300005578 Bacteria 783
145 Ga0068854_101569058 3300005578 Bacteria 599
146 Ga0068856_100039299 3300005614 Bacteria 4645
147 Ga0068856_100044982 3300005614 Bacteria 4345
148 Ga0068856_100076573 3300005614 Bacteria 3314
149 Ga0068856_100087951 3300005614 Bacteria 3089
150 Ga0068856_100406560 3300005614 Bacteria 1381
151 Ga0070702_100101619 3300005615 Bacteria 1765
152 Ga0068852_100457482 3300005616 Bacteria 1264
153 Ga0068859_100046132 3300005617 Bacteria 4377
154 Ga0068859_100665154 3300005617 Bacteria 1133
155 Ga0068864_100109354 3300005618 Bacteria 2461
156 Ga0068861_100001796 3300005719 Bacteria 13814
157 Ga0068870_10390384 3300005840 Bacteria 903
158 Ga0068863_100259524 3300005841 Bacteria 1679
159 Ga0068863_100654906 3300005841 Bacteria 1042
160 Ga0068863_101019016 3300005841 Bacteria 831
161 Ga0068863_102681780 3300005841 Bacteria 507
162 Ga0068858_100077420 3300005842 Bacteria 3090
163 Ga0068858_100147677 3300005842 Bacteria 2209
164 Ga0068858_100352439 3300005842 Bacteria 1410
165 Ga0068860_100002243 3300005843 Bacteria 20349
166 Ga0068860_100375087 3300005843 Bacteria 1404
167 Ga0068860_100916391 3300005843 Bacteria 893
168 Ga0068862_100333384 3300005844 Bacteria 1403
169 Ga0081540_1000482 3300005983 Bacteria 39035
170 Ga0081540_1164053 3300005983 Bacteria 857
171 Ga0070717_10000712 3300006028 Bacteria 21583
172 Ga0070717_10035300 3300006028 Bacteria 4047
173 Ga0070717_10151902 3300006028 Bacteria 2004
174 Ga0070717_10160951 3300006028 Bacteria 1947
175 Ga0070717_10291279 3300006028 Bacteria 1450
176 Ga0070717_10292906 3300006028 Bacteria 1445
177 Ga0070717_11443884 3300006028 Bacteria 624
178 Ga0075368_10310233 3300006042 Bacteria 682
179 Ga0070715_10008968 3300006163 Bacteria 3510
180 Ga0070715_10011170 3300006163 Bacteria 3226
181 Ga0070715_10314116 3300006163 Bacteria 843
182 Ga0070716_100000107 3300006173 Bacteria 33042
183 Ga0070716_100000726 3300006173 Bacteria 14049
184 Ga0070716_100039242 3300006173 Bacteria 2627
185 Ga0070716_100059402 3300006173 Bacteria 2204
186 Ga0070716_100224324 3300006173 Bacteria 1265
187 Ga0070712_100003795 3300006175 Bacteria 9304
188 Ga0070712_100025122 3300006175 Bacteria 3956
189 Ga0070712_100154621 3300006175 Bacteria 1765
190 Ga0070712_100259365 3300006175 Bacteria 1392
191 Ga0070712_100485612 3300006175 Bacteria 1033
192 Ga0075366_10220538 3300006195 Bacteria 1155
193 Ga0097621_100222160 3300006237 Bacteria 1646
194 Ga0097621_101528437 3300006237 Unclassified 634
195 Ga0068871_100023726 3300006358 Bacteria 4749
196 Ga0075428_100117619 3300006844 Bacteria 2896
197 Ga0075430_100020756 3300006846 Bacteria 5586
198 Ga0075430_100138881 3300006846 Bacteria 2024
199 Ga0075431_100008971 3300006847 Bacteria 10024
200 Ga0075431_100251713 3300006847 Bacteria 1795
201 Ga0075433_10043109 3300006852 Bacteria 3916
202 Ga0075433_10154477 3300006852 Bacteria 2042
203 Ga0075434_100045414 3300006871 Bacteria 4358
204 Ga0075434_100377057 3300006871 Bacteria 1439
205 Ga0075434_100402859 3300006871 Bacteria 1389
206 Ga0075429_100930344 3300006880 Bacteria 760
207 Ga0068865_101706899 3300006881 Bacteria 568
208 Ga0075436_100040389 3300006914 Bacteria 3219
209 Ga0075436_100176893 3300006914 Bacteria 1507
210 Ga0075436_100373834 3300006914 Bacteria 1030
211 Ga0075436_101208821 3300006914 Bacteria 571
212 Ga0097620_100046133 3300006931 Bacteria 4377
213 Ga0097620_100665164 3300006931 Bacteria 1133
214 Ga0075435_100002665 3300007076 Bacteria 11912
215 Ga0075435_100079499 3300007076 Bacteria 2691
216 Ga0075435_100172519 3300007076 Bacteria 1825
217 Ga0075435_100533617 3300007076 Bacteria 1015
218 Ga0075435_101006873 3300007076 Bacteria 728
219 Ga0075435_101725249 3300007076 Bacteria 549
220 Ga0099794_10318934 3300007265 Bacteria 806
221 Ga0105251_10276746 3300009011 Bacteria 759
222 Ga0105240_10118770 3300009093 Unclassified 3186
223 Ga0105240_10126052 3300009093 Bacteria 3077
224 Ga0111539_10053594 3300009094 Bacteria 4801
225 Ga0105245_10006829 3300009098 Bacteria 10013
226 Ga0105245_10279901 3300009098 Bacteria 1630
227 Ga0105245_10375812 3300009098 Bacteria 1414
228 Ga0105245_10726450 3300009098 Bacteria 1028
229 Ga0105245_11669205 3300009098 Unclassified 689
230 Ga0105247_10306649 3300009101 Bacteria 1103
231 Ga0114129_10329283 3300009147 Bacteria 2028
232 Ga0114129_11179624 3300009147 Bacteria 955
233 Ga0105243_10031845 3300009148 Bacteria 4069
234 Ga0105243_12754884 3300009148 Unclassified 532
235 Ga0105241_10044971 3300009174 Bacteria 3348
236 Ga0105241_10062828 3300009174 Bacteria 2864
237 Ga0105241_10683035 3300009174 Bacteria 935
238 Ga0105242_11733041 3300009176 Bacteria 662
239 Ga0105242_12678903 3300009176 Bacteria 548
240 Ga0105248_10144050 3300009177 Bacteria 2688
241 Ga0105248_11679244 3300009177 Bacteria 720
242 Ga0105237_10256997 3300009545 Bacteria 1749
243 Ga0105237_10303473 3300009545 Bacteria 1600
244 Ga0105237_10465298 3300009545 Bacteria 1270
245 Ga0105238_10149071 3300009551 Bacteria 2315
246 Ga0105238_10188444 3300009551 Bacteria 2039
247 Ga0105238_10255840 3300009551 Bacteria 1730
248 Ga0105238_11149481 3300009551 Bacteria 800
249 Ga0105238_11737993 3300009551 Bacteria 655
250 Ga0105249_10027380 3300009553 Bacteria 5142
251 Ga0105249_10517123 3300009553 Bacteria 1240
252 Ga0099796_10583841 3300010159 Unclassified 503
253 Ga0105239_10009903 3300010375 Bacteria 10704
254 Ga0105239_10938466 3300010375 Bacteria 994
255 Ga0105239_11272529 3300010375 Bacteria 848
256 Ga0105239_12312238 3300010375 Bacteria 626
257 Ga0105246_11119556 3300011119 Bacteria 720
258 Ga0157339_1038572 3300012505 Bacteria 590
259 Ga0157373_10210104 3300013100 Bacteria 1372
260 Ga0157373_10559714 3300013100 Bacteria 830
261 Ga0157373_11111006 3300013100 Unclassified 593
262 Ga0157371_10445910 3300013102 Bacteria 951
263 Ga0157370_10724834 3300013104 Bacteria 907
264 Ga0157370_10919537 3300013104 Unclassified 793
265 Ga0157370_11260681 3300013104 Archaea 666
266 Ga0157369_10368567 3300013105 Bacteria 1491
267 Ga0157369_10747506 3300013105 Bacteria 1006
268 Ga0157369_10923845 3300013105 Unclassified 895
269 Ga0157369_11189347 3300013105 Bacteria 778
270 Ga0157369_11699652 3300013105 Bacteria 641
271 Ga0157369_11748164 3300013105 Bacteria 632
272 Ga0157369_12132859 3300013105 Bacteria 568
273 Ga0157374_10015922 3300013296 Bacteria 6607
274 Ga0157374_10740224 3300013296 Bacteria 997
275 Ga0157374_11142280 3300013296 Bacteria 800
276 Ga0157378_10013493 3300013297 Bacteria 7145
277 Ga0157378_12057045 3300013297 Bacteria 621
278 Ga0163162_10001801 3300013306 Bacteria 20110
279 Ga0163162_10193082 3300013306 Bacteria 2164
280 Ga0157372_10183950 3300013307 Bacteria 2420
281 Ga0157372_10227439 3300013307 Bacteria 2162
282 Ga0157372_10500139 3300013307 Unclassified 1417
283 Ga0157372_10609285 3300013307 Unclassified 1273
284 Ga0157372_10990971 3300013307 Bacteria 973
285 Ga0157372_11182477 3300013307 Bacteria 884
286 Ga0157372_12137848 3300013307 Bacteria 643
287 Ga0157375_10098016 3300013308 Bacteria 3007
288 Ga0157375_10862547 3300013308 Bacteria 1051
289 Ga0157375_11548696 3300013308 Bacteria 783
290 Ga0157375_12187185 3300013308 Bacteria 659
291 Ga0157375_12655929 3300013308 Unclassified 598
292 Ga0163163_10759779 3300014325 Bacteria 1033
293 Ga0182008_10328897 3300014497 Bacteria 806
294 Ga0157377_10202523 3300014745 Bacteria 1261
295 Ga0157377_10667796 3300014745 Bacteria 750
296 Ga0157379_10006818 3300014968 Bacteria 9870
297 Ga0157379_10050003 3300014968 Bacteria 3731
298 Ga0157379_10068693 3300014968 Bacteria 3168
299 Ga0157379_11395184 3300014968 Bacteria 679
300 Ga0157379_11965082 3300014968 Bacteria 577
301 Ga0157376_10006886 3300014969 Bacteria 8049
302 Ga0157376_10072188 3300014969 Bacteria 2936
303 Ga0163161_10129362 3300017792 Bacteria 1903
304 Ga0163161_10192477 3300017792 Bacteria 1569
305 Ga0163161_11684242 3300017792 Bacteria 561
306 Ga0184595_106319 3300019166 Bacteria 602
307 Ga0184592_103689 3300019177 Bacteria 612
308 Ga0184594_129231 3300019181 Bacteria 624
309 Ga0184601_133098 3300019183 Bacteria 666
