F487251
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 389 | 1952 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101538938|Ga0070708_1015389382 |
| Length | 132 |
| Sequence | MARVKRAVNAHKKRRVVLERASGYRGQRSRMYRKAKEQTLHSMAYAYRDRKDRKGAFRRLWIQRINAAARADGLTYNRFIQGLKIAGVDIDRRMLAELAVDDPAAFSGLVDVARKALPDDLGGPSAADTAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 132 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 134 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 208 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 209 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 210 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 258 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 259 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 269 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 272 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 389 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.47 |
| Metatranscriptomes | 9.32 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 4.2 |
| Rhizosphere | 92.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_101538938 | 3300005445 | Bacteria | 619 |
| 2 | Ga0058862_10044764 | 3300004803 | Bacteria | 608 |
| 3 | Ga0065707_10082794 | 3300005295 | Bacteria | 12061 |
| 4 | Ga0070658_10816914 | 3300005327 | Bacteria | 810 |
| 5 | Ga0070658_11003980 | 3300005327 | Bacteria | 726 |
| 6 | Ga0070676_11262207 | 3300005328 | Bacteria | 563 |
| 7 | Ga0070683_100573657 | 3300005329 | Bacteria | 1079 |
| 8 | Ga0070670_101632167 | 3300005331 | Bacteria | 593 |
| 9 | Ga0070677_10352690 | 3300005333 | Bacteria | 763 |
| 10 | Ga0068869_100167989 | 3300005334 | Bacteria | 1712 |
| 11 | Ga0068869_101579171 | 3300005334 | Bacteria | 584 |
| 12 | Ga0070666_10175764 | 3300005335 | Bacteria | 1501 |
| 13 | Ga0070666_10222099 | 3300005335 | Bacteria | 1333 |
| 14 | Ga0070680_100218942 | 3300005336 | Bacteria | 1607 |
| 15 | Ga0070680_101237863 | 3300005336 | Bacteria | 646 |
| 16 | Ga0070682_100071490 | 3300005337 | Bacteria | 2221 |
| 17 | Ga0070682_100325543 | 3300005337 | Bacteria | 1137 |
| 18 | Ga0070682_101582171 | 3300005337 | Bacteria | 566 |
| 19 | Ga0068868_102002229 | 3300005338 | Bacteria | 550 |
| 20 | Ga0068868_102018053 | 3300005338 | Bacteria | 548 |
| 21 | Ga0070660_100707123 | 3300005339 | Bacteria | 845 |
| 22 | Ga0070660_100968934 | 3300005339 | Unclassified | 718 |
| 23 | Ga0070660_101747887 | 3300005339 | Bacteria | 530 |
| 24 | Ga0070689_101884571 | 3300005340 | Bacteria | 546 |
| 25 | Ga0070691_10041703 | 3300005341 | Bacteria | 2171 |
| 26 | Ga0070661_100024970 | 3300005344 | Bacteria | 4291 |
| 27 | Ga0070669_100047826 | 3300005353 | Bacteria | 3121 |
| 28 | Ga0070669_100130671 | 3300005353 | Bacteria | 1926 |
| 29 | Ga0070675_100766646 | 3300005354 | Bacteria | 881 |
| 30 | Ga0070675_100872775 | 3300005354 | Bacteria | 824 |
| 31 | Ga0070671_100015641 | 3300005355 | Bacteria | 6132 |
| 32 | Ga0070671_101464859 | 3300005355 | Unclassified | 604 |
| 33 | Ga0070674_100019188 | 3300005356 | Bacteria | 4340 |
| 34 | Ga0070674_100242849 | 3300005356 | Bacteria | 1411 |
| 35 | Ga0070673_101417359 | 3300005364 | Bacteria | 654 |
| 36 | Ga0070673_101512272 | 3300005364 | Bacteria | 633 |
| 37 | Ga0070709_10014574 | 3300005434 | Bacteria | 4448 |
| 38 | Ga0070709_10043900 | 3300005434 | Bacteria | 2767 |
| 39 | Ga0070709_10044658 | 3300005434 | Bacteria | 2745 |
| 40 | Ga0070709_10119093 | 3300005434 | Bacteria | 1786 |
| 41 | Ga0070709_10140570 | 3300005434 | Bacteria | 1658 |
| 42 | Ga0070709_10328443 | 3300005434 | Bacteria | 1124 |
| 43 | Ga0070709_11047221 | 3300005434 | Bacteria | 651 |
| 44 | Ga0070714_100000829 | 3300005435 | Bacteria | 21864 |
| 45 | Ga0070714_100008120 | 3300005435 | Bacteria | 8181 |
| 46 | Ga0070714_100022560 | 3300005435 | Bacteria | 5162 |
| 47 | Ga0070714_100041831 | 3300005435 | Bacteria | 3869 |
| 48 | Ga0070714_100094835 | 3300005435 | Bacteria | 2620 |
| 49 | Ga0070714_100109886 | 3300005435 | Bacteria | 2440 |
| 50 | Ga0070714_100156220 | 3300005435 | Unclassified | 2059 |
| 51 | Ga0070714_100312851 | 3300005435 | Bacteria | 1467 |
| 52 | Ga0070714_100322243 | 3300005435 | Bacteria | 1445 |
| 53 | Ga0070714_100551550 | 3300005435 | Bacteria | 1103 |
| 54 | Ga0070714_102442977 | 3300005435 | Bacteria | 507 |
| 55 | Ga0070713_100000301 | 3300005436 | Bacteria | 32722 |
| 56 | Ga0070713_100004793 | 3300005436 | Bacteria | 9160 |
| 57 | Ga0070713_100102293 | 3300005436 | Bacteria | 2484 |
| 58 | Ga0070713_100154458 | 3300005436 | Bacteria | 2044 |
| 59 | Ga0070713_100214204 | 3300005436 | Bacteria | 1745 |
| 60 | Ga0070713_100340933 | 3300005436 | Bacteria | 1388 |
| 61 | Ga0070710_10000358 | 3300005437 | Bacteria | 21534 |
| 62 | Ga0070710_10002036 | 3300005437 | Bacteria | 9574 |
| 63 | Ga0070710_10009948 | 3300005437 | Bacteria | 4662 |
| 64 | Ga0070710_10040181 | 3300005437 | Bacteria | 2578 |
| 65 | Ga0070710_10066864 | 3300005437 | Bacteria | 2061 |
| 66 | Ga0070710_10152031 | 3300005437 | Bacteria | 1428 |
| 67 | Ga0070710_10309561 | 3300005437 | Bacteria | 1033 |
| 68 | Ga0070711_100000638 | 3300005439 | Bacteria | 18273 |
| 69 | Ga0070711_100032942 | 3300005439 | Bacteria | 3448 |
| 70 | Ga0070711_100119441 | 3300005439 | Bacteria | 1947 |
| 71 | Ga0070711_100229918 | 3300005439 | Bacteria | 1445 |
| 72 | Ga0070711_100238893 | 3300005439 | Bacteria | 1420 |
| 73 | Ga0070711_100675774 | 3300005439 | Bacteria | 868 |
| 74 | Ga0070700_100045043 | 3300005441 | Bacteria | 2720 |
| 75 | Ga0070694_101694240 | 3300005444 | Bacteria | 538 |
| 76 | Ga0070708_100001321 | 3300005445 | Bacteria | 19006 |
| 77 | Ga0070708_100061763 | 3300005445 | Bacteria | 3348 |
| 78 | Ga0070708_100074283 | 3300005445 | Bacteria | 3066 |
| 79 | Ga0070708_100377224 | 3300005445 | Bacteria | 1337 |
| 80 | Ga0070663_101511412 | 3300005455 | Bacteria | 597 |
| 81 | Ga0070678_100105427 | 3300005456 | Bacteria | 2194 |
| 82 | Ga0070678_100905430 | 3300005456 | Bacteria | 807 |
| 83 | Ga0070678_101276596 | 3300005456 | Bacteria | 683 |
| 84 | Ga0070662_100775264 | 3300005457 | Bacteria | 814 |
| 85 | Ga0070681_10833047 | 3300005458 | Bacteria | 840 |
| 86 | Ga0068867_100017306 | 3300005459 | Bacteria | 5119 |
| 87 | Ga0068867_100612074 | 3300005459 | Bacteria | 951 |
| 88 | Ga0070706_100002905 | 3300005467 | Bacteria | 17059 |
| 89 | Ga0070706_100005180 | 3300005467 | Bacteria | 12443 |
| 90 | Ga0070706_100008719 | 3300005467 | Bacteria | 9449 |
| 91 | Ga0070706_100012401 | 3300005467 | Bacteria | 7897 |
| 92 | Ga0070706_100036657 | 3300005467 | Bacteria | 4530 |
| 93 | Ga0070706_100060797 | 3300005467 | Bacteria | 3487 |
| 94 | Ga0070706_100063225 | 3300005467 | Bacteria | 3420 |
| 95 | Ga0070706_100099112 | 3300005467 | Bacteria | 2707 |
| 96 | Ga0070706_100733835 | 3300005467 | Bacteria | 915 |
| 97 | Ga0070706_100766845 | 3300005467 | Bacteria | 893 |
| 98 | Ga0070707_100000300 | 3300005468 | Bacteria | 48384 |
| 99 | Ga0070707_100011644 | 3300005468 | Bacteria | 8207 |
| 100 | Ga0070707_100108861 | 3300005468 | Bacteria | 2687 |
| 101 | Ga0070707_100131178 | 3300005468 | Bacteria | 2437 |
| 102 | Ga0070707_100133287 | 3300005468 | Bacteria | 2416 |
| 103 | Ga0070707_100234827 | 3300005468 | Bacteria | 1785 |
| 104 | Ga0070707_100260045 | 3300005468 | Bacteria | 1689 |
| 105 | Ga0070707_100272657 | 3300005468 | Bacteria | 1645 |
| 106 | Ga0070698_100000801 | 3300005471 | Bacteria | 34248 |
| 107 | Ga0070698_100002410 | 3300005471 | Bacteria | 20596 |
| 108 | Ga0070698_100003145 | 3300005471 | Bacteria | 18190 |
| 109 | Ga0070698_100003899 | 3300005471 | Bacteria | 16402 |
| 110 | Ga0070698_100006066 | 3300005471 | Bacteria | 13162 |
| 111 | Ga0070698_100065689 | 3300005471 | Bacteria | 3652 |
| 112 | Ga0070698_100168910 | 3300005471 | Bacteria | 2129 |
| 113 | Ga0070698_100246640 | 3300005471 | Bacteria | 1719 |
| 114 | Ga0070699_100068826 | 3300005518 | Bacteria | 3075 |
| 115 | Ga0070699_100070353 | 3300005518 | Bacteria | 3042 |
| 116 | Ga0070699_100073117 | 3300005518 | Bacteria | 2983 |
| 117 | Ga0070699_101072992 | 3300005518 | Bacteria | 739 |
| 118 | Ga0070684_100115637 | 3300005535 | Bacteria | 2409 |
| 119 | Ga0070684_100139985 | 3300005535 | Bacteria | 2187 |
| 120 | Ga0070684_100928377 | 3300005535 | Bacteria | 816 |
| 121 | Ga0070684_101058809 | 3300005535 | Bacteria | 762 |
| 122 | Ga0070684_101367365 | 3300005535 | Bacteria | 667 |
| 123 | Ga0070697_100030550 | 3300005536 | Bacteria | 4328 |
| 124 | Ga0068853_100197912 | 3300005539 | Bacteria | 1828 |
| 125 | Ga0068853_100586708 | 3300005539 | Bacteria | 1058 |
| 126 | Ga0068853_100754483 | 3300005539 | Bacteria | 930 |
| 127 | Ga0068853_100895824 | 3300005539 | Bacteria | 852 |
| 128 | Ga0070672_100008328 | 3300005543 | Bacteria | 7085 |
| 129 | Ga0070672_100011156 | 3300005543 | Bacteria | 6257 |
| 130 | Ga0070672_101857696 | 3300005543 | Bacteria | 542 |
| 131 | Ga0070672_101990517 | 3300005543 | Bacteria | 523 |
| 132 | Ga0070695_100533938 | 3300005545 | Bacteria | 912 |
| 133 | Ga0070695_101067195 | 3300005545 | Bacteria | 660 |
| 134 | Ga0070665_100272775 | 3300005548 | Bacteria | 1693 |
| 135 | Ga0070665_100567533 | 3300005548 | Bacteria | 1147 |
| 136 | Ga0070704_100317062 | 3300005549 | Bacteria | 1305 |
| 137 | Ga0068855_100043684 | 3300005563 | Bacteria | 5307 |
| 138 | Ga0068855_100130053 | 3300005563 | Bacteria | 2876 |
| 139 | Ga0068855_100146481 | 3300005563 | Bacteria | 2688 |
| 140 | Ga0068855_101284481 | 3300005563 | Bacteria | 758 |
| 141 | Ga0070664_100728856 | 3300005564 | Bacteria | 925 |
| 142 | Ga0068857_100018116 | 3300005577 | Bacteria | 6177 |
| 143 | Ga0068857_101478477 | 3300005577 | Bacteria | 662 |
| 144 | Ga0068854_100887552 | 3300005578 | Bacteria | 783 |
| 145 | Ga0068854_101569058 | 3300005578 | Bacteria | 599 |
| 146 | Ga0068856_100039299 | 3300005614 | Bacteria | 4645 |
| 147 | Ga0068856_100044982 | 3300005614 | Bacteria | 4345 |
| 148 | Ga0068856_100076573 | 3300005614 | Bacteria | 3314 |
| 149 | Ga0068856_100087951 | 3300005614 | Bacteria | 3089 |
| 150 | Ga0068856_100406560 | 3300005614 | Bacteria | 1381 |
| 151 | Ga0070702_100101619 | 3300005615 | Bacteria | 1765 |
| 152 | Ga0068852_100457482 | 3300005616 | Bacteria | 1264 |
| 153 | Ga0068859_100046132 | 3300005617 | Bacteria | 4377 |
| 154 | Ga0068859_100665154 | 3300005617 | Bacteria | 1133 |
| 155 | Ga0068864_100109354 | 3300005618 | Bacteria | 2461 |
| 156 | Ga0068861_100001796 | 3300005719 | Bacteria | 13814 |
| 157 | Ga0068870_10390384 | 3300005840 | Bacteria | 903 |
| 158 | Ga0068863_100259524 | 3300005841 | Bacteria | 1679 |
| 159 | Ga0068863_100654906 | 3300005841 | Bacteria | 1042 |
| 160 | Ga0068863_101019016 | 3300005841 | Bacteria | 831 |
| 161 | Ga0068863_102681780 | 3300005841 | Bacteria | 507 |
| 162 | Ga0068858_100077420 | 3300005842 | Bacteria | 3090 |
| 163 | Ga0068858_100147677 | 3300005842 | Bacteria | 2209 |
| 164 | Ga0068858_100352439 | 3300005842 | Bacteria | 1410 |
| 165 | Ga0068860_100002243 | 3300005843 | Bacteria | 20349 |
| 166 | Ga0068860_100375087 | 3300005843 | Bacteria | 1404 |
| 167 | Ga0068860_100916391 | 3300005843 | Bacteria | 893 |
| 168 | Ga0068862_100333384 | 3300005844 | Bacteria | 1403 |
| 169 | Ga0081540_1000482 | 3300005983 | Bacteria | 39035 |
| 170 | Ga0081540_1164053 | 3300005983 | Bacteria | 857 |
| 171 | Ga0070717_10000712 | 3300006028 | Bacteria | 21583 |
| 172 | Ga0070717_10035300 | 3300006028 | Bacteria | 4047 |
| 173 | Ga0070717_10151902 | 3300006028 | Bacteria | 2004 |
| 174 | Ga0070717_10160951 | 3300006028 | Bacteria | 1947 |
| 175 | Ga0070717_10291279 | 3300006028 | Bacteria | 1450 |
| 176 | Ga0070717_10292906 | 3300006028 | Bacteria | 1445 |
