F487221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 975 | 282 | 1950 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10395210|Ga0065715_103952101 |
| Length | 189 |
| Sequence | MLSLECGALAPLWPKRRQGGAPQDHSTEIPMPKDAHEMTENEIRSRIITLAFGADERLFIAFYRKLQQGLPEGTGIVLRGSVITNKRHEDGEPFDSQGKNTSDLDVTLVGSKVMEAWNSDAYYIPGLHTKPLCDKDPDIAPSLKSLRESLQELVGRPVNFQATSSLVLYGRDVLFGETYYVVVPAGEGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 206 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 226 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 227 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 228 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 229 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 239 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 242 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 245 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 248 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 251 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 252 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 253 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 254 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 261 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 264 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 265 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 266 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 269 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 97.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10395210 | 3300005293 | Bacteria | 877 |
| 2 | SwRhRL2b_contig_19469 | 2162886007 | Unclassified | 898 |
| 3 | SwRhRL2b_contig_940246 | 2162886007 | Bacteria | 3786 |
| 4 | MBSR1b_contig_11702357 | 2162886012 | Bacteria | 1007 |
| 5 | MBSR1b_contig_357108 | 2162886012 | Unclassified | 1788 |
| 6 | MBSR1b_contig_931085 | 2162886012 | Bacteria | 965 |
| 7 | CNAas_1000523 | 3300000532 | Unclassified | 3737 |
| 8 | JGI24751J29686_10000038 | 3300002459 | Bacteria | 80932 |
| 9 | JGI25406J46586_10010758 | 3300003203 | Bacteria | 4042 |
| 10 | rootL2_10087314 | 3300003322 | Bacteria | 1027 |
| 11 | Ga0065714_10064462 | 3300005288 | Bacteria | 66145 |
| 12 | Ga0065714_10176383 | 3300005288 | Unclassified | 981 |
| 13 | Ga0065714_10385164 | 3300005288 | Bacteria | 603 |
| 14 | Ga0065704_10001276 | 3300005289 | Bacteria | 8813 |
| 15 | Ga0065704_10093146 | 3300005289 | Bacteria | 2601 |
| 16 | Ga0065712_10000135 | 3300005290 | Bacteria | 66145 |
| 17 | Ga0065712_10004694 | 3300005290 | Bacteria | 4792 |
| 18 | Ga0065712_10115832 | 3300005290 | Unclassified | 1745 |
| 19 | Ga0065712_10198370 | 3300005290 | Unclassified | 1118 |
| 20 | Ga0065712_10202013 | 3300005290 | Unclassified | 1105 |
| 21 | Ga0065715_10000518 | 3300005293 | Bacteria | 21761 |
| 22 | Ga0065715_10018641 | 3300005293 | Bacteria | 2392 |
| 23 | Ga0065715_10095497 | 3300005293 | Bacteria | 4073 |
| 24 | Ga0065715_10224383 | 3300005293 | Bacteria | 1249 |
| 25 | Ga0065715_10226068 | 3300005293 | Bacteria | 1245 |
| 26 | Ga0065715_10301402 | 3300005293 | Unclassified | 1040 |
| 27 | Ga0065715_10768521 | 3300005293 | Unclassified | 623 |
| 28 | Ga0065707_10004228 | 3300005295 | Bacteria | 5872 |
| 29 | Ga0065707_10109526 | 3300005295 | Bacteria | 2466 |
| 30 | Ga0065707_10145753 | 3300005295 | Bacteria | 1716 |
| 31 | Ga0065707_10186190 | 3300005295 | Bacteria | 1387 |
| 32 | Ga0065707_10216166 | 3300005295 | Bacteria | 1244 |
| 33 | Ga0065707_10253401 | 3300005295 | Bacteria | 1118 |
| 34 | Ga0070683_101486319 | 3300005329 | Unclassified | 651 |
| 35 | Ga0070690_100086887 | 3300005330 | Bacteria | 2053 |
| 36 | Ga0070690_100162010 | 3300005330 | Bacteria | 1533 |
| 37 | Ga0070690_100190557 | 3300005330 | Unclassified | 1421 |
| 38 | Ga0070670_100000073 | 3300005331 | Bacteria | 98443 |
| 39 | Ga0070670_100023928 | 3300005331 | Bacteria | 5255 |
| 40 | Ga0070670_100071727 | 3300005331 | Bacteria | 2974 |
| 41 | Ga0070670_100090104 | 3300005331 | Bacteria | 2636 |
| 42 | Ga0070670_100139848 | 3300005331 | Bacteria | 2094 |
| 43 | Ga0070670_100140563 | 3300005331 | Unclassified | 2087 |
| 44 | Ga0070670_100629051 | 3300005331 | Unclassified | 962 |
| 45 | Ga0070670_100691233 | 3300005331 | Unclassified | 917 |
| 46 | Ga0068869_100575570 | 3300005334 | Unclassified | 949 |
| 47 | Ga0068869_100637198 | 3300005334 | Unclassified | 904 |
| 48 | Ga0068869_101643464 | 3300005334 | Unclassified | 573 |
| 49 | Ga0070666_10076489 | 3300005335 | Bacteria | 2284 |
| 50 | Ga0070666_10908078 | 3300005335 | Unclassified | 651 |
| 51 | Ga0070680_100010009 | 3300005336 | Bacteria | 7305 |
| 52 | Ga0070680_100323922 | 3300005336 | Unclassified | 1308 |
| 53 | Ga0070680_100544429 | 3300005336 | Unclassified | 995 |
| 54 | Ga0070680_100560753 | 3300005336 | Unclassified | 979 |
| 55 | Ga0070682_100020890 | 3300005337 | Bacteria | 3859 |
| 56 | Ga0070682_100090743 | 3300005337 | Bacteria | 1999 |
| 57 | Ga0070682_100578339 | 3300005337 | Bacteria | 883 |
| 58 | Ga0068868_100003205 | 3300005338 | Bacteria | 11387 |
| 59 | Ga0068868_100073287 | 3300005338 | Unclassified | 2734 |
| 60 | Ga0068868_101041328 | 3300005338 | Unclassified | 750 |
| 61 | Ga0068868_101180516 | 3300005338 | Unclassified | 707 |
| 62 | Ga0068868_101320787 | 3300005338 | Unclassified | 670 |
| 63 | Ga0070660_100009748 | 3300005339 | Bacteria | 6769 |
| 64 | Ga0070689_100002495 | 3300005340 | Bacteria | 12028 |
| 65 | Ga0070689_100389217 | 3300005340 | Bacteria | 1176 |
| 66 | Ga0070689_100539628 | 3300005340 | Bacteria | 1004 |
| 67 | Ga0070689_101661283 | 3300005340 | Bacteria | 581 |
| 68 | Ga0070687_100005568 | 3300005343 | Bacteria | 5108 |
| 69 | Ga0070687_100109669 | 3300005343 | Unclassified | 1560 |
| 70 | Ga0070687_100129962 | 3300005343 | Bacteria | 1453 |
| 71 | Ga0070687_101133694 | 3300005343 | Unclassified | 574 |
| 72 | Ga0070661_100007782 | 3300005344 | Bacteria | 7395 |
| 73 | Ga0070661_100414086 | 3300005344 | Unclassified | 1067 |
| 74 | Ga0070692_10010809 | 3300005345 | Bacteria | 4172 |
| 75 | Ga0070692_10047386 | 3300005345 | Bacteria | 2224 |
| 76 | Ga0070692_10889857 | 3300005345 | Unclassified | 615 |
| 77 | Ga0070668_100033595 | 3300005347 | Bacteria | 3907 |
| 78 | Ga0070668_100191704 | 3300005347 | Unclassified | 1674 |
| 79 | Ga0070669_100051938 | 3300005353 | Bacteria | 2997 |
| 80 | Ga0070669_100060441 | 3300005353 | Bacteria | 2783 |
| 81 | Ga0070669_100110428 | 3300005353 | Unclassified | 2086 |
| 82 | Ga0070675_100005020 | 3300005354 | Bacteria | 10104 |
| 83 | Ga0070675_100160397 | 3300005354 | Bacteria | 1933 |
| 84 | Ga0070675_100296737 | 3300005354 | Bacteria | 1423 |
| 85 | Ga0070671_100016102 | 3300005355 | Bacteria | 6045 |
| 86 | Ga0070671_100193278 | 3300005355 | Unclassified | 1725 |
| 87 | Ga0070671_100754616 | 3300005355 | Bacteria | 846 |
| 88 | Ga0070674_100392644 | 3300005356 | Unclassified | 1132 |
| 89 | Ga0070674_100486285 | 3300005356 | Unclassified | 1025 |
| 90 | Ga0070673_100011196 | 3300005364 | Bacteria | 6116 |
| 91 | Ga0070673_100082774 | 3300005364 | Bacteria | 2605 |
| 92 | Ga0070673_100151043 | 3300005364 | Bacteria | 1967 |
| 93 | Ga0070673_100278136 | 3300005364 | Unclassified | 1467 |
| 94 | Ga0070673_100521158 | 3300005364 | Bacteria | 1077 |
| 95 | Ga0070673_100717608 | 3300005364 | Unclassified | 919 |
| 96 | Ga0070688_100095477 | 3300005365 | Bacteria | 1951 |
| 97 | Ga0070688_100481383 | 3300005365 | Bacteria | 933 |
| 98 | Ga0070688_100619932 | 3300005365 | Unclassified | 830 |
| 99 | Ga0070659_100006362 | 3300005366 | Bacteria | 8529 |
| 100 | Ga0070659_100028181 | 3300005366 | Bacteria | 4335 |
| 101 | Ga0070659_100999367 | 3300005366 | Unclassified | 734 |
| 102 | Ga0070667_100040149 | 3300005367 | Bacteria | 3924 |
| 103 | Ga0070667_100144424 | 3300005367 | Bacteria | 2086 |
| 104 | Ga0070703_10003811 | 3300005406 | Bacteria | 4267 |
| 105 | Ga0070701_10021145 | 3300005438 | Unclassified | 3101 |
| 106 | Ga0070701_10135429 | 3300005438 | Bacteria | 1403 |
| 107 | Ga0070701_10874208 | 3300005438 | Bacteria | 619 |
| 108 | Ga0070705_100027760 | 3300005440 | Bacteria | 3093 |
| 109 | Ga0070705_100029045 | 3300005440 | Bacteria | 3036 |
| 110 | Ga0070705_100033473 | 3300005440 | Bacteria | 2865 |
| 111 | Ga0070705_100183086 | 3300005440 | Bacteria | 1421 |
| 112 | Ga0070705_100383366 | 3300005440 | Bacteria | 1035 |
| 113 | Ga0070705_101260757 | 3300005440 | Unclassified | 611 |
| 114 | Ga0070700_100000036 | 3300005441 | Bacteria | 111099 |
| 115 | Ga0070700_100022252 | 3300005441 | Bacteria | 3694 |
| 116 | Ga0070700_100024136 | 3300005441 | Bacteria | 3566 |
| 117 | Ga0070700_100090395 | 3300005441 | Bacteria | 1997 |
| 118 | Ga0070700_100165686 | 3300005441 | Bacteria | 1526 |
| 119 | Ga0070700_100169080 | 3300005441 | Bacteria | 1512 |
| 120 | Ga0070700_100169455 | 3300005441 | Bacteria | 1511 |
| 121 | Ga0070700_100764474 | 3300005441 | Bacteria | 774 |
| 122 | Ga0070694_100012909 | 3300005444 | Bacteria | 5209 |
| 123 | Ga0070694_100020194 | 3300005444 | Unclassified | 4246 |
| 124 | Ga0070694_100021886 | 3300005444 | Bacteria | 4091 |
| 125 | Ga0070694_100037254 | 3300005444 | Bacteria | 3225 |
| 126 | Ga0070694_100056887 | 3300005444 | Bacteria | 2658 |
| 127 | Ga0070694_100058711 | 3300005444 | Unclassified | 2618 |
| 128 | Ga0070694_100061940 | 3300005444 | Bacteria | 2555 |
| 129 | Ga0070694_100102226 | 3300005444 | Bacteria | 2029 |
| 130 | Ga0070694_100122869 | 3300005444 | Bacteria | 1865 |
| 131 | Ga0070694_100147135 | 3300005444 | Unclassified | 1717 |
| 132 | Ga0070694_100198773 | 3300005444 | Bacteria | 1493 |
| 133 | Ga0070694_100852355 | 3300005444 | Unclassified | 750 |
| 134 | Ga0070694_100856652 | 3300005444 | Unclassified | 748 |
| 135 | Ga0070708_100000754 | 3300005445 | Bacteria | 24432 |
| 136 | Ga0070708_100568345 | 3300005445 | Unclassified | 1069 |
| 137 | Ga0070678_100529771 | 3300005456 | Unclassified | 1043 |
| 138 | Ga0070662_100055184 | 3300005457 | Bacteria | 2882 |
| 139 | Ga0070662_100073820 | 3300005457 | Unclassified | 2521 |
| 140 | Ga0070662_100295688 | 3300005457 | Unclassified | 1314 |
| 141 | Ga0070681_10004646 | 3300005458 | Bacteria | 13115 |
| 142 | Ga0070681_10023868 | 3300005458 | Bacteria | 6157 |
| 143 | Ga0070681_10045973 | 3300005458 | Unclassified | 4366 |
| 144 | Ga0068867_100112707 | 3300005459 | Bacteria | 2091 |
| 145 | Ga0068867_100257141 | 3300005459 | Unclassified | 1422 |
| 146 | Ga0068867_100264883 | 3300005459 | Unclassified | 1403 |
| 147 | Ga0068867_100425844 | 3300005459 | Bacteria | 1125 |
| 148 | Ga0068867_100653003 | 3300005459 | Unclassified | 923 |
| 149 | Ga0068867_100931404 | 3300005459 | Unclassified | 784 |
| 150 | Ga0070685_10098747 | 3300005466 | Bacteria | 1779 |
| 151 | Ga0070685_10130436 | 3300005466 | Bacteria | 1571 |
| 152 | Ga0070706_100000015 | 3300005467 | Bacteria | 188425 |
| 153 | Ga0070706_100028134 | 3300005467 | Bacteria | 5173 |
| 154 | Ga0070706_100332487 | 3300005467 | Bacteria | 1417 |
| 155 | Ga0070706_100515067 | 3300005467 | Unclassified | 1113 |
| 156 | Ga0070707_100255809 | 3300005468 | Bacteria | 1704 |
| 157 | Ga0070707_100257648 | 3300005468 | Unclassified | 1697 |
| 158 | Ga0070707_100724730 | 3300005468 | Bacteria | 957 |
| 159 | Ga0070698_100007009 | 3300005471 | Bacteria | 12208 |
| 160 | Ga0070698_100008421 | 3300005471 | Bacteria | 11147 |
| 161 | Ga0070698_100028005 | 3300005471 | Bacteria | 5856 |
| 162 | Ga0070698_100181594 | 3300005471 | Bacteria | 2042 |
| 163 | Ga0070699_100006181 | 3300005518 | Bacteria | 10463 |
| 164 | Ga0070699_100031705 | 3300005518 | Bacteria | 4563 |
| 165 | Ga0070699_100239523 | 3300005518 | Bacteria | 1619 |
| 166 | Ga0070699_100257822 | 3300005518 | Bacteria | 1559 |
| 167 | Ga0070699_100484971 | 3300005518 | Bacteria | 1122 |