310 Ga0184599_152346 3300019188 Bacteria 834
311 Ga0184600_139479 3300019190 Bacteria 1425
312 Ga0184603_145986 3300019192 Bacteria 852
313 Ga0197907_10081145 3300020069 Bacteria 4119
314 Ga0197907_11507248 3300020069 Bacteria 839
315 Ga0206356_10616066 3300020070 Bacteria 874
316 Ga0206356_11087391 3300020070 Bacteria 582
317 Ga0206356_11838597 3300020070 Bacteria 586
318 Ga0206355_1000641 3300020076 Bacteria 690
319 Ga0206352_10444515 3300020078 Bacteria 537
320 Ga0206352_10598243 3300020078 Bacteria 930
321 Ga0206352_10725269 3300020078 Bacteria 819
322 Ga0206350_11041294 3300020080 Bacteria 2550
323 Ga0206354_11188401 3300020081 Bacteria 1094
324 Ga0206354_11474612 3300020081 Bacteria 1214
325 Ga0206354_11668375 3300020081 Unclassified 523
326 Ga0206353_10824445 3300020082 Unclassified 758
327 Ga0206353_11633815 3300020082 Bacteria 897
328 Ga0213875_10000176 3300021388 Bacteria 67409
329 Ga0213875_10000584 3300021388 Bacteria 29499
330 Ga0213875_10083953 3300021388 Bacteria 1486
331 Ga0213875_10277652 3300021388 Bacteria 791
332 Ga0224712_10071645 3300022467 Bacteria 1409
333 Ga0224712_10081329 3300022467 Bacteria 1337
334 Ga0224712_10109490 3300022467 Bacteria 1183
335 Ga0247554_103440 3300023547 Bacteria 621
336 Ga0247551_105014 3300023552 Bacteria 542
337 Ga0247515_119401 3300023564 Bacteria 598
338 Ga0247553_103863 3300023672 Bacteria 744
339 Ga0247522_117983 3300023688 Bacteria 542
340 Ga0228600_1005907 3300024123 Bacteria 904
341 Ga0224572_1002833 3300024225 Bacteria 2857
342 Ga0228598_1018543 3300024227 Bacteria 1373
343 Ga0207682_10045239 3300025893 Bacteria 1806
344 Ga0207682_10236597 3300025893 Bacteria 848
345 Ga0207692_10000057 3300025898 Bacteria 32761
346 Ga0207692_10001524 3300025898 Bacteria 8706
347 Ga0207692_10022131 3300025898 Bacteria 2921
348 Ga0207692_10057414 3300025898 Bacteria 2001
349 Ga0207692_10100855 3300025898 Bacteria 1584
350 Ga0207692_10107778 3300025898 Bacteria 1540
351 Ga0207692_10264469 3300025898 Bacteria 1035
352 Ga0207692_10267296 3300025898 Bacteria 1030
353 Ga0207710_10289262 3300025900 Bacteria 826
354 Ga0207680_11296333 3300025903 Bacteria 518
355 Ga0207685_10003821 3300025905 Bacteria 3726
356 Ga0207685_10040562 3300025905 Bacteria 1736
357 Ga0207685_10058632 3300025905 Bacteria 1515
358 Ga0207699_10000162 3300025906 Bacteria 41608
359 Ga0207699_10002215 3300025906 Bacteria 9163
360 Ga0207699_10011202 3300025906 Bacteria 4520
361 Ga0207699_10012683 3300025906 Bacteria 4291
362 Ga0207699_10030697 3300025906 Bacteria 3010
363 Ga0207699_10045722 3300025906 Bacteria 2557
364 Ga0207699_10048477 3300025906 Bacteria 2495
365 Ga0207645_10524749 3300025907 Bacteria 802
366 Ga0207643_10965583 3300025908 Bacteria 552
367 Ga0207705_10567099 3300025909 Bacteria 882
368 Ga0207684_10000918 3300025910 Bacteria 33417
369 Ga0207684_10011073 3300025910 Bacteria 7897
370 Ga0207684_10018120 3300025910 Bacteria 6033
371 Ga0207684_10023539 3300025910 Bacteria 5259
372 Ga0207684_10049552 3300025910 Bacteria 3563
373 Ga0207684_10060226 3300025910 Bacteria 3224
374 Ga0207684_10093327 3300025910 Bacteria 2566
375 Ga0207684_10149788 3300025910 Bacteria 2007
376 Ga0207684_10188430 3300025910 Bacteria 1779
377 Ga0207684_10248326 3300025910 Bacteria 1535
378 Ga0207684_10596727 3300025910 Bacteria 943
379 Ga0207654_10233203 3300025911 Bacteria 1227
380 Ga0207654_10415210 3300025911 Bacteria 938
381 Ga0207707_10636439 3300025912 Bacteria 900
382 Ga0207707_11170358 3300025912 Bacteria 624
383 Ga0207695_10641696 3300025913 Unclassified 943
384 Ga0207671_10205438 3300025914 Bacteria 1539
385 Ga0207693_10001896 3300025915 Bacteria 18288
386 Ga0207693_10006360 3300025915 Bacteria 9787
387 Ga0207693_10044701 3300025915 Bacteria 3480
388 Ga0207693_10191816 3300025915 Bacteria 1608
389 Ga0207693_10208732 3300025915 Bacteria 1535
390 Ga0207693_10369276 3300025915 Bacteria 1122
391 Ga0207693_10979641 3300025915 Bacteria 646
392 Ga0207693_11076240 3300025915 Bacteria 611
393 Ga0207663_10001902 3300025916 Bacteria 9874
394 Ga0207663_10017791 3300025916 Bacteria 3968
395 Ga0207663_10026595 3300025916 Bacteria 3361
396 Ga0207663_10219572 3300025916 Bacteria 1382
397 Ga0207663_10275815 3300025916 Bacteria 1247
398 Ga0207663_10276295 3300025916 Bacteria 1246
399 Ga0207657_10559860 3300025919 Bacteria 894
400 Ga0207649_10023341 3300025920 Bacteria 3582
401 Ga0207649_11401799 3300025920 Bacteria 553
402 Ga0207652_10163960 3300025921 Bacteria 1992
403 Ga0207646_10000096 3300025922 Bacteria 117197
404 Ga0207646_10000913 3300025922 Bacteria 38056
405 Ga0207646_10005894 3300025922 Bacteria 12792
406 Ga0207646_10022563 3300025922 Bacteria 5796
407 Ga0207646_10023414 3300025922 Bacteria 5672
408 Ga0207646_10078339 3300025922 Bacteria 2954
409 Ga0207646_10079676 3300025922 Bacteria 2928
410 Ga0207646_10112559 3300025922 Bacteria 2443
411 Ga0207646_10632147 3300025922 Bacteria 960
412 Ga0207646_10720418 3300025922 Bacteria 891
413 Ga0207681_10026813 3300025923 Bacteria 3720
414 Ga0207694_10192080 3300025924 Bacteria 1659
415 Ga0207694_10287111 3300025924 Bacteria 1352
416 Ga0207650_10544859 3300025925 Bacteria 972
417 Ga0207650_11287729 3300025925 Bacteria 622
418 Ga0207650_11452329 3300025925 Bacteria 583
419 Ga0207659_10161282 3300025926 Bacteria 1761
420 Ga0207659_10393486 3300025926 Bacteria 1158
421 Ga0207687_10045122 3300025927 Unclassified 3045
422 Ga0207687_10271728 3300025927 Bacteria 1355
423 Ga0207687_10508647 3300025927 Bacteria 1006
424 Ga0207700_10000208 3300025928 Bacteria 35189
425 Ga0207700_10001506 3300025928 Bacteria 13187
426 Ga0207700_10033846 3300025928 Bacteria 3661
427 Ga0207700_10049204 3300025928 Bacteria 3134
428 Ga0207700_10092484 3300025928 Bacteria 2391
429 Ga0207700_10310267 3300025928 Bacteria 1364
430 Ga0207700_10431176 3300025928 Bacteria 1159
431 Ga0207700_10445808 3300025928 Bacteria 1140
432 Ga0207700_10632954 3300025928 Bacteria 953
433 Ga0207700_11330782 3300025928 Bacteria 640
434 Ga0207664_10000108 3300025929 Bacteria 72754
435 Ga0207664_10000652 3300025929 Bacteria 23974
436 Ga0207664_10006527 3300025929 Bacteria 8028
437 Ga0207664_10016881 3300025929 Bacteria 5337
438 Ga0207664_10020882 3300025929 Bacteria 4860
439 Ga0207664_10069941 3300025929 Bacteria 2823
440 Ga0207664_10194742 3300025929 Bacteria 1747
441 Ga0207664_10285164 3300025929 Bacteria 1450
442 Ga0207664_10410861 3300025929 Bacteria 1205
443 Ga0207664_10738700 3300025929 Bacteria 885
444 Ga0207644_10088932 3300025931 Bacteria 2298
445 Ga0207644_10497020 3300025931 Bacteria 1006
446 Ga0207644_11081192 3300025931 Bacteria 674
447 Ga0207690_11538681 3300025932 Bacteria 556
448 Ga0207706_10830157 3300025933 Bacteria 784
449 Ga0207706_11155557 3300025933 Bacteria 645
450 Ga0207706_11175918 3300025933 Bacteria 638
451 Ga0207669_10061121 3300025937 Bacteria 2313
452 Ga0207669_10158714 3300025937 Bacteria 1594
453 Ga0207704_10096701 3300025938 Bacteria 1956
454 Ga0207665_10000153 3300025939 Bacteria 46744
455 Ga0207665_10007829 3300025939 Bacteria 7054
456 Ga0207665_10010935 3300025939 Bacteria 5957
457 Ga0207665_10308428 3300025939 Bacteria 1185
458 Ga0207691_10017320 3300025940 Bacteria 6834
459 Ga0207691_10017572 3300025940 Bacteria 6779
460 Ga0207691_10742182 3300025940 Bacteria 827
461 Ga0207711_10181774 3300025941 Bacteria 1913
462 Ga0207711_10363797 3300025941 Bacteria 1340
463 Ga0207711_10735721 3300025941 Bacteria 920
464 Ga0207661_10133553 3300025944 Bacteria 2129
465 Ga0207661_10366019 3300025944 Bacteria 1303
466 Ga0207661_10445614 3300025944 Bacteria 1179
467 Ga0207661_11200490 3300025944 Bacteria 698
468 Ga0207661_11500679 3300025944 Bacteria 618
469 Ga0207679_10354493 3300025945 Bacteria 1280
470 Ga0207667_10061601 3300025949 Bacteria 3925
471 Ga0207667_10196512 3300025949 Bacteria 2069
472 Ga0207667_10422940 3300025949 Bacteria 1355
473 Ga0207667_10462714 3300025949 Bacteria 1288
474 Ga0207667_11266890 3300025949 Bacteria 715
475 Ga0207651_11400599 3300025960 Bacteria 629
476 Ga0207712_10100595 3300025961 Bacteria 2148