| 177 | Ga0070717_11443884 | 3300006028 | Bacteria | 624 |
| 178 | Ga0075368_10310233 | 3300006042 | Bacteria | 682 |
| 179 | Ga0070715_10008968 | 3300006163 | Bacteria | 3510 |
| 180 | Ga0070715_10011170 | 3300006163 | Bacteria | 3226 |
| 181 | Ga0070715_10314116 | 3300006163 | Bacteria | 843 |
| 182 | Ga0070716_100000107 | 3300006173 | Bacteria | 33042 |
| 183 | Ga0070716_100000726 | 3300006173 | Bacteria | 14049 |
| 184 | Ga0070716_100039242 | 3300006173 | Bacteria | 2627 |
| 185 | Ga0070716_100059402 | 3300006173 | Bacteria | 2204 |
| 186 | Ga0070716_100224324 | 3300006173 | Bacteria | 1265 |
| 187 | Ga0070712_100003795 | 3300006175 | Bacteria | 9304 |
| 188 | Ga0070712_100025122 | 3300006175 | Bacteria | 3956 |
| 189 | Ga0070712_100154621 | 3300006175 | Bacteria | 1765 |
| 190 | Ga0070712_100259365 | 3300006175 | Bacteria | 1392 |
| 191 | Ga0070712_100485612 | 3300006175 | Bacteria | 1033 |
| 192 | Ga0075366_10220538 | 3300006195 | Bacteria | 1155 |
| 193 | Ga0097621_100222160 | 3300006237 | Bacteria | 1646 |
| 194 | Ga0097621_101528437 | 3300006237 | Unclassified | 634 |
| 195 | Ga0068871_100023726 | 3300006358 | Bacteria | 4749 |
| 196 | Ga0075428_100117619 | 3300006844 | Bacteria | 2896 |
| 197 | Ga0075430_100020756 | 3300006846 | Bacteria | 5586 |
| 198 | Ga0075430_100138881 | 3300006846 | Bacteria | 2024 |
| 199 | Ga0075431_100008971 | 3300006847 | Bacteria | 10024 |
| 200 | Ga0075431_100251713 | 3300006847 | Bacteria | 1795 |
| 201 | Ga0075433_10043109 | 3300006852 | Bacteria | 3916 |
| 202 | Ga0075433_10154477 | 3300006852 | Bacteria | 2042 |
| 203 | Ga0075434_100045414 | 3300006871 | Bacteria | 4358 |
| 204 | Ga0075434_100377057 | 3300006871 | Bacteria | 1439 |
| 205 | Ga0075434_100402859 | 3300006871 | Bacteria | 1389 |
| 206 | Ga0075429_100930344 | 3300006880 | Bacteria | 760 |
| 207 | Ga0068865_101706899 | 3300006881 | Bacteria | 568 |
| 208 | Ga0075436_100040389 | 3300006914 | Bacteria | 3219 |
| 209 | Ga0075436_100176893 | 3300006914 | Bacteria | 1507 |
| 210 | Ga0075436_100373834 | 3300006914 | Bacteria | 1030 |
| 211 | Ga0075436_101208821 | 3300006914 | Bacteria | 571 |
| 212 | Ga0097620_100046133 | 3300006931 | Bacteria | 4377 |
| 213 | Ga0097620_100665164 | 3300006931 | Bacteria | 1133 |
| 214 | Ga0075435_100002665 | 3300007076 | Bacteria | 11912 |
| 215 | Ga0075435_100079499 | 3300007076 | Bacteria | 2691 |
| 216 | Ga0075435_100172519 | 3300007076 | Bacteria | 1825 |
| 217 | Ga0075435_100533617 | 3300007076 | Bacteria | 1015 |
| 218 | Ga0075435_101006873 | 3300007076 | Bacteria | 728 |
| 219 | Ga0075435_101725249 | 3300007076 | Bacteria | 549 |
| 220 | Ga0099794_10318934 | 3300007265 | Bacteria | 806 |
| 221 | Ga0105251_10276746 | 3300009011 | Bacteria | 759 |
| 222 | Ga0105240_10118770 | 3300009093 | Unclassified | 3186 |
| 223 | Ga0105240_10126052 | 3300009093 | Bacteria | 3077 |
| 224 | Ga0111539_10053594 | 3300009094 | Bacteria | 4801 |
| 225 | Ga0105245_10006829 | 3300009098 | Bacteria | 10013 |
| 226 | Ga0105245_10279901 | 3300009098 | Bacteria | 1630 |
| 227 | Ga0105245_10375812 | 3300009098 | Bacteria | 1414 |
| 228 | Ga0105245_10726450 | 3300009098 | Bacteria | 1028 |
| 229 | Ga0105245_11669205 | 3300009098 | Unclassified | 689 |
| 230 | Ga0105247_10306649 | 3300009101 | Bacteria | 1103 |
| 231 | Ga0114129_10329283 | 3300009147 | Bacteria | 2028 |
| 232 | Ga0114129_11179624 | 3300009147 | Bacteria | 955 |
| 233 | Ga0105243_10031845 | 3300009148 | Bacteria | 4069 |
| 234 | Ga0105243_12754884 | 3300009148 | Unclassified | 532 |
| 235 | Ga0105241_10044971 | 3300009174 | Bacteria | 3348 |
| 236 | Ga0105241_10062828 | 3300009174 | Bacteria | 2864 |
| 237 | Ga0105241_10683035 | 3300009174 | Bacteria | 935 |
| 238 | Ga0105242_11733041 | 3300009176 | Bacteria | 662 |
| 239 | Ga0105242_12678903 | 3300009176 | Bacteria | 548 |
| 240 | Ga0105248_10144050 | 3300009177 | Bacteria | 2688 |
| 241 | Ga0105248_11679244 | 3300009177 | Bacteria | 720 |
| 242 | Ga0105237_10256997 | 3300009545 | Bacteria | 1749 |
| 243 | Ga0105237_10303473 | 3300009545 | Bacteria | 1600 |
| 244 | Ga0105237_10465298 | 3300009545 | Bacteria | 1270 |
| 245 | Ga0105238_10149071 | 3300009551 | Bacteria | 2315 |
| 246 | Ga0105238_10188444 | 3300009551 | Bacteria | 2039 |
| 247 | Ga0105238_10255840 | 3300009551 | Bacteria | 1730 |
| 248 | Ga0105238_11149481 | 3300009551 | Bacteria | 800 |
| 249 | Ga0105238_11737993 | 3300009551 | Bacteria | 655 |
| 250 | Ga0105249_10027380 | 3300009553 | Bacteria | 5142 |
| 251 | Ga0105249_10517123 | 3300009553 | Bacteria | 1240 |
| 252 | Ga0099796_10583841 | 3300010159 | Unclassified | 503 |
| 253 | Ga0105239_10009903 | 3300010375 | Bacteria | 10704 |
| 254 | Ga0105239_10938466 | 3300010375 | Bacteria | 994 |
| 255 | Ga0105239_11272529 | 3300010375 | Bacteria | 848 |
| 256 | Ga0105239_12312238 | 3300010375 | Bacteria | 626 |
| 257 | Ga0105246_11119556 | 3300011119 | Bacteria | 720 |
| 258 | Ga0157339_1038572 | 3300012505 | Bacteria | 590 |
| 259 | Ga0157373_10210104 | 3300013100 | Bacteria | 1372 |
| 260 | Ga0157373_10559714 | 3300013100 | Bacteria | 830 |
| 261 | Ga0157373_11111006 | 3300013100 | Unclassified | 593 |
| 262 | Ga0157371_10445910 | 3300013102 | Bacteria | 951 |
| 263 | Ga0157370_10724834 | 3300013104 | Bacteria | 907 |
| 264 | Ga0157370_10919537 | 3300013104 | Unclassified | 793 |
| 265 | Ga0157370_11260681 | 3300013104 | Archaea | 666 |
| 266 | Ga0157369_10368567 | 3300013105 | Bacteria | 1491 |
| 267 | Ga0157369_10747506 | 3300013105 | Bacteria | 1006 |
| 268 | Ga0157369_10923845 | 3300013105 | Unclassified | 895 |
| 269 | Ga0157369_11189347 | 3300013105 | Bacteria | 778 |
| 270 | Ga0157369_11699652 | 3300013105 | Bacteria | 641 |
| 271 | Ga0157369_11748164 | 3300013105 | Bacteria | 632 |
| 272 | Ga0157369_12132859 | 3300013105 | Bacteria | 568 |
| 273 | Ga0157374_10015922 | 3300013296 | Bacteria | 6607 |
| 274 | Ga0157374_10740224 | 3300013296 | Bacteria | 997 |
| 275 | Ga0157374_11142280 | 3300013296 | Bacteria | 800 |
| 276 | Ga0157378_10013493 | 3300013297 | Bacteria | 7145 |
| 277 | Ga0157378_12057045 | 3300013297 | Bacteria | 621 |
| 278 | Ga0163162_10001801 | 3300013306 | Bacteria | 20110 |
| 279 | Ga0163162_10193082 | 3300013306 | Bacteria | 2164 |
| 280 | Ga0157372_10183950 | 3300013307 | Bacteria | 2420 |
| 281 | Ga0157372_10227439 | 3300013307 | Bacteria | 2162 |
| 282 | Ga0157372_10500139 | 3300013307 | Unclassified | 1417 |
| 283 | Ga0157372_10609285 | 3300013307 | Unclassified | 1273 |
| 284 | Ga0157372_10990971 | 3300013307 | Bacteria | 973 |
| 285 | Ga0157372_11182477 | 3300013307 | Bacteria | 884 |
| 286 | Ga0157372_12137848 | 3300013307 | Bacteria | 643 |
| 287 | Ga0157375_10098016 | 3300013308 | Bacteria | 3007 |
| 288 | Ga0157375_10862547 | 3300013308 | Bacteria | 1051 |
| 289 | Ga0157375_11548696 | 3300013308 | Bacteria | 783 |
| 290 | Ga0157375_12187185 | 3300013308 | Bacteria | 659 |
| 291 | Ga0157375_12655929 | 3300013308 | Unclassified | 598 |
| 292 | Ga0163163_10759779 | 3300014325 | Bacteria | 1033 |
| 293 | Ga0182008_10328897 | 3300014497 | Bacteria | 806 |
| 294 | Ga0157377_10202523 | 3300014745 | Bacteria | 1261 |
| 295 | Ga0157377_10667796 | 3300014745 | Bacteria | 750 |
| 296 | Ga0157379_10006818 | 3300014968 | Bacteria | 9870 |
| 297 | Ga0157379_10050003 | 3300014968 | Bacteria | 3731 |
| 298 | Ga0157379_10068693 | 3300014968 | Bacteria | 3168 |
| 299 | Ga0157379_11395184 | 3300014968 | Bacteria | 679 |
| 300 | Ga0157379_11965082 | 3300014968 | Bacteria | 577 |
| 301 | Ga0157376_10006886 | 3300014969 | Bacteria | 8049 |
| 302 | Ga0157376_10072188 | 3300014969 | Bacteria | 2936 |
| 303 | Ga0163161_10129362 | 3300017792 | Bacteria | 1903 |
| 304 | Ga0163161_10192477 | 3300017792 | Bacteria | 1569 |
| 305 | Ga0163161_11684242 | 3300017792 | Bacteria | 561 |
| 306 | Ga0184595_106319 | 3300019166 | Bacteria | 602 |
| 307 | Ga0184592_103689 | 3300019177 | Bacteria | 612 |
| 308 | Ga0184594_129231 | 3300019181 | Bacteria | 624 |
| 309 | Ga0184601_133098 | 3300019183 | Bacteria | 666 |
| 310 | Ga0184599_152346 | 3300019188 | Bacteria | 834 |
| 311 | Ga0184600_139479 | 3300019190 | Bacteria | 1425 |
| 312 | Ga0184603_145986 | 3300019192 | Bacteria | 852 |
| 313 | Ga0197907_10081145 | 3300020069 | Bacteria | 4119 |
| 314 | Ga0197907_11507248 | 3300020069 | Bacteria | 839 |
| 315 | Ga0206356_10616066 | 3300020070 | Bacteria | 874 |
| 316 | Ga0206356_11087391 | 3300020070 | Bacteria | 582 |
| 317 | Ga0206356_11838597 | 3300020070 | Bacteria | 586 |
| 318 | Ga0206355_1000641 | 3300020076 | Bacteria | 690 |
| 319 | Ga0206352_10444515 | 3300020078 | Bacteria | 537 |
| 320 | Ga0206352_10598243 | 3300020078 | Bacteria | 930 |
| 321 | Ga0206352_10725269 | 3300020078 | Bacteria | 819 |
| 322 | Ga0206350_11041294 | 3300020080 | Bacteria | 2550 |
| 323 | Ga0206354_11188401 | 3300020081 | Bacteria | 1094 |
| 324 | Ga0206354_11474612 | 3300020081 | Bacteria | 1214 |
| 325 | Ga0206354_11668375 | 3300020081 | Unclassified | 523 |
| 326 | Ga0206353_10824445 | 3300020082 | Unclassified | 758 |
| 327 | Ga0206353_11633815 | 3300020082 | Bacteria | 897 |
| 328 | Ga0213875_10000176 | 3300021388 | Bacteria | 67409 |
| 329 | Ga0213875_10000584 | 3300021388 | Bacteria | 29499 |
| 330 | Ga0213875_10083953 | 3300021388 | Bacteria | 1486 |
| 331 | Ga0213875_10277652 | 3300021388 | Bacteria | 791 |
| 332 | Ga0224712_10071645 | 3300022467 | Bacteria | 1409 |
| 333 | Ga0224712_10081329 | 3300022467 | Bacteria | 1337 |
| 334 | Ga0224712_10109490 | 3300022467 | Bacteria | 1183 |
| 335 | Ga0247554_103440 | 3300023547 | Bacteria | 621 |
| 336 | Ga0247551_105014 | 3300023552 | Bacteria | 542 |
| 337 | Ga0247515_119401 | 3300023564 | Bacteria | 598 |
| 338 | Ga0247553_103863 | 3300023672 | Bacteria | 744 |
| 339 | Ga0247522_117983 | 3300023688 | Bacteria | 542 |
| 340 | Ga0228600_1005907 | 3300024123 | Bacteria | 904 |
| 341 | Ga0224572_1002833 | 3300024225 | Bacteria | 2857 |
| 342 | Ga0228598_1018543 | 3300024227 | Bacteria | 1373 |
| 343 | Ga0207682_10045239 | 3300025893 | Bacteria | 1806 |
| 344 | Ga0207682_10236597 | 3300025893 | Bacteria | 848 |
| 345 | Ga0207692_10000057 | 3300025898 | Bacteria | 32761 |
| 346 | Ga0207692_10001524 | 3300025898 | Bacteria | 8706 |
| 347 | Ga0207692_10022131 | 3300025898 | Bacteria | 2921 |
| 348 | Ga0207692_10057414 | 3300025898 | Bacteria | 2001 |
| 349 | Ga0207692_10100855 | 3300025898 | Bacteria | 1584 |
| 350 | Ga0207692_10107778 | 3300025898 | Bacteria | 1540 |
| 351 | Ga0207692_10264469 | 3300025898 | Bacteria | 1035 |
| 352 | Ga0207692_10267296 | 3300025898 | Bacteria | 1030 |
| 353 | Ga0207710_10289262 | 3300025900 | Bacteria | 826 |
| 354 | Ga0207680_11296333 | 3300025903 | Bacteria | 518 |
| 355 | Ga0207685_10003821 | 3300025905 | Bacteria | 3726 |
| 356 | Ga0207685_10040562 | 3300025905 | Bacteria | 1736 |
| 357 | Ga0207685_10058632 | 3300025905 | Bacteria | 1515 |
| 358 | Ga0207699_10000162 | 3300025906 | Bacteria | 41608 |
| 359 | Ga0207699_10002215 | 3300025906 | Bacteria | 9163 |
| 360 | Ga0207699_10011202 | 3300025906 | Bacteria | 4520 |
| 361 | Ga0207699_10012683 | 3300025906 | Bacteria | 4291 |
| 362 | Ga0207699_10030697 | 3300025906 | Bacteria | 3010 |
| 363 | Ga0207699_10045722 | 3300025906 | Bacteria | 2557 |
| 364 | Ga0207699_10048477 | 3300025906 | Bacteria | 2495 |
| 365 | Ga0207645_10524749 | 3300025907 | Bacteria | 802 |
| 366 | Ga0207643_10965583 | 3300025908 | Bacteria | 552 |
| 367 | Ga0207705_10567099 | 3300025909 | Bacteria | 882 |
| 368 | Ga0207684_10000918 | 3300025910 | Bacteria | 33417 |
| 369 | Ga0207684_10011073 | 3300025910 | Bacteria | 7897 |
| 370 | Ga0207684_10018120 | 3300025910 | Bacteria | 6033 |