| 168 | Ga0070699_100711902 | 3300005518 | Bacteria | 917 |
| 169 | Ga0070699_100741382 | 3300005518 | Bacteria | 898 |
| 170 | Ga0070679_100036868 | 3300005530 | Bacteria | 4854 |
| 171 | Ga0070679_100110587 | 3300005530 | Bacteria | 2734 |
| 172 | Ga0070697_100007769 | 3300005536 | Bacteria | 8351 |
| 173 | Ga0070697_100057188 | 3300005536 | Bacteria | 3174 |
| 174 | Ga0070697_100148942 | 3300005536 | Bacteria | 1972 |
| 175 | Ga0070697_100269151 | 3300005536 | Unclassified | 1460 |
| 176 | Ga0070697_100836497 | 3300005536 | Unclassified | 815 |
| 177 | Ga0068853_100004345 | 3300005539 | Bacteria | 10966 |
| 178 | Ga0068853_100015636 | 3300005539 | Bacteria | 6233 |
| 179 | Ga0068853_100607973 | 3300005539 | Unclassified | 1038 |
| 180 | Ga0070672_100010581 | 3300005543 | Bacteria | 6403 |
| 181 | Ga0070672_100193118 | 3300005543 | Bacteria | 1701 |
| 182 | Ga0070686_100038592 | 3300005544 | Bacteria | 2970 |
| 183 | Ga0070695_100020513 | 3300005545 | Bacteria | 4035 |
| 184 | Ga0070695_100024122 | 3300005545 | Bacteria | 3745 |
| 185 | Ga0070695_100050997 | 3300005545 | Bacteria | 2654 |
| 186 | Ga0070695_100138975 | 3300005545 | Bacteria | 1682 |
| 187 | Ga0070695_100154880 | 3300005545 | Bacteria | 1603 |
| 188 | Ga0070695_100175716 | 3300005545 | Bacteria | 1514 |
| 189 | Ga0070695_100479223 | 3300005545 | Unclassified | 959 |
| 190 | Ga0070695_100806617 | 3300005545 | Unclassified | 752 |
| 191 | Ga0070695_101441891 | 3300005545 | Unclassified | 572 |
| 192 | Ga0070696_100031402 | 3300005546 | Bacteria | 3640 |
| 193 | Ga0070696_100058455 | 3300005546 | Bacteria | 2693 |
| 194 | Ga0070696_100059835 | 3300005546 | Unclassified | 2663 |
| 195 | Ga0070696_100309618 | 3300005546 | Unclassified | 1212 |
| 196 | Ga0070696_100339030 | 3300005546 | Unclassified | 1161 |
| 197 | Ga0070696_100400255 | 3300005546 | Unclassified | 1074 |
| 198 | Ga0070696_100535977 | 3300005546 | Bacteria | 936 |
| 199 | Ga0070696_100698140 | 3300005546 | Bacteria | 827 |
| 200 | Ga0070693_100000775 | 3300005547 | Bacteria | 14086 |
| 201 | Ga0070693_100011909 | 3300005547 | Bacteria | 4389 |
| 202 | Ga0070693_100015356 | 3300005547 | Unclassified | 3941 |
| 203 | Ga0070693_100016559 | 3300005547 | Bacteria | 3818 |
| 204 | Ga0070693_100061355 | 3300005547 | Unclassified | 2185 |
| 205 | Ga0070693_100178780 | 3300005547 | Bacteria | 1365 |
| 206 | Ga0070693_101021390 | 3300005547 | Bacteria | 627 |
| 207 | Ga0070665_100158496 | 3300005548 | Bacteria | 2265 |
| 208 | Ga0070704_100091555 | 3300005549 | Bacteria | 2268 |
| 209 | Ga0070704_100104193 | 3300005549 | Bacteria | 2144 |
| 210 | Ga0070704_100133812 | 3300005549 | Bacteria | 1926 |
| 211 | Ga0070704_100217426 | 3300005549 | Unclassified | 1552 |
| 212 | Ga0070704_100282971 | 3300005549 | Bacteria | 1375 |
| 213 | Ga0070704_100467630 | 3300005549 | Bacteria | 1089 |
| 214 | Ga0070704_100535327 | 3300005549 | Unclassified | 1022 |
| 215 | Ga0070704_100739543 | 3300005549 | Bacteria | 875 |
| 216 | Ga0068855_100137573 | 3300005563 | Bacteria | 2786 |
| 217 | Ga0068855_100609218 | 3300005563 | Bacteria | 1177 |
| 218 | Ga0070664_100002580 | 3300005564 | Bacteria | 14610 |
| 219 | Ga0070664_100267875 | 3300005564 | Bacteria | 1538 |
| 220 | Ga0070664_100452627 | 3300005564 | Bacteria | 1179 |
| 221 | Ga0070664_100596456 | 3300005564 | Bacteria | 1024 |
| 222 | Ga0070664_100843478 | 3300005564 | Unclassified | 858 |
| 223 | Ga0070664_100928563 | 3300005564 | Unclassified | 816 |
| 224 | Ga0068857_100002670 | 3300005577 | Bacteria | 14644 |
| 225 | Ga0068857_100046286 | 3300005577 | Bacteria | 3861 |
| 226 | Ga0068857_100127827 | 3300005577 | Bacteria | 2290 |
| 227 | Ga0068857_100140490 | 3300005577 | Bacteria | 2183 |
| 228 | Ga0068857_100204067 | 3300005577 | Bacteria | 1802 |
| 229 | Ga0068857_100816659 | 3300005577 | Bacteria | 891 |
| 230 | Ga0068857_100829651 | 3300005577 | Unclassified | 884 |
| 231 | Ga0068857_100874264 | 3300005577 | Unclassified | 861 |
| 232 | Ga0068854_100056797 | 3300005578 | Unclassified | 2822 |
| 233 | Ga0068854_100120815 | 3300005578 | Bacteria | 1989 |
| 234 | Ga0068854_100229047 | 3300005578 | Unclassified | 1474 |
| 235 | Ga0068854_100309478 | 3300005578 | Unclassified | 1281 |
| 236 | Ga0068854_100336401 | 3300005578 | Unclassified | 1232 |
| 237 | Ga0068854_100902874 | 3300005578 | Bacteria | 777 |
| 238 | Ga0068854_101097304 | 3300005578 | Unclassified | 709 |
| 239 | Ga0068856_100005300 | 3300005614 | Bacteria | 12724 |
| 240 | Ga0070702_100003492 | 3300005615 | Bacteria | 7036 |
| 241 | Ga0070702_100079893 | 3300005615 | Bacteria | 1956 |
| 242 | Ga0070702_100115532 | 3300005615 | Bacteria | 1672 |
| 243 | Ga0070702_100301659 | 3300005615 | Unclassified | 1108 |
| 244 | Ga0070702_100451768 | 3300005615 | Bacteria | 932 |
| 245 | Ga0070702_100462172 | 3300005615 | Unclassified | 923 |
| 246 | Ga0070702_101057559 | 3300005615 | Unclassified | 646 |
| 247 | Ga0068852_100236357 | 3300005616 | Unclassified | 1744 |
| 248 | Ga0068852_100350256 | 3300005616 | Bacteria | 1442 |
| 249 | Ga0068852_100369808 | 3300005616 | Unclassified | 1404 |
| 250 | Ga0068852_100429403 | 3300005616 | Bacteria | 1304 |
| 251 | Ga0068852_100713297 | 3300005616 | Bacteria | 1014 |
| 252 | Ga0068852_101105028 | 3300005616 | Bacteria | 813 |
| 253 | Ga0068859_100007922 | 3300005617 | Bacteria | 10774 |
| 254 | Ga0068859_100013228 | 3300005617 | Bacteria | 8279 |
| 255 | Ga0068859_100036108 | 3300005617 | Unclassified | 4960 |
| 256 | Ga0068859_100043033 | 3300005617 | Bacteria | 4538 |
| 257 | Ga0068859_100086985 | 3300005617 | Bacteria | 3172 |
| 258 | Ga0068859_100131954 | 3300005617 | Bacteria | 2570 |
| 259 | Ga0068859_100193692 | 3300005617 | Bacteria | 2117 |
| 260 | Ga0068859_100405841 | 3300005617 | Unclassified | 1459 |
| 261 | Ga0068859_101222223 | 3300005617 | Unclassified | 828 |
| 262 | Ga0068859_101388807 | 3300005617 | Bacteria | 774 |
| 263 | Ga0068859_101392126 | 3300005617 | Unclassified | 773 |
| 264 | Ga0068859_101402539 | 3300005617 | Bacteria | 770 |
| 265 | Ga0068859_101454652 | 3300005617 | Unclassified | 756 |
| 266 | Ga0068859_102095814 | 3300005617 | Unclassified | 624 |
| 267 | Ga0068864_100001219 | 3300005618 | Bacteria | 21368 |
| 268 | Ga0068864_100018626 | 3300005618 | Bacteria | 5802 |
| 269 | Ga0068864_100025577 | 3300005618 | Bacteria | 4973 |
| 270 | Ga0068864_100190372 | 3300005618 | Bacteria | 1880 |
| 271 | Ga0068864_100192015 | 3300005618 | Bacteria | 1873 |
| 272 | Ga0068864_100229083 | 3300005618 | Bacteria | 1718 |
| 273 | Ga0068864_100231901 | 3300005618 | Unclassified | 1708 |
| 274 | Ga0068864_100260504 | 3300005618 | Bacteria | 1613 |
| 275 | Ga0068864_100269194 | 3300005618 | Bacteria | 1587 |
| 276 | Ga0068864_100282780 | 3300005618 | Bacteria | 1549 |
| 277 | Ga0068864_100310682 | 3300005618 | Bacteria | 1478 |
| 278 | Ga0068864_100531623 | 3300005618 | Bacteria | 1135 |
| 279 | Ga0068864_100652749 | 3300005618 | Unclassified | 1025 |
| 280 | Ga0068864_102034065 | 3300005618 | Unclassified | 581 |
| 281 | Ga0068866_10005031 | 3300005718 | Bacteria | 5442 |
| 282 | Ga0068861_100008097 | 3300005719 | Bacteria | 7232 |
| 283 | Ga0068861_100022748 | 3300005719 | Bacteria | 4520 |
| 284 | Ga0068861_100028715 | 3300005719 | Unclassified | 4061 |
| 285 | Ga0068861_100062703 | 3300005719 | Unclassified | 2856 |
| 286 | Ga0068861_100249023 | 3300005719 | Bacteria | 1515 |
| 287 | Ga0068861_100504958 | 3300005719 | Unclassified | 1094 |
| 288 | Ga0068861_101759260 | 3300005719 | Unclassified | 614 |
| 289 | Ga0068851_10013712 | 3300005834 | Bacteria | 3837 |
| 290 | Ga0068870_10028203 | 3300005840 | Bacteria | 2817 |
| 291 | Ga0068870_10156000 | 3300005840 | Bacteria | 1349 |
| 292 | Ga0068870_10229281 | 3300005840 | Unclassified | 1141 |
| 293 | Ga0068870_10742931 | 3300005840 | Bacteria | 681 |
| 294 | Ga0068863_100146705 | 3300005841 | Unclassified | 2257 |
| 295 | Ga0068863_100190549 | 3300005841 | Unclassified | 1970 |
| 296 | Ga0068863_100241479 | 3300005841 | Unclassified | 1743 |
| 297 | Ga0068863_100580132 | 3300005841 | Bacteria | 1109 |
| 298 | Ga0068858_100058113 | 3300005842 | Bacteria | 3576 |
| 299 | Ga0068858_100069609 | 3300005842 | Bacteria | 3262 |
| 300 | Ga0068858_100117601 | 3300005842 | Bacteria | 2485 |
| 301 | Ga0068858_100139032 | 3300005842 | Bacteria | 2280 |
| 302 | Ga0068858_100167819 | 3300005842 | Bacteria | 2069 |
| 303 | Ga0068858_100206124 | 3300005842 | Bacteria | 1860 |
| 304 | Ga0068858_100239355 | 3300005842 | Unclassified | 1722 |
| 305 | Ga0068858_100270339 | 3300005842 | Bacteria | 1617 |
| 306 | Ga0068858_100326388 | 3300005842 | Unclassified | 1467 |
| 307 | Ga0068858_100476366 | 3300005842 | Bacteria | 1204 |
| 308 | Ga0068858_102363058 | 3300005842 | Unclassified | 525 |
| 309 | Ga0068860_100078315 | 3300005843 | Bacteria | 3143 |
| 310 | Ga0068860_100213204 | 3300005843 | Bacteria | 1873 |
| 311 | Ga0068860_100289930 | 3300005843 | Bacteria | 1601 |
| 312 | Ga0068860_100347761 | 3300005843 | Bacteria | 1458 |
| 313 | Ga0068860_100585163 | 3300005843 | Bacteria | 1121 |
| 314 | Ga0068860_100833533 | 3300005843 | Bacteria | 936 |
| 315 | Ga0068860_100936601 | 3300005843 | Unclassified | 883 |
| 316 | Ga0068860_101267648 | 3300005843 | Unclassified | 758 |
| 317 | Ga0068862_100018132 | 3300005844 | Bacteria | 5861 |
| 318 | Ga0068862_100029245 | 3300005844 | Unclassified | 4642 |
| 319 | Ga0068862_100095055 | 3300005844 | Bacteria | 2599 |
| 320 | Ga0068862_100239530 | 3300005844 | Bacteria | 1649 |
| 321 | Ga0068862_100429975 | 3300005844 | Bacteria | 1241 |
| 322 | Ga0068862_100467340 | 3300005844 | Bacteria | 1192 |
| 323 | Ga0068862_101175652 | 3300005844 | Unclassified | 765 |
| 324 | Ga0068862_101198384 | 3300005844 | Bacteria | 758 |
| 325 | Ga0081539_10000487 | 3300005985 | Bacteria | 83994 |
| 326 | Ga0081539_10003495 | 3300005985 | Bacteria | 19198 |
| 327 | Ga0075432_10043540 | 3300006058 | Unclassified | 1573 |
| 328 | Ga0070716_100229478 | 3300006173 | Unclassified | 1252 |
| 329 | Ga0070716_100366417 | 3300006173 | Unclassified | 1025 |
| 330 | Ga0097621_100001343 | 3300006237 | Bacteria | 16907 |
| 331 | Ga0097621_100019601 | 3300006237 | Bacteria | 5196 |
| 332 | Ga0097621_100031588 | 3300006237 | Bacteria | 4203 |
| 333 | Ga0097621_100438482 | 3300006237 | Bacteria | 1175 |
| 334 | Ga0068871_100007860 | 3300006358 | Bacteria | 7641 |
| 335 | Ga0068871_100043720 | 3300006358 | Bacteria | 3599 |
| 336 | Ga0068871_100047482 | 3300006358 | Unclassified | 3463 |
| 337 | Ga0068871_100127451 | 3300006358 | Bacteria | 2156 |
| 338 | Ga0068871_100468125 | 3300006358 | Unclassified | 1132 |
| 339 | Ga0075428_100081296 | 3300006844 | Bacteria | 3536 |
| 340 | Ga0075428_100083970 | 3300006844 | Bacteria | 3474 |
| 341 | Ga0075428_100911329 | 3300006844 | Unclassified | 932 |
| 342 | Ga0075430_100458873 | 3300006846 | Unclassified | 1051 |
| 343 | Ga0075431_100073125 | 3300006847 | Unclassified | 3537 |
| 344 | Ga0075431_100188611 | 3300006847 | Bacteria | 2113 |
| 345 | Ga0075431_100790428 | 3300006847 | Unclassified | 923 |
| 346 | Ga0075433_10006875 | 3300006852 | Bacteria | 9016 |
| 347 | Ga0075433_10013861 | 3300006852 | Bacteria | 6572 |
| 348 | Ga0075433_10031197 | 3300006852 | Unclassified | 4554 |
| 349 | Ga0075433_10050622 | 3300006852 | Bacteria | 3616 |
| 350 | Ga0075433_10153666 | 3300006852 | Bacteria | 2047 |
| 351 | Ga0075433_10180526 | 3300006852 | Bacteria | 1878 |
| 352 | Ga0075433_10194957 | 3300006852 | Unclassified | 1802 |
| 353 | Ga0075433_10220696 | 3300006852 | Bacteria | 1684 |
| 354 | Ga0075433_10730423 | 3300006852 | Bacteria | 867 |
| 355 | Ga0075434_100043034 | 3300006871 | Unclassified | 4478 |
| 356 | Ga0075434_100049269 | 3300006871 | Bacteria | 4182 |