477 Ga0207668_10520320 3300025972 Bacteria 1026
478 Ga0207640_11087884 3300025981 Bacteria 707
479 Ga0207640_11258837 3300025981 Bacteria 659
480 Ga0207677_10121231 3300026023 Bacteria 1967
481 Ga0207703_10191219 3300026035 Bacteria 1813
482 Ga0207703_10211941 3300026035 Bacteria 1728
483 Ga0207703_11023852 3300026035 Bacteria 792
484 Ga0207639_10309470 3300026041 Bacteria 1399
485 Ga0207639_10621887 3300026041 Bacteria 997
486 Ga0207639_10622664 3300026041 Bacteria 997
487 Ga0207639_11656431 3300026041 Bacteria 600
488 Ga0207678_10162970 3300026067 Bacteria 1904
489 Ga0207708_10010427 3300026075 Bacteria 6899
490 Ga0207702_10013210 3300026078 Bacteria 6867
491 Ga0207702_10115369 3300026078 Bacteria 2395
492 Ga0207702_10127832 3300026078 Bacteria 2284
493 Ga0207702_10251081 3300026078 Bacteria 1661
494 Ga0207702_10478064 3300026078 Bacteria 1212
495 Ga0207641_10078018 3300026088 Bacteria 2868
496 Ga0207641_10316220 3300026088 Bacteria 1479
497 Ga0207641_11536802 3300026088 Bacteria 667
498 Ga0207648_10005680 3300026089 Bacteria 12515
499 Ga0207648_10555708 3300026089 Bacteria 1055
500 Ga0207676_10083480 3300026095 Bacteria 2602
501 Ga0207674_10005230 3300026116 Bacteria 15448
502 Ga0207674_10214387 3300026116 Bacteria 1874
503 Ga0207674_10660886 3300026116 Bacteria 1009
504 Ga0207674_11328395 3300026116 Bacteria 688
505 Ga0207675_100083223 3300026118 Bacteria 3001
506 Ga0207683_10081319 3300026121 Bacteria 2875
507 Ga0207683_10170703 3300026121 Bacteria 1970
508 Ga0207683_10956099 3300026121 Bacteria 795
509 Ga0207683_11357671 3300026121 Bacteria 657
510 Ga0207683_11733689 3300026121 Bacteria 574
511 Ga0207698_10366444 3300026142 Bacteria 1366
512 Ga0207698_12610938 3300026142 Bacteria 514
513 Ga0209813_10466884 3300027866 Bacteria 519
514 Ga0207428_11100078 3300027907 Bacteria 555
515 Ga0268266_10205974 3300028379 Bacteria 1802
516 Ga0268266_10307163 3300028379 Bacteria 1481
517 Ga0268266_11771618 3300028379 Bacteria 592
518 Ga0268265_10066323 3300028380 Bacteria 2790
519 Ga0268264_10020547 3300028381 Bacteria 5395
520 Ga0268264_10455089 3300028381 Bacteria 1241
521 Ga0268264_10509985 3300028381 Bacteria 1174
522 Ga0268264_11787458 3300028381 Bacteria 625
523 Ga0268264_12378094 3300028381 Bacteria 536
524 Ga0265336_10029909 3300028666 Bacteria 1697
525 Ga0265338_10004219 3300028800 Bacteria 19560
526 Ga0265762_1029976 3300030760 Bacteria 1030
527 Ga0265775_100408 3300030762 Bacteria 1723
528 Ga0265767_103009 3300030836 Bacteria 931
529 Ga0265770_1075700 3300030878 Bacteria 650
530 Ga0265770_1156947 3300030878 Bacteria 503
531 Ga0265772_102273 3300030886 Bacteria 749
532 Ga0265779_104757 3300031043 Bacteria 731
533 Ga0265760_10283520 3300031090 Unclassified 583
534 Ga0307408_100230583 3300031548 Bacteria 1516
535 Ga0307408_100951638 3300031548 Bacteria 789
536 Ga0310113_120032 3300031636 Bacteria 696
537 Ga0316576_10017752 3300031727 Bacteria 4843
538 Ga0316578_10008072 3300031728 Bacteria 5326
539 Ga0316577_10011528 3300031733 Bacteria 4791
540 Ga0316043_122996 3300031828 Bacteria 673
541 Ga0307410_10155625 3300031852 Bacteria 1707
542 Ga0307410_10628448 3300031852 Bacteria 898
543 Ga0307406_12114092 3300031901 Bacteria 505
544 Ga0307407_10380230 3300031903 Bacteria 1008
545 Ga0307407_10533906 3300031903 Unclassified 865
546 Ga0307412_10630795 3300031911 Bacteria 912
547 Ga0307409_100071621 3300031995 Bacteria 2757
548 Ga0307409_100886127 3300031995 Bacteria 905
549 Ga0307409_101001411 3300031995 Bacteria 854
550 Ga0307416_100904838 3300032002 Bacteria 983
551 Ga0307416_101853021 3300032002 Bacteria 707
552 Ga0307415_101914947 3300032126 Bacteria 576
553 Ga0307415_102196122 3300032126 Bacteria 540
554 Ga0316593_10351470 3300032168 Bacteria 564
555 Ga0316588_1027473 3300033528 Bacteria 1322
556 Ga0316214_1058218 3300033545 Bacteria 564
557 Ga0373930_0009592 3300034816 Bacteria 1715
558 Ga0373948_0006634 3300034817 Bacteria 1920
559 Ga0373950_0026422 3300034818 Bacteria 1053
560 Ga0373959_0039662 3300034820 Bacteria 983
561 Ga0373938_0042615 3300034957 Bacteria 1013
562 Ga0373926_0076877 3300035083 Bacteria 1231
563 Ga0373926_0080036 3300035083 Bacteria 1207
564 Ga0373926_0088325 3300035083 Bacteria 1151
565 Ga0373928_0003638 3300035084 Bacteria 2939
566 Ga0373929_0022314 3300035085 Bacteria 1291
567 Ga0373934_0000014 3300035086 Bacteria 59312
568 Ga0373934_0016558 3300035086 Bacteria 2802
569 Ga0373934_0020829 3300035086 Bacteria 2523
570 Ga0373934_0034213 3300035086 Bacteria 1996
571 Ga0373934_0106900 3300035086 Bacteria 1133
572 Ga0373940_0036537 3300035088 Bacteria 1334
573 Ga0373944_0016313 3300035089 Bacteria 2093
574 Ga0373944_0070879 3300035089 Bacteria 1135
575 Ga0373944_0298320 3300035089 Bacteria 604
576 Ga0373952_0256161 3300035092 Bacteria 531
577 Ga0373923_0057809 3300035111 Bacteria 1641
578 Ga0373923_0259795 3300035111 Bacteria 814
579 Ga0373923_0445157 3300035111 Bacteria 627
580 Ga0373923_0495191 3300035111 Bacteria 596
581 Ga0373936_0022933 3300035113 Bacteria 2430
582 Ga0373936_0274725 3300035113 Bacteria 756
583 Ga0373939_0003426 3300035114 Bacteria 3718
584 Ga0373941_0125737 3300035115 Bacteria 918
585 Ga0373945_0126792 3300035116 Bacteria 1019
586 Ga0373945_0274903 3300035116 Bacteria 716
587 Ga0373945_0521918 3300035116 Bacteria 531
588 Ga0373953_0000096 3300035117 Bacteria 21135
589 Ga0373953_0019062 3300035117 Bacteria 2547
590 Ga0373953_0362767 3300035117 Bacteria 635
591 Ga0373954_0000675 3300035118 Bacteria 13087
592 Ga0373954_0005492 3300035118 Bacteria 5485
593 Ga0373954_0187365 3300035118 Bacteria 1015
594 Ga0373954_0219848 3300035118 Bacteria 934
595 Ga0373954_0232432 3300035118 Bacteria 907
596 Ga0373954_0308421 3300035118 Bacteria 781
597 Ga0373956_0000506 3300035119 Bacteria 15926
598 Ga0373956_0006083 3300035119 Bacteria 4830
599 Ga0373956_0043829 3300035119 Bacteria 1992
600 Ga0373956_0055911 3300035119 Bacteria 1780
601 Ga0373957_0001124 3300035120 Bacteria 7096
602 Ga0373957_0007197 3300035120 Bacteria 3550
603 Ga0373957_0020704 3300035120 Bacteria 2327
604 Ga0373957_0243880 3300035120 Bacteria 755
605 Ga0373960_0039434 3300035121 Bacteria 1358
606 Ga0373943_0055049 3300035170 Bacteria 1969
607 Ga0373943_0081542 3300035170 Bacteria 1659
608 Ga0373943_0124009 3300035170 Bacteria 1375
609 Ga0373943_0249445 3300035170 Bacteria 996
610 Ga0373943_0853659 3300035170 Bacteria 543
611 Ga0373946_0020106 3300035171 Bacteria 2578
612 Ga0373946_0155007 3300035171 Bacteria 1071
613 Ga0373946_0276136 3300035171 Bacteria 825
614 Ga0373955_0000040 3300035172 Bacteria 51762
615 Ga0373955_0005314 3300035172 Bacteria 5782
616 Ga0373955_0025872 3300035172 Bacteria 3018
617 Ga0373955_0030416 3300035172 Bacteria 2819
618 Ga0373942_0167403 3300035207 Bacteria 714
619 Ga0316574_0001226 3300035398 Bacteria 11928
620 Ga0316574_0088763 3300035398 Bacteria 1969
621 Ga0373924_0003168 3300035410 Bacteria 5624
622 Ga0373924_0038561 3300035410 Bacteria 1949
623 Ga0373924_0068770 3300035410 Bacteria 1491
624 Ga0373924_0089218 3300035410 Bacteria 1318
625 Ga0373924_0089376 3300035410 Bacteria 1316
626 Ga0373931_0147028 3300035691 Bacteria 1371
627 Ga0373931_0196553 3300035691 Bacteria 1202
628 Ga0373931_0331832 3300035691 Bacteria 947
629 Ga0373931_0520111 3300035691 Bacteria 770
630 Ga0373931_0658952 3300035691 Bacteria 688
631 Ga0373935_0005512 3300035692 Bacteria 7454
632 Ga0373935_0231254 3300035692 Bacteria 1287
633 Ga0373935_0400568 3300035692 Bacteria 985
634 Ga0373935_1239423 3300035692 Bacteria 556
635 Ga0373935_1472241 3300035692 Bacteria 510
636 Ga0373927_0150765 3300035695 Bacteria 1522
637 Ga0373927_0259108 3300035695 Bacteria 1143
638 Ga0373927_1010704 3300035695 Bacteria 548
639 Ga0373933_0000085 3300035724 Bacteria 59115
640 Ga0373933_0043337 3300035724 Bacteria 2662
641 Ga0373933_0047667 3300035724 Bacteria 2549
642 Ga0373933_0063629 3300035724 Bacteria 2230
643 Ga0373933_0106008 3300035724 Bacteria 1748
644 Ga0373947_0000195 3300035725 Bacteria 33609