| 371 | Ga0207684_10023539 | 3300025910 | Bacteria | 5259 |
| 372 | Ga0207684_10049552 | 3300025910 | Bacteria | 3563 |
| 373 | Ga0207684_10060226 | 3300025910 | Bacteria | 3224 |
| 374 | Ga0207684_10093327 | 3300025910 | Bacteria | 2566 |
| 375 | Ga0207684_10149788 | 3300025910 | Bacteria | 2007 |
| 376 | Ga0207684_10188430 | 3300025910 | Bacteria | 1779 |
| 377 | Ga0207684_10248326 | 3300025910 | Bacteria | 1535 |
| 378 | Ga0207684_10596727 | 3300025910 | Bacteria | 943 |
| 379 | Ga0207654_10233203 | 3300025911 | Bacteria | 1227 |
| 380 | Ga0207654_10415210 | 3300025911 | Bacteria | 938 |
| 381 | Ga0207707_10636439 | 3300025912 | Bacteria | 900 |
| 382 | Ga0207707_11170358 | 3300025912 | Bacteria | 624 |
| 383 | Ga0207695_10641696 | 3300025913 | Unclassified | 943 |
| 384 | Ga0207671_10205438 | 3300025914 | Bacteria | 1539 |
| 385 | Ga0207693_10001896 | 3300025915 | Bacteria | 18288 |
| 386 | Ga0207693_10006360 | 3300025915 | Bacteria | 9787 |
| 387 | Ga0207693_10044701 | 3300025915 | Bacteria | 3480 |
| 388 | Ga0207693_10191816 | 3300025915 | Bacteria | 1608 |
| 389 | Ga0207693_10208732 | 3300025915 | Bacteria | 1535 |
| 390 | Ga0207693_10369276 | 3300025915 | Bacteria | 1122 |
| 391 | Ga0207693_10979641 | 3300025915 | Bacteria | 646 |
| 392 | Ga0207693_11076240 | 3300025915 | Bacteria | 611 |
| 393 | Ga0207663_10001902 | 3300025916 | Bacteria | 9874 |
| 394 | Ga0207663_10017791 | 3300025916 | Bacteria | 3968 |
| 395 | Ga0207663_10026595 | 3300025916 | Bacteria | 3361 |
| 396 | Ga0207663_10219572 | 3300025916 | Bacteria | 1382 |
| 397 | Ga0207663_10275815 | 3300025916 | Bacteria | 1247 |
| 398 | Ga0207663_10276295 | 3300025916 | Bacteria | 1246 |
| 399 | Ga0207657_10559860 | 3300025919 | Bacteria | 894 |
| 400 | Ga0207649_10023341 | 3300025920 | Bacteria | 3582 |
| 401 | Ga0207649_11401799 | 3300025920 | Bacteria | 553 |
| 402 | Ga0207652_10163960 | 3300025921 | Bacteria | 1992 |
| 403 | Ga0207646_10000096 | 3300025922 | Bacteria | 117197 |
| 404 | Ga0207646_10000913 | 3300025922 | Bacteria | 38056 |
| 405 | Ga0207646_10005894 | 3300025922 | Bacteria | 12792 |
| 406 | Ga0207646_10022563 | 3300025922 | Bacteria | 5796 |
| 407 | Ga0207646_10023414 | 3300025922 | Bacteria | 5672 |
| 408 | Ga0207646_10078339 | 3300025922 | Bacteria | 2954 |
| 409 | Ga0207646_10079676 | 3300025922 | Bacteria | 2928 |
| 410 | Ga0207646_10112559 | 3300025922 | Bacteria | 2443 |
| 411 | Ga0207646_10632147 | 3300025922 | Bacteria | 960 |
| 412 | Ga0207646_10720418 | 3300025922 | Bacteria | 891 |
| 413 | Ga0207681_10026813 | 3300025923 | Bacteria | 3720 |
| 414 | Ga0207694_10192080 | 3300025924 | Bacteria | 1659 |
| 415 | Ga0207694_10287111 | 3300025924 | Bacteria | 1352 |
| 416 | Ga0207650_10544859 | 3300025925 | Bacteria | 972 |
| 417 | Ga0207650_11287729 | 3300025925 | Bacteria | 622 |
| 418 | Ga0207650_11452329 | 3300025925 | Bacteria | 583 |
| 419 | Ga0207659_10161282 | 3300025926 | Bacteria | 1761 |
| 420 | Ga0207659_10393486 | 3300025926 | Bacteria | 1158 |
| 421 | Ga0207687_10045122 | 3300025927 | Unclassified | 3045 |
| 422 | Ga0207687_10271728 | 3300025927 | Bacteria | 1355 |
| 423 | Ga0207687_10508647 | 3300025927 | Bacteria | 1006 |
| 424 | Ga0207700_10000208 | 3300025928 | Bacteria | 35189 |
| 425 | Ga0207700_10001506 | 3300025928 | Bacteria | 13187 |
| 426 | Ga0207700_10033846 | 3300025928 | Bacteria | 3661 |
| 427 | Ga0207700_10049204 | 3300025928 | Bacteria | 3134 |
| 428 | Ga0207700_10092484 | 3300025928 | Bacteria | 2391 |
| 429 | Ga0207700_10310267 | 3300025928 | Bacteria | 1364 |
| 430 | Ga0207700_10431176 | 3300025928 | Bacteria | 1159 |
| 431 | Ga0207700_10445808 | 3300025928 | Bacteria | 1140 |
| 432 | Ga0207700_10632954 | 3300025928 | Bacteria | 953 |
| 433 | Ga0207700_11330782 | 3300025928 | Bacteria | 640 |
| 434 | Ga0207664_10000108 | 3300025929 | Bacteria | 72754 |
| 435 | Ga0207664_10000652 | 3300025929 | Bacteria | 23974 |
| 436 | Ga0207664_10006527 | 3300025929 | Bacteria | 8028 |
| 437 | Ga0207664_10016881 | 3300025929 | Bacteria | 5337 |
| 438 | Ga0207664_10020882 | 3300025929 | Bacteria | 4860 |
| 439 | Ga0207664_10069941 | 3300025929 | Bacteria | 2823 |
| 440 | Ga0207664_10194742 | 3300025929 | Bacteria | 1747 |
| 441 | Ga0207664_10285164 | 3300025929 | Bacteria | 1450 |
| 442 | Ga0207664_10410861 | 3300025929 | Bacteria | 1205 |
| 443 | Ga0207664_10738700 | 3300025929 | Bacteria | 885 |
| 444 | Ga0207644_10088932 | 3300025931 | Bacteria | 2298 |
| 445 | Ga0207644_10497020 | 3300025931 | Bacteria | 1006 |
| 446 | Ga0207644_11081192 | 3300025931 | Bacteria | 674 |
| 447 | Ga0207690_11538681 | 3300025932 | Bacteria | 556 |
| 448 | Ga0207706_10830157 | 3300025933 | Bacteria | 784 |
| 449 | Ga0207706_11155557 | 3300025933 | Bacteria | 645 |
| 450 | Ga0207706_11175918 | 3300025933 | Bacteria | 638 |
| 451 | Ga0207669_10061121 | 3300025937 | Bacteria | 2313 |
| 452 | Ga0207669_10158714 | 3300025937 | Bacteria | 1594 |
| 453 | Ga0207704_10096701 | 3300025938 | Bacteria | 1956 |
| 454 | Ga0207665_10000153 | 3300025939 | Bacteria | 46744 |
| 455 | Ga0207665_10007829 | 3300025939 | Bacteria | 7054 |
| 456 | Ga0207665_10010935 | 3300025939 | Bacteria | 5957 |
| 457 | Ga0207665_10308428 | 3300025939 | Bacteria | 1185 |
| 458 | Ga0207691_10017320 | 3300025940 | Bacteria | 6834 |
| 459 | Ga0207691_10017572 | 3300025940 | Bacteria | 6779 |
| 460 | Ga0207691_10742182 | 3300025940 | Bacteria | 827 |
| 461 | Ga0207711_10181774 | 3300025941 | Bacteria | 1913 |
| 462 | Ga0207711_10363797 | 3300025941 | Bacteria | 1340 |
| 463 | Ga0207711_10735721 | 3300025941 | Bacteria | 920 |
| 464 | Ga0207661_10133553 | 3300025944 | Bacteria | 2129 |
| 465 | Ga0207661_10366019 | 3300025944 | Bacteria | 1303 |
| 466 | Ga0207661_10445614 | 3300025944 | Bacteria | 1179 |
| 467 | Ga0207661_11200490 | 3300025944 | Bacteria | 698 |
| 468 | Ga0207661_11500679 | 3300025944 | Bacteria | 618 |
| 469 | Ga0207679_10354493 | 3300025945 | Bacteria | 1280 |
| 470 | Ga0207667_10061601 | 3300025949 | Bacteria | 3925 |
| 471 | Ga0207667_10196512 | 3300025949 | Bacteria | 2069 |
| 472 | Ga0207667_10422940 | 3300025949 | Bacteria | 1355 |
| 473 | Ga0207667_10462714 | 3300025949 | Bacteria | 1288 |
| 474 | Ga0207667_11266890 | 3300025949 | Bacteria | 715 |
| 475 | Ga0207651_11400599 | 3300025960 | Bacteria | 629 |
| 476 | Ga0207712_10100595 | 3300025961 | Bacteria | 2148 |
| 477 | Ga0207668_10520320 | 3300025972 | Bacteria | 1026 |
| 478 | Ga0207640_11087884 | 3300025981 | Bacteria | 707 |
| 479 | Ga0207640_11258837 | 3300025981 | Bacteria | 659 |
| 480 | Ga0207677_10121231 | 3300026023 | Bacteria | 1967 |
| 481 | Ga0207703_10191219 | 3300026035 | Bacteria | 1813 |
| 482 | Ga0207703_10211941 | 3300026035 | Bacteria | 1728 |
| 483 | Ga0207703_11023852 | 3300026035 | Bacteria | 792 |
| 484 | Ga0207639_10309470 | 3300026041 | Bacteria | 1399 |
| 485 | Ga0207639_10621887 | 3300026041 | Bacteria | 997 |
| 486 | Ga0207639_10622664 | 3300026041 | Bacteria | 997 |
| 487 | Ga0207639_11656431 | 3300026041 | Bacteria | 600 |
| 488 | Ga0207678_10162970 | 3300026067 | Bacteria | 1904 |
| 489 | Ga0207708_10010427 | 3300026075 | Bacteria | 6899 |
| 490 | Ga0207702_10013210 | 3300026078 | Bacteria | 6867 |
| 491 | Ga0207702_10115369 | 3300026078 | Bacteria | 2395 |
| 492 | Ga0207702_10127832 | 3300026078 | Bacteria | 2284 |
| 493 | Ga0207702_10251081 | 3300026078 | Bacteria | 1661 |
| 494 | Ga0207702_10478064 | 3300026078 | Bacteria | 1212 |
| 495 | Ga0207641_10078018 | 3300026088 | Bacteria | 2868 |
| 496 | Ga0207641_10316220 | 3300026088 | Bacteria | 1479 |
| 497 | Ga0207641_11536802 | 3300026088 | Bacteria | 667 |
| 498 | Ga0207648_10005680 | 3300026089 | Bacteria | 12515 |
| 499 | Ga0207648_10555708 | 3300026089 | Bacteria | 1055 |
| 500 | Ga0207676_10083480 | 3300026095 | Bacteria | 2602 |
| 501 | Ga0207674_10005230 | 3300026116 | Bacteria | 15448 |
| 502 | Ga0207674_10214387 | 3300026116 | Bacteria | 1874 |
| 503 | Ga0207674_10660886 | 3300026116 | Bacteria | 1009 |
| 504 | Ga0207674_11328395 | 3300026116 | Bacteria | 688 |
| 505 | Ga0207675_100083223 | 3300026118 | Bacteria | 3001 |
| 506 | Ga0207683_10081319 | 3300026121 | Bacteria | 2875 |
| 507 | Ga0207683_10170703 | 3300026121 | Bacteria | 1970 |
| 508 | Ga0207683_10956099 | 3300026121 | Bacteria | 795 |
| 509 | Ga0207683_11357671 | 3300026121 | Bacteria | 657 |
| 510 | Ga0207683_11733689 | 3300026121 | Bacteria | 574 |
| 511 | Ga0207698_10366444 | 3300026142 | Bacteria | 1366 |
| 512 | Ga0207698_12610938 | 3300026142 | Bacteria | 514 |
| 513 | Ga0209813_10466884 | 3300027866 | Bacteria | 519 |
| 514 | Ga0207428_11100078 | 3300027907 | Bacteria | 555 |
| 515 | Ga0268266_10205974 | 3300028379 | Bacteria | 1802 |
| 516 | Ga0268266_10307163 | 3300028379 | Bacteria | 1481 |
| 517 | Ga0268266_11771618 | 3300028379 | Bacteria | 592 |
| 518 | Ga0268265_10066323 | 3300028380 | Bacteria | 2790 |
| 519 | Ga0268264_10020547 | 3300028381 | Bacteria | 5395 |
| 520 | Ga0268264_10455089 | 3300028381 | Bacteria | 1241 |
| 521 | Ga0268264_10509985 | 3300028381 | Bacteria | 1174 |
| 522 | Ga0268264_11787458 | 3300028381 | Bacteria | 625 |
| 523 | Ga0268264_12378094 | 3300028381 | Bacteria | 536 |
| 524 | Ga0265336_10029909 | 3300028666 | Bacteria | 1697 |
| 525 | Ga0265338_10004219 | 3300028800 | Bacteria | 19560 |
| 526 | Ga0265762_1029976 | 3300030760 | Bacteria | 1030 |
| 527 | Ga0265775_100408 | 3300030762 | Bacteria | 1723 |
| 528 | Ga0265767_103009 | 3300030836 | Bacteria | 931 |
| 529 | Ga0265770_1075700 | 3300030878 | Bacteria | 650 |
| 530 | Ga0265770_1156947 | 3300030878 | Bacteria | 503 |
| 531 | Ga0265772_102273 | 3300030886 | Bacteria | 749 |
| 532 | Ga0265779_104757 | 3300031043 | Bacteria | 731 |
| 533 | Ga0265760_10283520 | 3300031090 | Unclassified | 583 |
| 534 | Ga0307408_100230583 | 3300031548 | Bacteria | 1516 |
| 535 | Ga0307408_100951638 | 3300031548 | Bacteria | 789 |
| 536 | Ga0310113_120032 | 3300031636 | Bacteria | 696 |
| 537 | Ga0316576_10017752 | 3300031727 | Bacteria | 4843 |
| 538 | Ga0316578_10008072 | 3300031728 | Bacteria | 5326 |
| 539 | Ga0316577_10011528 | 3300031733 | Bacteria | 4791 |
| 540 | Ga0316043_122996 | 3300031828 | Bacteria | 673 |
| 541 | Ga0307410_10155625 | 3300031852 | Bacteria | 1707 |
| 542 | Ga0307410_10628448 | 3300031852 | Bacteria | 898 |
| 543 | Ga0307406_12114092 | 3300031901 | Bacteria | 505 |
| 544 | Ga0307407_10380230 | 3300031903 | Bacteria | 1008 |
| 545 | Ga0307407_10533906 | 3300031903 | Unclassified | 865 |
| 546 | Ga0307412_10630795 | 3300031911 | Bacteria | 912 |
| 547 | Ga0307409_100071621 | 3300031995 | Bacteria | 2757 |
| 548 | Ga0307409_100886127 | 3300031995 | Bacteria | 905 |
| 549 | Ga0307409_101001411 | 3300031995 | Bacteria | 854 |
| 550 | Ga0307416_100904838 | 3300032002 | Bacteria | 983 |
| 551 | Ga0307416_101853021 | 3300032002 | Bacteria | 707 |
| 552 | Ga0307415_101914947 | 3300032126 | Bacteria | 576 |
| 553 | Ga0307415_102196122 | 3300032126 | Bacteria | 540 |
| 554 | Ga0316593_10351470 | 3300032168 | Bacteria | 564 |
| 555 | Ga0316588_1027473 | 3300033528 | Bacteria | 1322 |
| 556 | Ga0316214_1058218 | 3300033545 | Bacteria | 564 |
| 557 | Ga0373930_0009592 | 3300034816 | Bacteria | 1715 |
| 558 | Ga0373948_0006634 | 3300034817 | Bacteria | 1920 |
| 559 | Ga0373950_0026422 | 3300034818 | Bacteria | 1053 |
| 560 | Ga0373959_0039662 | 3300034820 | Bacteria | 983 |
| 561 | Ga0373938_0042615 | 3300034957 | Bacteria | 1013 |
| 562 | Ga0373926_0076877 | 3300035083 | Bacteria | 1231 |
| 563 | Ga0373926_0080036 | 3300035083 | Bacteria | 1207 |
| 564 | Ga0373926_0088325 | 3300035083 | Bacteria | 1151 |
| 565 | Ga0373928_0003638 | 3300035084 | Bacteria | 2939 |
| 566 | Ga0373929_0022314 | 3300035085 | Bacteria | 1291 |