| 357 | Ga0075434_100348874 | 3300006871 | Bacteria | 1501 |
| 358 | Ga0075434_100539747 | 3300006871 | Bacteria | 1186 |
| 359 | Ga0075434_100593309 | 3300006871 | Unclassified | 1127 |
| 360 | Ga0075434_101473349 | 3300006871 | Unclassified | 690 |
| 361 | Ga0075429_100015591 | 3300006880 | Bacteria | 6587 |
| 362 | Ga0075429_100106679 | 3300006880 | Bacteria | 2447 |
| 363 | Ga0075429_100121025 | 3300006880 | Bacteria | 2288 |
| 364 | Ga0075429_100144798 | 3300006880 | Unclassified | 2080 |
| 365 | Ga0068865_100160008 | 3300006881 | Unclassified | 1717 |
| 366 | Ga0068865_100329059 | 3300006881 | Bacteria | 1231 |
| 367 | Ga0068865_100477519 | 3300006881 | Bacteria | 1035 |
| 368 | Ga0075436_100023126 | 3300006914 | Bacteria | 4269 |
| 369 | Ga0097620_100007923 | 3300006931 | Bacteria | 10774 |
| 370 | Ga0097620_100013228 | 3300006931 | Bacteria | 8279 |
| 371 | Ga0097620_100036109 | 3300006931 | Unclassified | 4960 |
| 372 | Ga0097620_100043031 | 3300006931 | Bacteria | 4538 |
| 373 | Ga0097620_100086983 | 3300006931 | Bacteria | 3172 |
| 374 | Ga0097620_100131950 | 3300006931 | Bacteria | 2570 |
| 375 | Ga0097620_100193666 | 3300006931 | Bacteria | 2117 |
| 376 | Ga0097620_100405880 | 3300006931 | Unclassified | 1459 |
| 377 | Ga0097620_101222255 | 3300006931 | Unclassified | 828 |
| 378 | Ga0097620_101388775 | 3300006931 | Bacteria | 774 |
| 379 | Ga0097620_101392138 | 3300006931 | Unclassified | 773 |
| 380 | Ga0097620_101402532 | 3300006931 | Bacteria | 770 |
| 381 | Ga0097620_101454374 | 3300006931 | Unclassified | 756 |
| 382 | Ga0097620_102095773 | 3300006931 | Unclassified | 624 |
| 383 | Ga0075435_100006392 | 3300007076 | Bacteria | 8330 |
| 384 | Ga0075435_100590130 | 3300007076 | Unclassified | 963 |
| 385 | Ga0099794_10566226 | 3300007265 | Unclassified | 600 |
| 386 | Ga0105251_10129543 | 3300009011 | Unclassified | 1144 |
| 387 | Ga0105251_10265475 | 3300009011 | Bacteria | 775 |
| 388 | Ga0105240_10134905 | 3300009093 | Viruses | 2957 |
| 389 | Ga0111539_10079327 | 3300009094 | Bacteria | 3862 |
| 390 | Ga0111539_10154246 | 3300009094 | Bacteria | 2688 |
| 391 | Ga0111539_10159347 | 3300009094 | Bacteria | 2640 |
| 392 | Ga0105245_10249548 | 3300009098 | Bacteria | 1723 |
| 393 | Ga0105245_10528738 | 3300009098 | Unclassified | 1199 |
| 394 | Ga0105245_10602225 | 3300009098 | Bacteria | 1125 |
| 395 | Ga0105245_10685058 | 3300009098 | Bacteria | 1057 |
| 396 | Ga0105245_10768395 | 3300009098 | Bacteria | 1000 |
| 397 | Ga0105245_10812780 | 3300009098 | Unclassified | 973 |
| 398 | Ga0105247_10037314 | 3300009101 | Bacteria | 2965 |
| 399 | Ga0105247_10056096 | 3300009101 | Unclassified | 2432 |
| 400 | Ga0105247_10062815 | 3300009101 | Unclassified | 2304 |
| 401 | Ga0105247_10079635 | 3300009101 | Bacteria | 2062 |
| 402 | Ga0105247_10523647 | 3300009101 | Bacteria | 867 |
| 403 | Ga0105247_11149579 | 3300009101 | Unclassified | 615 |
| 404 | Ga0114129_10004897 | 3300009147 | Bacteria | 18898 |
| 405 | Ga0114129_10108771 | 3300009147 | Bacteria | 3827 |
| 406 | Ga0114129_10109956 | 3300009147 | Bacteria | 3804 |
| 407 | Ga0114129_10227794 | 3300009147 | Bacteria | 2511 |
| 408 | Ga0114129_10253051 | 3300009147 | Bacteria | 2364 |
| 409 | Ga0114129_10268134 | 3300009147 | Bacteria | 2285 |
| 410 | Ga0114129_11286659 | 3300009147 | Bacteria | 907 |
| 411 | Ga0114129_11397339 | 3300009147 | Bacteria | 864 |
| 412 | Ga0114129_12078280 | 3300009147 | Unclassified | 686 |
| 413 | Ga0105243_10001952 | 3300009148 | Bacteria | 17560 |
| 414 | Ga0105243_10011066 | 3300009148 | Viruses | 6825 |
| 415 | Ga0105243_10133105 | 3300009148 | Unclassified | 2112 |
| 416 | Ga0105243_10236103 | 3300009148 | Bacteria | 1624 |
| 417 | Ga0105243_10309892 | 3300009148 | Bacteria | 1434 |
| 418 | Ga0105243_10580888 | 3300009148 | Bacteria | 1076 |
| 419 | Ga0105241_10019131 | 3300009174 | Bacteria | 5050 |
| 420 | Ga0105241_10020033 | 3300009174 | Bacteria | 4940 |
| 421 | Ga0105241_10056913 | 3300009174 | Bacteria | 2998 |
| 422 | Ga0105241_10101685 | 3300009174 | Unclassified | 2286 |
| 423 | Ga0105241_10279458 | 3300009174 | Unclassified | 1425 |
| 424 | Ga0105241_10344228 | 3300009174 | Bacteria | 1293 |
| 425 | Ga0105241_10384564 | 3300009174 | Unclassified | 1227 |
| 426 | Ga0105241_10527537 | 3300009174 | Bacteria | 1057 |
| 427 | Ga0105241_10613536 | 3300009174 | Unclassified | 984 |
| 428 | Ga0105241_10641696 | 3300009174 | Unclassified | 963 |
| 429 | Ga0105241_10896005 | 3300009174 | Unclassified | 823 |
| 430 | Ga0105241_10916105 | 3300009174 | Bacteria | 815 |
| 431 | Ga0105241_11135029 | 3300009174 | Unclassified | 737 |
| 432 | Ga0105241_11538070 | 3300009174 | Unclassified | 641 |
| 433 | Ga0105242_10132200 | 3300009176 | Bacteria | 2155 |
| 434 | Ga0105242_10150841 | 3300009176 | Unclassified | 2026 |
| 435 | Ga0105242_10204557 | 3300009176 | Unclassified | 1755 |
| 436 | Ga0105242_10265263 | 3300009176 | Viruses | 1553 |
| 437 | Ga0105242_10793254 | 3300009176 | Bacteria | 937 |
| 438 | Ga0105242_11249826 | 3300009176 | Bacteria | 764 |
| 439 | Ga0105248_10005050 | 3300009177 | Bacteria | 14571 |
| 440 | Ga0105248_10007877 | 3300009177 | Bacteria | 11702 |
| 441 | Ga0105248_10092690 | 3300009177 | Unclassified | 3402 |
| 442 | Ga0105248_10111760 | 3300009177 | Unclassified | 3081 |
| 443 | Ga0105248_10119835 | 3300009177 | Unclassified | 2968 |
| 444 | Ga0105248_10182462 | 3300009177 | Bacteria | 2365 |
| 445 | Ga0105248_10258325 | 3300009177 | Bacteria | 1961 |
| 446 | Ga0105248_10610498 | 3300009177 | Bacteria | 1231 |
| 447 | Ga0105248_10649135 | 3300009177 | Bacteria | 1191 |
| 448 | Ga0105248_11028285 | 3300009177 | Bacteria | 931 |
| 449 | Ga0105248_11031255 | 3300009177 | Bacteria | 929 |
| 450 | Ga0105248_11113475 | 3300009177 | Unclassified | 892 |
| 451 | Ga0105248_11380131 | 3300009177 | Unclassified | 797 |
| 452 | Ga0105248_11767455 | 3300009177 | Bacteria | 701 |
| 453 | Ga0105237_10001132 | 3300009545 | Bacteria | 35782 |
| 454 | Ga0105237_10042047 | 3300009545 | Bacteria | 4609 |
| 455 | Ga0105237_10080027 | 3300009545 | Bacteria | 3258 |
| 456 | Ga0105237_11488175 | 3300009545 | Bacteria | 684 |
| 457 | Ga0105238_10002642 | 3300009551 | Bacteria | 17857 |
| 458 | Ga0105238_10006395 | 3300009551 | Bacteria | 11722 |
| 459 | Ga0105249_10000029 | 3300009553 | Bacteria | 227479 |
| 460 | Ga0105249_10011040 | 3300009553 | Bacteria | 7936 |
| 461 | Ga0105249_10044992 | 3300009553 | Bacteria | 4014 |
| 462 | Ga0105249_10075873 | 3300009553 | Bacteria | 3114 |
| 463 | Ga0105249_10174903 | 3300009553 | Bacteria | 2084 |
| 464 | Ga0105249_10221788 | 3300009553 | Unclassified | 1861 |
| 465 | Ga0105249_10502725 | 3300009553 | Unclassified | 1257 |
| 466 | Ga0105249_10558796 | 3300009553 | Bacteria | 1196 |
| 467 | Ga0105249_11759623 | 3300009553 | Unclassified | 692 |
| 468 | Ga0099796_10062247 | 3300010159 | Unclassified | 1326 |
| 469 | Ga0105239_10101185 | 3300010375 | Bacteria | 3188 |
| 470 | Ga0105239_10145157 | 3300010375 | Unclassified | 2646 |
| 471 | Ga0105239_10580804 | 3300010375 | Bacteria | 1277 |
| 472 | Ga0105239_10801409 | 3300010375 | Bacteria | 1079 |
| 473 | Ga0105246_10105079 | 3300011119 | Bacteria | 2063 |
| 474 | Ga0105246_10153661 | 3300011119 | Bacteria | 1745 |
| 475 | Ga0105246_10242148 | 3300011119 | Unclassified | 1426 |
| 476 | Ga0105246_10361028 | 3300011119 | Unclassified | 1194 |
| 477 | Ga0105246_10400032 | 3300011119 | Bacteria | 1140 |
| 478 | Ga0105246_10885543 | 3300011119 | Bacteria | 799 |
| 479 | Ga0105246_11028925 | 3300011119 | Unclassified | 747 |
| 480 | Ga0105246_11777870 | 3300011119 | Bacteria | 588 |
| 481 | Ga0157373_10006338 | 3300013100 | Bacteria | 8839 |
| 482 | Ga0157373_10009488 | 3300013100 | Bacteria | 7189 |
| 483 | Ga0157373_10017090 | 3300013100 | Bacteria | 5283 |
| 484 | Ga0157373_10095244 | 3300013100 | Unclassified | 2095 |
| 485 | Ga0157373_10698240 | 3300013100 | Unclassified | 743 |
| 486 | Ga0157373_10772813 | 3300013100 | Unclassified | 707 |
| 487 | Ga0157373_10957197 | 3300013100 | Unclassified | 637 |
| 488 | Ga0157371_10158534 | 3300013102 | Bacteria | 1616 |
| 489 | Ga0157371_10825009 | 3300013102 | Bacteria | 700 |
| 490 | Ga0157374_10022626 | 3300013296 | Bacteria | 5608 |
| 491 | Ga0157374_10032330 | 3300013296 | Unclassified | 4762 |
| 492 | Ga0157374_11721782 | 3300013296 | Unclassified | 652 |
| 493 | Ga0157374_12018549 | 3300013296 | Unclassified | 603 |
| 494 | Ga0157374_12177566 | 3300013296 | Unclassified | 581 |
| 495 | Ga0157378_10010378 | 3300013297 | Bacteria | 8131 |
| 496 | Ga0157378_10015544 | 3300013297 | Bacteria | 6666 |
| 497 | Ga0157378_10025558 | 3300013297 | Bacteria | 5200 |
| 498 | Ga0157378_10053702 | 3300013297 | Bacteria | 3588 |
| 499 | Ga0157378_10179805 | 3300013297 | Bacteria | 1989 |
| 500 | Ga0157378_10512108 | 3300013297 | Bacteria | 1200 |
| 501 | Ga0157378_10649952 | 3300013297 | Unclassified | 1070 |
| 502 | Ga0157378_11082420 | 3300013297 | Unclassified | 838 |
| 503 | Ga0163162_10000009 | 3300013306 | Bacteria | 316099 |
| 504 | Ga0163162_10008612 | 3300013306 | Bacteria | 9941 |
| 505 | Ga0163162_10010879 | 3300013306 | Bacteria | 8856 |
| 506 | Ga0163162_10041507 | 3300013306 | Bacteria | 4604 |
| 507 | Ga0163162_10053986 | 3300013306 | Bacteria | 4040 |
| 508 | Ga0163162_10508634 | 3300013306 | Unclassified | 1335 |
| 509 | Ga0163162_10662578 | 3300013306 | Bacteria | 1167 |
| 510 | Ga0163162_10672833 | 3300013306 | Bacteria | 1158 |
| 511 | Ga0163162_10684081 | 3300013306 | Bacteria | 1148 |
| 512 | Ga0163162_10781228 | 3300013306 | Bacteria | 1073 |
| 513 | Ga0157372_10033659 | 3300013307 | Bacteria | 5631 |
| 514 | Ga0157372_10420145 | 3300013307 | Unclassified | 1558 |
| 515 | Ga0157372_10471524 | 3300013307 | Bacteria | 1463 |
| 516 | Ga0157372_10565087 | 3300013307 | Unclassified | 1326 |
| 517 | Ga0157372_11281273 | 3300013307 | Bacteria | 846 |
| 518 | Ga0157372_12362863 | 3300013307 | Bacteria | 610 |
| 519 | Ga0157375_10009777 | 3300013308 | Bacteria | 8431 |
| 520 | Ga0157375_10018218 | 3300013308 | Bacteria | 6364 |
| 521 | Ga0157375_10128892 | 3300013308 | Bacteria | 2648 |
| 522 | Ga0157375_10226322 | 3300013308 | Bacteria | 2029 |
| 523 | Ga0157375_10284166 | 3300013308 | Unclassified | 1818 |
| 524 | Ga0157375_10382809 | 3300013308 | Bacteria | 1573 |
| 525 | Ga0157375_10413504 | 3300013308 | Unclassified | 1515 |
| 526 | Ga0157375_10454290 | 3300013308 | Unclassified | 1447 |
| 527 | Ga0157375_10788697 | 3300013308 | Unclassified | 1099 |
| 528 | Ga0157375_10859873 | 3300013308 | Bacteria | 1053 |
| 529 | Ga0157375_10899652 | 3300013308 | Bacteria | 1029 |
| 530 | Ga0157375_11375474 | 3300013308 | Unclassified | 831 |
| 531 | Ga0163163_10000466 | 3300014325 | Bacteria | 36943 |
| 532 | Ga0163163_10002054 | 3300014325 | Bacteria | 16994 |
| 533 | Ga0163163_10002763 | 3300014325 | Bacteria | 14814 |
| 534 | Ga0163163_10027595 | 3300014325 | Bacteria | 5441 |
| 535 | Ga0163163_10029203 | 3300014325 | Bacteria | 5303 |
| 536 | Ga0163163_10072427 | 3300014325 | Bacteria | 3435 |
| 537 | Ga0163163_10188652 | 3300014325 | Bacteria | 2110 |
| 538 | Ga0163163_10246532 | 3300014325 | Unclassified | 1836 |
| 539 | Ga0163163_10594073 | 3300014325 | Bacteria | 1170 |
| 540 | Ga0163163_10666976 | 3300014325 | Unclassified | 1103 |
| 541 | Ga0163163_10846928 | 3300014325 | Bacteria | 978 |
| 542 | Ga0163163_11525040 | 3300014325 | Bacteria | 730 |
| 543 | Ga0157380_10000188 | 3300014326 | Bacteria | 35876 |
| 544 | Ga0157380_10007110 | 3300014326 | Bacteria | 7929 |
| 545 | Ga0157380_10012447 | 3300014326 | Bacteria | 6172 |
| 546 | Ga0157380_10034924 | 3300014326 | Bacteria | 3880 |
| 547 | Ga0157380_10134421 | 3300014326 | Bacteria | 2115 |
| 548 | Ga0157380_10151479 | 3300014326 | Bacteria | 2005 |