645 Ga0373947_0302687 3300035725 Bacteria 1066
646 Ga0373947_0458696 3300035725 Bacteria 863
647 Ga0373947_0576344 3300035725 Bacteria 766
648 Ga0373947_0748862 3300035725 Bacteria 667
649 Ga0373937_0000197 3300036401 Bacteria 59124
650 Ga0373937_0000859 3300036401 Bacteria 26083
651 Ga0373937_0024567 3300036401 Bacteria 5437
652 Ga0373937_0041264 3300036401 Bacteria 4209
653 Ga0373937_0171223 3300036401 Bacteria 2037
654 Ga0373937_0483943 3300036401 Bacteria 1175
655 Ga0265778_017865 3300036457 Bacteria 859
656 Ga0372808_018957 3300036459 Bacteria 989
657 Ga0372808_071145 3300036459 Bacteria 503
658 Ga0310109_017307 3300036534 Bacteria 974
659 Ga0310110_037020 3300036535 Bacteria 615
660 Ga0316582_0173590 3300036647 Bacteria 1464
661 Ga0316582_0493729 3300036647 Bacteria 844
662 Ga0316584_0066676 3300036712 Bacteria 2697
663 Ga0373925_0034101 3300037068 Bacteria 3751
664 Ga0373925_0293585 3300037068 Bacteria 1311
665 Ga0373925_0429135 3300037068 Bacteria 1080
666 Ga0373925_0941052 3300037068 Bacteria 712
667 Ga0373925_1304912 3300037068 Bacteria 595
668 Ga0436364_0188941 3300037853 Bacteria 4808
669 Ga0436364_0303129 3300037853 Bacteria 102080
670 Ga0436364_0473877 3300037853 Bacteria 2145
671 Ga0436364_0875353 3300037853 Bacteria 55373
672 Ga0436364_0876629 3300037853 Bacteria 1196
673 Ga0395901_0334151 3300038443 Unclassified 1566
674 Ga0242420_065571 3300038996 Bacteria 731
675 Ga0436361_0599980 3300039447 Bacteria 1044
676 Ga0436363_0225853 3300039450 Bacteria 733
677 Ga0436363_0338172 3300039450 Bacteria 1831
678 Ga0436363_1250789 3300039450 Bacteria 1357
679 Ga0436363_1357246 3300039450 Bacteria 564
680 Ga0436362_0056231 3300039453 Bacteria 1216
681 Ga0436362_0844715 3300039453 Bacteria 1139
682 Ga0451804_0730933 3300041463 Unclassified 910
683 Ga0451807_1366442 3300041486 Bacteria 559
684 Ga0451855_0597846 3300041511 Unclassified 524
685 Ga0466966_0116711 3300044684 Bacteria 1643
686 Ga0466966_0309983 3300044684 Bacteria 949
687 Ga0466964_0235673 3300044706 Bacteria 895
688 Ga0466964_0383725 3300044706 Bacteria 730
689 Ga0451576_0000327 3300045051 Bacteria 115197
690 Ga0466967_0409578 3300045976 Bacteria 1320
691 Ga0495592_0000157 3300046454 Bacteria 59697
692 Ga0495592_0007117 3300046454 Bacteria 8373
693 Ga0495592_0088375 3300046454 Bacteria 2227
694 Ga0495592_0439403 3300046454 Bacteria 819
695 Ga0495603_0093688 3300046455 Bacteria 1755
696 Ga0495603_0473144 3300046455 Bacteria 717
697 Ga0495629_0017621 3300046459 Bacteria 5120
698 Ga0495629_0422482 3300046459 Bacteria 904
699 Ga0495641_0010809 3300046461 Bacteria 5250
700 Ga0495641_0024093 3300046461 Bacteria 3009
701 Ga0495641_0031029 3300046461 Bacteria 2557
702 Ga0495641_0236431 3300046461 Bacteria 820
703 Ga0495651_0000115 3300046462 Bacteria 59129
704 Ga0495651_0008585 3300046462 Bacteria 7831
705 Ga0495651_0015867 3300046462 Bacteria 5832
706 Ga0495651_0081108 3300046462 Bacteria 2449
707 Ga0495653_0001269 3300046463 Bacteria 19535
708 Ga0495653_0015090 3300046463 Bacteria 6296
709 Ga0495653_0038301 3300046463 Bacteria 3763
710 Ga0495653_0049617 3300046463 Bacteria 3232
711 Ga0495653_0106127 3300046463 Bacteria 2026
712 Ga0495653_0177048 3300046463 Unclassified 1467
713 Ga0495653_0238969 3300046463 Bacteria 1212
714 Ga0495580_0017290 3300046472 Bacteria 5397
715 Ga0495580_0059974 3300046472 Bacteria 2673
716 Ga0495580_0343509 3300046472 Bacteria 1012
717 Ga0495582_0018891 3300046473 Bacteria 3770
718 Ga0495582_0725455 3300046473 Bacteria 575
719 Ga0495639_0104780 3300046475 Bacteria 1338
720 Ga0495639_0365787 3300046475 Bacteria 725
721 Ga0495639_0516709 3300046475 Bacteria 610
722 Ga0495662_0110634 3300046476 Bacteria 1346
723 Ga0495662_0143651 3300046476 Bacteria 1175
724 Ga0495664_0096499 3300046477 Bacteria 1779
725 Ga0495664_0724907 3300046477 Bacteria 587
726 Ga0495594_0098468 3300046499 Bacteria 1644
727 Ga0495594_0396881 3300046499 Bacteria 785
728 Ga0495608_0000157 3300046511 Bacteria 48714
729 Ga0495608_0005803 3300046511 Bacteria 8797
730 Ga0495608_0016774 3300046511 Bacteria 5068
731 Ga0495608_0181300 3300046511 Unclassified 1332
732 Ga0495618_0019815 3300046514 Bacteria 4141
733 Ga0495618_0061436 3300046514 Bacteria 2383
734 Ga0495618_0077977 3300046514 Bacteria 2111
735 Ga0495628_0000492 3300046516 Bacteria 36145
736 Ga0495628_0037350 3300046516 Bacteria 3894
737 Ga0495628_0170409 3300046516 Bacteria 1651
738 Ga0495630_0000704 3300046517 Bacteria 23798
739 Ga0495630_0031948 3300046517 Bacteria 3920
740 Ga0495630_0096381 3300046517 Bacteria 2236
741 Ga0495630_0521367 3300046517 Bacteria 911
742 Ga0495666_0080589 3300046526 Bacteria 1540
743 Ga0495666_0201777 3300046526 Bacteria 914
744 Ga0495652_0001666 3300046529 Bacteria 24105
745 Ga0495652_0014911 3300046529 Bacteria 6966
746 Ga0495652_0195190 3300046529 Bacteria 1541
747 Ga0495652_0199504 3300046529 Bacteria 1519
748 Ga0495652_0492977 3300046529 Unclassified 851
749 Ga0495665_0046857 3300046531 Bacteria 2294
750 Ga0495665_0256081 3300046531 Bacteria 900
751 Ga0495640_0018497 3300046533 Bacteria 5164
752 Ga0495640_0067864 3300046533 Bacteria 2401
753 Ga0495640_0092821 3300046533 Bacteria 1990
754 Ga0495640_0457639 3300046533 Bacteria 779
755 Ga0495586_0086587 3300046535 Bacteria 1727
756 Ga0495586_0132069 3300046535 Bacteria 1398
757 Ga0495586_0491999 3300046535 Unclassified 708
758 Ga0495587_0000123 3300046536 Bacteria 59101
759 Ga0495587_0024822 3300046536 Bacteria 3670
760 Ga0495587_0042122 3300046536 Bacteria 2723
761 Ga0495598_0268427 3300046537 Bacteria 637
762 Ga0495645_0179720 3300046543 Bacteria 1450
763 Ga0495645_0187274 3300046543 Bacteria 1413
764 Ga0495645_0188426 3300046543 Bacteria 1408
765 Ga0495667_0000107 3300046559 Bacteria 60366
766 Ga0495667_0023793 3300046559 Bacteria 4125
767 Ga0495667_0035901 3300046559 Bacteria 3311
768 Ga0495667_0110091 3300046559 Bacteria 1779
769 Ga0495667_0710730 3300046559 Bacteria 622
770 Ga0495656_0630561 3300046615 Bacteria 575
771 Ga0495634_0021291 3300046642 Bacteria 4585
772 Ga0495634_0079421 3300046642 Bacteria 2148
773 Ga0495634_0659152 3300046642 Unclassified 604
774 Ga0495635_0035305 3300046663 Bacteria 3466
775 Ga0495635_0097311 3300046663 Bacteria 2011
776 Ga0495635_0122397 3300046663 Bacteria 1774
777 Ga0495635_0211128 3300046663 Bacteria 1314
778 Ga0495635_0599619 3300046663 Bacteria 719
779 Ga0495657_0000169 3300046675 Bacteria 59112
780 Ga0495657_0011153 3300046675 Bacteria 6731
781 Ga0495657_0063435 3300046675 Bacteria 2437
782 Ga0495657_0618321 3300046675 Unclassified 626
783 Ga0495599_0000129 3300046678 Bacteria 48682
784 Ga0495599_0007746 3300046678 Bacteria 6519
785 Ga0495599_0141122 3300046678 Bacteria 1494
786 Ga0495599_0160450 3300046678 Bacteria 1390
787 Ga0495599_0236898 3300046678 Bacteria 1113
788 Ga0495599_0366391 3300046678 Bacteria 862
789 Ga0495623_0000166 3300046679 Bacteria 41152
790 Ga0495623_0018966 3300046679 Bacteria 4441
791 Ga0495623_0025353 3300046679 Bacteria 3819
792 Ga0495623_0027458 3300046679 Bacteria 3662
793 Ga0495623_0163146 3300046679 Bacteria 1308
794 Ga0495646_0048031 3300046680 Bacteria 2595
795 Ga0495646_0338701 3300046680 Bacteria 789
796 Ga0495647_0035681 3300046681 Bacteria 1868
797 Ga0495658_0050594 3300046683 Bacteria 2351
798 Ga0495658_0066913 3300046683 Bacteria 2077
799 Ga0495613_0115698 3300046689 Bacteria 1929
800 Ga0495613_0169418 3300046689 Bacteria 1550
801 Ga0495613_0197320 3300046689 Unclassified 1420
802 Ga0495624_0026458 3300046690 Bacteria 3802
803 Ga0495624_0048030 3300046690 Bacteria 2710
804 Ga0495624_0124948 3300046690 Bacteria 1579
805 Ga0495624_0400897 3300046690 Bacteria 823
806 Ga0495600_0005205 3300046809 Bacteria 7820
807 Ga0495600_0029746 3300046809 Bacteria 3537
808 Ga0495600_0038660 3300046809 Bacteria 3105
809 Ga0495600_0141580 3300046809 Bacteria 1560
810 Ga0495600_0282301 3300046809 Bacteria 1051
811 Ga0495600_0307826 3300046809 Bacteria 998
812 Ga0495581_0092546 3300047315 Bacteria 1755
813 Ga0495581_0149945 3300047315 Bacteria 1361
814 Ga0495581_0205475 3300047315 Bacteria 1152