| 567 | Ga0373934_0000014 | 3300035086 | Bacteria | 59312 |
| 568 | Ga0373934_0016558 | 3300035086 | Bacteria | 2802 |
| 569 | Ga0373934_0020829 | 3300035086 | Bacteria | 2523 |
| 570 | Ga0373934_0034213 | 3300035086 | Bacteria | 1996 |
| 571 | Ga0373934_0106900 | 3300035086 | Bacteria | 1133 |
| 572 | Ga0373940_0036537 | 3300035088 | Bacteria | 1334 |
| 573 | Ga0373944_0016313 | 3300035089 | Bacteria | 2093 |
| 574 | Ga0373944_0070879 | 3300035089 | Bacteria | 1135 |
| 575 | Ga0373944_0298320 | 3300035089 | Bacteria | 604 |
| 576 | Ga0373952_0256161 | 3300035092 | Bacteria | 531 |
| 577 | Ga0373923_0057809 | 3300035111 | Bacteria | 1641 |
| 578 | Ga0373923_0259795 | 3300035111 | Bacteria | 814 |
| 579 | Ga0373923_0445157 | 3300035111 | Bacteria | 627 |
| 580 | Ga0373923_0495191 | 3300035111 | Bacteria | 596 |
| 581 | Ga0373936_0022933 | 3300035113 | Bacteria | 2430 |
| 582 | Ga0373936_0274725 | 3300035113 | Bacteria | 756 |
| 583 | Ga0373939_0003426 | 3300035114 | Bacteria | 3718 |
| 584 | Ga0373941_0125737 | 3300035115 | Bacteria | 918 |
| 585 | Ga0373945_0126792 | 3300035116 | Bacteria | 1019 |
| 586 | Ga0373945_0274903 | 3300035116 | Bacteria | 716 |
| 587 | Ga0373945_0521918 | 3300035116 | Bacteria | 531 |
| 588 | Ga0373953_0000096 | 3300035117 | Bacteria | 21135 |
| 589 | Ga0373953_0019062 | 3300035117 | Bacteria | 2547 |
| 590 | Ga0373953_0362767 | 3300035117 | Bacteria | 635 |
| 591 | Ga0373954_0000675 | 3300035118 | Bacteria | 13087 |
| 592 | Ga0373954_0005492 | 3300035118 | Bacteria | 5485 |
| 593 | Ga0373954_0187365 | 3300035118 | Bacteria | 1015 |
| 594 | Ga0373954_0219848 | 3300035118 | Bacteria | 934 |
| 595 | Ga0373954_0232432 | 3300035118 | Bacteria | 907 |
| 596 | Ga0373954_0308421 | 3300035118 | Bacteria | 781 |
| 597 | Ga0373956_0000506 | 3300035119 | Bacteria | 15926 |
| 598 | Ga0373956_0006083 | 3300035119 | Bacteria | 4830 |
| 599 | Ga0373956_0043829 | 3300035119 | Bacteria | 1992 |
| 600 | Ga0373956_0055911 | 3300035119 | Bacteria | 1780 |
| 601 | Ga0373957_0001124 | 3300035120 | Bacteria | 7096 |
| 602 | Ga0373957_0007197 | 3300035120 | Bacteria | 3550 |
| 603 | Ga0373957_0020704 | 3300035120 | Bacteria | 2327 |
| 604 | Ga0373957_0243880 | 3300035120 | Bacteria | 755 |
| 605 | Ga0373960_0039434 | 3300035121 | Bacteria | 1358 |
| 606 | Ga0373943_0055049 | 3300035170 | Bacteria | 1969 |
| 607 | Ga0373943_0081542 | 3300035170 | Bacteria | 1659 |
| 608 | Ga0373943_0124009 | 3300035170 | Bacteria | 1375 |
| 609 | Ga0373943_0249445 | 3300035170 | Bacteria | 996 |
| 610 | Ga0373943_0853659 | 3300035170 | Bacteria | 543 |
| 611 | Ga0373946_0020106 | 3300035171 | Bacteria | 2578 |
| 612 | Ga0373946_0155007 | 3300035171 | Bacteria | 1071 |
| 613 | Ga0373946_0276136 | 3300035171 | Bacteria | 825 |
| 614 | Ga0373955_0000040 | 3300035172 | Bacteria | 51762 |
| 615 | Ga0373955_0005314 | 3300035172 | Bacteria | 5782 |
| 616 | Ga0373955_0025872 | 3300035172 | Bacteria | 3018 |
| 617 | Ga0373955_0030416 | 3300035172 | Bacteria | 2819 |
| 618 | Ga0373942_0167403 | 3300035207 | Bacteria | 714 |
| 619 | Ga0316574_0001226 | 3300035398 | Bacteria | 11928 |
| 620 | Ga0316574_0088763 | 3300035398 | Bacteria | 1969 |
| 621 | Ga0373924_0003168 | 3300035410 | Bacteria | 5624 |
| 622 | Ga0373924_0038561 | 3300035410 | Bacteria | 1949 |
| 623 | Ga0373924_0068770 | 3300035410 | Bacteria | 1491 |
| 624 | Ga0373924_0089218 | 3300035410 | Bacteria | 1318 |
| 625 | Ga0373924_0089376 | 3300035410 | Bacteria | 1316 |
| 626 | Ga0373931_0147028 | 3300035691 | Bacteria | 1371 |
| 627 | Ga0373931_0196553 | 3300035691 | Bacteria | 1202 |
| 628 | Ga0373931_0331832 | 3300035691 | Bacteria | 947 |
| 629 | Ga0373931_0520111 | 3300035691 | Bacteria | 770 |
| 630 | Ga0373931_0658952 | 3300035691 | Bacteria | 688 |
| 631 | Ga0373935_0005512 | 3300035692 | Bacteria | 7454 |
| 632 | Ga0373935_0231254 | 3300035692 | Bacteria | 1287 |
| 633 | Ga0373935_0400568 | 3300035692 | Bacteria | 985 |
| 634 | Ga0373935_1239423 | 3300035692 | Bacteria | 556 |
| 635 | Ga0373935_1472241 | 3300035692 | Bacteria | 510 |
| 636 | Ga0373927_0150765 | 3300035695 | Bacteria | 1522 |
| 637 | Ga0373927_0259108 | 3300035695 | Bacteria | 1143 |
| 638 | Ga0373927_1010704 | 3300035695 | Bacteria | 548 |
| 639 | Ga0373933_0000085 | 3300035724 | Bacteria | 59115 |
| 640 | Ga0373933_0043337 | 3300035724 | Bacteria | 2662 |
| 641 | Ga0373933_0047667 | 3300035724 | Bacteria | 2549 |
| 642 | Ga0373933_0063629 | 3300035724 | Bacteria | 2230 |
| 643 | Ga0373933_0106008 | 3300035724 | Bacteria | 1748 |
| 644 | Ga0373947_0000195 | 3300035725 | Bacteria | 33609 |
| 645 | Ga0373947_0302687 | 3300035725 | Bacteria | 1066 |
| 646 | Ga0373947_0458696 | 3300035725 | Bacteria | 863 |
| 647 | Ga0373947_0576344 | 3300035725 | Bacteria | 766 |
| 648 | Ga0373947_0748862 | 3300035725 | Bacteria | 667 |
| 649 | Ga0373937_0000197 | 3300036401 | Bacteria | 59124 |
| 650 | Ga0373937_0000859 | 3300036401 | Bacteria | 26083 |
| 651 | Ga0373937_0024567 | 3300036401 | Bacteria | 5437 |
| 652 | Ga0373937_0041264 | 3300036401 | Bacteria | 4209 |
| 653 | Ga0373937_0171223 | 3300036401 | Bacteria | 2037 |
| 654 | Ga0373937_0483943 | 3300036401 | Bacteria | 1175 |
| 655 | Ga0265778_017865 | 3300036457 | Bacteria | 859 |
| 656 | Ga0372808_018957 | 3300036459 | Bacteria | 989 |
| 657 | Ga0372808_071145 | 3300036459 | Bacteria | 503 |
| 658 | Ga0310109_017307 | 3300036534 | Bacteria | 974 |
| 659 | Ga0310110_037020 | 3300036535 | Bacteria | 615 |
| 660 | Ga0316582_0173590 | 3300036647 | Bacteria | 1464 |
| 661 | Ga0316582_0493729 | 3300036647 | Bacteria | 844 |
| 662 | Ga0316584_0066676 | 3300036712 | Bacteria | 2697 |
| 663 | Ga0373925_0034101 | 3300037068 | Bacteria | 3751 |
| 664 | Ga0373925_0293585 | 3300037068 | Bacteria | 1311 |
| 665 | Ga0373925_0429135 | 3300037068 | Bacteria | 1080 |
| 666 | Ga0373925_0941052 | 3300037068 | Bacteria | 712 |
| 667 | Ga0373925_1304912 | 3300037068 | Bacteria | 595 |
| 668 | Ga0436364_0188941 | 3300037853 | Bacteria | 4808 |
| 669 | Ga0436364_0303129 | 3300037853 | Bacteria | 102080 |
| 670 | Ga0436364_0473877 | 3300037853 | Bacteria | 2145 |
| 671 | Ga0436364_0875353 | 3300037853 | Bacteria | 55373 |
| 672 | Ga0436364_0876629 | 3300037853 | Bacteria | 1196 |
| 673 | Ga0395901_0334151 | 3300038443 | Unclassified | 1566 |
| 674 | Ga0242420_065571 | 3300038996 | Bacteria | 731 |
| 675 | Ga0436361_0599980 | 3300039447 | Bacteria | 1044 |
| 676 | Ga0436363_0225853 | 3300039450 | Bacteria | 733 |
| 677 | Ga0436363_0338172 | 3300039450 | Bacteria | 1831 |
| 678 | Ga0436363_1250789 | 3300039450 | Bacteria | 1357 |
| 679 | Ga0436363_1357246 | 3300039450 | Bacteria | 564 |
| 680 | Ga0436362_0056231 | 3300039453 | Bacteria | 1216 |
| 681 | Ga0436362_0844715 | 3300039453 | Bacteria | 1139 |
| 682 | Ga0451804_0730933 | 3300041463 | Unclassified | 910 |
| 683 | Ga0451807_1366442 | 3300041486 | Bacteria | 559 |
| 684 | Ga0451855_0597846 | 3300041511 | Unclassified | 524 |
| 685 | Ga0466966_0116711 | 3300044684 | Bacteria | 1643 |
| 686 | Ga0466966_0309983 | 3300044684 | Bacteria | 949 |
| 687 | Ga0466964_0235673 | 3300044706 | Bacteria | 895 |
| 688 | Ga0466964_0383725 | 3300044706 | Bacteria | 730 |
| 689 | Ga0451576_0000327 | 3300045051 | Bacteria | 115197 |
| 690 | Ga0466967_0409578 | 3300045976 | Bacteria | 1320 |
| 691 | Ga0495592_0000157 | 3300046454 | Bacteria | 59697 |
| 692 | Ga0495592_0007117 | 3300046454 | Bacteria | 8373 |
| 693 | Ga0495592_0088375 | 3300046454 | Bacteria | 2227 |
| 694 | Ga0495592_0439403 | 3300046454 | Bacteria | 819 |
| 695 | Ga0495603_0093688 | 3300046455 | Bacteria | 1755 |
| 696 | Ga0495603_0473144 | 3300046455 | Bacteria | 717 |
| 697 | Ga0495629_0017621 | 3300046459 | Bacteria | 5120 |
| 698 | Ga0495629_0422482 | 3300046459 | Bacteria | 904 |
| 699 | Ga0495641_0010809 | 3300046461 | Bacteria | 5250 |
| 700 | Ga0495641_0024093 | 3300046461 | Bacteria | 3009 |
| 701 | Ga0495641_0031029 | 3300046461 | Bacteria | 2557 |
| 702 | Ga0495641_0236431 | 3300046461 | Bacteria | 820 |
| 703 | Ga0495651_0000115 | 3300046462 | Bacteria | 59129 |
| 704 | Ga0495651_0008585 | 3300046462 | Bacteria | 7831 |
| 705 | Ga0495651_0015867 | 3300046462 | Bacteria | 5832 |
| 706 | Ga0495651_0081108 | 3300046462 | Bacteria | 2449 |
| 707 | Ga0495653_0001269 | 3300046463 | Bacteria | 19535 |
| 708 | Ga0495653_0015090 | 3300046463 | Bacteria | 6296 |
| 709 | Ga0495653_0038301 | 3300046463 | Bacteria | 3763 |
| 710 | Ga0495653_0049617 | 3300046463 | Bacteria | 3232 |
| 711 | Ga0495653_0106127 | 3300046463 | Bacteria | 2026 |
| 712 | Ga0495653_0177048 | 3300046463 | Unclassified | 1467 |
| 713 | Ga0495653_0238969 | 3300046463 | Bacteria | 1212 |
| 714 | Ga0495580_0017290 | 3300046472 | Bacteria | 5397 |
| 715 | Ga0495580_0059974 | 3300046472 | Bacteria | 2673 |
| 716 | Ga0495580_0343509 | 3300046472 | Bacteria | 1012 |
| 717 | Ga0495582_0018891 | 3300046473 | Bacteria | 3770 |
| 718 | Ga0495582_0725455 | 3300046473 | Bacteria | 575 |
| 719 | Ga0495639_0104780 | 3300046475 | Bacteria | 1338 |
| 720 | Ga0495639_0365787 | 3300046475 | Bacteria | 725 |
| 721 | Ga0495639_0516709 | 3300046475 | Bacteria | 610 |
| 722 | Ga0495662_0110634 | 3300046476 | Bacteria | 1346 |
| 723 | Ga0495662_0143651 | 3300046476 | Bacteria | 1175 |
| 724 | Ga0495664_0096499 | 3300046477 | Bacteria | 1779 |
| 725 | Ga0495664_0724907 | 3300046477 | Bacteria | 587 |
| 726 | Ga0495594_0098468 | 3300046499 | Bacteria | 1644 |
| 727 | Ga0495594_0396881 | 3300046499 | Bacteria | 785 |
| 728 | Ga0495608_0000157 | 3300046511 | Bacteria | 48714 |
| 729 | Ga0495608_0005803 | 3300046511 | Bacteria | 8797 |
| 730 | Ga0495608_0016774 | 3300046511 | Bacteria | 5068 |
| 731 | Ga0495608_0181300 | 3300046511 | Unclassified | 1332 |
| 732 | Ga0495618_0019815 | 3300046514 | Bacteria | 4141 |
| 733 | Ga0495618_0061436 | 3300046514 | Bacteria | 2383 |
| 734 | Ga0495618_0077977 | 3300046514 | Bacteria | 2111 |
| 735 | Ga0495628_0000492 | 3300046516 | Bacteria | 36145 |
| 736 | Ga0495628_0037350 | 3300046516 | Bacteria | 3894 |
| 737 | Ga0495628_0170409 | 3300046516 | Bacteria | 1651 |
| 738 | Ga0495630_0000704 | 3300046517 | Bacteria | 23798 |
| 739 | Ga0495630_0031948 | 3300046517 | Bacteria | 3920 |
| 740 | Ga0495630_0096381 | 3300046517 | Bacteria | 2236 |
| 741 | Ga0495630_0521367 | 3300046517 | Bacteria | 911 |
| 742 | Ga0495666_0080589 | 3300046526 | Bacteria | 1540 |
| 743 | Ga0495666_0201777 | 3300046526 | Bacteria | 914 |
| 744 | Ga0495652_0001666 | 3300046529 | Bacteria | 24105 |
| 745 | Ga0495652_0014911 | 3300046529 | Bacteria | 6966 |
| 746 | Ga0495652_0195190 | 3300046529 | Bacteria | 1541 |
| 747 | Ga0495652_0199504 | 3300046529 | Bacteria | 1519 |
| 748 | Ga0495652_0492977 | 3300046529 | Unclassified | 851 |
| 749 | Ga0495665_0046857 | 3300046531 | Bacteria | 2294 |
| 750 | Ga0495665_0256081 | 3300046531 | Bacteria | 900 |
| 751 | Ga0495640_0018497 | 3300046533 | Bacteria | 5164 |
| 752 | Ga0495640_0067864 | 3300046533 | Bacteria | 2401 |
| 753 | Ga0495640_0092821 | 3300046533 | Bacteria | 1990 |
| 754 | Ga0495640_0457639 | 3300046533 | Bacteria | 779 |
| 755 | Ga0495586_0086587 | 3300046535 | Bacteria | 1727 |
| 756 | Ga0495586_0132069 | 3300046535 | Bacteria | 1398 |
| 757 | Ga0495586_0491999 | 3300046535 | Unclassified | 708 |
| 758 | Ga0495587_0000123 | 3300046536 | Bacteria | 59101 |
| 759 | Ga0495587_0024822 | 3300046536 | Bacteria | 3670 |
| 760 | Ga0495587_0042122 | 3300046536 | Bacteria | 2723 |
| 761 | Ga0495598_0268427 | 3300046537 | Bacteria | 637 |
| 762 | Ga0495645_0179720 | 3300046543 | Bacteria | 1450 |
| 763 | Ga0495645_0187274 | 3300046543 | Bacteria | 1413 |
| 764 | Ga0495645_0188426 | 3300046543 | Bacteria | 1408 |