| 549 | Ga0157380_10254915 | 3300014326 | Bacteria | 1590 |
| 550 | Ga0157380_10256447 | 3300014326 | Unclassified | 1586 |
| 551 | Ga0157377_10016406 | 3300014745 | Bacteria | 3810 |
| 552 | Ga0157377_10017921 | 3300014745 | Bacteria | 3673 |
| 553 | Ga0157377_10139754 | 3300014745 | Bacteria | 1487 |
| 554 | Ga0157377_10214093 | 3300014745 | Bacteria | 1230 |
| 555 | Ga0157379_10058845 | 3300014968 | Bacteria | 3436 |
| 556 | Ga0157379_10099538 | 3300014968 | Unclassified | 2610 |
| 557 | Ga0157379_10682695 | 3300014968 | Bacteria | 963 |
| 558 | Ga0157379_10822662 | 3300014968 | Unclassified | 878 |
| 559 | Ga0157376_10055570 | 3300014969 | Unclassified | 3304 |
| 560 | Ga0182007_10135814 | 3300015262 | Bacteria | 830 |
| 561 | Ga0163161_10006702 | 3300017792 | Bacteria | 7968 |
| 562 | Ga0163161_10149121 | 3300017792 | Unclassified | 1776 |
| 563 | Ga0163161_10609462 | 3300017792 | Bacteria | 901 |
| 564 | Ga0207697_10071051 | 3300025315 | Bacteria | 1458 |
| 565 | Ga0207656_10011668 | 3300025321 | Bacteria | 3324 |
| 566 | Ga0207653_10022098 | 3300025885 | Bacteria | 2020 |
| 567 | Ga0207642_10009682 | 3300025899 | Bacteria | 3362 |
| 568 | Ga0207642_10365506 | 3300025899 | Unclassified | 855 |
| 569 | Ga0207642_10956786 | 3300025899 | Unclassified | 550 |
| 570 | Ga0207710_10000389 | 3300025900 | Bacteria | 29876 |
| 571 | Ga0207710_10237708 | 3300025900 | Bacteria | 908 |
| 572 | Ga0207680_10029178 | 3300025903 | Bacteria | 3096 |
| 573 | Ga0207680_10660760 | 3300025903 | Unclassified | 748 |
| 574 | Ga0207680_10735240 | 3300025903 | Unclassified | 707 |
| 575 | Ga0207647_10003482 | 3300025904 | Bacteria | 11800 |
| 576 | Ga0207647_10232088 | 3300025904 | Bacteria | 1061 |
| 577 | Ga0207647_10340864 | 3300025904 | Unclassified | 849 |
| 578 | Ga0207645_10135104 | 3300025907 | Bacteria | 1606 |
| 579 | Ga0207643_10020307 | 3300025908 | Bacteria | 3645 |
| 580 | Ga0207643_10045238 | 3300025908 | Bacteria | 2486 |
| 581 | Ga0207643_10058845 | 3300025908 | Bacteria | 2191 |
| 582 | Ga0207643_10397431 | 3300025908 | Unclassified | 871 |
| 583 | Ga0207684_10000083 | 3300025910 | Bacteria | 176092 |
| 584 | Ga0207684_10082433 | 3300025910 | Archaea | 2739 |
| 585 | Ga0207684_10372382 | 3300025910 | Unclassified | 1229 |
| 586 | Ga0207684_10644840 | 3300025910 | Unclassified | 903 |
| 587 | Ga0207654_10062482 | 3300025911 | Bacteria | 2182 |
| 588 | Ga0207654_10071422 | 3300025911 | Bacteria | 2064 |
| 589 | Ga0207654_10105851 | 3300025911 | Bacteria | 1741 |
| 590 | Ga0207654_10144790 | 3300025911 | Unclassified | 1519 |
| 591 | Ga0207654_10313119 | 3300025911 | Unclassified | 1071 |
| 592 | Ga0207654_10553544 | 3300025911 | Unclassified | 817 |
| 593 | Ga0207654_10741262 | 3300025911 | Bacteria | 707 |
| 594 | Ga0207707_10015795 | 3300025912 | Bacteria | 6582 |
| 595 | Ga0207707_10068064 | 3300025912 | Bacteria | 3102 |
| 596 | Ga0207707_10140489 | 3300025912 | Bacteria | 2112 |
| 597 | Ga0207695_10071094 | 3300025913 | Bacteria | 3554 |
| 598 | Ga0207671_10015690 | 3300025914 | Bacteria | 5922 |
| 599 | Ga0207671_10039720 | 3300025914 | Bacteria | 3484 |
| 600 | Ga0207671_10418663 | 3300025914 | Bacteria | 1066 |
| 601 | Ga0207660_10011883 | 3300025917 | Bacteria | 5679 |
| 602 | Ga0207660_10069429 | 3300025917 | Unclassified | 2559 |
| 603 | Ga0207660_10638869 | 3300025917 | Unclassified | 867 |
| 604 | Ga0207660_10651062 | 3300025917 | Unclassified | 859 |
| 605 | Ga0207662_10031125 | 3300025918 | Bacteria | 3100 |
| 606 | Ga0207662_10063770 | 3300025918 | Unclassified | 2216 |
| 607 | Ga0207662_10149304 | 3300025918 | Bacteria | 1485 |
| 608 | Ga0207662_10152938 | 3300025918 | Unclassified | 1469 |
| 609 | Ga0207657_10021188 | 3300025919 | Bacteria | 6123 |
| 610 | Ga0207652_10052074 | 3300025921 | Bacteria | 3512 |
| 611 | Ga0207646_10023701 | 3300025922 | Bacteria | 5634 |
| 612 | Ga0207646_10534260 | 3300025922 | Bacteria | 1055 |
| 613 | Ga0207681_10014169 | 3300025923 | Unclassified | 4948 |
| 614 | Ga0207681_10031671 | 3300025923 | Bacteria | 3456 |
| 615 | Ga0207681_10186601 | 3300025923 | Unclassified | 1583 |
| 616 | Ga0207681_10957839 | 3300025923 | Unclassified | 717 |
| 617 | Ga0207694_10003054 | 3300025924 | Bacteria | 13422 |
| 618 | Ga0207694_10023376 | 3300025924 | Bacteria | 4691 |
| 619 | Ga0207650_10000006 | 3300025925 | Bacteria | 544730 |
| 620 | Ga0207650_10047907 | 3300025925 | Bacteria | 3151 |
| 621 | Ga0207650_10088478 | 3300025925 | Unclassified | 2362 |
| 622 | Ga0207650_10217418 | 3300025925 | Bacteria | 1537 |
| 623 | Ga0207650_10498990 | 3300025925 | Bacteria | 1017 |
| 624 | Ga0207659_10332538 | 3300025926 | Unclassified | 1256 |
| 625 | Ga0207659_10334316 | 3300025926 | Bacteria | 1253 |
| 626 | Ga0207687_10032505 | 3300025927 | Unclassified | 3534 |
| 627 | Ga0207687_10452239 | 3300025927 | Unclassified | 1065 |
| 628 | Ga0207644_10139909 | 3300025931 | Unclassified | 1863 |
| 629 | Ga0207644_10254492 | 3300025931 | Bacteria | 1402 |
| 630 | Ga0207644_10472962 | 3300025931 | Unclassified | 1031 |
| 631 | Ga0207690_10004343 | 3300025932 | Bacteria | 8374 |
| 632 | Ga0207690_10011300 | 3300025932 | Bacteria | 5335 |
| 633 | Ga0207690_11034294 | 3300025932 | Unclassified | 684 |
| 634 | Ga0207706_10039447 | 3300025933 | Bacteria | 4187 |
| 635 | Ga0207706_10178680 | 3300025933 | Bacteria | 1864 |
| 636 | Ga0207706_10565916 | 3300025933 | Bacteria | 978 |
| 637 | Ga0207686_10069102 | 3300025934 | Bacteria | 2265 |
| 638 | Ga0207686_10230588 | 3300025934 | Bacteria | 1342 |
| 639 | Ga0207686_10627922 | 3300025934 | Bacteria | 848 |
| 640 | Ga0207686_10866607 | 3300025934 | Unclassified | 727 |
| 641 | Ga0207709_10008229 | 3300025935 | Bacteria | 5777 |
| 642 | Ga0207709_10082783 | 3300025935 | Bacteria | 2073 |
| 643 | Ga0207709_10084431 | 3300025935 | Bacteria | 2056 |
| 644 | Ga0207709_10276703 | 3300025935 | Bacteria | 1238 |
| 645 | Ga0207709_10453616 | 3300025935 | Unclassified | 992 |
| 646 | Ga0207709_10976443 | 3300025935 | Unclassified | 691 |
| 647 | Ga0207670_10000236 | 3300025936 | Bacteria | 35069 |
| 648 | Ga0207670_10228939 | 3300025936 | Unclassified | 1426 |
| 649 | Ga0207670_10566286 | 3300025936 | Bacteria | 930 |
| 650 | Ga0207670_11233894 | 3300025936 | Unclassified | 633 |
| 651 | Ga0207704_10020308 | 3300025938 | Unclassified | 3511 |
| 652 | Ga0207704_10106621 | 3300025938 | Bacteria | 1883 |
| 653 | Ga0207704_11362981 | 3300025938 | Unclassified | 607 |
| 654 | Ga0207665_10409240 | 3300025939 | Unclassified | 1034 |
| 655 | Ga0207665_10470168 | 3300025939 | Unclassified | 967 |
| 656 | Ga0207691_10008611 | 3300025940 | Bacteria | 9789 |
| 657 | Ga0207691_10200594 | 3300025940 | Bacteria | 1736 |
| 658 | Ga0207691_10326090 | 3300025940 | Bacteria | 1316 |
| 659 | Ga0207691_10352049 | 3300025940 | Bacteria | 1260 |
| 660 | Ga0207711_10001380 | 3300025941 | Bacteria | 22853 |
| 661 | Ga0207711_10007092 | 3300025941 | Bacteria | 9387 |
| 662 | Ga0207711_10028460 | 3300025941 | Bacteria | 4702 |
| 663 | Ga0207711_10126284 | 3300025941 | Bacteria | 2288 |
| 664 | Ga0207711_10348650 | 3300025941 | Unclassified | 1371 |
| 665 | Ga0207711_11534406 | 3300025941 | Unclassified | 609 |
| 666 | Ga0207689_10002536 | 3300025942 | Bacteria | 16961 |
| 667 | Ga0207689_10054287 | 3300025942 | Bacteria | 3300 |
| 668 | Ga0207689_10091962 | 3300025942 | Bacteria | 2492 |
| 669 | Ga0207689_10110088 | 3300025942 | Bacteria | 2263 |
| 670 | Ga0207689_10263012 | 3300025942 | Bacteria | 1427 |
| 671 | Ga0207689_10291320 | 3300025942 | Unclassified | 1352 |
| 672 | Ga0207689_10478842 | 3300025942 | Bacteria | 1042 |
| 673 | Ga0207679_10005396 | 3300025945 | Bacteria | 8007 |
| 674 | Ga0207667_10664522 | 3300025949 | Bacteria | 1047 |
| 675 | Ga0207667_10706308 | 3300025949 | Bacteria | 1010 |
| 676 | Ga0207651_10027295 | 3300025960 | Unclassified | 3584 |
| 677 | Ga0207651_10121347 | 3300025960 | Unclassified | 1983 |
| 678 | Ga0207651_10422784 | 3300025960 | Bacteria | 1138 |
| 679 | Ga0207651_10553878 | 3300025960 | Bacteria | 1000 |
| 680 | Ga0207651_10606725 | 3300025960 | Unclassified | 957 |
| 681 | Ga0207651_11048986 | 3300025960 | Unclassified | 730 |
| 682 | Ga0207651_11075327 | 3300025960 | Unclassified | 720 |
| 683 | Ga0207712_10000366 | 3300025961 | Bacteria | 40009 |
| 684 | Ga0207712_10017290 | 3300025961 | Bacteria | 4682 |
| 685 | Ga0207712_10085159 | 3300025961 | Unclassified | 2312 |
| 686 | Ga0207712_10726315 | 3300025961 | Unclassified | 868 |
| 687 | Ga0207712_11061774 | 3300025961 | Unclassified | 720 |
| 688 | Ga0207712_11365686 | 3300025961 | Unclassified | 634 |
| 689 | Ga0207668_10022918 | 3300025972 | Unclassified | 4004 |
| 690 | Ga0207640_10116792 | 3300025981 | Bacteria | 1903 |
| 691 | Ga0207640_10374069 | 3300025981 | Bacteria | 1152 |
| 692 | Ga0207640_10400251 | 3300025981 | Bacteria | 1118 |
| 693 | Ga0207640_10475619 | 3300025981 | Unclassified | 1035 |
| 694 | Ga0207640_10527606 | 3300025981 | Unclassified | 988 |
| 695 | Ga0207658_10034157 | 3300025986 | Bacteria | 3633 |
| 696 | Ga0207703_10109086 | 3300026035 | Bacteria | 2358 |
| 697 | Ga0207703_10117939 | 3300026035 | Bacteria | 2275 |
| 698 | Ga0207703_10260901 | 3300026035 | Bacteria | 1566 |
| 699 | Ga0207703_10415234 | 3300026035 | Bacteria | 1251 |
| 700 | Ga0207703_10420524 | 3300026035 | Bacteria | 1243 |
| 701 | Ga0207703_10602196 | 3300026035 | Bacteria | 1039 |
| 702 | Ga0207703_11035470 | 3300026035 | Bacteria | 788 |
| 703 | Ga0207703_11393924 | 3300026035 | Unclassified | 674 |
| 704 | Ga0207639_10015732 | 3300026041 | Bacteria | 5338 |
| 705 | Ga0207639_10215500 | 3300026041 | Bacteria | 1655 |
| 706 | Ga0207639_10344909 | 3300026041 | Bacteria | 1328 |
| 707 | Ga0207708_10000016 | 3300026075 | Bacteria | 193989 |
| 708 | Ga0207708_10005449 | 3300026075 | Bacteria | 9387 |
| 709 | Ga0207708_10012864 | 3300026075 | Bacteria | 6243 |
| 710 | Ga0207708_10038646 | 3300026075 | Bacteria | 3635 |
| 711 | Ga0207708_10041802 | 3300026075 | Bacteria | 3495 |
| 712 | Ga0207708_10098792 | 3300026075 | Bacteria | 2257 |
| 713 | Ga0207708_10111097 | 3300026075 | Bacteria | 2128 |
| 714 | Ga0207708_10157002 | 3300026075 | Unclassified | 1794 |
| 715 | Ga0207708_10157968 | 3300026075 | Bacteria | 1789 |
| 716 | Ga0207708_10177232 | 3300026075 | Bacteria | 1691 |
| 717 | Ga0207702_10025855 | 3300026078 | Unclassified | 4873 |
| 718 | Ga0207641_10019825 | 3300026088 | Bacteria | 5520 |
| 719 | Ga0207641_10066218 | 3300026088 | Bacteria | 3092 |
| 720 | Ga0207641_10331451 | 3300026088 | Bacteria | 1446 |
| 721 | Ga0207641_11955997 | 3300026088 | Unclassified | 588 |
| 722 | Ga0207648_10027694 | 3300026089 | Bacteria | 5029 |
| 723 | Ga0207648_10091227 | 3300026089 | Bacteria | 2664 |
| 724 | Ga0207648_10167620 | 3300026089 | Unclassified | 1941 |
| 725 | Ga0207648_10305198 | 3300026089 | Bacteria | 1428 |
| 726 | Ga0207648_10328246 | 3300026089 | Unclassified | 1376 |
| 727 | Ga0207648_10859179 | 3300026089 | Bacteria | 846 |
| 728 | Ga0207648_10864210 | 3300026089 | Bacteria | 844 |
| 729 | Ga0207648_11306774 | 3300026089 | Unclassified | 681 |
| 730 | Ga0207676_10006815 | 3300026095 | Bacteria | 8090 |
| 731 | Ga0207676_10011201 | 3300026095 | Bacteria | 6404 |
| 732 | Ga0207676_10176041 | 3300026095 | Bacteria | 1869 |
| 733 | Ga0207676_10190228 | 3300026095 | Bacteria | 1805 |
| 734 | Ga0207676_10217862 | 3300026095 | Bacteria | 1698 |
| 735 | Ga0207676_10344813 | 3300026095 | Bacteria | 1376 |
| 736 | Ga0207676_10413572 | 3300026095 | Unclassified | 1263 |
| 737 | Ga0207676_10420825 | 3300026095 | Unclassified | 1253 |
| 738 | Ga0207674_10000834 | 3300026116 | Bacteria | 40210 |
| 739 | Ga0207674_10094378 | 3300026116 | Bacteria | 2978 |
| 740 | Ga0207674_10146258 | 3300026116 | Bacteria | 2322 |