815 Ga0495581_0650711 3300047315 Bacteria 609
816 Ga0495604_0000161 3300047317 Bacteria 59093
817 Ga0495604_0021329 3300047317 Bacteria 5171
818 Ga0495604_0022314 3300047317 Bacteria 5053
819 Ga0495674_0031694 3300047319 Bacteria 4799
820 Ga0495674_0070796 3300047319 Bacteria 3013
821 Ga0495674_0106094 3300047319 Bacteria 2386
822 Ga0495674_0117037 3300047319 Bacteria 2254
823 Ga0495674_0148391 3300047319 Bacteria 1967
824 Ga0495674_0687951 3300047319 Bacteria 803
825 Ga0495676_0159945 3300047321 Bacteria 1594
826 Ga0495680_0000395 3300047322 Bacteria 48768
827 Ga0495680_0027978 3300047322 Bacteria 4626
828 Ga0495680_0061015 3300047322 Bacteria 2902
829 Ga0495680_0075647 3300047322 Bacteria 2554
830 Ga0495680_0544004 3300047322 Bacteria 783
831 Ga0495675_0000277 3300047444 Bacteria 37154
832 Ga0495675_0001985 3300047444 Bacteria 12218
833 Ga0495675_0011289 3300047444 Bacteria 5605
834 Ga0495675_0058257 3300047444 Bacteria 2449
835 Ga0495675_0216178 3300047444 Bacteria 1162
836 Ga0495675_0235840 3300047444 Bacteria 1103
837 Ga0495684_0006066 3300047471 Bacteria 9394
838 Ga0495684_0064659 3300047471 Bacteria 2780
839 Ga0495684_0116686 3300047471 Bacteria 2012
840 Ga0495684_0120509 3300047471 Bacteria 1976
841 Ga0495684_0120709 3300047471 Bacteria 1974
842 Ga0495684_0157550 3300047471 Bacteria 1695
843 Ga0495684_0303013 3300047471 Bacteria 1147
844 Ga0495684_0544419 3300047471 Bacteria 791
845 Ga0495593_0012129 3300047673 Bacteria 4931
846 Ga0495602_0000182 3300048088 Bacteria 59124
847 Ga0495602_0006022 3300048088 Bacteria 12734
848 Ga0495602_0015749 3300048088 Bacteria 7617
849 Ga0495602_0025045 3300048088 Bacteria 5781
850 Ga0495614_0206996 3300048089 Bacteria 889
851 Ga0495614_0221704 3300048089 Bacteria 860
852 Ga0495614_0246333 3300048089 Bacteria 816
853 Ga0495614_0363093 3300048089 Bacteria 676
854 Ga0496100_0108694 3300048903 Bacteria 1923
855 Ga0496100_0161420 3300048903 Bacteria 1607
856 Ga0496101_0034687 3300048904 Bacteria 3566
857 Ga0496101_1537138 3300048904 Bacteria 518
858 Ga0496102_0766486 3300048905 Bacteria 887
859 Ga0496102_0956472 3300048905 Bacteria 777
860 Ga0496104_0020438 3300048907 Bacteria 6069
861 Ga0496104_0033085 3300048907 Bacteria 4813
862 Ga0496104_0075679 3300048907 Bacteria 3205
863 Ga0496104_0105643 3300048907 Bacteria 2698
864 Ga0496104_0429188 3300048907 Bacteria 1233
865 Ga0496105_0002275 3300048908 Bacteria 13934
866 Ga0496105_0081192 3300048908 Bacteria 2678
867 Ga0496105_0094368 3300048908 Bacteria 2471
868 Ga0496106_0298536 3300048909 Bacteria 1291
869 Ga0496106_0333548 3300048909 Bacteria 1218
870 Ga0496107_0087579 3300048910 Bacteria 2273
871 Ga0496108_0002330 3300048911 Bacteria 15212
872 Ga0496108_0041572 3300048911 Bacteria 3838
873 Ga0496108_0054006 3300048911 Bacteria 3371
874 Ga0496108_0714370 3300048911 Bacteria 868
875 Ga0496109_0053471 3300048912 Bacteria 3683
876 Ga0496109_0749167 3300048912 Bacteria 914
877 Ga0496109_1025623 3300048912 Bacteria 762
878 Ga0496110_0007267 3300048913 Bacteria 8829
879 Ga0496110_0042417 3300048913 Bacteria 3971
880 Ga0496110_0066558 3300048913 Bacteria 3186
881 Ga0496110_0699424 3300048913 Bacteria 915
882 Ga0496110_1755996 3300048913 Bacteria 530
883 Ga0496111_0032735 3300048914 Bacteria 3707
884 Ga0496111_1310780 3300048914 Bacteria 510
885 Ga0496112_0105729 3300048915 Bacteria 2784
886 Ga0496112_0161178 3300048915 Bacteria 2210
887 Ga0496112_0191433 3300048915 Bacteria 2007
888 Ga0496113_0141140 3300048916 Bacteria 1895
889 Ga0496114_0559399 3300048917 Bacteria 1010
890 Ga0496115_0009458 3300048918 Bacteria 7239
891 Ga0496115_0011285 3300048918 Bacteria 6695
892 Ga0496115_0193421 3300048918 Bacteria 1681
893 Ga0501309_086441 3300049129 Bacteria 531
894 Ga0501310_052071 3300049130 Unclassified 594
895 Ga0501298_023255 3300049521 Bacteria 1173
896 Ga0501034_0128692 3300049571 Bacteria 2516
897 Ga0501036_1693264 3300049572 Bacteria 510
898 Ga0501042_0123474 3300049578 Bacteria 1864
899 Ga0501047_0414081 3300049581 Bacteria 1180
900 Ga0501070_0133729 3300049586 Bacteria 2048
901 Ga0501071_0516673 3300049587 Bacteria 916
902 Ga0501080_0403465 3300049742 Bacteria 1230
903 nmdc:mga0k408_111314_c1 3300050493 Bacteria 1618
904 nmdc:mga0k408_629615_c1 3300050493 Bacteria 632
905 nmdc:mga05p37_2306_c1 3300050507 Bacteria 22258
906 nmdc:mga0qj67_15845_c1 3300050509 Bacteria 5708
907 nmdc:mga0qj67_214985_c1 3300050509 Bacteria 1561
908 nmdc:mga06r32_23029_c1 3300050510 Bacteria 5761
909 nmdc:mga06r32_258386_c1 3300050510 Bacteria 1729
910 nmdc:mga08y16_603568_c1 3300050511 Bacteria 1106
911 nmdc:mga08y16_71882_c1 3300050511 Bacteria 3605
912 nmdc:mga0n895_1644616_c1 3300050512 Bacteria 606
913 nmdc:mga0n895_1676745_c1 3300050512 Bacteria 599
914 nmdc:mga0n895_232641_c1 3300050512 Bacteria 1870
915 nmdc:mga0n895_8584_c1 3300050512 Bacteria 8861
916 nmdc:mga0n895_884259_c1 3300050512 Bacteria 880
917 nmdc:mga0rr50_243298_c1 3300050513 Bacteria 1492
918 nmdc:mga0rr50_262907_c1 3300050513 Bacteria 1436
919 nmdc:mga0rr50_431198_c1 3300050513 Bacteria 1116
920 nmdc:mga0rr50_553386_c1 3300050513 Bacteria 980
921 nmdc:mga0rr50_592672_c1 3300050513 Bacteria 945
922 nmdc:mga08x19_134993_c1 3300050514 Bacteria 1663
923 nmdc:mga08x19_177911_c1 3300050514 Bacteria 1451
924 nmdc:mga08x19_305082_c1 3300050514 Bacteria 1106
925 nmdc:mga0a205_115359_c1 3300050515 Bacteria 2585
926 Ga0495601_0009245 3300053077 Bacteria 5826
927 Ga0495601_0061262 3300053077 Bacteria 2388
928 Ga0495612_0015816 3300053078 Bacteria 3024
929 Ga0495612_0059076 3300053078 Bacteria 1585
930 Ga0495595_0067128 3300053084 Bacteria 1690
931 Ga0495619_0302206 3300053085 Bacteria 1108
932 Ga0495619_0318545 3300053085 Bacteria 1076
933 Ga0495619_0723796 3300053085 Bacteria 676
934 Ga0587066_044076 3300059490 Bacteria 852
935 Ga0587066_132894 3300059490 Bacteria 600
936 Ga0587073_0080425 3300059492 Bacteria 808
937 Ga0587073_0083348 3300059492 Bacteria 798
938 Ga0587073_0253626 3300059492 Bacteria 553
939 Ga0587077_197900 3300059493 Bacteria 554
940 Ga0587080_036176 3300059503 Bacteria 882
941 Ga0587080_173305 3300059503 Bacteria 513
942 Ga0587083_0048247 3300059505 Bacteria 919
943 Ga0587083_0067486 3300059505 Bacteria 822
944 Ga0587085_023820 3300059506 Bacteria 955
945 Ga0587085_066241 3300059506 Unclassified 695
946 Ga0587085_127718 3300059506 Bacteria 565
947 Ga0587088_051657 3300059508 Bacteria 807
948 Ga0587089_077022 3300059509 Bacteria 575
949 Ga0587091_028934 3300059511 Bacteria 1026
950 Ga0587092_119908 3300059512 Bacteria 561
951 Ga0587094_053819 3300059513 Bacteria 688
952 Ga0587098_030580 3300059604 Bacteria 739
953 Ga0587106_029350 3300059605 Bacteria 873
954 Ga0587106_057517 3300059605 Bacteria 706
955 Ga0587129_028600 3300059608 Bacteria 527
956 Ga0587099_024271 3300059622 Bacteria 704
957 Ga0587115_024370 3300059626 Bacteria 863
958 Ga0587115_025511 3300059626 Bacteria 850
959 Ga0587062_106805 3300059639 Bacteria 551
960 Ga0587069_093977 3300059642 Bacteria 603
961 Ga0587072_088687 3300059643 Bacteria 679
962 Ga0587075_035518 3300059644 Bacteria 813
963 Ga0587075_038477 3300059644 Bacteria 792
964 Ga0587075_047949 3300059644 Bacteria 737
965 Ga0587078_053510 3300059646 Bacteria 597
966 Ga0587079_151950 3300059647 Bacteria 599
967 Ga0587107_022589 3300059652 Bacteria 891
968 Ga0587107_031979 3300059652 Bacteria 806
969 Ga0587107_037604 3300059652 Bacteria 767
970 Ga0587107_065587 3300059652 Bacteria 651
971 Ga0587114_070961 3300059655 Bacteria 631
972 Ga0587116_08021 3300059656 Bacteria 678
973 Ga0587071_109506 3300060344 Bacteria 648
974 Ga0587111_0188745 3300060346 Unclassified 577
975 2990050122 2990044586 Bacteria 6603797
976 8056065457 8056060235 Bacteria 7259403
977 Ga0070708_101538938
978 Ga0058862_10044764
979 Ga0065707_10082794
980 Ga0070658_10816914
981 Ga0070658_11003980
982 Ga0070676_11262207
983 Ga0070683_100573657
984 Ga0070670_101632167
985 Ga0070677_10352690
986 Ga0068869_100167989
987 Ga0068869_101579171
988 Ga0070666_10175764
989 Ga0070666_10222099