| 765 | Ga0495667_0000107 | 3300046559 | Bacteria | 60366 |
| 766 | Ga0495667_0023793 | 3300046559 | Bacteria | 4125 |
| 767 | Ga0495667_0035901 | 3300046559 | Bacteria | 3311 |
| 768 | Ga0495667_0110091 | 3300046559 | Bacteria | 1779 |
| 769 | Ga0495667_0710730 | 3300046559 | Bacteria | 622 |
| 770 | Ga0495656_0630561 | 3300046615 | Bacteria | 575 |
| 771 | Ga0495634_0021291 | 3300046642 | Bacteria | 4585 |
| 772 | Ga0495634_0079421 | 3300046642 | Bacteria | 2148 |
| 773 | Ga0495634_0659152 | 3300046642 | Unclassified | 604 |
| 774 | Ga0495635_0035305 | 3300046663 | Bacteria | 3466 |
| 775 | Ga0495635_0097311 | 3300046663 | Bacteria | 2011 |
| 776 | Ga0495635_0122397 | 3300046663 | Bacteria | 1774 |
| 777 | Ga0495635_0211128 | 3300046663 | Bacteria | 1314 |
| 778 | Ga0495635_0599619 | 3300046663 | Bacteria | 719 |
| 779 | Ga0495657_0000169 | 3300046675 | Bacteria | 59112 |
| 780 | Ga0495657_0011153 | 3300046675 | Bacteria | 6731 |
| 781 | Ga0495657_0063435 | 3300046675 | Bacteria | 2437 |
| 782 | Ga0495657_0618321 | 3300046675 | Unclassified | 626 |
| 783 | Ga0495599_0000129 | 3300046678 | Bacteria | 48682 |
| 784 | Ga0495599_0007746 | 3300046678 | Bacteria | 6519 |
| 785 | Ga0495599_0141122 | 3300046678 | Bacteria | 1494 |
| 786 | Ga0495599_0160450 | 3300046678 | Bacteria | 1390 |
| 787 | Ga0495599_0236898 | 3300046678 | Bacteria | 1113 |
| 788 | Ga0495599_0366391 | 3300046678 | Bacteria | 862 |
| 789 | Ga0495623_0000166 | 3300046679 | Bacteria | 41152 |
| 790 | Ga0495623_0018966 | 3300046679 | Bacteria | 4441 |
| 791 | Ga0495623_0025353 | 3300046679 | Bacteria | 3819 |
| 792 | Ga0495623_0027458 | 3300046679 | Bacteria | 3662 |
| 793 | Ga0495623_0163146 | 3300046679 | Bacteria | 1308 |
| 794 | Ga0495646_0048031 | 3300046680 | Bacteria | 2595 |
| 795 | Ga0495646_0338701 | 3300046680 | Bacteria | 789 |
| 796 | Ga0495647_0035681 | 3300046681 | Bacteria | 1868 |
| 797 | Ga0495658_0050594 | 3300046683 | Bacteria | 2351 |
| 798 | Ga0495658_0066913 | 3300046683 | Bacteria | 2077 |
| 799 | Ga0495613_0115698 | 3300046689 | Bacteria | 1929 |
| 800 | Ga0495613_0169418 | 3300046689 | Bacteria | 1550 |
| 801 | Ga0495613_0197320 | 3300046689 | Unclassified | 1420 |
| 802 | Ga0495624_0026458 | 3300046690 | Bacteria | 3802 |
| 803 | Ga0495624_0048030 | 3300046690 | Bacteria | 2710 |
| 804 | Ga0495624_0124948 | 3300046690 | Bacteria | 1579 |
| 805 | Ga0495624_0400897 | 3300046690 | Bacteria | 823 |
| 806 | Ga0495600_0005205 | 3300046809 | Bacteria | 7820 |
| 807 | Ga0495600_0029746 | 3300046809 | Bacteria | 3537 |
| 808 | Ga0495600_0038660 | 3300046809 | Bacteria | 3105 |
| 809 | Ga0495600_0141580 | 3300046809 | Bacteria | 1560 |
| 810 | Ga0495600_0282301 | 3300046809 | Bacteria | 1051 |
| 811 | Ga0495600_0307826 | 3300046809 | Bacteria | 998 |
| 812 | Ga0495581_0092546 | 3300047315 | Bacteria | 1755 |
| 813 | Ga0495581_0149945 | 3300047315 | Bacteria | 1361 |
| 814 | Ga0495581_0205475 | 3300047315 | Bacteria | 1152 |
| 815 | Ga0495581_0650711 | 3300047315 | Bacteria | 609 |
| 816 | Ga0495604_0000161 | 3300047317 | Bacteria | 59093 |
| 817 | Ga0495604_0021329 | 3300047317 | Bacteria | 5171 |
| 818 | Ga0495604_0022314 | 3300047317 | Bacteria | 5053 |
| 819 | Ga0495674_0031694 | 3300047319 | Bacteria | 4799 |
| 820 | Ga0495674_0070796 | 3300047319 | Bacteria | 3013 |
| 821 | Ga0495674_0106094 | 3300047319 | Bacteria | 2386 |
| 822 | Ga0495674_0117037 | 3300047319 | Bacteria | 2254 |
| 823 | Ga0495674_0148391 | 3300047319 | Bacteria | 1967 |
| 824 | Ga0495674_0687951 | 3300047319 | Bacteria | 803 |
| 825 | Ga0495676_0159945 | 3300047321 | Bacteria | 1594 |
| 826 | Ga0495680_0000395 | 3300047322 | Bacteria | 48768 |
| 827 | Ga0495680_0027978 | 3300047322 | Bacteria | 4626 |
| 828 | Ga0495680_0061015 | 3300047322 | Bacteria | 2902 |
| 829 | Ga0495680_0075647 | 3300047322 | Bacteria | 2554 |
| 830 | Ga0495680_0544004 | 3300047322 | Bacteria | 783 |
| 831 | Ga0495675_0000277 | 3300047444 | Bacteria | 37154 |
| 832 | Ga0495675_0001985 | 3300047444 | Bacteria | 12218 |
| 833 | Ga0495675_0011289 | 3300047444 | Bacteria | 5605 |
| 834 | Ga0495675_0058257 | 3300047444 | Bacteria | 2449 |
| 835 | Ga0495675_0216178 | 3300047444 | Bacteria | 1162 |
| 836 | Ga0495675_0235840 | 3300047444 | Bacteria | 1103 |
| 837 | Ga0495684_0006066 | 3300047471 | Bacteria | 9394 |
| 838 | Ga0495684_0064659 | 3300047471 | Bacteria | 2780 |
| 839 | Ga0495684_0116686 | 3300047471 | Bacteria | 2012 |
| 840 | Ga0495684_0120509 | 3300047471 | Bacteria | 1976 |
| 841 | Ga0495684_0120709 | 3300047471 | Bacteria | 1974 |
| 842 | Ga0495684_0157550 | 3300047471 | Bacteria | 1695 |
| 843 | Ga0495684_0303013 | 3300047471 | Bacteria | 1147 |
| 844 | Ga0495684_0544419 | 3300047471 | Bacteria | 791 |
| 845 | Ga0495593_0012129 | 3300047673 | Bacteria | 4931 |
| 846 | Ga0495602_0000182 | 3300048088 | Bacteria | 59124 |
| 847 | Ga0495602_0006022 | 3300048088 | Bacteria | 12734 |
| 848 | Ga0495602_0015749 | 3300048088 | Bacteria | 7617 |
| 849 | Ga0495602_0025045 | 3300048088 | Bacteria | 5781 |
| 850 | Ga0495614_0206996 | 3300048089 | Bacteria | 889 |
| 851 | Ga0495614_0221704 | 3300048089 | Bacteria | 860 |
| 852 | Ga0495614_0246333 | 3300048089 | Bacteria | 816 |
| 853 | Ga0495614_0363093 | 3300048089 | Bacteria | 676 |
| 854 | Ga0496100_0108694 | 3300048903 | Bacteria | 1923 |
| 855 | Ga0496100_0161420 | 3300048903 | Bacteria | 1607 |
| 856 | Ga0496101_0034687 | 3300048904 | Bacteria | 3566 |
| 857 | Ga0496101_1537138 | 3300048904 | Bacteria | 518 |
| 858 | Ga0496102_0766486 | 3300048905 | Bacteria | 887 |
| 859 | Ga0496102_0956472 | 3300048905 | Bacteria | 777 |
| 860 | Ga0496104_0020438 | 3300048907 | Bacteria | 6069 |
| 861 | Ga0496104_0033085 | 3300048907 | Bacteria | 4813 |
| 862 | Ga0496104_0075679 | 3300048907 | Bacteria | 3205 |
| 863 | Ga0496104_0105643 | 3300048907 | Bacteria | 2698 |
| 864 | Ga0496104_0429188 | 3300048907 | Bacteria | 1233 |
| 865 | Ga0496105_0002275 | 3300048908 | Bacteria | 13934 |
| 866 | Ga0496105_0081192 | 3300048908 | Bacteria | 2678 |
| 867 | Ga0496105_0094368 | 3300048908 | Bacteria | 2471 |
| 868 | Ga0496106_0298536 | 3300048909 | Bacteria | 1291 |
| 869 | Ga0496106_0333548 | 3300048909 | Bacteria | 1218 |
| 870 | Ga0496107_0087579 | 3300048910 | Bacteria | 2273 |
| 871 | Ga0496108_0002330 | 3300048911 | Bacteria | 15212 |
| 872 | Ga0496108_0041572 | 3300048911 | Bacteria | 3838 |
| 873 | Ga0496108_0054006 | 3300048911 | Bacteria | 3371 |
| 874 | Ga0496108_0714370 | 3300048911 | Bacteria | 868 |
| 875 | Ga0496109_0053471 | 3300048912 | Bacteria | 3683 |
| 876 | Ga0496109_0749167 | 3300048912 | Bacteria | 914 |
| 877 | Ga0496109_1025623 | 3300048912 | Bacteria | 762 |
| 878 | Ga0496110_0007267 | 3300048913 | Bacteria | 8829 |
| 879 | Ga0496110_0042417 | 3300048913 | Bacteria | 3971 |
| 880 | Ga0496110_0066558 | 3300048913 | Bacteria | 3186 |
| 881 | Ga0496110_0699424 | 3300048913 | Bacteria | 915 |
| 882 | Ga0496110_1755996 | 3300048913 | Bacteria | 530 |
| 883 | Ga0496111_0032735 | 3300048914 | Bacteria | 3707 |
| 884 | Ga0496111_1310780 | 3300048914 | Bacteria | 510 |
| 885 | Ga0496112_0105729 | 3300048915 | Bacteria | 2784 |
| 886 | Ga0496112_0161178 | 3300048915 | Bacteria | 2210 |
| 887 | Ga0496112_0191433 | 3300048915 | Bacteria | 2007 |
| 888 | Ga0496113_0141140 | 3300048916 | Bacteria | 1895 |
| 889 | Ga0496114_0559399 | 3300048917 | Bacteria | 1010 |
| 890 | Ga0496115_0009458 | 3300048918 | Bacteria | 7239 |
| 891 | Ga0496115_0011285 | 3300048918 | Bacteria | 6695 |
| 892 | Ga0496115_0193421 | 3300048918 | Bacteria | 1681 |
| 893 | Ga0501309_086441 | 3300049129 | Bacteria | 531 |
| 894 | Ga0501310_052071 | 3300049130 | Unclassified | 594 |
| 895 | Ga0501298_023255 | 3300049521 | Bacteria | 1173 |
| 896 | Ga0501034_0128692 | 3300049571 | Bacteria | 2516 |
| 897 | Ga0501036_1693264 | 3300049572 | Bacteria | 510 |
| 898 | Ga0501042_0123474 | 3300049578 | Bacteria | 1864 |
| 899 | Ga0501047_0414081 | 3300049581 | Bacteria | 1180 |
| 900 | Ga0501070_0133729 | 3300049586 | Bacteria | 2048 |
| 901 | Ga0501071_0516673 | 3300049587 | Bacteria | 916 |
| 902 | Ga0501080_0403465 | 3300049742 | Bacteria | 1230 |
| 903 | nmdc:mga0k408_111314_c1 | 3300050493 | Bacteria | 1618 |
| 904 | nmdc:mga0k408_629615_c1 | 3300050493 | Bacteria | 632 |
| 905 | nmdc:mga05p37_2306_c1 | 3300050507 | Bacteria | 22258 |
| 906 | nmdc:mga0qj67_15845_c1 | 3300050509 | Bacteria | 5708 |
| 907 | nmdc:mga0qj67_214985_c1 | 3300050509 | Bacteria | 1561 |
| 908 | nmdc:mga06r32_23029_c1 | 3300050510 | Bacteria | 5761 |
| 909 | nmdc:mga06r32_258386_c1 | 3300050510 | Bacteria | 1729 |
| 910 | nmdc:mga08y16_603568_c1 | 3300050511 | Bacteria | 1106 |
| 911 | nmdc:mga08y16_71882_c1 | 3300050511 | Bacteria | 3605 |
| 912 | nmdc:mga0n895_1644616_c1 | 3300050512 | Bacteria | 606 |
| 913 | nmdc:mga0n895_1676745_c1 | 3300050512 | Bacteria | 599 |
| 914 | nmdc:mga0n895_232641_c1 | 3300050512 | Bacteria | 1870 |
| 915 | nmdc:mga0n895_8584_c1 | 3300050512 | Bacteria | 8861 |
| 916 | nmdc:mga0n895_884259_c1 | 3300050512 | Bacteria | 880 |
| 917 | nmdc:mga0rr50_243298_c1 | 3300050513 | Bacteria | 1492 |
| 918 | nmdc:mga0rr50_262907_c1 | 3300050513 | Bacteria | 1436 |
| 919 | nmdc:mga0rr50_431198_c1 | 3300050513 | Bacteria | 1116 |
| 920 | nmdc:mga0rr50_553386_c1 | 3300050513 | Bacteria | 980 |
| 921 | nmdc:mga0rr50_592672_c1 | 3300050513 | Bacteria | 945 |
| 922 | nmdc:mga08x19_134993_c1 | 3300050514 | Bacteria | 1663 |
| 923 | nmdc:mga08x19_177911_c1 | 3300050514 | Bacteria | 1451 |
| 924 | nmdc:mga08x19_305082_c1 | 3300050514 | Bacteria | 1106 |
| 925 | nmdc:mga0a205_115359_c1 | 3300050515 | Bacteria | 2585 |
| 926 | Ga0495601_0009245 | 3300053077 | Bacteria | 5826 |
| 927 | Ga0495601_0061262 | 3300053077 | Bacteria | 2388 |
| 928 | Ga0495612_0015816 | 3300053078 | Bacteria | 3024 |
| 929 | Ga0495612_0059076 | 3300053078 | Bacteria | 1585 |
| 930 | Ga0495595_0067128 | 3300053084 | Bacteria | 1690 |
| 931 | Ga0495619_0302206 | 3300053085 | Bacteria | 1108 |
| 932 | Ga0495619_0318545 | 3300053085 | Bacteria | 1076 |
| 933 | Ga0495619_0723796 | 3300053085 | Bacteria | 676 |
| 934 | Ga0587066_044076 | 3300059490 | Bacteria | 852 |
| 935 | Ga0587066_132894 | 3300059490 | Bacteria | 600 |
| 936 | Ga0587073_0080425 | 3300059492 | Bacteria | 808 |
| 937 | Ga0587073_0083348 | 3300059492 | Bacteria | 798 |
| 938 | Ga0587073_0253626 | 3300059492 | Bacteria | 553 |
| 939 | Ga0587077_197900 | 3300059493 | Bacteria | 554 |
| 940 | Ga0587080_036176 | 3300059503 | Bacteria | 882 |
| 941 | Ga0587080_173305 | 3300059503 | Bacteria | 513 |
| 942 | Ga0587083_0048247 | 3300059505 | Bacteria | 919 |
| 943 | Ga0587083_0067486 | 3300059505 | Bacteria | 822 |
| 944 | Ga0587085_023820 | 3300059506 | Bacteria | 955 |
| 945 | Ga0587085_066241 | 3300059506 | Unclassified | 695 |
| 946 | Ga0587085_127718 | 3300059506 | Bacteria | 565 |
| 947 | Ga0587088_051657 | 3300059508 | Bacteria | 807 |
| 948 | Ga0587089_077022 | 3300059509 | Bacteria | 575 |
| 949 | Ga0587091_028934 | 3300059511 | Bacteria | 1026 |
| 950 | Ga0587092_119908 | 3300059512 | Bacteria | 561 |
| 951 | Ga0587094_053819 | 3300059513 | Bacteria | 688 |
| 952 | Ga0587098_030580 | 3300059604 | Bacteria | 739 |
| 953 | Ga0587106_029350 | 3300059605 | Bacteria | 873 |
| 954 | Ga0587106_057517 | 3300059605 | Bacteria | 706 |
| 955 | Ga0587129_028600 | 3300059608 | Bacteria | 527 |
| 956 | Ga0587099_024271 | 3300059622 | Bacteria | 704 |
| 957 | Ga0587115_024370 | 3300059626 | Bacteria | 863 |
| 958 | Ga0587115_025511 | 3300059626 | Bacteria | 850 |
| 959 | Ga0587062_106805 | 3300059639 | Bacteria | 551 |
| 960 | Ga0587069_093977 | 3300059642 | Bacteria | 603 |