| 741 | Ga0207674_10366955 | 3300026116 | Bacteria | 1392 |
| 742 | Ga0207674_10373283 | 3300026116 | Unclassified | 1379 |
| 743 | Ga0207674_10382951 | 3300026116 | Unclassified | 1360 |
| 744 | Ga0207674_10388551 | 3300026116 | Unclassified | 1349 |
| 745 | Ga0207674_10530946 | 3300026116 | Unclassified | 1137 |
| 746 | Ga0207674_10920194 | 3300026116 | Unclassified | 843 |
| 747 | Ga0207674_11364048 | 3300026116 | Bacteria | 678 |
| 748 | Ga0207675_100003117 | 3300026118 | Bacteria | 16262 |
| 749 | Ga0207675_100012658 | 3300026118 | Bacteria | 7882 |
| 750 | Ga0207675_100046683 | 3300026118 | Unclassified | 4047 |
| 751 | Ga0207675_100056048 | 3300026118 | Bacteria | 3677 |
| 752 | Ga0207675_100159458 | 3300026118 | Unclassified | 2151 |
| 753 | Ga0207675_100419899 | 3300026118 | Unclassified | 1321 |
| 754 | Ga0207675_100672714 | 3300026118 | Bacteria | 1042 |
| 755 | Ga0207675_101361439 | 3300026118 | Unclassified | 730 |
| 756 | Ga0207683_10127280 | 3300026121 | Unclassified | 2290 |
| 757 | Ga0207698_10233540 | 3300026142 | Bacteria | 1671 |
| 758 | Ga0207698_10335443 | 3300026142 | Bacteria | 1422 |
| 759 | Ga0207698_11049058 | 3300026142 | Bacteria | 827 |
| 760 | Ga0209967_1033995 | 3300027364 | Bacteria | 767 |
| 761 | Ga0207428_10054685 | 3300027907 | Bacteria | 3178 |
| 762 | Ga0268266_10141588 | 3300028379 | Bacteria | 2159 |
| 763 | Ga0268265_10033069 | 3300028380 | Bacteria | 3756 |
| 764 | Ga0268265_10087594 | 3300028380 | Bacteria | 2478 |
| 765 | Ga0268265_10208743 | 3300028380 | Bacteria | 1700 |
| 766 | Ga0268265_10591524 | 3300028380 | Bacteria | 1059 |
| 767 | Ga0268265_11066591 | 3300028380 | Unclassified | 801 |
| 768 | Ga0268265_11223928 | 3300028380 | Unclassified | 749 |
| 769 | Ga0268264_10024961 | 3300028381 | Bacteria | 4885 |
| 770 | Ga0268264_10095839 | 3300028381 | Bacteria | 2568 |
| 771 | Ga0268264_10134680 | 3300028381 | Bacteria | 2195 |
| 772 | Ga0268264_10276873 | 3300028381 | Bacteria | 1570 |
| 773 | Ga0268264_10370593 | 3300028381 | Unclassified | 1369 |
| 774 | Ga0268264_10378851 | 3300028381 | Bacteria | 1354 |
| 775 | Ga0268264_10581037 | 3300028381 | Bacteria | 1102 |
| 776 | Ga0268264_11337811 | 3300028381 | Unclassified | 727 |
| 777 | Ga0268264_12089120 | 3300028381 | Unclassified | 575 |
| 778 | Ga0307408_100058290 | 3300031548 | Bacteria | 2807 |
| 779 | Ga0307408_100058786 | 3300031548 | Bacteria | 2796 |
| 780 | Ga0307408_100083651 | 3300031548 | Bacteria | 2392 |
| 781 | Ga0307408_100355205 | 3300031548 | Unclassified | 1245 |
| 782 | Ga0307408_100732165 | 3300031548 | Bacteria | 892 |
| 783 | Ga0307405_10007336 | 3300031731 | Bacteria | 5503 |
| 784 | Ga0307405_10281083 | 3300031731 | Bacteria | 1253 |
| 785 | Ga0307413_10079091 | 3300031824 | Bacteria | 2101 |
| 786 | Ga0307410_10044268 | 3300031852 | Bacteria | 2956 |
| 787 | Ga0307410_10062511 | 3300031852 | Unclassified | 2552 |
| 788 | Ga0307410_10371671 | 3300031852 | Bacteria | 1148 |
| 789 | Ga0307406_10012436 | 3300031901 | Bacteria | 4855 |
| 790 | Ga0307406_10173237 | 3300031901 | Bacteria | 1564 |
| 791 | Ga0307406_10207909 | 3300031901 | Bacteria | 1446 |
| 792 | Ga0307412_10082499 | 3300031911 | Bacteria | 2226 |
| 793 | Ga0307412_10087461 | 3300031911 | Bacteria | 2171 |
| 794 | Ga0307409_100358691 | 3300031995 | Bacteria | 1378 |
| 795 | Ga0307409_100786661 | 3300031995 | Bacteria | 958 |
| 796 | Ga0307416_100083558 | 3300032002 | Bacteria | 2710 |
| 797 | Ga0307416_100103916 | 3300032002 | Unclassified | 2482 |
| 798 | Ga0307414_10021049 | 3300032004 | Unclassified | 4081 |
| 799 | Ga0307414_10224313 | 3300032004 | Bacteria | 1545 |
| 800 | Ga0307414_11548063 | 3300032004 | Unclassified | 617 |
| 801 | Ga0307411_10234703 | 3300032005 | Bacteria | 1432 |
| 802 | Ga0307411_10740545 | 3300032005 | Unclassified | 860 |
| 803 | Ga0307415_100028009 | 3300032126 | Bacteria | 3578 |
| 804 | Ga0307415_100384331 | 3300032126 | Bacteria | 1193 |
| 805 | Ga0307415_100482794 | 3300032126 | Bacteria | 1079 |
| 806 | Ga0307415_101042791 | 3300032126 | Bacteria | 762 |
| 807 | Ga0373940_0043646 | 3300035088 | Unclassified | 1240 |
| 808 | Ga0373949_0058196 | 3300035090 | Bacteria | 989 |
| 809 | Ga0373951_0003140 | 3300035091 | Bacteria | 4071 |
| 810 | Ga0373952_0251776 | 3300035092 | Unclassified | 535 |
| 811 | Ga0373941_0019453 | 3300035115 | Unclassified | 1891 |
| 812 | Ga0373942_0005511 | 3300035207 | Unclassified | 2934 |
| 813 | Ga0373962_0025963 | 3300035242 | Unclassified | 1576 |
| 814 | Ga0373931_0086906 | 3300035691 | Unclassified | 1736 |
| 815 | Ga0373937_0346035 | 3300036401 | Unclassified | 1408 |
| 816 | Ga0395899_0330619 | 3300037312 | Bacteria | 1024 |
| 817 | Ga0395899_0387042 | 3300037312 | Unclassified | 928 |
| 818 | Ga0395900_0244909 | 3300037418 | Unclassified | 1797 |
| 819 | Ga0395900_0726539 | 3300037418 | Unclassified | 925 |
| 820 | Ga0395898_0637714 | 3300037466 | Unclassified | 1008 |
| 821 | Ga0395905_1290733 | 3300037471 | Unclassified | 634 |
| 822 | Ga0395901_0471172 | 3300038443 | Bacteria | 1282 |
| 823 | Ga0395901_0738960 | 3300038443 | Bacteria | 978 |
| 824 | Ga0395901_0814393 | 3300038443 | Unclassified | 922 |
| 825 | Ga0395901_1036785 | 3300038443 | Unclassified | 794 |
| 826 | Ga0242422_04767 | 3300038699 | Bacteria | 840 |
| 827 | Ga0242420_009839 | 3300038996 | Bacteria | 1578 |
| 828 | Ga0439458_0004103 | 3300042157 | Bacteria | 3362 |
| 829 | Ga0453683_0393403 | 3300044673 | Unclassified | 893 |
| 830 | Ga0451576_0325816 | 3300045051 | Bacteria | 1608 |
| 831 | Ga0451576_0350324 | 3300045051 | Bacteria | 1546 |
| 832 | Ga0495582_0231348 | 3300046473 | Unclassified | 1058 |
| 833 | Ga0495658_0081528 | 3300046683 | Bacteria | 1900 |
| 834 | Ga0495669_0659587 | 3300046684 | Unclassified | 509 |
| 835 | Ga0496102_0010938 | 3300048905 | Bacteria | 7815 |
| 836 | Ga0496102_0443468 | 3300048905 | Unclassified | 1218 |
| 837 | Ga0496103_0215791 | 3300048906 | Bacteria | 1234 |
| 838 | Ga0496104_0276520 | 3300048907 | Unclassified | 1592 |
| 839 | Ga0496104_1146128 | 3300048907 | Bacteria | 681 |
| 840 | Ga0496105_0223379 | 3300048908 | Bacteria | 1533 |
| 841 | Ga0496106_0260649 | 3300048909 | Bacteria | 1387 |
| 842 | Ga0496106_0951200 | 3300048909 | Unclassified | 677 |
| 843 | Ga0496107_0449432 | 3300048910 | Bacteria | 957 |
| 844 | Ga0496108_0118307 | 3300048911 | Bacteria | 2271 |
| 845 | Ga0496109_1659987 | 3300048912 | Unclassified | 573 |
| 846 | Ga0496110_0154049 | 3300048913 | Unclassified | 2082 |
| 847 | Ga0496112_0083049 | 3300048915 | Bacteria | 3168 |
| 848 | Ga0496112_0184022 | 3300048915 | Bacteria | 2053 |
| 849 | Ga0496112_0374146 | 3300048915 | Bacteria | 1366 |
| 850 | Ga0496112_0582876 | 3300048915 | Bacteria | 1051 |
| 851 | Ga0496112_1389171 | 3300048915 | Bacteria | 617 |
| 852 | Ga0496113_0137148 | 3300048916 | Bacteria | 1923 |
| 853 | Ga0496113_0622670 | 3300048916 | Unclassified | 864 |
| 854 | Ga0496113_0907532 | 3300048916 | Unclassified | 697 |
| 855 | Ga0501291_021860 | 3300049514 | Viruses | 1023 |
| 856 | Ga0501292_002722 | 3300049515 | Bacteria | 2303 |
| 857 | Ga0501292_007066 | 3300049515 | Bacteria | 1615 |
| 858 | Ga0501292_075040 | 3300049515 | Bacteria | 635 |
| 859 | Ga0501293_007382 | 3300049516 | Unclassified | 910 |
| 860 | Ga0501295_045974 | 3300049518 | Unclassified | 921 |
| 861 | Ga0501297_071120 | 3300049520 | Unclassified | 549 |
| 862 | Ga0501298_001979 | 3300049521 | Bacteria | 3064 |
| 863 | Ga0501298_029368 | 3300049521 | Bacteria | 1072 |
| 864 | Ga0501299_016697 | 3300049522 | Unclassified | 1302 |
| 865 | Ga0501299_021657 | 3300049522 | Bacteria | 1180 |
| 866 | Ga0501300_012114 | 3300049523 | Unclassified | 1257 |
| 867 | Ga0501300_019024 | 3300049523 | Unclassified | 1003 |
| 868 | Ga0501038_0001488 | 3300049574 | Bacteria | 21593 |
| 869 | Ga0501048_0463202 | 3300049582 | Bacteria | 908 |
| 870 | Ga0501076_0953295 | 3300049592 | Unclassified | 707 |
| 871 | Ga0501077_0235325 | 3300049593 | Bacteria | 1164 |
| 872 | Ga0501198_001801 | 3300049649 | Bacteria | 2829 |
| 873 | Ga0501198_049046 | 3300049649 | Unclassified | 749 |
| 874 | Ga0501202_002390 | 3300049652 | Unclassified | 3148 |
| 875 | Ga0501202_010365 | 3300049652 | Bacteria | 1728 |
| 876 | Ga0501207_011242 | 3300049654 | Bacteria | 1330 |
| 877 | Ga0501207_021814 | 3300049654 | Unclassified | 1030 |
| 878 | Ga0501207_059252 | 3300049654 | Unclassified | 698 |
| 879 | Ga0501208_105982 | 3300049655 | Bacteria | 607 |
| 880 | Ga0501209_294549 | 3300049656 | Unclassified | 510 |
| 881 | Ga0501217_006848 | 3300049661 | Bacteria | 2432 |
| 882 | Ga0501217_033331 | 3300049661 | Unclassified | 1279 |
| 883 | Ga0501223_005881 | 3300049663 | Bacteria | 2561 |
| 884 | Ga0501223_008448 | 3300049663 | Bacteria | 2099 |
| 885 | Ga0501227_002240 | 3300049665 | Unclassified | 4280 |
| 886 | Ga0501227_034743 | 3300049665 | Unclassified | 1224 |
| 887 | Ga0501230_053957 | 3300049667 | Unclassified | 803 |
| 888 | Ga0501230_066551 | 3300049667 | Unclassified | 736 |
| 889 | Ga0501233_001572 | 3300049668 | Bacteria | 3921 |
| 890 | Ga0501233_024411 | 3300049668 | Unclassified | 1322 |
| 891 | Ga0501233_030248 | 3300049668 | Bacteria | 1219 |
| 892 | Ga0501233_044325 | 3300049668 | Bacteria | 1057 |
| 893 | Ga0501235_002210 | 3300049669 | Bacteria | 4186 |
| 894 | Ga0501235_007087 | 3300049669 | Unclassified | 2442 |
| 895 | Ga0501235_129563 | 3300049669 | Unclassified | 638 |
| 896 | Ga0501243_007902 | 3300049675 | Bacteria | 1633 |
| 897 | Ga0501243_008184 | 3300049675 | Unclassified | 1609 |
| 898 | Ga0501243_020491 | 3300049675 | Unclassified | 1087 |
| 899 | Ga0501249_099794 | 3300049679 | Unclassified | 694 |
| 900 | Ga0501250_034939 | 3300049680 | Bacteria | 714 |
| 901 | Ga0501253_015593 | 3300049683 | Bacteria | 1251 |
| 902 | Ga0501257_008644 | 3300049686 | Bacteria | 2292 |
| 903 | Ga0501257_024783 | 3300049686 | Unclassified | 1425 |
| 904 | Ga0501257_041005 | 3300049686 | Bacteria | 1137 |
| 905 | Ga0501259_062183 | 3300049688 | Unclassified | 782 |
| 906 | Ga0501260_016444 | 3300049689 | Unclassified | 779 |
| 907 | Ga0501261_018026 | 3300049690 | Unclassified | 993 |
| 908 | Ga0501221_210874 | 3300049704 | Unclassified | 544 |
| 909 | Ga0501225_0003567 | 3300049705 | Bacteria | 4695 |
| 910 | Ga0501225_0007426 | 3300049705 | Bacteria | 3174 |
| 911 | Ga0501225_0008102 | 3300049705 | Bacteria | 3023 |
| 912 | Ga0501234_008102 | 3300049707 | Bacteria | 1642 |
| 913 | Ga0501245_007052 | 3300049708 | Unclassified | 1583 |
| 914 | Ga0501245_010601 | 3300049708 | Bacteria | 1333 |
| 915 | Ga0501079_1322561 | 3300049741 | Unclassified | 567 |
| 916 | Ga0501263_031899 | 3300049760 | Unclassified | 747 |
| 917 | Ga0501270_014283 | 3300049767 | Bacteria | 1115 |
| 918 | Ga0501272_015562 | 3300049769 | Unclassified | 886 |
| 919 | Ga0501273_008681 | 3300049770 | Unclassified | 1219 |
| 920 | Ga0501276_014137 | 3300049773 | Unclassified | 706 |
| 921 | Ga0501283_001695 | 3300049779 | Bacteria | 2866 |
| 922 | Ga0501200_08989 | 3300049849 | Unclassified | 527 |
| 923 | Ga0501212_008410 | 3300049851 | Bacteria | 1434 |
| 924 | Ga0501212_025784 | 3300049851 | Unclassified | 929 |
| 925 | Ga0501220_03647 | 3300049852 | Bacteria | 684 |
| 926 | Ga0501226_002383 | 3300049853 | Bacteria | 2304 |
| 927 | nmdc:mga05p37_102248_c1 | 3300050507 | Bacteria | 3529 |
| 928 | nmdc:mga05p37_103422_c1 | 3300050507 | Bacteria | 3506 |
| 929 | nmdc:mga05p37_106263_c1 | 3300050507 | Bacteria | 3453 |
| 930 | nmdc:mga05p37_1077839_c1 | 3300050507 | Bacteria | 844 |
| 931 | nmdc:mga05p37_1157893_c1 | 3300050507 | Unclassified | 804 |
| 932 | nmdc:mga05p37_238860_c1 | 3300050507 | Unclassified | 2186 |
| 933 | nmdc:mga05p37_388298_c1 | 3300050507 | Unclassified | 1633 |
| 934 | nmdc:mga05p37_439359_c1 | 3300050507 | Bacteria | 1513 |