990 Ga0070680_100218942
991 Ga0070680_101237863
992 Ga0070682_100071490
993 Ga0070682_100325543
994 Ga0070682_101582171
995 Ga0068868_102002229
996 Ga0068868_102018053
997 Ga0070660_100707123
998 Ga0070660_100968934
999 Ga0070660_101747887
1000 Ga0070689_101884571
1001 Ga0070691_10041703
1002 Ga0070661_100024970
1003 Ga0070669_100047826
1004 Ga0070669_100130671
1005 Ga0070675_100766646
1006 Ga0070675_100872775
1007 Ga0070671_100015641
1008 Ga0070671_101464859
1009 Ga0070674_100019188
1010 Ga0070674_100242849
1011 Ga0070673_101417359
1012 Ga0070673_101512272
1013 Ga0070709_10014574
1014 Ga0070709_10043900
1015 Ga0070709_10044658
1016 Ga0070709_10119093
1017 Ga0070709_10140570
1018 Ga0070709_10328443
1019 Ga0070709_11047221
1020 Ga0070714_100000829
1021 Ga0070714_100008120
1022 Ga0070714_100022560
1023 Ga0070714_100041831
1024 Ga0070714_100094835
1025 Ga0070714_100109886
1026 Ga0070714_100156220
1027 Ga0070714_100312851
1028 Ga0070714_100322243
1029 Ga0070714_100551550
1030 Ga0070714_102442977
1031 Ga0070713_100000301
1032 Ga0070713_100004793
1033 Ga0070713_100102293
1034 Ga0070713_100154458
1035 Ga0070713_100214204
1036 Ga0070713_100340933
1037 Ga0070710_10000358
1038 Ga0070710_10002036
1039 Ga0070710_10009948
1040 Ga0070710_10040181
1041 Ga0070710_10066864
1042 Ga0070710_10152031
1043 Ga0070710_10309561
1044 Ga0070711_100000638
1045 Ga0070711_100032942
1046 Ga0070711_100119441
1047 Ga0070711_100229918
1048 Ga0070711_100238893
1049 Ga0070711_100675774
1050 Ga0070700_100045043
1051 Ga0070694_101694240
1052 Ga0070708_100001321
1053 Ga0070708_100061763
1054 Ga0070708_100074283
1055 Ga0070708_100377224
1056 Ga0070663_101511412
1057 Ga0070678_100105427
1058 Ga0070678_100905430
1059 Ga0070678_101276596
1060 Ga0070662_100775264
1061 Ga0070681_10833047
1062 Ga0068867_100017306
1063 Ga0068867_100612074
1064 Ga0070706_100002905
1065 Ga0070706_100005180
1066 Ga0070706_100008719
1067 Ga0070706_100012401
1068 Ga0070706_100036657
1069 Ga0070706_100060797
1070 Ga0070706_100063225
1071 Ga0070706_100099112
1072 Ga0070706_100733835
1073 Ga0070706_100766845
1074 Ga0070707_100000300
1075 Ga0070707_100011644
1076 Ga0070707_100108861
1077 Ga0070707_100131178
1078 Ga0070707_100133287
1079 Ga0070707_100234827
1080 Ga0070707_100260045
1081 Ga0070707_100272657
1082 Ga0070698_100000801
1083 Ga0070698_100002410
1084 Ga0070698_100003145
1085 Ga0070698_100003899
1086 Ga0070698_100006066
1087 Ga0070698_100065689
1088 Ga0070698_100168910
1089 Ga0070698_100246640
1090 Ga0070699_100068826
1091 Ga0070699_100070353
1092 Ga0070699_100073117
1093 Ga0070699_101072992
1094 Ga0070684_100115637
1095 Ga0070684_100139985
1096 Ga0070684_100928377
1097 Ga0070684_101058809
1098 Ga0070684_101367365
1099 Ga0070697_100030550
1100 Ga0068853_100197912
1101 Ga0068853_100586708
1102 Ga0068853_100754483
1103 Ga0068853_100895824
1104 Ga0070672_100008328
1105 Ga0070672_100011156
1106 Ga0070672_101857696
1107 Ga0070672_101990517
1108 Ga0070695_100533938
1109 Ga0070695_101067195
1110 Ga0070665_100272775
1111 Ga0070665_100567533
1112 Ga0070704_100317062
1113 Ga0068855_100043684
1114 Ga0068855_100130053
1115 Ga0068855_100146481
1116 Ga0068855_101284481
1117 Ga0070664_100728856
1118 Ga0068857_100018116
1119 Ga0068857_101478477
1120 Ga0068854_100887552
1121 Ga0068854_101569058
1122 Ga0068856_100039299
1123 Ga0068856_100044982
1124 Ga0068856_100076573
1125 Ga0068856_100087951
1126 Ga0068856_100406560
1127 Ga0070702_100101619
1128 Ga0068852_100457482
1129 Ga0068859_100046132
1130 Ga0068859_100665154
1131 Ga0068864_100109354
1132 Ga0068861_100001796
1133 Ga0068870_10390384
1134 Ga0068863_100259524
1135 Ga0068863_100654906
1136 Ga0068863_101019016
1137 Ga0068863_102681780
1138 Ga0068858_100077420
1139 Ga0068858_100147677
1140 Ga0068858_100352439
1141 Ga0068860_100002243
1142 Ga0068860_100375087
1143 Ga0068860_100916391
1144 Ga0068862_100333384
1145 Ga0081540_1000482
1146 Ga0081540_1164053
1147 Ga0070717_10000712
1148 Ga0070717_10035300
1149 Ga0070717_10151902
1150 Ga0070717_10160951
1151 Ga0070717_10291279
1152 Ga0070717_10292906
1153 Ga0070717_11443884
1154 Ga0075368_10310233
1155 Ga0070715_10008968
1156 Ga0070715_10011170
1157 Ga0070715_10314116
1158 Ga0070716_100000107
1159 Ga0070716_100000726
1160 Ga0070716_100039242
1161 Ga0070716_100059402
1162 Ga0070716_100224324
1163 Ga0070712_100003795
1164 Ga0070712_100025122
1165 Ga0070712_100154621
1166 Ga0070712_100259365
1167 Ga0070712_100485612
1168 Ga0075366_10220538
1169 Ga0097621_100222160
1170 Ga0097621_101528437
1171 Ga0068871_100023726
1172 Ga0075428_100117619
1173 Ga0075430_100020756
1174 Ga0075430_100138881
1175 Ga0075431_100008971
1176 Ga0075431_100251713
1177 Ga0075433_10043109
1178 Ga0075433_10154477
1179 Ga0075434_100045414
1180 Ga0075434_100377057
1181 Ga0075434_100402859
1182 Ga0075429_100930344
1183 Ga0068865_101706899
1184 Ga0075436_100040389
1185 Ga0075436_100176893
1186 Ga0075436_100373834
1187 Ga0075436_101208821
1188 Ga0097620_100046133
1189 Ga0097620_100665164
1190 Ga0075435_100002665
1191 Ga0075435_100079499
1192 Ga0075435_100172519
1193 Ga0075435_100533617
1194 Ga0075435_101006873
1195 Ga0075435_101725249
1196 Ga0099794_10318934
1197 Ga0105251_10276746
1198 Ga0105240_10118770
1199 Ga0105240_10126052
1200 Ga0111539_10053594
1201 Ga0105245_10006829
1202 Ga0105245_10279901
1203 Ga0105245_10375812
1204 Ga0105245_10726450
1205 Ga0105245_11669205
1206 Ga0105247_10306649
1207 Ga0114129_10329283
1208 Ga0114129_11179624
1209 Ga0105243_10031845
1210 Ga0105243_12754884
1211 Ga0105241_10044971
1212 Ga0105241_10062828
1213 Ga0105241_10683035
1214 Ga0105242_11733041
1215 Ga0105242_12678903
1216 Ga0105248_10144050
1217 Ga0105248_11679244
1218 Ga0105237_10256997
1219 Ga0105237_10303473
1220 Ga0105237_10465298
1221 Ga0105238_10149071
1222 Ga0105238_10188444
1223 Ga0105238_10255840
1224 Ga0105238_11149481
1225 Ga0105238_11737993
1226 Ga0105249_10027380
1227 Ga0105249_10517123
1228 Ga0099796_10583841
1229 Ga0105239_10009903
1230 Ga0105239_10938466
1231 Ga0105239_11272529
1232 Ga0105239_12312238
1233 Ga0105246_11119556
1234 Ga0157339_1038572
1235 Ga0157373_10210104
1236 Ga0157373_10559714
1237 Ga0157373_11111006
1238 Ga0157371_10445910
1239 Ga0157370_10724834
1240 Ga0157370_10919537
1241 Ga0157370_11260681
1242 Ga0157369_10368567
1243 Ga0157369_10747506
1244 Ga0157369_10923845
1245 Ga0157369_11189347
1246 Ga0157369_11699652
1247 Ga0157369_11748164
1248 Ga0157369_12132859
1249 Ga0157374_10015922
1250 Ga0157374_10740224
1251 Ga0157374_11142280
1252 Ga0157378_10013493
1253 Ga0157378_12057045
1254 Ga0163162_10001801
1255 Ga0163162_10193082
1256 Ga0157372_10183950
1257 Ga0157372_10227439
1258 Ga0157372_10500139
1259 Ga0157372_10609285
1260 Ga0157372_10990971
1261 Ga0157372_11182477
1262 Ga0157372_12137848
1263 Ga0157375_10098016
1264 Ga0157375_10862547
1265 Ga0157375_11548696
1266 Ga0157375_12187185
1267 Ga0157375_12655929
1268 Ga0163163_10759779
1269 Ga0182008_10328897
1270 Ga0157377_10202523
1271 Ga0157377_10667796
1272 Ga0157379_10006818
1273 Ga0157379_10050003
1274 Ga0157379_10068693
1275 Ga0157379_11395184
1276 Ga0157379_11965082
1277 Ga0157376_10006886
1278 Ga0157376_10072188
1279 Ga0163161_10129362
1280 Ga0163161_10192477
1281 Ga0163161_11684242
1282 Ga0184595_106319
1283 Ga0184592_103689
1284 Ga0184594_129231
1285 Ga0184601_133098
1286 Ga0184599_152346
1287 Ga0184600_139479
1288 Ga0184603_145986
1289 Ga0197907_10081145
1290 Ga0197907_11507248
1291 Ga0206356_10616066
1292 Ga0206356_11087391
1293 Ga0206356_11838597
1294 Ga0206355_1000641
1295 Ga0206352_10444515
1296 Ga0206352_10598243
1297 Ga0206352_10725269
1298 Ga0206350_11041294
1299 Ga0206354_11188401
1300 Ga0206354_11474612
1301 Ga0206354_11668375
1302 Ga0206353_10824445
1303 Ga0206353_11633815
1304 Ga0213875_10000176
1305 Ga0213875_10000584
1306 Ga0213875_10083953
1307 Ga0213875_10277652
1308 Ga0224712_10071645
1309 Ga0224712_10081329
1310 Ga0224712_10109490
1311 Ga0247554_103440
1312 Ga0247551_105014
1313 Ga0247515_119401
1314 Ga0247553_103863
1315 Ga0247522_117983