| 961 | Ga0587072_088687 | 3300059643 | Bacteria | 679 |
| 962 | Ga0587075_035518 | 3300059644 | Bacteria | 813 |
| 963 | Ga0587075_038477 | 3300059644 | Bacteria | 792 |
| 964 | Ga0587075_047949 | 3300059644 | Bacteria | 737 |
| 965 | Ga0587078_053510 | 3300059646 | Bacteria | 597 |
| 966 | Ga0587079_151950 | 3300059647 | Bacteria | 599 |
| 967 | Ga0587107_022589 | 3300059652 | Bacteria | 891 |
| 968 | Ga0587107_031979 | 3300059652 | Bacteria | 806 |
| 969 | Ga0587107_037604 | 3300059652 | Bacteria | 767 |
| 970 | Ga0587107_065587 | 3300059652 | Bacteria | 651 |
| 971 | Ga0587114_070961 | 3300059655 | Bacteria | 631 |
| 972 | Ga0587116_08021 | 3300059656 | Bacteria | 678 |
| 973 | Ga0587071_109506 | 3300060344 | Bacteria | 648 |
| 974 | Ga0587111_0188745 | 3300060346 | Unclassified | 577 |
| 975 | 2990050122 | 2990044586 | Bacteria | 6603797 |
| 976 | 8056065457 | 8056060235 | Bacteria | 7259403 |
| 977 | Ga0070708_101538938 | |||
| 978 | Ga0058862_10044764 | |||
| 979 | Ga0065707_10082794 | |||
| 980 | Ga0070658_10816914 | |||
| 981 | Ga0070658_11003980 | |||
| 982 | Ga0070676_11262207 | |||
| 983 | Ga0070683_100573657 | |||
| 984 | Ga0070670_101632167 | |||
| 985 | Ga0070677_10352690 | |||
| 986 | Ga0068869_100167989 | |||
| 987 | Ga0068869_101579171 | |||
| 988 | Ga0070666_10175764 | |||
| 989 | Ga0070666_10222099 | |||
| 990 | Ga0070680_100218942 | |||
| 991 | Ga0070680_101237863 | |||
| 992 | Ga0070682_100071490 | |||
| 993 | Ga0070682_100325543 | |||
| 994 | Ga0070682_101582171 | |||
| 995 | Ga0068868_102002229 | |||
| 996 | Ga0068868_102018053 | |||
| 997 | Ga0070660_100707123 | |||
| 998 | Ga0070660_100968934 | |||
| 999 | Ga0070660_101747887 | |||
| 1000 | Ga0070689_101884571 | |||
| 1001 | Ga0070691_10041703 | |||
| 1002 | Ga0070661_100024970 | |||
| 1003 | Ga0070669_100047826 | |||
| 1004 | Ga0070669_100130671 | |||
| 1005 | Ga0070675_100766646 | |||
| 1006 | Ga0070675_100872775 | |||
| 1007 | Ga0070671_100015641 | |||
| 1008 | Ga0070671_101464859 | |||
| 1009 | Ga0070674_100019188 | |||
| 1010 | Ga0070674_100242849 | |||
| 1011 | Ga0070673_101417359 | |||
| 1012 | Ga0070673_101512272 | |||
| 1013 | Ga0070709_10014574 | |||
| 1014 | Ga0070709_10043900 | |||
| 1015 | Ga0070709_10044658 | |||
| 1016 | Ga0070709_10119093 | |||
| 1017 | Ga0070709_10140570 | |||
| 1018 | Ga0070709_10328443 | |||
| 1019 | Ga0070709_11047221 | |||
| 1020 | Ga0070714_100000829 | |||
| 1021 | Ga0070714_100008120 | |||
| 1022 | Ga0070714_100022560 | |||
| 1023 | Ga0070714_100041831 | |||
| 1024 | Ga0070714_100094835 | |||
| 1025 | Ga0070714_100109886 | |||
| 1026 | Ga0070714_100156220 | |||
| 1027 | Ga0070714_100312851 | |||
| 1028 | Ga0070714_100322243 | |||
| 1029 | Ga0070714_100551550 | |||
| 1030 | Ga0070714_102442977 | |||
| 1031 | Ga0070713_100000301 | |||
| 1032 | Ga0070713_100004793 | |||
| 1033 | Ga0070713_100102293 | |||
| 1034 | Ga0070713_100154458 | |||
| 1035 | Ga0070713_100214204 | |||
| 1036 | Ga0070713_100340933 | |||
| 1037 | Ga0070710_10000358 | |||
| 1038 | Ga0070710_10002036 | |||
| 1039 | Ga0070710_10009948 | |||
| 1040 | Ga0070710_10040181 | |||
| 1041 | Ga0070710_10066864 | |||
| 1042 | Ga0070710_10152031 | |||
| 1043 | Ga0070710_10309561 | |||
| 1044 | Ga0070711_100000638 | |||
| 1045 | Ga0070711_100032942 | |||
| 1046 | Ga0070711_100119441 | |||
| 1047 | Ga0070711_100229918 | |||
| 1048 | Ga0070711_100238893 | |||
| 1049 | Ga0070711_100675774 | |||
| 1050 | Ga0070700_100045043 | |||
| 1051 | Ga0070694_101694240 | |||
| 1052 | Ga0070708_100001321 | |||
| 1053 | Ga0070708_100061763 | |||
| 1054 | Ga0070708_100074283 | |||
| 1055 | Ga0070708_100377224 | |||
| 1056 | Ga0070663_101511412 | |||
| 1057 | Ga0070678_100105427 | |||
| 1058 | Ga0070678_100905430 | |||
| 1059 | Ga0070678_101276596 | |||
| 1060 | Ga0070662_100775264 | |||
| 1061 | Ga0070681_10833047 | |||
| 1062 | Ga0068867_100017306 | |||
| 1063 | Ga0068867_100612074 | |||
| 1064 | Ga0070706_100002905 | |||
| 1065 | Ga0070706_100005180 | |||
| 1066 | Ga0070706_100008719 | |||
| 1067 | Ga0070706_100012401 | |||
| 1068 | Ga0070706_100036657 | |||
| 1069 | Ga0070706_100060797 | |||
| 1070 | Ga0070706_100063225 | |||
| 1071 | Ga0070706_100099112 | |||
| 1072 | Ga0070706_100733835 | |||
| 1073 | Ga0070706_100766845 | |||
| 1074 | Ga0070707_100000300 | |||
| 1075 | Ga0070707_100011644 | |||
| 1076 | Ga0070707_100108861 | |||
| 1077 | Ga0070707_100131178 | |||
| 1078 | Ga0070707_100133287 | |||
| 1079 | Ga0070707_100234827 | |||
| 1080 | Ga0070707_100260045 | |||
| 1081 | Ga0070707_100272657 | |||
| 1082 | Ga0070698_100000801 | |||
| 1083 | Ga0070698_100002410 | |||
| 1084 | Ga0070698_100003145 | |||
| 1085 | Ga0070698_100003899 | |||
| 1086 | Ga0070698_100006066 | |||
| 1087 | Ga0070698_100065689 | |||
| 1088 | Ga0070698_100168910 | |||
| 1089 | Ga0070698_100246640 | |||
| 1090 | Ga0070699_100068826 | |||
| 1091 | Ga0070699_100070353 | |||
| 1092 | Ga0070699_100073117 | |||
| 1093 | Ga0070699_101072992 | |||
| 1094 | Ga0070684_100115637 | |||
| 1095 | Ga0070684_100139985 | |||
| 1096 | Ga0070684_100928377 | |||
| 1097 | Ga0070684_101058809 | |||
| 1098 | Ga0070684_101367365 | |||
| 1099 | Ga0070697_100030550 | |||
| 1100 | Ga0068853_100197912 | |||
| 1101 | Ga0068853_100586708 | |||
| 1102 | Ga0068853_100754483 | |||
| 1103 | Ga0068853_100895824 | |||
| 1104 | Ga0070672_100008328 | |||
| 1105 | Ga0070672_100011156 | |||
| 1106 | Ga0070672_101857696 | |||
| 1107 | Ga0070672_101990517 | |||
| 1108 | Ga0070695_100533938 | |||
| 1109 | Ga0070695_101067195 | |||
| 1110 | Ga0070665_100272775 | |||
| 1111 | Ga0070665_100567533 | |||
| 1112 | Ga0070704_100317062 | |||
| 1113 | Ga0068855_100043684 | |||
| 1114 | Ga0068855_100130053 | |||
| 1115 | Ga0068855_100146481 | |||
| 1116 | Ga0068855_101284481 | |||
| 1117 | Ga0070664_100728856 | |||
| 1118 | Ga0068857_100018116 | |||
| 1119 | Ga0068857_101478477 | |||
| 1120 | Ga0068854_100887552 | |||
| 1121 | Ga0068854_101569058 | |||
| 1122 | Ga0068856_100039299 | |||
| 1123 | Ga0068856_100044982 | |||
| 1124 | Ga0068856_100076573 | |||
| 1125 | Ga0068856_100087951 | |||
| 1126 | Ga0068856_100406560 | |||
| 1127 | Ga0070702_100101619 | |||
| 1128 | Ga0068852_100457482 | |||
| 1129 | Ga0068859_100046132 | |||
| 1130 | Ga0068859_100665154 | |||
| 1131 | Ga0068864_100109354 | |||
| 1132 | Ga0068861_100001796 | |||
| 1133 | Ga0068870_10390384 | |||
| 1134 | Ga0068863_100259524 | |||
| 1135 | Ga0068863_100654906 | |||
| 1136 | Ga0068863_101019016 | |||
| 1137 | Ga0068863_102681780 | |||
| 1138 | Ga0068858_100077420 | |||
| 1139 | Ga0068858_100147677 | |||
| 1140 | Ga0068858_100352439 | |||
| 1141 | Ga0068860_100002243 | |||
| 1142 | Ga0068860_100375087 | |||
| 1143 | Ga0068860_100916391 | |||
| 1144 | Ga0068862_100333384 | |||
| 1145 | Ga0081540_1000482 | |||
| 1146 | Ga0081540_1164053 | |||
| 1147 | Ga0070717_10000712 | |||
| 1148 | Ga0070717_10035300 | |||
| 1149 | Ga0070717_10151902 | |||
| 1150 | Ga0070717_10160951 | |||
| 1151 | Ga0070717_10291279 | |||
| 1152 | Ga0070717_10292906 | |||
| 1153 | Ga0070717_11443884 | |||
| 1154 | Ga0075368_10310233 | |||
| 1155 | Ga0070715_10008968 | |||
| 1156 | Ga0070715_10011170 | |||
| 1157 | Ga0070715_10314116 | |||
| 1158 | Ga0070716_100000107 | |||
| 1159 | Ga0070716_100000726 | |||
| 1160 | Ga0070716_100039242 | |||
| 1161 | Ga0070716_100059402 | |||
| 1162 | Ga0070716_100224324 | |||
| 1163 | Ga0070712_100003795 | |||
| 1164 | Ga0070712_100025122 | |||
| 1165 | Ga0070712_100154621 | |||
| 1166 | Ga0070712_100259365 | |||
| 1167 | Ga0070712_100485612 | |||
| 1168 | Ga0075366_10220538 | |||
| 1169 | Ga0097621_100222160 | |||
| 1170 | Ga0097621_101528437 | |||
| 1171 | Ga0068871_100023726 | |||
| 1172 | Ga0075428_100117619 | |||
| 1173 | Ga0075430_100020756 | |||
| 1174 | Ga0075430_100138881 | |||
| 1175 | Ga0075431_100008971 | |||
| 1176 | Ga0075431_100251713 | |||
| 1177 | Ga0075433_10043109 | |||
| 1178 | Ga0075433_10154477 | |||
| 1179 | Ga0075434_100045414 | |||
| 1180 | Ga0075434_100377057 | |||
| 1181 | Ga0075434_100402859 | |||
| 1182 | Ga0075429_100930344 | |||
| 1183 | Ga0068865_101706899 | |||
| 1184 | Ga0075436_100040389 | |||
| 1185 | Ga0075436_100176893 | |||
| 1186 | Ga0075436_100373834 | |||
| 1187 | Ga0075436_101208821 | |||
| 1188 | Ga0097620_100046133 | |||
| 1189 | Ga0097620_100665164 | |||
| 1190 | Ga0075435_100002665 | |||
| 1191 | Ga0075435_100079499 | |||
| 1192 | Ga0075435_100172519 | |||
| 1193 | Ga0075435_100533617 | |||
| 1194 | Ga0075435_101006873 | |||
| 1195 | Ga0075435_101725249 | |||
| 1196 | Ga0099794_10318934 | |||
| 1197 | Ga0105251_10276746 | |||
| 1198 | Ga0105240_10118770 | |||
| 1199 | Ga0105240_10126052 | |||
| 1200 | Ga0111539_10053594 | |||
| 1201 | Ga0105245_10006829 | |||
| 1202 | Ga0105245_10279901 | |||
| 1203 | Ga0105245_10375812 | |||
| 1204 | Ga0105245_10726450 | |||
| 1205 | Ga0105245_11669205 | |||
| 1206 | Ga0105247_10306649 | |||
| 1207 | Ga0114129_10329283 | |||
| 1208 | Ga0114129_11179624 | |||
| 1209 | Ga0105243_10031845 | |||
| 1210 | Ga0105243_12754884 | |||
| 1211 | Ga0105241_10044971 | |||
| 1212 | Ga0105241_10062828 | |||
| 1213 | Ga0105241_10683035 | |||
| 1214 | Ga0105242_11733041 | |||
| 1215 | Ga0105242_12678903 | |||
| 1216 | Ga0105248_10144050 | |||
| 1217 | Ga0105248_11679244 | |||
| 1218 | Ga0105237_10256997 | |||
| 1219 | Ga0105237_10303473 | |||
| 1220 | Ga0105237_10465298 | |||
| 1221 | Ga0105238_10149071 | |||
| 1222 | Ga0105238_10188444 | |||
| 1223 | Ga0105238_10255840 | |||
| 1224 | Ga0105238_11149481 | |||
| 1225 | Ga0105238_11737993 | |||
| 1226 | Ga0105249_10027380 | |||
| 1227 | Ga0105249_10517123 | |||
| 1228 | Ga0099796_10583841 | |||
| 1229 | Ga0105239_10009903 | |||
| 1230 | Ga0105239_10938466 | |||
| 1231 | Ga0105239_11272529 | |||
| 1232 | Ga0105239_12312238 | |||
| 1233 | Ga0105246_11119556 | |||
| 1234 | Ga0157339_1038572 | |||
| 1235 | Ga0157373_10210104 | |||
| 1236 | Ga0157373_10559714 | |||
| 1237 | Ga0157373_11111006 | |||
| 1238 | Ga0157371_10445910 | |||
| 1239 | Ga0157370_10724834 | |||
| 1240 | Ga0157370_10919537 | |||
| 1241 | Ga0157370_11260681 | |||
| 1242 | Ga0157369_10368567 | |||
| 1243 | Ga0157369_10747506 | |||
| 1244 | Ga0157369_10923845 | |||
| 1245 | Ga0157369_11189347 | |||
| 1246 | Ga0157369_11699652 | |||
| 1247 | Ga0157369_11748164 | |||
| 1248 | Ga0157369_12132859 | |||
| 1249 | Ga0157374_10015922 | |||
| 1250 | Ga0157374_10740224 | |||
| 1251 | Ga0157374_11142280 | |||
| 1252 | Ga0157378_10013493 | |||
| 1253 | Ga0157378_12057045 | |||
| 1254 | Ga0163162_10001801 | |||
| 1255 | Ga0163162_10193082 | |||
| 1256 | Ga0157372_10183950 | |||
| 1257 | Ga0157372_10227439 | |||
| 1258 | Ga0157372_10500139 | |||
| 1259 | Ga0157372_10609285 | |||
| 1260 | Ga0157372_10990971 | |||
| 1261 | Ga0157372_11182477 | |||
| 1262 | Ga0157372_12137848 | |||
| 1263 | Ga0157375_10098016 | |||
| 1264 | Ga0157375_10862547 | |||
| 1265 | Ga0157375_11548696 | |||
| 1266 | Ga0157375_12187185 | |||
| 1267 | Ga0157375_12655929 | |||
| 1268 | Ga0163163_10759779 | |||
| 1269 | Ga0182008_10328897 | |||
| 1270 | Ga0157377_10202523 | |||
| 1271 | Ga0157377_10667796 | |||
| 1272 | Ga0157379_10006818 | |||
| 1273 | Ga0157379_10050003 | |||
| 1274 | Ga0157379_10068693 | |||
| 1275 | Ga0157379_11395184 | |||
| 1276 | Ga0157379_11965082 | |||
| 1277 | Ga0157376_10006886 | |||
| 1278 | Ga0157376_10072188 | |||
| 1279 | Ga0163161_10129362 | |||
| 1280 | Ga0163161_10192477 | |||
| 1281 | Ga0163161_11684242 | |||
| 1282 | Ga0184595_106319 | |||
| 1283 | Ga0184592_103689 | |||
| 1284 | Ga0184594_129231 | |||
| 1285 | Ga0184601_133098 | |||
| 1286 | Ga0184599_152346 | |||
| 1287 | Ga0184600_139479 | |||
| 1288 | Ga0184603_145986 | |||