| 935 | nmdc:mga05p37_509967_c1 | 3300050507 | Bacteria | 1378 |
| 936 | nmdc:mga05p37_842050_c1 | 3300050507 | Bacteria | 997 |
| 937 | nmdc:mga05p37_919854_c1 | 3300050507 | Bacteria | 940 |
| 938 | nmdc:mga09592_116305_c1 | 3300050508 | Bacteria | 2295 |
| 939 | nmdc:mga09592_133127_c1 | 3300050508 | Bacteria | 2140 |
| 940 | nmdc:mga09592_315488_c1 | 3300050508 | Bacteria | 1354 |
| 941 | nmdc:mga09592_403994_c1 | 3300050508 | Unclassified | 1181 |
| 942 | nmdc:mga09592_684220_c1 | 3300050508 | Unclassified | 874 |
| 943 | nmdc:mga0qj67_136954_c1 | 3300050509 | Unclassified | 1984 |
| 944 | nmdc:mga0qj67_315936_c1 | 3300050509 | Unclassified | 1265 |
| 945 | nmdc:mga0qj67_720052_c1 | 3300050509 | Bacteria | 793 |
| 946 | nmdc:mga06r32_308453_c1 | 3300050510 | Bacteria | 1568 |
| 947 | nmdc:mga06r32_420403_c1 | 3300050510 | Bacteria | 1318 |
| 948 | nmdc:mga08y16_23581_c1 | 3300050511 | Bacteria | 6500 |
| 949 | nmdc:mga08y16_691343_c1 | 3300050511 | Unclassified | 1021 |
| 950 | nmdc:mga08y16_86430_c1 | 3300050511 | Unclassified | 3268 |
| 951 | nmdc:mga0n895_262588_c1 | 3300050512 | Bacteria | 1752 |
| 952 | nmdc:mga0n895_281620_c1 | 3300050512 | Bacteria | 1686 |
| 953 | nmdc:mga0n895_333904_c1 | 3300050512 | Unclassified | 1536 |
| 954 | nmdc:mga0n895_536797_c1 | 3300050512 | Bacteria | 1176 |
| 955 | nmdc:mga0n895_53683_c1 | 3300050512 | Bacteria | 3961 |
| 956 | nmdc:mga0n895_763564_c1 | 3300050512 | Unclassified | 959 |
| 957 | nmdc:mga0n895_767241_c1 | 3300050512 | Unclassified | 956 |
| 958 | nmdc:mga0rr50_166505_c1 | 3300050513 | Unclassified | 1792 |
| 959 | nmdc:mga0rr50_19621_c1 | 3300050513 | Bacteria | 4569 |
| 960 | nmdc:mga0rr50_301315_c1 | 3300050513 | Bacteria | 1341 |
| 961 | nmdc:mga08x19_7479_c1 | 3300050514 | Bacteria | 6488 |
| 962 | nmdc:mga0a205_101889_c1 | 3300050515 | Unclassified | 2770 |
| 963 | nmdc:mga0a205_134664_c1 | 3300050515 | Bacteria | 2371 |
| 964 | nmdc:mga0a205_167735_c1 | 3300050515 | Bacteria | 2091 |
| 965 | nmdc:mga0a205_207241_c1 | 3300050515 | Bacteria | 1850 |
| 966 | nmdc:mga0a205_21072_c1 | 3300050515 | Bacteria | 6163 |
| 967 | nmdc:mga0a205_337620_c1 | 3300050515 | Bacteria | 1376 |
| 968 | nmdc:mga0a205_392130_c1 | 3300050515 | Bacteria | 1253 |
| 969 | nmdc:mga0a205_59234_c1 | 3300050515 | Bacteria | 3699 |
| 970 | nmdc:mga0a205_717968_c1 | 3300050515 | Bacteria | 849 |
| 971 | Ga0501084_0230351 | 3300054114 | Unclassified | 1564 |
| 972 | Ga0501084_0626117 | 3300054114 | Unclassified | 909 |
| 973 | Ga0587091_157000 | 3300059511 | Bacteria | 582 |
| 974 | Ga0501082_0589232 | 3300060353 | Unclassified | 973 |
| 975 | Ga0530510_0583283 | 3300061734 | Unclassified | 850 |
| 976 | Ga0065715_10395210 | |||
| 977 | SwRhRL2b_contig_19469 | |||
| 978 | SwRhRL2b_contig_940246 | |||
| 979 | MBSR1b_contig_11702357 | |||
| 980 | MBSR1b_contig_357108 | |||
| 981 | MBSR1b_contig_931085 | |||
| 982 | CNAas_1000523 | |||
| 983 | JGI24751J29686_10000038 | |||
| 984 | JGI25406J46586_10010758 | |||
| 985 | rootL2_10087314 | |||
| 986 | Ga0065714_10064462 | |||
| 987 | Ga0065714_10176383 | |||
| 988 | Ga0065714_10385164 | |||
| 989 | Ga0065704_10001276 | |||
| 990 | Ga0065704_10093146 | |||
| 991 | Ga0065712_10000135 | |||
| 992 | Ga0065712_10004694 | |||
| 993 | Ga0065712_10115832 | |||
| 994 | Ga0065712_10198370 | |||
| 995 | Ga0065712_10202013 | |||
| 996 | Ga0065715_10000518 | |||
| 997 | Ga0065715_10018641 | |||
| 998 | Ga0065715_10095497 | |||
| 999 | Ga0065715_10224383 | |||
| 1000 | Ga0065715_10226068 | |||
| 1001 | Ga0065715_10301402 | |||
| 1002 | Ga0065715_10768521 | |||
| 1003 | Ga0065707_10004228 | |||
| 1004 | Ga0065707_10109526 | |||
| 1005 | Ga0065707_10145753 | |||
| 1006 | Ga0065707_10186190 | |||
| 1007 | Ga0065707_10216166 | |||
| 1008 | Ga0065707_10253401 | |||
| 1009 | Ga0070683_101486319 | |||
| 1010 | Ga0070690_100086887 | |||
| 1011 | Ga0070690_100162010 | |||
| 1012 | Ga0070690_100190557 | |||
| 1013 | Ga0070670_100000073 | |||
| 1014 | Ga0070670_100023928 | |||
| 1015 | Ga0070670_100071727 | |||
| 1016 | Ga0070670_100090104 | |||
| 1017 | Ga0070670_100139848 | |||
| 1018 | Ga0070670_100140563 | |||
| 1019 | Ga0070670_100629051 | |||
| 1020 | Ga0070670_100691233 | |||
| 1021 | Ga0068869_100575570 | |||
| 1022 | Ga0068869_100637198 | |||
| 1023 | Ga0068869_101643464 | |||
| 1024 | Ga0070666_10076489 | |||
| 1025 | Ga0070666_10908078 | |||
| 1026 | Ga0070680_100010009 | |||
| 1027 | Ga0070680_100323922 | |||
| 1028 | Ga0070680_100544429 | |||
| 1029 | Ga0070680_100560753 | |||
| 1030 | Ga0070682_100020890 | |||
| 1031 | Ga0070682_100090743 | |||
| 1032 | Ga0070682_100578339 | |||
| 1033 | Ga0068868_100003205 | |||
| 1034 | Ga0068868_100073287 | |||
| 1035 | Ga0068868_101041328 | |||
| 1036 | Ga0068868_101180516 | |||
| 1037 | Ga0068868_101320787 | |||
| 1038 | Ga0070660_100009748 | |||
| 1039 | Ga0070689_100002495 | |||
| 1040 | Ga0070689_100389217 | |||
| 1041 | Ga0070689_100539628 | |||
| 1042 | Ga0070689_101661283 | |||
| 1043 | Ga0070687_100005568 | |||
| 1044 | Ga0070687_100109669 | |||
| 1045 | Ga0070687_100129962 | |||
| 1046 | Ga0070687_101133694 | |||
| 1047 | Ga0070661_100007782 | |||
| 1048 | Ga0070661_100414086 | |||
| 1049 | Ga0070692_10010809 | |||
| 1050 | Ga0070692_10047386 | |||
| 1051 | Ga0070692_10889857 | |||
| 1052 | Ga0070668_100033595 | |||
| 1053 | Ga0070668_100191704 | |||
| 1054 | Ga0070669_100051938 | |||
| 1055 | Ga0070669_100060441 | |||
| 1056 | Ga0070669_100110428 | |||
| 1057 | Ga0070675_100005020 | |||
| 1058 | Ga0070675_100160397 | |||
| 1059 | Ga0070675_100296737 | |||
| 1060 | Ga0070671_100016102 | |||
| 1061 | Ga0070671_100193278 | |||
| 1062 | Ga0070671_100754616 | |||
| 1063 | Ga0070674_100392644 | |||
| 1064 | Ga0070674_100486285 | |||
| 1065 | Ga0070673_100011196 | |||
| 1066 | Ga0070673_100082774 | |||
| 1067 | Ga0070673_100151043 | |||
| 1068 | Ga0070673_100278136 | |||
| 1069 | Ga0070673_100521158 | |||
| 1070 | Ga0070673_100717608 | |||
| 1071 | Ga0070688_100095477 | |||
| 1072 | Ga0070688_100481383 | |||
| 1073 | Ga0070688_100619932 | |||
| 1074 | Ga0070659_100006362 | |||
| 1075 | Ga0070659_100028181 | |||
| 1076 | Ga0070659_100999367 | |||
| 1077 | Ga0070667_100040149 | |||
| 1078 | Ga0070667_100144424 | |||
| 1079 | Ga0070703_10003811 | |||
| 1080 | Ga0070701_10021145 | |||
| 1081 | Ga0070701_10135429 | |||
| 1082 | Ga0070701_10874208 | |||
| 1083 | Ga0070705_100027760 | |||
| 1084 | Ga0070705_100029045 | |||
| 1085 | Ga0070705_100033473 | |||
| 1086 | Ga0070705_100183086 | |||
| 1087 | Ga0070705_100383366 | |||
| 1088 | Ga0070705_101260757 | |||
| 1089 | Ga0070700_100000036 | |||
| 1090 | Ga0070700_100022252 | |||
| 1091 | Ga0070700_100024136 | |||
| 1092 | Ga0070700_100090395 | |||
| 1093 | Ga0070700_100165686 | |||
| 1094 | Ga0070700_100169080 | |||
| 1095 | Ga0070700_100169455 | |||
| 1096 | Ga0070700_100764474 | |||
| 1097 | Ga0070694_100012909 | |||
| 1098 | Ga0070694_100020194 | |||
| 1099 | Ga0070694_100021886 | |||
| 1100 | Ga0070694_100037254 | |||
| 1101 | Ga0070694_100056887 | |||
| 1102 | Ga0070694_100058711 | |||
| 1103 | Ga0070694_100061940 | |||
| 1104 | Ga0070694_100102226 | |||
| 1105 | Ga0070694_100122869 | |||
| 1106 | Ga0070694_100147135 | |||
| 1107 | Ga0070694_100198773 | |||
| 1108 | Ga0070694_100852355 | |||
| 1109 | Ga0070694_100856652 | |||
| 1110 | Ga0070708_100000754 | |||
| 1111 | Ga0070708_100568345 | |||
| 1112 | Ga0070678_100529771 | |||
| 1113 | Ga0070662_100055184 | |||
| 1114 | Ga0070662_100073820 | |||
| 1115 | Ga0070662_100295688 | |||
| 1116 | Ga0070681_10004646 | |||
| 1117 | Ga0070681_10023868 | |||
| 1118 | Ga0070681_10045973 | |||
| 1119 | Ga0068867_100112707 | |||
| 1120 | Ga0068867_100257141 | |||
| 1121 | Ga0068867_100264883 | |||
| 1122 | Ga0068867_100425844 | |||
| 1123 | Ga0068867_100653003 | |||
| 1124 | Ga0068867_100931404 | |||
| 1125 | Ga0070685_10098747 | |||
| 1126 | Ga0070685_10130436 | |||
| 1127 | Ga0070706_100000015 | |||
| 1128 | Ga0070706_100028134 | |||
| 1129 | Ga0070706_100332487 | |||
| 1130 | Ga0070706_100515067 | |||
| 1131 | Ga0070707_100255809 | |||
| 1132 | Ga0070707_100257648 | |||
| 1133 | Ga0070707_100724730 | |||
| 1134 | Ga0070698_100007009 | |||
| 1135 | Ga0070698_100008421 | |||
| 1136 | Ga0070698_100028005 | |||
| 1137 | Ga0070698_100181594 | |||
| 1138 | Ga0070699_100006181 | |||
| 1139 | Ga0070699_100031705 | |||
| 1140 | Ga0070699_100239523 | |||
| 1141 | Ga0070699_100257822 | |||
| 1142 | Ga0070699_100484971 | |||
| 1143 | Ga0070699_100711902 | |||
| 1144 | Ga0070699_100741382 | |||
| 1145 | Ga0070679_100036868 | |||
| 1146 | Ga0070679_100110587 | |||
| 1147 | Ga0070697_100007769 | |||
| 1148 | Ga0070697_100057188 | |||
| 1149 | Ga0070697_100148942 | |||
| 1150 | Ga0070697_100269151 | |||
| 1151 | Ga0070697_100836497 | |||
| 1152 | Ga0068853_100004345 | |||
| 1153 | Ga0068853_100015636 | |||
| 1154 | Ga0068853_100607973 | |||
| 1155 | Ga0070672_100010581 | |||
| 1156 | Ga0070672_100193118 | |||
| 1157 | Ga0070686_100038592 | |||
| 1158 | Ga0070695_100020513 | |||
| 1159 | Ga0070695_100024122 | |||
| 1160 | Ga0070695_100050997 | |||
| 1161 | Ga0070695_100138975 | |||
| 1162 | Ga0070695_100154880 | |||
| 1163 | Ga0070695_100175716 | |||
| 1164 | Ga0070695_100479223 | |||
| 1165 | Ga0070695_100806617 | |||
| 1166 | Ga0070695_101441891 | |||
| 1167 | Ga0070696_100031402 | |||
| 1168 | Ga0070696_100058455 | |||
| 1169 | Ga0070696_100059835 | |||
| 1170 | Ga0070696_100309618 | |||
| 1171 | Ga0070696_100339030 | |||
| 1172 | Ga0070696_100400255 | |||
| 1173 | Ga0070696_100535977 | |||
| 1174 | Ga0070696_100698140 | |||
| 1175 | Ga0070693_100000775 | |||
| 1176 | Ga0070693_100011909 | |||
| 1177 | Ga0070693_100015356 | |||
| 1178 | Ga0070693_100016559 | |||
| 1179 | Ga0070693_100061355 | |||
| 1180 | Ga0070693_100178780 | |||
| 1181 | Ga0070693_101021390 | |||
| 1182 | Ga0070665_100158496 | |||
| 1183 | Ga0070704_100091555 | |||
| 1184 | Ga0070704_100104193 | |||
| 1185 | Ga0070704_100133812 | |||
| 1186 | Ga0070704_100217426 | |||
| 1187 | Ga0070704_100282971 | |||
| 1188 | Ga0070704_100467630 | |||
| 1189 | Ga0070704_100535327 | |||
| 1190 | Ga0070704_100739543 | |||
| 1191 | Ga0068855_100137573 | |||
| 1192 | Ga0068855_100609218 | |||
| 1193 | Ga0070664_100002580 | |||
| 1194 | Ga0070664_100267875 | |||
| 1195 | Ga0070664_100452627 | |||
| 1196 | Ga0070664_100596456 | |||
| 1197 | Ga0070664_100843478 | |||
| 1198 | Ga0070664_100928563 | |||
| 1199 | Ga0068857_100002670 | |||
| 1200 | Ga0068857_100046286 | |||
| 1201 | Ga0068857_100127827 | |||
| 1202 | Ga0068857_100140490 | |||
| 1203 | Ga0068857_100204067 | |||
| 1204 | Ga0068857_100816659 | |||
| 1205 | Ga0068857_100829651 | |||
| 1206 | Ga0068857_100874264 | |||
| 1207 | Ga0068854_100056797 | |||
| 1208 | Ga0068854_100120815 | |||
| 1209 | Ga0068854_100229047 | |||
| 1210 | Ga0068854_100309478 | |||
| 1211 | Ga0068854_100336401 | |||
| 1212 | Ga0068854_100902874 | |||
| 1213 | Ga0068854_101097304 | |||
| 1214 | Ga0068856_100005300 | |||
| 1215 | Ga0070702_100003492 | |||
| 1216 | Ga0070702_100079893 | |||
| 1217 | Ga0070702_100115532 | |||
| 1218 | Ga0070702_100301659 | |||
| 1219 | Ga0070702_100451768 | |||
| 1220 | Ga0070702_100462172 | |||
| 1221 | Ga0070702_101057559 | |||
| 1222 | Ga0068852_100236357 | |||
| 1223 | Ga0068852_100350256 | |||
| 1224 | Ga0068852_100369808 | |||
| 1225 | Ga0068852_100429403 | |||
| 1226 | Ga0068852_100713297 | |||
| 1227 | Ga0068852_101105028 | |||
| 1228 | Ga0068859_100007922 | |||
| 1229 | Ga0068859_100013228 | |||
| 1230 | Ga0068859_100036108 | |||
| 1231 | Ga0068859_100043033 | |||
| 1232 | Ga0068859_100086985 | |||
| 1233 | Ga0068859_100131954 | |||
| 1234 | Ga0068859_100193692 | |||
| 1235 | Ga0068859_100405841 | |||