1316 Ga0228600_1005907
1317 Ga0224572_1002833
1318 Ga0228598_1018543
1319 Ga0207682_10045239
1320 Ga0207682_10236597
1321 Ga0207692_10000057
1322 Ga0207692_10001524
1323 Ga0207692_10022131
1324 Ga0207692_10057414
1325 Ga0207692_10100855
1326 Ga0207692_10107778
1327 Ga0207692_10264469
1328 Ga0207692_10267296
1329 Ga0207710_10289262
1330 Ga0207680_11296333
1331 Ga0207685_10003821
1332 Ga0207685_10040562
1333 Ga0207685_10058632
1334 Ga0207699_10000162
1335 Ga0207699_10002215
1336 Ga0207699_10011202
1337 Ga0207699_10012683
1338 Ga0207699_10030697
1339 Ga0207699_10045722
1340 Ga0207699_10048477
1341 Ga0207645_10524749
1342 Ga0207643_10965583
1343 Ga0207705_10567099
1344 Ga0207684_10000918
1345 Ga0207684_10011073
1346 Ga0207684_10018120
1347 Ga0207684_10023539
1348 Ga0207684_10049552
1349 Ga0207684_10060226
1350 Ga0207684_10093327
1351 Ga0207684_10149788
1352 Ga0207684_10188430
1353 Ga0207684_10248326
1354 Ga0207684_10596727
1355 Ga0207654_10233203
1356 Ga0207654_10415210
1357 Ga0207707_10636439
1358 Ga0207707_11170358
1359 Ga0207695_10641696
1360 Ga0207671_10205438
1361 Ga0207693_10001896
1362 Ga0207693_10006360
1363 Ga0207693_10044701
1364 Ga0207693_10191816
1365 Ga0207693_10208732
1366 Ga0207693_10369276
1367 Ga0207693_10979641
1368 Ga0207693_11076240
1369 Ga0207663_10001902
1370 Ga0207663_10017791
1371 Ga0207663_10026595
1372 Ga0207663_10219572
1373 Ga0207663_10275815
1374 Ga0207663_10276295
1375 Ga0207657_10559860
1376 Ga0207649_10023341
1377 Ga0207649_11401799
1378 Ga0207652_10163960
1379 Ga0207646_10000096
1380 Ga0207646_10000913
1381 Ga0207646_10005894
1382 Ga0207646_10022563
1383 Ga0207646_10023414
1384 Ga0207646_10078339
1385 Ga0207646_10079676
1386 Ga0207646_10112559
1387 Ga0207646_10632147
1388 Ga0207646_10720418
1389 Ga0207681_10026813
1390 Ga0207694_10192080
1391 Ga0207694_10287111
1392 Ga0207650_10544859
1393 Ga0207650_11287729
1394 Ga0207650_11452329
1395 Ga0207659_10161282
1396 Ga0207659_10393486
1397 Ga0207687_10045122
1398 Ga0207687_10271728
1399 Ga0207687_10508647
1400 Ga0207700_10000208
1401 Ga0207700_10001506
1402 Ga0207700_10033846
1403 Ga0207700_10049204
1404 Ga0207700_10092484
1405 Ga0207700_10310267
1406 Ga0207700_10431176
1407 Ga0207700_10445808
1408 Ga0207700_10632954
1409 Ga0207700_11330782
1410 Ga0207664_10000108
1411 Ga0207664_10000652
1412 Ga0207664_10006527
1413 Ga0207664_10016881
1414 Ga0207664_10020882
1415 Ga0207664_10069941
1416 Ga0207664_10194742
1417 Ga0207664_10285164
1418 Ga0207664_10410861
1419 Ga0207664_10738700
1420 Ga0207644_10088932
1421 Ga0207644_10497020
1422 Ga0207644_11081192
1423 Ga0207690_11538681
1424 Ga0207706_10830157
1425 Ga0207706_11155557
1426 Ga0207706_11175918
1427 Ga0207669_10061121
1428 Ga0207669_10158714
1429 Ga0207704_10096701
1430 Ga0207665_10000153
1431 Ga0207665_10007829
1432 Ga0207665_10010935
1433 Ga0207665_10308428
1434 Ga0207691_10017320
1435 Ga0207691_10017572
1436 Ga0207691_10742182
1437 Ga0207711_10181774
1438 Ga0207711_10363797
1439 Ga0207711_10735721
1440 Ga0207661_10133553
1441 Ga0207661_10366019
1442 Ga0207661_10445614
1443 Ga0207661_11200490
1444 Ga0207661_11500679
1445 Ga0207679_10354493
1446 Ga0207667_10061601
1447 Ga0207667_10196512
1448 Ga0207667_10422940
1449 Ga0207667_10462714
1450 Ga0207667_11266890
1451 Ga0207651_11400599
1452 Ga0207712_10100595
1453 Ga0207668_10520320
1454 Ga0207640_11087884
1455 Ga0207640_11258837
1456 Ga0207677_10121231
1457 Ga0207703_10191219
1458 Ga0207703_10211941
1459 Ga0207703_11023852
1460 Ga0207639_10309470
1461 Ga0207639_10621887
1462 Ga0207639_10622664
1463 Ga0207639_11656431
1464 Ga0207678_10162970
1465 Ga0207708_10010427
1466 Ga0207702_10013210
1467 Ga0207702_10115369
1468 Ga0207702_10127832
1469 Ga0207702_10251081
1470 Ga0207702_10478064
1471 Ga0207641_10078018
1472 Ga0207641_10316220
1473 Ga0207641_11536802
1474 Ga0207648_10005680
1475 Ga0207648_10555708
1476 Ga0207676_10083480
1477 Ga0207674_10005230
1478 Ga0207674_10214387
1479 Ga0207674_10660886
1480 Ga0207674_11328395
1481 Ga0207675_100083223
1482 Ga0207683_10081319
1483 Ga0207683_10170703
1484 Ga0207683_10956099
1485 Ga0207683_11357671
1486 Ga0207683_11733689
1487 Ga0207698_10366444
1488 Ga0207698_12610938
1489 Ga0209813_10466884
1490 Ga0207428_11100078
1491 Ga0268266_10205974
1492 Ga0268266_10307163
1493 Ga0268266_11771618
1494 Ga0268265_10066323
1495 Ga0268264_10020547
1496 Ga0268264_10455089
1497 Ga0268264_10509985
1498 Ga0268264_11787458
1499 Ga0268264_12378094
1500 Ga0265336_10029909
1501 Ga0265338_10004219
1502 Ga0265762_1029976
1503 Ga0265775_100408
1504 Ga0265767_103009
1505 Ga0265770_1075700
1506 Ga0265770_1156947
1507 Ga0265772_102273
1508 Ga0265779_104757
1509 Ga0265760_10283520
1510 Ga0307408_100230583
1511 Ga0307408_100951638
1512 Ga0310113_120032
1513 Ga0316576_10017752
1514 Ga0316578_10008072
1515 Ga0316577_10011528
1516 Ga0316043_122996
1517 Ga0307410_10155625
1518 Ga0307410_10628448
1519 Ga0307406_12114092
1520 Ga0307407_10380230
1521 Ga0307407_10533906
1522 Ga0307412_10630795
1523 Ga0307409_100071621
1524 Ga0307409_100886127
1525 Ga0307409_101001411
1526 Ga0307416_100904838
1527 Ga0307416_101853021
1528 Ga0307415_101914947
1529 Ga0307415_102196122
1530 Ga0316593_10351470
1531 Ga0316588_1027473
1532 Ga0316214_1058218
1533 Ga0373930_0009592
1534 Ga0373948_0006634
1535 Ga0373950_0026422
1536 Ga0373959_0039662
1537 Ga0373938_0042615
1538 Ga0373926_0076877
1539 Ga0373926_0080036
1540 Ga0373926_0088325
1541 Ga0373928_0003638
1542 Ga0373929_0022314
1543 Ga0373934_0000014
1544 Ga0373934_0016558
1545 Ga0373934_0020829
1546 Ga0373934_0034213
1547 Ga0373934_0106900
1548 Ga0373940_0036537
1549 Ga0373944_0016313
1550 Ga0373944_0070879
1551 Ga0373944_0298320
1552 Ga0373952_0256161
1553 Ga0373923_0057809
1554 Ga0373923_0259795
1555 Ga0373923_0445157
1556 Ga0373923_0495191
1557 Ga0373936_0022933
1558 Ga0373936_0274725
1559 Ga0373939_0003426
1560 Ga0373941_0125737
1561 Ga0373945_0126792
1562 Ga0373945_0274903
1563 Ga0373945_0521918
1564 Ga0373953_0000096
1565 Ga0373953_0019062
1566 Ga0373953_0362767
1567 Ga0373954_0000675
1568 Ga0373954_0005492
1569 Ga0373954_0187365
1570 Ga0373954_0219848
1571 Ga0373954_0232432
1572 Ga0373954_0308421
1573 Ga0373956_0000506
1574 Ga0373956_0006083
1575 Ga0373956_0043829
1576 Ga0373956_0055911
1577 Ga0373957_0001124
1578 Ga0373957_0007197
1579 Ga0373957_0020704
1580 Ga0373957_0243880
1581 Ga0373960_0039434
1582 Ga0373943_0055049
1583 Ga0373943_0081542
1584 Ga0373943_0124009
1585 Ga0373943_0249445
1586 Ga0373943_0853659
1587 Ga0373946_0020106
1588 Ga0373946_0155007
1589 Ga0373946_0276136
1590 Ga0373955_0000040
1591 Ga0373955_0005314
1592 Ga0373955_0025872
1593 Ga0373955_0030416
1594 Ga0373942_0167403
1595 Ga0316574_0001226
1596 Ga0316574_0088763
1597 Ga0373924_0003168
1598 Ga0373924_0038561
1599 Ga0373924_0068770
1600 Ga0373924_0089218
1601 Ga0373924_0089376
1602 Ga0373931_0147028
1603 Ga0373931_0196553
1604 Ga0373931_0331832
1605 Ga0373931_0520111
1606 Ga0373931_0658952
1607 Ga0373935_0005512
1608 Ga0373935_0231254
1609 Ga0373935_0400568
1610 Ga0373935_1239423
1611 Ga0373935_1472241
1612 Ga0373927_0150765
1613 Ga0373927_0259108
1614 Ga0373927_1010704
1615 Ga0373933_0000085
1616 Ga0373933_0043337
1617 Ga0373933_0047667
1618 Ga0373933_0063629
1619 Ga0373933_0106008
1620 Ga0373947_0000195
1621 Ga0373947_0302687
1622 Ga0373947_0458696
1623 Ga0373947_0576344
1624 Ga0373947_0748862
1625 Ga0373937_0000197
1626 Ga0373937_0000859
1627 Ga0373937_0024567
1628 Ga0373937_0041264
1629 Ga0373937_0171223
1630 Ga0373937_0483943
1631 Ga0265778_017865
1632 Ga0372808_018957
1633 Ga0372808_071145
1634 Ga0310109_017307
1635 Ga0310110_037020
1636 Ga0316582_0173590
1637 Ga0316582_0493729
1638 Ga0316584_0066676
1639 Ga0373925_0034101
1640 Ga0373925_0293585
1641 Ga0373925_0429135
1642 Ga0373925_0941052
1643 Ga0373925_1304912
1644 Ga0436364_0188941
1645 Ga0436364_0303129
1646 Ga0436364_0473877
1647 Ga0436364_0875353
1648 Ga0436364_0876629
1649 Ga0395901_0334151
1650 Ga0242420_065571
1651 Ga0436361_0599980
1652 Ga0436363_0225853
1653 Ga0436363_0338172