| 1289 | Ga0197907_10081145 | |||
| 1290 | Ga0197907_11507248 | |||
| 1291 | Ga0206356_10616066 | |||
| 1292 | Ga0206356_11087391 | |||
| 1293 | Ga0206356_11838597 | |||
| 1294 | Ga0206355_1000641 | |||
| 1295 | Ga0206352_10444515 | |||
| 1296 | Ga0206352_10598243 | |||
| 1297 | Ga0206352_10725269 | |||
| 1298 | Ga0206350_11041294 | |||
| 1299 | Ga0206354_11188401 | |||
| 1300 | Ga0206354_11474612 | |||
| 1301 | Ga0206354_11668375 | |||
| 1302 | Ga0206353_10824445 | |||
| 1303 | Ga0206353_11633815 | |||
| 1304 | Ga0213875_10000176 | |||
| 1305 | Ga0213875_10000584 | |||
| 1306 | Ga0213875_10083953 | |||
| 1307 | Ga0213875_10277652 | |||
| 1308 | Ga0224712_10071645 | |||
| 1309 | Ga0224712_10081329 | |||
| 1310 | Ga0224712_10109490 | |||
| 1311 | Ga0247554_103440 | |||
| 1312 | Ga0247551_105014 | |||
| 1313 | Ga0247515_119401 | |||
| 1314 | Ga0247553_103863 | |||
| 1315 | Ga0247522_117983 | |||
| 1316 | Ga0228600_1005907 | |||
| 1317 | Ga0224572_1002833 | |||
| 1318 | Ga0228598_1018543 | |||
| 1319 | Ga0207682_10045239 | |||
| 1320 | Ga0207682_10236597 | |||
| 1321 | Ga0207692_10000057 | |||
| 1322 | Ga0207692_10001524 | |||
| 1323 | Ga0207692_10022131 | |||
| 1324 | Ga0207692_10057414 | |||
| 1325 | Ga0207692_10100855 | |||
| 1326 | Ga0207692_10107778 | |||
| 1327 | Ga0207692_10264469 | |||
| 1328 | Ga0207692_10267296 | |||
| 1329 | Ga0207710_10289262 | |||
| 1330 | Ga0207680_11296333 | |||
| 1331 | Ga0207685_10003821 | |||
| 1332 | Ga0207685_10040562 | |||
| 1333 | Ga0207685_10058632 | |||
| 1334 | Ga0207699_10000162 | |||
| 1335 | Ga0207699_10002215 | |||
| 1336 | Ga0207699_10011202 | |||
| 1337 | Ga0207699_10012683 | |||
| 1338 | Ga0207699_10030697 | |||
| 1339 | Ga0207699_10045722 | |||
| 1340 | Ga0207699_10048477 | |||
| 1341 | Ga0207645_10524749 | |||
| 1342 | Ga0207643_10965583 | |||
| 1343 | Ga0207705_10567099 | |||
| 1344 | Ga0207684_10000918 | |||
| 1345 | Ga0207684_10011073 | |||
| 1346 | Ga0207684_10018120 | |||
| 1347 | Ga0207684_10023539 | |||
| 1348 | Ga0207684_10049552 | |||
| 1349 | Ga0207684_10060226 | |||
| 1350 | Ga0207684_10093327 | |||
| 1351 | Ga0207684_10149788 | |||
| 1352 | Ga0207684_10188430 | |||
| 1353 | Ga0207684_10248326 | |||
| 1354 | Ga0207684_10596727 | |||
| 1355 | Ga0207654_10233203 | |||
| 1356 | Ga0207654_10415210 | |||
| 1357 | Ga0207707_10636439 | |||
| 1358 | Ga0207707_11170358 | |||
| 1359 | Ga0207695_10641696 | |||
| 1360 | Ga0207671_10205438 | |||
| 1361 | Ga0207693_10001896 | |||
| 1362 | Ga0207693_10006360 | |||
| 1363 | Ga0207693_10044701 | |||
| 1364 | Ga0207693_10191816 | |||
| 1365 | Ga0207693_10208732 | |||
| 1366 | Ga0207693_10369276 | |||
| 1367 | Ga0207693_10979641 | |||
| 1368 | Ga0207693_11076240 | |||
| 1369 | Ga0207663_10001902 | |||
| 1370 | Ga0207663_10017791 | |||
| 1371 | Ga0207663_10026595 | |||
| 1372 | Ga0207663_10219572 | |||
| 1373 | Ga0207663_10275815 | |||
| 1374 | Ga0207663_10276295 | |||
| 1375 | Ga0207657_10559860 | |||
| 1376 | Ga0207649_10023341 | |||
| 1377 | Ga0207649_11401799 | |||
| 1378 | Ga0207652_10163960 | |||
| 1379 | Ga0207646_10000096 | |||
| 1380 | Ga0207646_10000913 | |||
| 1381 | Ga0207646_10005894 | |||
| 1382 | Ga0207646_10022563 | |||
| 1383 | Ga0207646_10023414 | |||
| 1384 | Ga0207646_10078339 | |||
| 1385 | Ga0207646_10079676 | |||
| 1386 | Ga0207646_10112559 | |||
| 1387 | Ga0207646_10632147 | |||
| 1388 | Ga0207646_10720418 | |||
| 1389 | Ga0207681_10026813 | |||
| 1390 | Ga0207694_10192080 | |||
| 1391 | Ga0207694_10287111 | |||
| 1392 | Ga0207650_10544859 | |||
| 1393 | Ga0207650_11287729 | |||
| 1394 | Ga0207650_11452329 | |||
| 1395 | Ga0207659_10161282 | |||
| 1396 | Ga0207659_10393486 | |||
| 1397 | Ga0207687_10045122 | |||
| 1398 | Ga0207687_10271728 | |||
| 1399 | Ga0207687_10508647 | |||
| 1400 | Ga0207700_10000208 | |||
| 1401 | Ga0207700_10001506 | |||
| 1402 | Ga0207700_10033846 | |||
| 1403 | Ga0207700_10049204 | |||
| 1404 | Ga0207700_10092484 | |||
| 1405 | Ga0207700_10310267 | |||
| 1406 | Ga0207700_10431176 | |||
| 1407 | Ga0207700_10445808 | |||
| 1408 | Ga0207700_10632954 | |||
| 1409 | Ga0207700_11330782 | |||
| 1410 | Ga0207664_10000108 | |||
| 1411 | Ga0207664_10000652 | |||
| 1412 | Ga0207664_10006527 | |||
| 1413 | Ga0207664_10016881 | |||
| 1414 | Ga0207664_10020882 | |||
| 1415 | Ga0207664_10069941 | |||
| 1416 | Ga0207664_10194742 | |||
| 1417 | Ga0207664_10285164 | |||
| 1418 | Ga0207664_10410861 | |||
| 1419 | Ga0207664_10738700 | |||
| 1420 | Ga0207644_10088932 | |||
| 1421 | Ga0207644_10497020 | |||
| 1422 | Ga0207644_11081192 | |||
| 1423 | Ga0207690_11538681 | |||
| 1424 | Ga0207706_10830157 | |||
| 1425 | Ga0207706_11155557 | |||
| 1426 | Ga0207706_11175918 | |||
| 1427 | Ga0207669_10061121 | |||
| 1428 | Ga0207669_10158714 | |||
| 1429 | Ga0207704_10096701 | |||
| 1430 | Ga0207665_10000153 | |||
| 1431 | Ga0207665_10007829 | |||
| 1432 | Ga0207665_10010935 | |||
| 1433 | Ga0207665_10308428 | |||
| 1434 | Ga0207691_10017320 | |||
| 1435 | Ga0207691_10017572 | |||
| 1436 | Ga0207691_10742182 | |||
| 1437 | Ga0207711_10181774 | |||
| 1438 | Ga0207711_10363797 | |||
| 1439 | Ga0207711_10735721 | |||
| 1440 | Ga0207661_10133553 | |||
| 1441 | Ga0207661_10366019 | |||
| 1442 | Ga0207661_10445614 | |||
| 1443 | Ga0207661_11200490 | |||
| 1444 | Ga0207661_11500679 | |||
| 1445 | Ga0207679_10354493 | |||
| 1446 | Ga0207667_10061601 | |||
| 1447 | Ga0207667_10196512 | |||
| 1448 | Ga0207667_10422940 | |||
| 1449 | Ga0207667_10462714 | |||
| 1450 | Ga0207667_11266890 | |||
| 1451 | Ga0207651_11400599 | |||
| 1452 | Ga0207712_10100595 | |||
| 1453 | Ga0207668_10520320 | |||
| 1454 | Ga0207640_11087884 | |||
| 1455 | Ga0207640_11258837 | |||
| 1456 | Ga0207677_10121231 | |||
| 1457 | Ga0207703_10191219 | |||
| 1458 | Ga0207703_10211941 | |||
| 1459 | Ga0207703_11023852 | |||
| 1460 | Ga0207639_10309470 | |||
| 1461 | Ga0207639_10621887 | |||
| 1462 | Ga0207639_10622664 | |||
| 1463 | Ga0207639_11656431 | |||
| 1464 | Ga0207678_10162970 | |||
| 1465 | Ga0207708_10010427 | |||
| 1466 | Ga0207702_10013210 | |||
| 1467 | Ga0207702_10115369 | |||
| 1468 | Ga0207702_10127832 | |||
| 1469 | Ga0207702_10251081 | |||
| 1470 | Ga0207702_10478064 | |||
| 1471 | Ga0207641_10078018 | |||
| 1472 | Ga0207641_10316220 | |||
| 1473 | Ga0207641_11536802 | |||
| 1474 | Ga0207648_10005680 | |||
| 1475 | Ga0207648_10555708 | |||
| 1476 | Ga0207676_10083480 | |||
| 1477 | Ga0207674_10005230 | |||
| 1478 | Ga0207674_10214387 | |||
| 1479 | Ga0207674_10660886 | |||
| 1480 | Ga0207674_11328395 | |||
| 1481 | Ga0207675_100083223 | |||
| 1482 | Ga0207683_10081319 | |||
| 1483 | Ga0207683_10170703 | |||
| 1484 | Ga0207683_10956099 | |||
| 1485 | Ga0207683_11357671 | |||
| 1486 | Ga0207683_11733689 | |||
| 1487 | Ga0207698_10366444 | |||
| 1488 | Ga0207698_12610938 | |||
| 1489 | Ga0209813_10466884 | |||
| 1490 | Ga0207428_11100078 | |||
| 1491 | Ga0268266_10205974 | |||
| 1492 | Ga0268266_10307163 | |||
| 1493 | Ga0268266_11771618 | |||
| 1494 | Ga0268265_10066323 | |||
| 1495 | Ga0268264_10020547 | |||
| 1496 | Ga0268264_10455089 | |||
| 1497 | Ga0268264_10509985 | |||
| 1498 | Ga0268264_11787458 | |||
| 1499 | Ga0268264_12378094 | |||
| 1500 | Ga0265336_10029909 | |||
| 1501 | Ga0265338_10004219 | |||
| 1502 | Ga0265762_1029976 | |||
| 1503 | Ga0265775_100408 | |||
| 1504 | Ga0265767_103009 | |||
| 1505 | Ga0265770_1075700 | |||
| 1506 | Ga0265770_1156947 | |||
| 1507 | Ga0265772_102273 | |||
| 1508 | Ga0265779_104757 | |||
| 1509 | Ga0265760_10283520 | |||
| 1510 | Ga0307408_100230583 | |||
| 1511 | Ga0307408_100951638 | |||
| 1512 | Ga0310113_120032 | |||
| 1513 | Ga0316576_10017752 | |||
| 1514 | Ga0316578_10008072 | |||
| 1515 | Ga0316577_10011528 | |||
| 1516 | Ga0316043_122996 | |||
| 1517 | Ga0307410_10155625 | |||
| 1518 | Ga0307410_10628448 | |||
| 1519 | Ga0307406_12114092 | |||
| 1520 | Ga0307407_10380230 | |||
| 1521 | Ga0307407_10533906 | |||
| 1522 | Ga0307412_10630795 | |||
| 1523 | Ga0307409_100071621 | |||
| 1524 | Ga0307409_100886127 | |||
| 1525 | Ga0307409_101001411 | |||
| 1526 | Ga0307416_100904838 | |||
| 1527 | Ga0307416_101853021 | |||
| 1528 | Ga0307415_101914947 | |||
| 1529 | Ga0307415_102196122 | |||
| 1530 | Ga0316593_10351470 | |||
| 1531 | Ga0316588_1027473 | |||
| 1532 | Ga0316214_1058218 | |||
| 1533 | Ga0373930_0009592 | |||
| 1534 | Ga0373948_0006634 | |||
| 1535 | Ga0373950_0026422 | |||
| 1536 | Ga0373959_0039662 | |||
| 1537 | Ga0373938_0042615 | |||
| 1538 | Ga0373926_0076877 | |||
| 1539 | Ga0373926_0080036 | |||
| 1540 | Ga0373926_0088325 | |||
| 1541 | Ga0373928_0003638 | |||
| 1542 | Ga0373929_0022314 | |||
| 1543 | Ga0373934_0000014 | |||
| 1544 | Ga0373934_0016558 | |||
| 1545 | Ga0373934_0020829 | |||
| 1546 | Ga0373934_0034213 | |||
| 1547 | Ga0373934_0106900 | |||
| 1548 | Ga0373940_0036537 | |||
| 1549 | Ga0373944_0016313 | |||
| 1550 | Ga0373944_0070879 | |||
| 1551 | Ga0373944_0298320 | |||
| 1552 | Ga0373952_0256161 | |||
| 1553 | Ga0373923_0057809 | |||
| 1554 | Ga0373923_0259795 | |||
| 1555 | Ga0373923_0445157 | |||
| 1556 | Ga0373923_0495191 | |||
| 1557 | Ga0373936_0022933 | |||
| 1558 | Ga0373936_0274725 | |||
| 1559 | Ga0373939_0003426 | |||
| 1560 | Ga0373941_0125737 | |||
| 1561 | Ga0373945_0126792 | |||
| 1562 | Ga0373945_0274903 | |||
| 1563 | Ga0373945_0521918 | |||
| 1564 | Ga0373953_0000096 | |||
| 1565 | Ga0373953_0019062 | |||
| 1566 | Ga0373953_0362767 | |||
| 1567 | Ga0373954_0000675 | |||
| 1568 | Ga0373954_0005492 | |||
| 1569 | Ga0373954_0187365 | |||
| 1570 | Ga0373954_0219848 | |||
| 1571 | Ga0373954_0232432 | |||
| 1572 | Ga0373954_0308421 | |||
| 1573 | Ga0373956_0000506 | |||
| 1574 | Ga0373956_0006083 | |||
| 1575 | Ga0373956_0043829 | |||
| 1576 | Ga0373956_0055911 | |||
| 1577 | Ga0373957_0001124 | |||
| 1578 | Ga0373957_0007197 | |||
| 1579 | Ga0373957_0020704 | |||
| 1580 | Ga0373957_0243880 | |||
| 1581 | Ga0373960_0039434 | |||
| 1582 | Ga0373943_0055049 | |||
| 1583 | Ga0373943_0081542 | |||
| 1584 | Ga0373943_0124009 | |||
| 1585 | Ga0373943_0249445 | |||
| 1586 | Ga0373943_0853659 | |||
| 1587 | Ga0373946_0020106 | |||
| 1588 | Ga0373946_0155007 | |||
| 1589 | Ga0373946_0276136 | |||
| 1590 | Ga0373955_0000040 | |||
| 1591 | Ga0373955_0005314 | |||
| 1592 | Ga0373955_0025872 | |||
| 1593 | Ga0373955_0030416 | |||
| 1594 | Ga0373942_0167403 | |||
| 1595 | Ga0316574_0001226 | |||
| 1596 | Ga0316574_0088763 | |||
| 1597 | Ga0373924_0003168 | |||
| 1598 | Ga0373924_0038561 | |||
| 1599 | Ga0373924_0068770 | |||
| 1600 | Ga0373924_0089218 | |||
| 1601 | Ga0373924_0089376 | |||
| 1602 | Ga0373931_0147028 | |||
| 1603 | Ga0373931_0196553 | |||
| 1604 | Ga0373931_0331832 | |||
| 1605 | Ga0373931_0520111 | |||
| 1606 | Ga0373931_0658952 | |||
| 1607 | Ga0373935_0005512 | |||
| 1608 | Ga0373935_0231254 | |||
| 1609 | Ga0373935_0400568 | |||
| 1610 | Ga0373935_1239423 | |||
| 1611 | Ga0373935_1472241 | |||
| 1612 | Ga0373927_0150765 | |||
| 1613 | Ga0373927_0259108 | |||
| 1614 | Ga0373927_1010704 | |||
| 1615 | Ga0373933_0000085 | |||
| 1616 | Ga0373933_0043337 | |||
| 1617 | Ga0373933_0047667 | |||
| 1618 | Ga0373933_0063629 | |||
| 1619 | Ga0373933_0106008 | |||
| 1620 | Ga0373947_0000195 | |||
| 1621 | Ga0373947_0302687 | |||
| 1622 | Ga0373947_0458696 | |||
| 1623 | Ga0373947_0576344 | |||
| 1624 | Ga0373947_0748862 | |||
| 1625 | Ga0373937_0000197 | |||
| 1626 | Ga0373937_0000859 | |||
| 1627 | Ga0373937_0024567 | |||
| 1628 | Ga0373937_0041264 | |||
| 1629 | Ga0373937_0171223 | |||
| 1630 | Ga0373937_0483943 | |||
| 1631 | Ga0265778_017865 | |||
| 1632 | Ga0372808_018957 | |||
| 1633 | Ga0372808_071145 | |||
| 1634 | Ga0310109_017307 | |||
| 1635 | Ga0310110_037020 | |||