| 1236 | Ga0068859_101222223 | |||
| 1237 | Ga0068859_101388807 | |||
| 1238 | Ga0068859_101392126 | |||
| 1239 | Ga0068859_101402539 | |||
| 1240 | Ga0068859_101454652 | |||
| 1241 | Ga0068859_102095814 | |||
| 1242 | Ga0068864_100001219 | |||
| 1243 | Ga0068864_100018626 | |||
| 1244 | Ga0068864_100025577 | |||
| 1245 | Ga0068864_100190372 | |||
| 1246 | Ga0068864_100192015 | |||
| 1247 | Ga0068864_100229083 | |||
| 1248 | Ga0068864_100231901 | |||
| 1249 | Ga0068864_100260504 | |||
| 1250 | Ga0068864_100269194 | |||
| 1251 | Ga0068864_100282780 | |||
| 1252 | Ga0068864_100310682 | |||
| 1253 | Ga0068864_100531623 | |||
| 1254 | Ga0068864_100652749 | |||
| 1255 | Ga0068864_102034065 | |||
| 1256 | Ga0068866_10005031 | |||
| 1257 | Ga0068861_100008097 | |||
| 1258 | Ga0068861_100022748 | |||
| 1259 | Ga0068861_100028715 | |||
| 1260 | Ga0068861_100062703 | |||
| 1261 | Ga0068861_100249023 | |||
| 1262 | Ga0068861_100504958 | |||
| 1263 | Ga0068861_101759260 | |||
| 1264 | Ga0068851_10013712 | |||
| 1265 | Ga0068870_10028203 | |||
| 1266 | Ga0068870_10156000 | |||
| 1267 | Ga0068870_10229281 | |||
| 1268 | Ga0068870_10742931 | |||
| 1269 | Ga0068863_100146705 | |||
| 1270 | Ga0068863_100190549 | |||
| 1271 | Ga0068863_100241479 | |||
| 1272 | Ga0068863_100580132 | |||
| 1273 | Ga0068858_100058113 | |||
| 1274 | Ga0068858_100069609 | |||
| 1275 | Ga0068858_100117601 | |||
| 1276 | Ga0068858_100139032 | |||
| 1277 | Ga0068858_100167819 | |||
| 1278 | Ga0068858_100206124 | |||
| 1279 | Ga0068858_100239355 | |||
| 1280 | Ga0068858_100270339 | |||
| 1281 | Ga0068858_100326388 | |||
| 1282 | Ga0068858_100476366 | |||
| 1283 | Ga0068858_102363058 | |||
| 1284 | Ga0068860_100078315 | |||
| 1285 | Ga0068860_100213204 | |||
| 1286 | Ga0068860_100289930 | |||
| 1287 | Ga0068860_100347761 | |||
| 1288 | Ga0068860_100585163 | |||
| 1289 | Ga0068860_100833533 | |||
| 1290 | Ga0068860_100936601 | |||
| 1291 | Ga0068860_101267648 | |||
| 1292 | Ga0068862_100018132 | |||
| 1293 | Ga0068862_100029245 | |||
| 1294 | Ga0068862_100095055 | |||
| 1295 | Ga0068862_100239530 | |||
| 1296 | Ga0068862_100429975 | |||
| 1297 | Ga0068862_100467340 | |||
| 1298 | Ga0068862_101175652 | |||
| 1299 | Ga0068862_101198384 | |||
| 1300 | Ga0081539_10000487 | |||
| 1301 | Ga0081539_10003495 | |||
| 1302 | Ga0075432_10043540 | |||
| 1303 | Ga0070716_100229478 | |||
| 1304 | Ga0070716_100366417 | |||
| 1305 | Ga0097621_100001343 | |||
| 1306 | Ga0097621_100019601 | |||
| 1307 | Ga0097621_100031588 | |||
| 1308 | Ga0097621_100438482 | |||
| 1309 | Ga0068871_100007860 | |||
| 1310 | Ga0068871_100043720 | |||
| 1311 | Ga0068871_100047482 | |||
| 1312 | Ga0068871_100127451 | |||
| 1313 | Ga0068871_100468125 | |||
| 1314 | Ga0075428_100081296 | |||
| 1315 | Ga0075428_100083970 | |||
| 1316 | Ga0075428_100911329 | |||
| 1317 | Ga0075430_100458873 | |||
| 1318 | Ga0075431_100073125 | |||
| 1319 | Ga0075431_100188611 | |||
| 1320 | Ga0075431_100790428 | |||
| 1321 | Ga0075433_10006875 | |||
| 1322 | Ga0075433_10013861 | |||
| 1323 | Ga0075433_10031197 | |||
| 1324 | Ga0075433_10050622 | |||
| 1325 | Ga0075433_10153666 | |||
| 1326 | Ga0075433_10180526 | |||
| 1327 | Ga0075433_10194957 | |||
| 1328 | Ga0075433_10220696 | |||
| 1329 | Ga0075433_10730423 | |||
| 1330 | Ga0075434_100043034 | |||
| 1331 | Ga0075434_100049269 | |||
| 1332 | Ga0075434_100348874 | |||
| 1333 | Ga0075434_100539747 | |||
| 1334 | Ga0075434_100593309 | |||
| 1335 | Ga0075434_101473349 | |||
| 1336 | Ga0075429_100015591 | |||
| 1337 | Ga0075429_100106679 | |||
| 1338 | Ga0075429_100121025 | |||
| 1339 | Ga0075429_100144798 | |||
| 1340 | Ga0068865_100160008 | |||
| 1341 | Ga0068865_100329059 | |||
| 1342 | Ga0068865_100477519 | |||
| 1343 | Ga0075436_100023126 | |||
| 1344 | Ga0097620_100007923 | |||
| 1345 | Ga0097620_100013228 | |||
| 1346 | Ga0097620_100036109 | |||
| 1347 | Ga0097620_100043031 | |||
| 1348 | Ga0097620_100086983 | |||
| 1349 | Ga0097620_100131950 | |||
| 1350 | Ga0097620_100193666 | |||
| 1351 | Ga0097620_100405880 | |||
| 1352 | Ga0097620_101222255 | |||
| 1353 | Ga0097620_101388775 | |||
| 1354 | Ga0097620_101392138 | |||
| 1355 | Ga0097620_101402532 | |||
| 1356 | Ga0097620_101454374 | |||
| 1357 | Ga0097620_102095773 | |||
| 1358 | Ga0075435_100006392 | |||
| 1359 | Ga0075435_100590130 | |||
| 1360 | Ga0099794_10566226 | |||
| 1361 | Ga0105251_10129543 | |||
| 1362 | Ga0105251_10265475 | |||
| 1363 | Ga0105240_10134905 | |||
| 1364 | Ga0111539_10079327 | |||
| 1365 | Ga0111539_10154246 | |||
| 1366 | Ga0111539_10159347 | |||
| 1367 | Ga0105245_10249548 | |||
| 1368 | Ga0105245_10528738 | |||
| 1369 | Ga0105245_10602225 | |||
| 1370 | Ga0105245_10685058 | |||
| 1371 | Ga0105245_10768395 | |||
| 1372 | Ga0105245_10812780 | |||
| 1373 | Ga0105247_10037314 | |||
| 1374 | Ga0105247_10056096 | |||
| 1375 | Ga0105247_10062815 | |||
| 1376 | Ga0105247_10079635 | |||
| 1377 | Ga0105247_10523647 | |||
| 1378 | Ga0105247_11149579 | |||
| 1379 | Ga0114129_10004897 | |||
| 1380 | Ga0114129_10108771 | |||
| 1381 | Ga0114129_10109956 | |||
| 1382 | Ga0114129_10227794 | |||
| 1383 | Ga0114129_10253051 | |||
| 1384 | Ga0114129_10268134 | |||
| 1385 | Ga0114129_11286659 | |||
| 1386 | Ga0114129_11397339 | |||
| 1387 | Ga0114129_12078280 | |||
| 1388 | Ga0105243_10001952 | |||
| 1389 | Ga0105243_10011066 | |||
| 1390 | Ga0105243_10133105 | |||
| 1391 | Ga0105243_10236103 | |||
| 1392 | Ga0105243_10309892 | |||
| 1393 | Ga0105243_10580888 | |||
| 1394 | Ga0105241_10019131 | |||
| 1395 | Ga0105241_10020033 | |||
| 1396 | Ga0105241_10056913 | |||
| 1397 | Ga0105241_10101685 | |||
| 1398 | Ga0105241_10279458 | |||
| 1399 | Ga0105241_10344228 | |||
| 1400 | Ga0105241_10384564 | |||
| 1401 | Ga0105241_10527537 | |||
| 1402 | Ga0105241_10613536 | |||
| 1403 | Ga0105241_10641696 | |||
| 1404 | Ga0105241_10896005 | |||
| 1405 | Ga0105241_10916105 | |||
| 1406 | Ga0105241_11135029 | |||
| 1407 | Ga0105241_11538070 | |||
| 1408 | Ga0105242_10132200 | |||
| 1409 | Ga0105242_10150841 | |||
| 1410 | Ga0105242_10204557 | |||
| 1411 | Ga0105242_10265263 | |||
| 1412 | Ga0105242_10793254 | |||
| 1413 | Ga0105242_11249826 | |||
| 1414 | Ga0105248_10005050 | |||
| 1415 | Ga0105248_10007877 | |||
| 1416 | Ga0105248_10092690 | |||
| 1417 | Ga0105248_10111760 | |||
| 1418 | Ga0105248_10119835 | |||
| 1419 | Ga0105248_10182462 | |||
| 1420 | Ga0105248_10258325 | |||
| 1421 | Ga0105248_10610498 | |||
| 1422 | Ga0105248_10649135 | |||
| 1423 | Ga0105248_11028285 | |||
| 1424 | Ga0105248_11031255 | |||
| 1425 | Ga0105248_11113475 | |||
| 1426 | Ga0105248_11380131 | |||
| 1427 | Ga0105248_11767455 | |||
| 1428 | Ga0105237_10001132 | |||
| 1429 | Ga0105237_10042047 | |||
| 1430 | Ga0105237_10080027 | |||
| 1431 | Ga0105237_11488175 | |||
| 1432 | Ga0105238_10002642 | |||
| 1433 | Ga0105238_10006395 | |||
| 1434 | Ga0105249_10000029 | |||
| 1435 | Ga0105249_10011040 | |||
| 1436 | Ga0105249_10044992 | |||
| 1437 | Ga0105249_10075873 | |||
| 1438 | Ga0105249_10174903 | |||
| 1439 | Ga0105249_10221788 | |||
| 1440 | Ga0105249_10502725 | |||
| 1441 | Ga0105249_10558796 | |||
| 1442 | Ga0105249_11759623 | |||
| 1443 | Ga0099796_10062247 | |||
| 1444 | Ga0105239_10101185 | |||
| 1445 | Ga0105239_10145157 | |||
| 1446 | Ga0105239_10580804 | |||
| 1447 | Ga0105239_10801409 | |||
| 1448 | Ga0105246_10105079 | |||
| 1449 | Ga0105246_10153661 | |||
| 1450 | Ga0105246_10242148 | |||
| 1451 | Ga0105246_10361028 | |||
| 1452 | Ga0105246_10400032 | |||
| 1453 | Ga0105246_10885543 | |||
| 1454 | Ga0105246_11028925 | |||
| 1455 | Ga0105246_11777870 | |||
| 1456 | Ga0157373_10006338 | |||
| 1457 | Ga0157373_10009488 | |||
| 1458 | Ga0157373_10017090 | |||
| 1459 | Ga0157373_10095244 | |||
| 1460 | Ga0157373_10698240 | |||
| 1461 | Ga0157373_10772813 | |||
| 1462 | Ga0157373_10957197 | |||
| 1463 | Ga0157371_10158534 | |||
| 1464 | Ga0157371_10825009 | |||
| 1465 | Ga0157374_10022626 | |||
| 1466 | Ga0157374_10032330 | |||
| 1467 | Ga0157374_11721782 | |||
| 1468 | Ga0157374_12018549 | |||
| 1469 | Ga0157374_12177566 | |||
| 1470 | Ga0157378_10010378 | |||
| 1471 | Ga0157378_10015544 | |||
| 1472 | Ga0157378_10025558 | |||
| 1473 | Ga0157378_10053702 | |||
| 1474 | Ga0157378_10179805 | |||
| 1475 | Ga0157378_10512108 | |||
| 1476 | Ga0157378_10649952 | |||
| 1477 | Ga0157378_11082420 | |||
| 1478 | Ga0163162_10000009 | |||
| 1479 | Ga0163162_10008612 | |||
| 1480 | Ga0163162_10010879 | |||
| 1481 | Ga0163162_10041507 | |||
| 1482 | Ga0163162_10053986 | |||
| 1483 | Ga0163162_10508634 | |||
| 1484 | Ga0163162_10662578 | |||
| 1485 | Ga0163162_10672833 | |||
| 1486 | Ga0163162_10684081 | |||
| 1487 | Ga0163162_10781228 | |||
| 1488 | Ga0157372_10033659 | |||
| 1489 | Ga0157372_10420145 | |||
| 1490 | Ga0157372_10471524 | |||
| 1491 | Ga0157372_10565087 | |||
| 1492 | Ga0157372_11281273 | |||
| 1493 | Ga0157372_12362863 | |||
| 1494 | Ga0157375_10009777 | |||
| 1495 | Ga0157375_10018218 | |||
| 1496 | Ga0157375_10128892 | |||
| 1497 | Ga0157375_10226322 | |||
| 1498 | Ga0157375_10284166 | |||
| 1499 | Ga0157375_10382809 | |||
| 1500 | Ga0157375_10413504 | |||
| 1501 | Ga0157375_10454290 | |||
| 1502 | Ga0157375_10788697 | |||
| 1503 | Ga0157375_10859873 | |||
| 1504 | Ga0157375_10899652 | |||
| 1505 | Ga0157375_11375474 | |||
| 1506 | Ga0163163_10000466 | |||
| 1507 | Ga0163163_10002054 | |||
| 1508 | Ga0163163_10002763 | |||
| 1509 | Ga0163163_10027595 | |||
| 1510 | Ga0163163_10029203 | |||
| 1511 | Ga0163163_10072427 | |||
| 1512 | Ga0163163_10188652 | |||
| 1513 | Ga0163163_10246532 | |||
| 1514 | Ga0163163_10594073 | |||
| 1515 | Ga0163163_10666976 | |||
| 1516 | Ga0163163_10846928 | |||
| 1517 | Ga0163163_11525040 | |||
| 1518 | Ga0157380_10000188 | |||
| 1519 | Ga0157380_10007110 | |||
| 1520 | Ga0157380_10012447 | |||
| 1521 | Ga0157380_10034924 | |||
| 1522 | Ga0157380_10134421 | |||
| 1523 | Ga0157380_10151479 | |||
| 1524 | Ga0157380_10254915 | |||
| 1525 | Ga0157380_10256447 | |||
| 1526 | Ga0157377_10016406 | |||
| 1527 | Ga0157377_10017921 | |||
| 1528 | Ga0157377_10139754 | |||
| 1529 | Ga0157377_10214093 | |||
| 1530 | Ga0157379_10058845 | |||
| 1531 | Ga0157379_10099538 | |||
| 1532 | Ga0157379_10682695 | |||
| 1533 | Ga0157379_10822662 | |||
| 1534 | Ga0157376_10055570 | |||
| 1535 | Ga0182007_10135814 | |||
| 1536 | Ga0163161_10006702 | |||
| 1537 | Ga0163161_10149121 | |||
| 1538 | Ga0163161_10609462 | |||
| 1539 | Ga0207697_10071051 | |||
| 1540 | Ga0207656_10011668 | |||
| 1541 | Ga0207653_10022098 | |||
| 1542 | Ga0207642_10009682 | |||
| 1543 | Ga0207642_10365506 | |||
| 1544 | Ga0207642_10956786 | |||
| 1545 | Ga0207710_10000389 | |||
| 1546 | Ga0207710_10237708 | |||
| 1547 | Ga0207680_10029178 | |||
| 1548 | Ga0207680_10660760 | |||
| 1549 | Ga0207680_10735240 | |||
| 1550 | Ga0207647_10003482 | |||
| 1551 | Ga0207647_10232088 | |||
| 1552 | Ga0207647_10340864 | |||
| 1553 | Ga0207645_10135104 | |||
| 1554 | Ga0207643_10020307 | |||
| 1555 | Ga0207643_10045238 | |||
| 1556 | Ga0207643_10058845 | |||
| 1557 | Ga0207643_10397431 | |||
| 1558 | Ga0207684_10000083 | |||
| 1559 | Ga0207684_10082433 | |||
| 1560 | Ga0207684_10372382 | |||
| 1561 | Ga0207684_10644840 | |||
| 1562 | Ga0207654_10062482 | |||
| 1563 | Ga0207654_10071422 | |||
| 1564 | Ga0207654_10105851 | |||
| 1565 | Ga0207654_10144790 | |||
| 1566 | Ga0207654_10313119 | |||
| 1567 | Ga0207654_10553544 | |||
| 1568 | Ga0207654_10741262 | |||
| 1569 | Ga0207707_10015795 | |||
| 1570 | Ga0207707_10068064 | |||
| 1571 | Ga0207707_10140489 | |||
| 1572 | Ga0207695_10071094 | |||
| 1573 | Ga0207671_10015690 | |||
| 1574 | Ga0207671_10039720 | |||
| 1575 | Ga0207671_10418663 | |||
| 1576 | Ga0207660_10011883 | |||
| 1577 | Ga0207660_10069429 | |||
| 1578 | Ga0207660_10638869 | |||