1654 Ga0436363_1250789
1655 Ga0436363_1357246
1656 Ga0436362_0056231
1657 Ga0436362_0844715
1658 Ga0451804_0730933
1659 Ga0451807_1366442
1660 Ga0451855_0597846
1661 Ga0466966_0116711
1662 Ga0466966_0309983
1663 Ga0466964_0235673
1664 Ga0466964_0383725
1665 Ga0451576_0000327
1666 Ga0466967_0409578
1667 Ga0495592_0000157
1668 Ga0495592_0007117
1669 Ga0495592_0088375
1670 Ga0495592_0439403
1671 Ga0495603_0093688
1672 Ga0495603_0473144
1673 Ga0495629_0017621
1674 Ga0495629_0422482
1675 Ga0495641_0010809
1676 Ga0495641_0024093
1677 Ga0495641_0031029
1678 Ga0495641_0236431
1679 Ga0495651_0000115
1680 Ga0495651_0008585
1681 Ga0495651_0015867
1682 Ga0495651_0081108
1683 Ga0495653_0001269
1684 Ga0495653_0015090
1685 Ga0495653_0038301
1686 Ga0495653_0049617
1687 Ga0495653_0106127
1688 Ga0495653_0177048
1689 Ga0495653_0238969
1690 Ga0495580_0017290
1691 Ga0495580_0059974
1692 Ga0495580_0343509
1693 Ga0495582_0018891
1694 Ga0495582_0725455
1695 Ga0495639_0104780
1696 Ga0495639_0365787
1697 Ga0495639_0516709
1698 Ga0495662_0110634
1699 Ga0495662_0143651
1700 Ga0495664_0096499
1701 Ga0495664_0724907
1702 Ga0495594_0098468
1703 Ga0495594_0396881
1704 Ga0495608_0000157
1705 Ga0495608_0005803
1706 Ga0495608_0016774
1707 Ga0495608_0181300
1708 Ga0495618_0019815
1709 Ga0495618_0061436
1710 Ga0495618_0077977
1711 Ga0495628_0000492
1712 Ga0495628_0037350
1713 Ga0495628_0170409
1714 Ga0495630_0000704
1715 Ga0495630_0031948
1716 Ga0495630_0096381
1717 Ga0495630_0521367
1718 Ga0495666_0080589
1719 Ga0495666_0201777
1720 Ga0495652_0001666
1721 Ga0495652_0014911
1722 Ga0495652_0195190
1723 Ga0495652_0199504
1724 Ga0495652_0492977
1725 Ga0495665_0046857
1726 Ga0495665_0256081
1727 Ga0495640_0018497
1728 Ga0495640_0067864
1729 Ga0495640_0092821
1730 Ga0495640_0457639
1731 Ga0495586_0086587
1732 Ga0495586_0132069
1733 Ga0495586_0491999
1734 Ga0495587_0000123
1735 Ga0495587_0024822
1736 Ga0495587_0042122
1737 Ga0495598_0268427
1738 Ga0495645_0179720
1739 Ga0495645_0187274
1740 Ga0495645_0188426
1741 Ga0495667_0000107
1742 Ga0495667_0023793
1743 Ga0495667_0035901
1744 Ga0495667_0110091
1745 Ga0495667_0710730
1746 Ga0495656_0630561
1747 Ga0495634_0021291
1748 Ga0495634_0079421
1749 Ga0495634_0659152
1750 Ga0495635_0035305
1751 Ga0495635_0097311
1752 Ga0495635_0122397
1753 Ga0495635_0211128
1754 Ga0495635_0599619
1755 Ga0495657_0000169
1756 Ga0495657_0011153
1757 Ga0495657_0063435
1758 Ga0495657_0618321
1759 Ga0495599_0000129
1760 Ga0495599_0007746
1761 Ga0495599_0141122
1762 Ga0495599_0160450
1763 Ga0495599_0236898
1764 Ga0495599_0366391
1765 Ga0495623_0000166
1766 Ga0495623_0018966
1767 Ga0495623_0025353
1768 Ga0495623_0027458
1769 Ga0495623_0163146
1770 Ga0495646_0048031
1771 Ga0495646_0338701
1772 Ga0495647_0035681
1773 Ga0495658_0050594
1774 Ga0495658_0066913
1775 Ga0495613_0115698
1776 Ga0495613_0169418
1777 Ga0495613_0197320
1778 Ga0495624_0026458
1779 Ga0495624_0048030
1780 Ga0495624_0124948
1781 Ga0495624_0400897
1782 Ga0495600_0005205
1783 Ga0495600_0029746
1784 Ga0495600_0038660
1785 Ga0495600_0141580
1786 Ga0495600_0282301
1787 Ga0495600_0307826
1788 Ga0495581_0092546
1789 Ga0495581_0149945
1790 Ga0495581_0205475
1791 Ga0495581_0650711
1792 Ga0495604_0000161
1793 Ga0495604_0021329
1794 Ga0495604_0022314
1795 Ga0495674_0031694
1796 Ga0495674_0070796
1797 Ga0495674_0106094
1798 Ga0495674_0117037
1799 Ga0495674_0148391
1800 Ga0495674_0687951
1801 Ga0495676_0159945
1802 Ga0495680_0000395
1803 Ga0495680_0027978
1804 Ga0495680_0061015
1805 Ga0495680_0075647
1806 Ga0495680_0544004
1807 Ga0495675_0000277
1808 Ga0495675_0001985
1809 Ga0495675_0011289
1810 Ga0495675_0058257
1811 Ga0495675_0216178
1812 Ga0495675_0235840
1813 Ga0495684_0006066
1814 Ga0495684_0064659
1815 Ga0495684_0116686
1816 Ga0495684_0120509
1817 Ga0495684_0120709
1818 Ga0495684_0157550
1819 Ga0495684_0303013
1820 Ga0495684_0544419
1821 Ga0495593_0012129
1822 Ga0495602_0000182
1823 Ga0495602_0006022
1824 Ga0495602_0015749
1825 Ga0495602_0025045
1826 Ga0495614_0206996
1827 Ga0495614_0221704
1828 Ga0495614_0246333
1829 Ga0495614_0363093
1830 Ga0496100_0108694
1831 Ga0496100_0161420
1832 Ga0496101_0034687
1833 Ga0496101_1537138
1834 Ga0496102_0766486
1835 Ga0496102_0956472
1836 Ga0496104_0020438
1837 Ga0496104_0033085
1838 Ga0496104_0075679
1839 Ga0496104_0105643
1840 Ga0496104_0429188
1841 Ga0496105_0002275
1842 Ga0496105_0081192
1843 Ga0496105_0094368
1844 Ga0496106_0298536
1845 Ga0496106_0333548
1846 Ga0496107_0087579
1847 Ga0496108_0002330
1848 Ga0496108_0041572
1849 Ga0496108_0054006
1850 Ga0496108_0714370
1851 Ga0496109_0053471
1852 Ga0496109_0749167
1853 Ga0496109_1025623
1854 Ga0496110_0007267
1855 Ga0496110_0042417
1856 Ga0496110_0066558
1857 Ga0496110_0699424
1858 Ga0496110_1755996
1859 Ga0496111_0032735
1860 Ga0496111_1310780
1861 Ga0496112_0105729
1862 Ga0496112_0161178
1863 Ga0496112_0191433
1864 Ga0496113_0141140
1865 Ga0496114_0559399
1866 Ga0496115_0009458
1867 Ga0496115_0011285
1868 Ga0496115_0193421
1869 Ga0501309_086441
1870 Ga0501310_052071
1871 Ga0501298_023255
1872 Ga0501034_0128692
1873 Ga0501036_1693264
1874 Ga0501042_0123474
1875 Ga0501047_0414081
1876 Ga0501070_0133729
1877 Ga0501071_0516673
1878 Ga0501080_0403465
1879 nmdc:mga0k408_111314_c1
1880 nmdc:mga0k408_629615_c1
1881 nmdc:mga05p37_2306_c1
1882 nmdc:mga0qj67_15845_c1
1883 nmdc:mga0qj67_214985_c1
1884 nmdc:mga06r32_23029_c1
1885 nmdc:mga06r32_258386_c1
1886 nmdc:mga08y16_603568_c1
1887 nmdc:mga08y16_71882_c1
1888 nmdc:mga0n895_1644616_c1
1889 nmdc:mga0n895_1676745_c1
1890 nmdc:mga0n895_232641_c1
1891 nmdc:mga0n895_8584_c1
1892 nmdc:mga0n895_884259_c1
1893 nmdc:mga0rr50_243298_c1
1894 nmdc:mga0rr50_262907_c1
1895 nmdc:mga0rr50_431198_c1
1896 nmdc:mga0rr50_553386_c1
1897 nmdc:mga0rr50_592672_c1
1898 nmdc:mga08x19_134993_c1
1899 nmdc:mga08x19_177911_c1
1900 nmdc:mga08x19_305082_c1
1901 nmdc:mga0a205_115359_c1
1902 Ga0495601_0009245
1903 Ga0495601_0061262
1904 Ga0495612_0015816
1905 Ga0495612_0059076
1906 Ga0495595_0067128
1907 Ga0495619_0302206
1908 Ga0495619_0318545
1909 Ga0495619_0723796
1910 Ga0587066_044076
1911 Ga0587066_132894
1912 Ga0587073_0080425
1913 Ga0587073_0083348
1914 Ga0587073_0253626
1915 Ga0587077_197900
1916 Ga0587080_036176
1917 Ga0587080_173305
1918 Ga0587083_0048247
1919 Ga0587083_0067486
1920 Ga0587085_023820
1921 Ga0587085_066241
1922 Ga0587085_127718
1923 Ga0587088_051657
1924 Ga0587089_077022
1925 Ga0587091_028934
1926 Ga0587092_119908
1927 Ga0587094_053819
1928 Ga0587098_030580
1929 Ga0587106_029350
1930 Ga0587106_057517
1931 Ga0587129_028600
1932 Ga0587099_024271
1933 Ga0587115_024370
1934 Ga0587115_025511
1935 Ga0587062_106805
1936 Ga0587069_093977
1937 Ga0587072_088687
1938 Ga0587075_035518
1939 Ga0587075_038477
1940 Ga0587075_047949
1941 Ga0587078_053510
1942 Ga0587079_151950
1943 Ga0587107_022589
1944 Ga0587107_031979
1945 Ga0587107_037604
1946 Ga0587107_065587
1947 Ga0587114_070961
1948 Ga0587116_08021
1949 Ga0587071_109506
1950 Ga0587111_0188745
1951 2990050122
1952 8056065457

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8674 50 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8564 50 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8543 61 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8061 61 117
2ghj-assembly1.cif.gz_A crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 0.7 21 116
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9516 53 118 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8987 53 118 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8962 58 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8543 61 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8061 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-G6EM08-F1-model_v4 deleted 1.005 57 115
AF-J9FK27-F1-model_v4 Ribosomal protein L20 1.005 60 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.003 53 115 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2D8YKH1-F1-model_v4 deleted 0.9998 58 117
AF-A0A2N8FNS0-F1-model_v4 deleted 0.9958 56 120

Map