| 1636 | Ga0316582_0173590 | |||
| 1637 | Ga0316582_0493729 | |||
| 1638 | Ga0316584_0066676 | |||
| 1639 | Ga0373925_0034101 | |||
| 1640 | Ga0373925_0293585 | |||
| 1641 | Ga0373925_0429135 | |||
| 1642 | Ga0373925_0941052 | |||
| 1643 | Ga0373925_1304912 | |||
| 1644 | Ga0436364_0188941 | |||
| 1645 | Ga0436364_0303129 | |||
| 1646 | Ga0436364_0473877 | |||
| 1647 | Ga0436364_0875353 | |||
| 1648 | Ga0436364_0876629 | |||
| 1649 | Ga0395901_0334151 | |||
| 1650 | Ga0242420_065571 | |||
| 1651 | Ga0436361_0599980 | |||
| 1652 | Ga0436363_0225853 | |||
| 1653 | Ga0436363_0338172 | |||
| 1654 | Ga0436363_1250789 | |||
| 1655 | Ga0436363_1357246 | |||
| 1656 | Ga0436362_0056231 | |||
| 1657 | Ga0436362_0844715 | |||
| 1658 | Ga0451804_0730933 | |||
| 1659 | Ga0451807_1366442 | |||
| 1660 | Ga0451855_0597846 | |||
| 1661 | Ga0466966_0116711 | |||
| 1662 | Ga0466966_0309983 | |||
| 1663 | Ga0466964_0235673 | |||
| 1664 | Ga0466964_0383725 | |||
| 1665 | Ga0451576_0000327 | |||
| 1666 | Ga0466967_0409578 | |||
| 1667 | Ga0495592_0000157 | |||
| 1668 | Ga0495592_0007117 | |||
| 1669 | Ga0495592_0088375 | |||
| 1670 | Ga0495592_0439403 | |||
| 1671 | Ga0495603_0093688 | |||
| 1672 | Ga0495603_0473144 | |||
| 1673 | Ga0495629_0017621 | |||
| 1674 | Ga0495629_0422482 | |||
| 1675 | Ga0495641_0010809 | |||
| 1676 | Ga0495641_0024093 | |||
| 1677 | Ga0495641_0031029 | |||
| 1678 | Ga0495641_0236431 | |||
| 1679 | Ga0495651_0000115 | |||
| 1680 | Ga0495651_0008585 | |||
| 1681 | Ga0495651_0015867 | |||
| 1682 | Ga0495651_0081108 | |||
| 1683 | Ga0495653_0001269 | |||
| 1684 | Ga0495653_0015090 | |||
| 1685 | Ga0495653_0038301 | |||
| 1686 | Ga0495653_0049617 | |||
| 1687 | Ga0495653_0106127 | |||
| 1688 | Ga0495653_0177048 | |||
| 1689 | Ga0495653_0238969 | |||
| 1690 | Ga0495580_0017290 | |||
| 1691 | Ga0495580_0059974 | |||
| 1692 | Ga0495580_0343509 | |||
| 1693 | Ga0495582_0018891 | |||
| 1694 | Ga0495582_0725455 | |||
| 1695 | Ga0495639_0104780 | |||
| 1696 | Ga0495639_0365787 | |||
| 1697 | Ga0495639_0516709 | |||
| 1698 | Ga0495662_0110634 | |||
| 1699 | Ga0495662_0143651 | |||
| 1700 | Ga0495664_0096499 | |||
| 1701 | Ga0495664_0724907 | |||
| 1702 | Ga0495594_0098468 | |||
| 1703 | Ga0495594_0396881 | |||
| 1704 | Ga0495608_0000157 | |||
| 1705 | Ga0495608_0005803 | |||
| 1706 | Ga0495608_0016774 | |||
| 1707 | Ga0495608_0181300 | |||
| 1708 | Ga0495618_0019815 | |||
| 1709 | Ga0495618_0061436 | |||
| 1710 | Ga0495618_0077977 | |||
| 1711 | Ga0495628_0000492 | |||
| 1712 | Ga0495628_0037350 | |||
| 1713 | Ga0495628_0170409 | |||
| 1714 | Ga0495630_0000704 | |||
| 1715 | Ga0495630_0031948 | |||
| 1716 | Ga0495630_0096381 | |||
| 1717 | Ga0495630_0521367 | |||
| 1718 | Ga0495666_0080589 | |||
| 1719 | Ga0495666_0201777 | |||
| 1720 | Ga0495652_0001666 | |||
| 1721 | Ga0495652_0014911 | |||
| 1722 | Ga0495652_0195190 | |||
| 1723 | Ga0495652_0199504 | |||
| 1724 | Ga0495652_0492977 | |||
| 1725 | Ga0495665_0046857 | |||
| 1726 | Ga0495665_0256081 | |||
| 1727 | Ga0495640_0018497 | |||
| 1728 | Ga0495640_0067864 | |||
| 1729 | Ga0495640_0092821 | |||
| 1730 | Ga0495640_0457639 | |||
| 1731 | Ga0495586_0086587 | |||
| 1732 | Ga0495586_0132069 | |||
| 1733 | Ga0495586_0491999 | |||
| 1734 | Ga0495587_0000123 | |||
| 1735 | Ga0495587_0024822 | |||
| 1736 | Ga0495587_0042122 | |||
| 1737 | Ga0495598_0268427 | |||
| 1738 | Ga0495645_0179720 | |||
| 1739 | Ga0495645_0187274 | |||
| 1740 | Ga0495645_0188426 | |||
| 1741 | Ga0495667_0000107 | |||
| 1742 | Ga0495667_0023793 | |||
| 1743 | Ga0495667_0035901 | |||
| 1744 | Ga0495667_0110091 | |||
| 1745 | Ga0495667_0710730 | |||
| 1746 | Ga0495656_0630561 | |||
| 1747 | Ga0495634_0021291 | |||
| 1748 | Ga0495634_0079421 | |||
| 1749 | Ga0495634_0659152 | |||
| 1750 | Ga0495635_0035305 | |||
| 1751 | Ga0495635_0097311 | |||
| 1752 | Ga0495635_0122397 | |||
| 1753 | Ga0495635_0211128 | |||
| 1754 | Ga0495635_0599619 | |||
| 1755 | Ga0495657_0000169 | |||
| 1756 | Ga0495657_0011153 | |||
| 1757 | Ga0495657_0063435 | |||
| 1758 | Ga0495657_0618321 | |||
| 1759 | Ga0495599_0000129 | |||
| 1760 | Ga0495599_0007746 | |||
| 1761 | Ga0495599_0141122 | |||
| 1762 | Ga0495599_0160450 | |||
| 1763 | Ga0495599_0236898 | |||
| 1764 | Ga0495599_0366391 | |||
| 1765 | Ga0495623_0000166 | |||
| 1766 | Ga0495623_0018966 | |||
| 1767 | Ga0495623_0025353 | |||
| 1768 | Ga0495623_0027458 | |||
| 1769 | Ga0495623_0163146 | |||
| 1770 | Ga0495646_0048031 | |||
| 1771 | Ga0495646_0338701 | |||
| 1772 | Ga0495647_0035681 | |||
| 1773 | Ga0495658_0050594 | |||
| 1774 | Ga0495658_0066913 | |||
| 1775 | Ga0495613_0115698 | |||
| 1776 | Ga0495613_0169418 | |||
| 1777 | Ga0495613_0197320 | |||
| 1778 | Ga0495624_0026458 | |||
| 1779 | Ga0495624_0048030 | |||
| 1780 | Ga0495624_0124948 | |||
| 1781 | Ga0495624_0400897 | |||
| 1782 | Ga0495600_0005205 | |||
| 1783 | Ga0495600_0029746 | |||
| 1784 | Ga0495600_0038660 | |||
| 1785 | Ga0495600_0141580 | |||
| 1786 | Ga0495600_0282301 | |||
| 1787 | Ga0495600_0307826 | |||
| 1788 | Ga0495581_0092546 | |||
| 1789 | Ga0495581_0149945 | |||
| 1790 | Ga0495581_0205475 | |||
| 1791 | Ga0495581_0650711 | |||
| 1792 | Ga0495604_0000161 | |||
| 1793 | Ga0495604_0021329 | |||
| 1794 | Ga0495604_0022314 | |||
| 1795 | Ga0495674_0031694 | |||
| 1796 | Ga0495674_0070796 | |||
| 1797 | Ga0495674_0106094 | |||
| 1798 | Ga0495674_0117037 | |||
| 1799 | Ga0495674_0148391 | |||
| 1800 | Ga0495674_0687951 | |||
| 1801 | Ga0495676_0159945 | |||
| 1802 | Ga0495680_0000395 | |||
| 1803 | Ga0495680_0027978 | |||
| 1804 | Ga0495680_0061015 | |||
| 1805 | Ga0495680_0075647 | |||
| 1806 | Ga0495680_0544004 | |||
| 1807 | Ga0495675_0000277 | |||
| 1808 | Ga0495675_0001985 | |||
| 1809 | Ga0495675_0011289 | |||
| 1810 | Ga0495675_0058257 | |||
| 1811 | Ga0495675_0216178 | |||
| 1812 | Ga0495675_0235840 | |||
| 1813 | Ga0495684_0006066 | |||
| 1814 | Ga0495684_0064659 | |||
| 1815 | Ga0495684_0116686 | |||
| 1816 | Ga0495684_0120509 | |||
| 1817 | Ga0495684_0120709 | |||
| 1818 | Ga0495684_0157550 | |||
| 1819 | Ga0495684_0303013 | |||
| 1820 | Ga0495684_0544419 | |||
| 1821 | Ga0495593_0012129 | |||
| 1822 | Ga0495602_0000182 | |||
| 1823 | Ga0495602_0006022 | |||
| 1824 | Ga0495602_0015749 | |||
| 1825 | Ga0495602_0025045 | |||
| 1826 | Ga0495614_0206996 | |||
| 1827 | Ga0495614_0221704 | |||
| 1828 | Ga0495614_0246333 | |||
| 1829 | Ga0495614_0363093 | |||
| 1830 | Ga0496100_0108694 | |||
| 1831 | Ga0496100_0161420 | |||
| 1832 | Ga0496101_0034687 | |||
| 1833 | Ga0496101_1537138 | |||
| 1834 | Ga0496102_0766486 | |||
| 1835 | Ga0496102_0956472 | |||
| 1836 | Ga0496104_0020438 | |||
| 1837 | Ga0496104_0033085 | |||
| 1838 | Ga0496104_0075679 | |||
| 1839 | Ga0496104_0105643 | |||
| 1840 | Ga0496104_0429188 | |||
| 1841 | Ga0496105_0002275 | |||
| 1842 | Ga0496105_0081192 | |||
| 1843 | Ga0496105_0094368 | |||
| 1844 | Ga0496106_0298536 | |||
| 1845 | Ga0496106_0333548 | |||
| 1846 | Ga0496107_0087579 | |||
| 1847 | Ga0496108_0002330 | |||
| 1848 | Ga0496108_0041572 | |||
| 1849 | Ga0496108_0054006 | |||
| 1850 | Ga0496108_0714370 | |||
| 1851 | Ga0496109_0053471 | |||
| 1852 | Ga0496109_0749167 | |||
| 1853 | Ga0496109_1025623 | |||
| 1854 | Ga0496110_0007267 | |||
| 1855 | Ga0496110_0042417 | |||
| 1856 | Ga0496110_0066558 | |||
| 1857 | Ga0496110_0699424 | |||
| 1858 | Ga0496110_1755996 | |||
| 1859 | Ga0496111_0032735 | |||
| 1860 | Ga0496111_1310780 | |||
| 1861 | Ga0496112_0105729 | |||
| 1862 | Ga0496112_0161178 | |||
| 1863 | Ga0496112_0191433 | |||
| 1864 | Ga0496113_0141140 | |||
| 1865 | Ga0496114_0559399 | |||
| 1866 | Ga0496115_0009458 | |||
| 1867 | Ga0496115_0011285 | |||
| 1868 | Ga0496115_0193421 | |||
| 1869 | Ga0501309_086441 | |||
| 1870 | Ga0501310_052071 | |||
| 1871 | Ga0501298_023255 | |||
| 1872 | Ga0501034_0128692 | |||
| 1873 | Ga0501036_1693264 | |||
| 1874 | Ga0501042_0123474 | |||
| 1875 | Ga0501047_0414081 | |||
| 1876 | Ga0501070_0133729 | |||
| 1877 | Ga0501071_0516673 | |||
| 1878 | Ga0501080_0403465 | |||
| 1879 | nmdc:mga0k408_111314_c1 | |||
| 1880 | nmdc:mga0k408_629615_c1 | |||
| 1881 | nmdc:mga05p37_2306_c1 | |||
| 1882 | nmdc:mga0qj67_15845_c1 | |||
| 1883 | nmdc:mga0qj67_214985_c1 | |||
| 1884 | nmdc:mga06r32_23029_c1 | |||
| 1885 | nmdc:mga06r32_258386_c1 | |||
| 1886 | nmdc:mga08y16_603568_c1 | |||
| 1887 | nmdc:mga08y16_71882_c1 | |||
| 1888 | nmdc:mga0n895_1644616_c1 | |||
| 1889 | nmdc:mga0n895_1676745_c1 | |||
| 1890 | nmdc:mga0n895_232641_c1 | |||
| 1891 | nmdc:mga0n895_8584_c1 | |||
| 1892 | nmdc:mga0n895_884259_c1 | |||
| 1893 | nmdc:mga0rr50_243298_c1 | |||
| 1894 | nmdc:mga0rr50_262907_c1 | |||
| 1895 | nmdc:mga0rr50_431198_c1 | |||
| 1896 | nmdc:mga0rr50_553386_c1 | |||
| 1897 | nmdc:mga0rr50_592672_c1 | |||
| 1898 | nmdc:mga08x19_134993_c1 | |||
| 1899 | nmdc:mga08x19_177911_c1 | |||
| 1900 | nmdc:mga08x19_305082_c1 | |||
| 1901 | nmdc:mga0a205_115359_c1 | |||
| 1902 | Ga0495601_0009245 | |||
| 1903 | Ga0495601_0061262 | |||
| 1904 | Ga0495612_0015816 | |||
| 1905 | Ga0495612_0059076 | |||
| 1906 | Ga0495595_0067128 | |||
| 1907 | Ga0495619_0302206 | |||
| 1908 | Ga0495619_0318545 | |||
| 1909 | Ga0495619_0723796 | |||
| 1910 | Ga0587066_044076 | |||
| 1911 | Ga0587066_132894 | |||
| 1912 | Ga0587073_0080425 | |||
| 1913 | Ga0587073_0083348 | |||
| 1914 | Ga0587073_0253626 | |||
| 1915 | Ga0587077_197900 | |||
| 1916 | Ga0587080_036176 | |||
| 1917 | Ga0587080_173305 | |||
| 1918 | Ga0587083_0048247 | |||
| 1919 | Ga0587083_0067486 | |||
| 1920 | Ga0587085_023820 | |||
| 1921 | Ga0587085_066241 | |||
| 1922 | Ga0587085_127718 | |||
| 1923 | Ga0587088_051657 | |||
| 1924 | Ga0587089_077022 | |||
| 1925 | Ga0587091_028934 | |||
| 1926 | Ga0587092_119908 | |||
| 1927 | Ga0587094_053819 | |||
| 1928 | Ga0587098_030580 | |||
| 1929 | Ga0587106_029350 | |||
| 1930 | Ga0587106_057517 | |||
| 1931 | Ga0587129_028600 | |||
| 1932 | Ga0587099_024271 | |||
| 1933 | Ga0587115_024370 | |||
| 1934 | Ga0587115_025511 | |||
| 1935 | Ga0587062_106805 | |||
| 1936 | Ga0587069_093977 | |||
| 1937 | Ga0587072_088687 | |||
| 1938 | Ga0587075_035518 | |||
| 1939 | Ga0587075_038477 | |||
| 1940 | Ga0587075_047949 | |||
| 1941 | Ga0587078_053510 | |||
| 1942 | Ga0587079_151950 | |||
| 1943 | Ga0587107_022589 | |||
| 1944 | Ga0587107_031979 | |||
| 1945 | Ga0587107_037604 | |||
| 1946 | Ga0587107_065587 | |||
| 1947 | Ga0587114_070961 | |||
| 1948 | Ga0587116_08021 | |||
| 1949 | Ga0587071_109506 | |||
| 1950 | Ga0587111_0188745 | |||
| 1951 | 2990050122 | |||
| 1952 | 8056065457 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8674 | 50 | 117 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8564 | 50 | 117 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8543 | 61 | 117 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8061 | 61 | 117 |
| 2ghj-assembly1.cif.gz_A | crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 | 0.7 | 21 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9516 | 53 | 118 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8987 | 53 | 118 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8962 | 58 | 116 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8543 | 61 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8061 | 61 | 117 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G6EM08-F1-model_v4 | deleted | 1.005 | 57 | 115 |
|
| AF-J9FK27-F1-model_v4 | Ribosomal protein L20 | 1.005 | 60 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.003 | 53 | 115 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2D8YKH1-F1-model_v4 | deleted | 0.9998 | 58 | 117 |
|
| AF-A0A2N8FNS0-F1-model_v4 | deleted | 0.9958 | 56 | 120 |
|