| 1579 | Ga0207660_10651062 | |||
| 1580 | Ga0207662_10031125 | |||
| 1581 | Ga0207662_10063770 | |||
| 1582 | Ga0207662_10149304 | |||
| 1583 | Ga0207662_10152938 | |||
| 1584 | Ga0207657_10021188 | |||
| 1585 | Ga0207652_10052074 | |||
| 1586 | Ga0207646_10023701 | |||
| 1587 | Ga0207646_10534260 | |||
| 1588 | Ga0207681_10014169 | |||
| 1589 | Ga0207681_10031671 | |||
| 1590 | Ga0207681_10186601 | |||
| 1591 | Ga0207681_10957839 | |||
| 1592 | Ga0207694_10003054 | |||
| 1593 | Ga0207694_10023376 | |||
| 1594 | Ga0207650_10000006 | |||
| 1595 | Ga0207650_10047907 | |||
| 1596 | Ga0207650_10088478 | |||
| 1597 | Ga0207650_10217418 | |||
| 1598 | Ga0207650_10498990 | |||
| 1599 | Ga0207659_10332538 | |||
| 1600 | Ga0207659_10334316 | |||
| 1601 | Ga0207687_10032505 | |||
| 1602 | Ga0207687_10452239 | |||
| 1603 | Ga0207644_10139909 | |||
| 1604 | Ga0207644_10254492 | |||
| 1605 | Ga0207644_10472962 | |||
| 1606 | Ga0207690_10004343 | |||
| 1607 | Ga0207690_10011300 | |||
| 1608 | Ga0207690_11034294 | |||
| 1609 | Ga0207706_10039447 | |||
| 1610 | Ga0207706_10178680 | |||
| 1611 | Ga0207706_10565916 | |||
| 1612 | Ga0207686_10069102 | |||
| 1613 | Ga0207686_10230588 | |||
| 1614 | Ga0207686_10627922 | |||
| 1615 | Ga0207686_10866607 | |||
| 1616 | Ga0207709_10008229 | |||
| 1617 | Ga0207709_10082783 | |||
| 1618 | Ga0207709_10084431 | |||
| 1619 | Ga0207709_10276703 | |||
| 1620 | Ga0207709_10453616 | |||
| 1621 | Ga0207709_10976443 | |||
| 1622 | Ga0207670_10000236 | |||
| 1623 | Ga0207670_10228939 | |||
| 1624 | Ga0207670_10566286 | |||
| 1625 | Ga0207670_11233894 | |||
| 1626 | Ga0207704_10020308 | |||
| 1627 | Ga0207704_10106621 | |||
| 1628 | Ga0207704_11362981 | |||
| 1629 | Ga0207665_10409240 | |||
| 1630 | Ga0207665_10470168 | |||
| 1631 | Ga0207691_10008611 | |||
| 1632 | Ga0207691_10200594 | |||
| 1633 | Ga0207691_10326090 | |||
| 1634 | Ga0207691_10352049 | |||
| 1635 | Ga0207711_10001380 | |||
| 1636 | Ga0207711_10007092 | |||
| 1637 | Ga0207711_10028460 | |||
| 1638 | Ga0207711_10126284 | |||
| 1639 | Ga0207711_10348650 | |||
| 1640 | Ga0207711_11534406 | |||
| 1641 | Ga0207689_10002536 | |||
| 1642 | Ga0207689_10054287 | |||
| 1643 | Ga0207689_10091962 | |||
| 1644 | Ga0207689_10110088 | |||
| 1645 | Ga0207689_10263012 | |||
| 1646 | Ga0207689_10291320 | |||
| 1647 | Ga0207689_10478842 | |||
| 1648 | Ga0207679_10005396 | |||
| 1649 | Ga0207667_10664522 | |||
| 1650 | Ga0207667_10706308 | |||
| 1651 | Ga0207651_10027295 | |||
| 1652 | Ga0207651_10121347 | |||
| 1653 | Ga0207651_10422784 | |||
| 1654 | Ga0207651_10553878 | |||
| 1655 | Ga0207651_10606725 | |||
| 1656 | Ga0207651_11048986 | |||
| 1657 | Ga0207651_11075327 | |||
| 1658 | Ga0207712_10000366 | |||
| 1659 | Ga0207712_10017290 | |||
| 1660 | Ga0207712_10085159 | |||
| 1661 | Ga0207712_10726315 | |||
| 1662 | Ga0207712_11061774 | |||
| 1663 | Ga0207712_11365686 | |||
| 1664 | Ga0207668_10022918 | |||
| 1665 | Ga0207640_10116792 | |||
| 1666 | Ga0207640_10374069 | |||
| 1667 | Ga0207640_10400251 | |||
| 1668 | Ga0207640_10475619 | |||
| 1669 | Ga0207640_10527606 | |||
| 1670 | Ga0207658_10034157 | |||
| 1671 | Ga0207703_10109086 | |||
| 1672 | Ga0207703_10117939 | |||
| 1673 | Ga0207703_10260901 | |||
| 1674 | Ga0207703_10415234 | |||
| 1675 | Ga0207703_10420524 | |||
| 1676 | Ga0207703_10602196 | |||
| 1677 | Ga0207703_11035470 | |||
| 1678 | Ga0207703_11393924 | |||
| 1679 | Ga0207639_10015732 | |||
| 1680 | Ga0207639_10215500 | |||
| 1681 | Ga0207639_10344909 | |||
| 1682 | Ga0207708_10000016 | |||
| 1683 | Ga0207708_10005449 | |||
| 1684 | Ga0207708_10012864 | |||
| 1685 | Ga0207708_10038646 | |||
| 1686 | Ga0207708_10041802 | |||
| 1687 | Ga0207708_10098792 | |||
| 1688 | Ga0207708_10111097 | |||
| 1689 | Ga0207708_10157002 | |||
| 1690 | Ga0207708_10157968 | |||
| 1691 | Ga0207708_10177232 | |||
| 1692 | Ga0207702_10025855 | |||
| 1693 | Ga0207641_10019825 | |||
| 1694 | Ga0207641_10066218 | |||
| 1695 | Ga0207641_10331451 | |||
| 1696 | Ga0207641_11955997 | |||
| 1697 | Ga0207648_10027694 | |||
| 1698 | Ga0207648_10091227 | |||
| 1699 | Ga0207648_10167620 | |||
| 1700 | Ga0207648_10305198 | |||
| 1701 | Ga0207648_10328246 | |||
| 1702 | Ga0207648_10859179 | |||
| 1703 | Ga0207648_10864210 | |||
| 1704 | Ga0207648_11306774 | |||
| 1705 | Ga0207676_10006815 | |||
| 1706 | Ga0207676_10011201 | |||
| 1707 | Ga0207676_10176041 | |||
| 1708 | Ga0207676_10190228 | |||
| 1709 | Ga0207676_10217862 | |||
| 1710 | Ga0207676_10344813 | |||
| 1711 | Ga0207676_10413572 | |||
| 1712 | Ga0207676_10420825 | |||
| 1713 | Ga0207674_10000834 | |||
| 1714 | Ga0207674_10094378 | |||
| 1715 | Ga0207674_10146258 | |||
| 1716 | Ga0207674_10366955 | |||
| 1717 | Ga0207674_10373283 | |||
| 1718 | Ga0207674_10382951 | |||
| 1719 | Ga0207674_10388551 | |||
| 1720 | Ga0207674_10530946 | |||
| 1721 | Ga0207674_10920194 | |||
| 1722 | Ga0207674_11364048 | |||
| 1723 | Ga0207675_100003117 | |||
| 1724 | Ga0207675_100012658 | |||
| 1725 | Ga0207675_100046683 | |||
| 1726 | Ga0207675_100056048 | |||
| 1727 | Ga0207675_100159458 | |||
| 1728 | Ga0207675_100419899 | |||
| 1729 | Ga0207675_100672714 | |||
| 1730 | Ga0207675_101361439 | |||
| 1731 | Ga0207683_10127280 | |||
| 1732 | Ga0207698_10233540 | |||
| 1733 | Ga0207698_10335443 | |||
| 1734 | Ga0207698_11049058 | |||
| 1735 | Ga0209967_1033995 | |||
| 1736 | Ga0207428_10054685 | |||
| 1737 | Ga0268266_10141588 | |||
| 1738 | Ga0268265_10033069 | |||
| 1739 | Ga0268265_10087594 | |||
| 1740 | Ga0268265_10208743 | |||
| 1741 | Ga0268265_10591524 | |||
| 1742 | Ga0268265_11066591 | |||
| 1743 | Ga0268265_11223928 | |||
| 1744 | Ga0268264_10024961 | |||
| 1745 | Ga0268264_10095839 | |||
| 1746 | Ga0268264_10134680 | |||
| 1747 | Ga0268264_10276873 | |||
| 1748 | Ga0268264_10370593 | |||
| 1749 | Ga0268264_10378851 | |||
| 1750 | Ga0268264_10581037 | |||
| 1751 | Ga0268264_11337811 | |||
| 1752 | Ga0268264_12089120 | |||
| 1753 | Ga0307408_100058290 | |||
| 1754 | Ga0307408_100058786 | |||
| 1755 | Ga0307408_100083651 | |||
| 1756 | Ga0307408_100355205 | |||
| 1757 | Ga0307408_100732165 | |||
| 1758 | Ga0307405_10007336 | |||
| 1759 | Ga0307405_10281083 | |||
| 1760 | Ga0307413_10079091 | |||
| 1761 | Ga0307410_10044268 | |||
| 1762 | Ga0307410_10062511 | |||
| 1763 | Ga0307410_10371671 | |||
| 1764 | Ga0307406_10012436 | |||
| 1765 | Ga0307406_10173237 | |||
| 1766 | Ga0307406_10207909 | |||
| 1767 | Ga0307412_10082499 | |||
| 1768 | Ga0307412_10087461 | |||
| 1769 | Ga0307409_100358691 | |||
| 1770 | Ga0307409_100786661 | |||
| 1771 | Ga0307416_100083558 | |||
| 1772 | Ga0307416_100103916 | |||
| 1773 | Ga0307414_10021049 | |||
| 1774 | Ga0307414_10224313 | |||
| 1775 | Ga0307414_11548063 | |||
| 1776 | Ga0307411_10234703 | |||
| 1777 | Ga0307411_10740545 | |||
| 1778 | Ga0307415_100028009 | |||
| 1779 | Ga0307415_100384331 | |||
| 1780 | Ga0307415_100482794 | |||
| 1781 | Ga0307415_101042791 | |||
| 1782 | Ga0373940_0043646 | |||
| 1783 | Ga0373949_0058196 | |||
| 1784 | Ga0373951_0003140 | |||
| 1785 | Ga0373952_0251776 | |||
| 1786 | Ga0373941_0019453 | |||
| 1787 | Ga0373942_0005511 | |||
| 1788 | Ga0373962_0025963 | |||
| 1789 | Ga0373931_0086906 | |||
| 1790 | Ga0373937_0346035 | |||
| 1791 | Ga0395899_0330619 | |||
| 1792 | Ga0395899_0387042 | |||
| 1793 | Ga0395900_0244909 | |||
| 1794 | Ga0395900_0726539 | |||
| 1795 | Ga0395898_0637714 | |||
| 1796 | Ga0395905_1290733 | |||
| 1797 | Ga0395901_0471172 | |||
| 1798 | Ga0395901_0738960 | |||
| 1799 | Ga0395901_0814393 | |||
| 1800 | Ga0395901_1036785 | |||
| 1801 | Ga0242422_04767 | |||
| 1802 | Ga0242420_009839 | |||
| 1803 | Ga0439458_0004103 | |||
| 1804 | Ga0453683_0393403 | |||
| 1805 | Ga0451576_0325816 | |||
| 1806 | Ga0451576_0350324 | |||
| 1807 | Ga0495582_0231348 | |||
| 1808 | Ga0495658_0081528 | |||
| 1809 | Ga0495669_0659587 | |||
| 1810 | Ga0496102_0010938 | |||
| 1811 | Ga0496102_0443468 | |||
| 1812 | Ga0496103_0215791 | |||
| 1813 | Ga0496104_0276520 | |||
| 1814 | Ga0496104_1146128 | |||
| 1815 | Ga0496105_0223379 | |||
| 1816 | Ga0496106_0260649 | |||
| 1817 | Ga0496106_0951200 | |||
| 1818 | Ga0496107_0449432 | |||
| 1819 | Ga0496108_0118307 | |||
| 1820 | Ga0496109_1659987 | |||
| 1821 | Ga0496110_0154049 | |||
| 1822 | Ga0496112_0083049 | |||
| 1823 | Ga0496112_0184022 | |||
| 1824 | Ga0496112_0374146 | |||
| 1825 | Ga0496112_0582876 | |||
| 1826 | Ga0496112_1389171 | |||
| 1827 | Ga0496113_0137148 | |||
| 1828 | Ga0496113_0622670 | |||
| 1829 | Ga0496113_0907532 | |||
| 1830 | Ga0501291_021860 | |||
| 1831 | Ga0501292_002722 | |||
| 1832 | Ga0501292_007066 | |||
| 1833 | Ga0501292_075040 | |||
| 1834 | Ga0501293_007382 | |||
| 1835 | Ga0501295_045974 | |||
| 1836 | Ga0501297_071120 | |||
| 1837 | Ga0501298_001979 | |||
| 1838 | Ga0501298_029368 | |||
| 1839 | Ga0501299_016697 | |||
| 1840 | Ga0501299_021657 | |||
| 1841 | Ga0501300_012114 | |||
| 1842 | Ga0501300_019024 | |||
| 1843 | Ga0501038_0001488 | |||
| 1844 | Ga0501048_0463202 | |||
| 1845 | Ga0501076_0953295 | |||
| 1846 | Ga0501077_0235325 | |||
| 1847 | Ga0501198_001801 | |||
| 1848 | Ga0501198_049046 | |||
| 1849 | Ga0501202_002390 | |||
| 1850 | Ga0501202_010365 | |||
| 1851 | Ga0501207_011242 | |||
| 1852 | Ga0501207_021814 | |||
| 1853 | Ga0501207_059252 | |||
| 1854 | Ga0501208_105982 | |||
| 1855 | Ga0501209_294549 | |||
| 1856 | Ga0501217_006848 | |||
| 1857 | Ga0501217_033331 | |||
| 1858 | Ga0501223_005881 | |||
| 1859 | Ga0501223_008448 | |||
| 1860 | Ga0501227_002240 | |||
| 1861 | Ga0501227_034743 | |||
| 1862 | Ga0501230_053957 | |||
| 1863 | Ga0501230_066551 | |||
| 1864 | Ga0501233_001572 | |||
| 1865 | Ga0501233_024411 | |||
| 1866 | Ga0501233_030248 | |||
| 1867 | Ga0501233_044325 | |||
| 1868 | Ga0501235_002210 | |||
| 1869 | Ga0501235_007087 | |||
| 1870 | Ga0501235_129563 | |||
| 1871 | Ga0501243_007902 | |||
| 1872 | Ga0501243_008184 | |||
| 1873 | Ga0501243_020491 | |||
| 1874 | Ga0501249_099794 | |||
| 1875 | Ga0501250_034939 | |||
| 1876 | Ga0501253_015593 | |||
| 1877 | Ga0501257_008644 | |||
| 1878 | Ga0501257_024783 | |||
| 1879 | Ga0501257_041005 | |||
| 1880 | Ga0501259_062183 | |||
| 1881 | Ga0501260_016444 | |||
| 1882 | Ga0501261_018026 | |||
| 1883 | Ga0501221_210874 | |||
| 1884 | Ga0501225_0003567 | |||
| 1885 | Ga0501225_0007426 | |||
| 1886 | Ga0501225_0008102 | |||
| 1887 | Ga0501234_008102 | |||
| 1888 | Ga0501245_007052 | |||
| 1889 | Ga0501245_010601 | |||
| 1890 | Ga0501079_1322561 | |||
| 1891 | Ga0501263_031899 | |||
| 1892 | Ga0501270_014283 | |||
| 1893 | Ga0501272_015562 | |||
| 1894 | Ga0501273_008681 | |||
| 1895 | Ga0501276_014137 | |||
| 1896 | Ga0501283_001695 | |||
| 1897 | Ga0501200_08989 | |||
| 1898 | Ga0501212_008410 | |||
| 1899 | Ga0501212_025784 | |||
| 1900 | Ga0501220_03647 | |||
| 1901 | Ga0501226_002383 | |||
| 1902 | nmdc:mga05p37_102248_c1 | |||
| 1903 | nmdc:mga05p37_103422_c1 | |||
| 1904 | nmdc:mga05p37_106263_c1 | |||
| 1905 | nmdc:mga05p37_1077839_c1 | |||
| 1906 | nmdc:mga05p37_1157893_c1 | |||
| 1907 | nmdc:mga05p37_238860_c1 | |||
| 1908 | nmdc:mga05p37_388298_c1 | |||
| 1909 | nmdc:mga05p37_439359_c1 | |||
| 1910 | nmdc:mga05p37_509967_c1 | |||
| 1911 | nmdc:mga05p37_842050_c1 | |||
| 1912 | nmdc:mga05p37_919854_c1 | |||
| 1913 | nmdc:mga09592_116305_c1 | |||
| 1914 | nmdc:mga09592_133127_c1 | |||
| 1915 | nmdc:mga09592_315488_c1 | |||
| 1916 | nmdc:mga09592_403994_c1 | |||
| 1917 | nmdc:mga09592_684220_c1 | |||
| 1918 | nmdc:mga0qj67_136954_c1 | |||
| 1919 | nmdc:mga0qj67_315936_c1 | |||
| 1920 | nmdc:mga0qj67_720052_c1 | |||
| 1921 | nmdc:mga06r32_308453_c1 | |||
| 1922 | nmdc:mga06r32_420403_c1 | |||
| 1923 | nmdc:mga08y16_23581_c1 | |||
| 1924 | nmdc:mga08y16_691343_c1 | |||
| 1925 | nmdc:mga08y16_86430_c1 | |||
| 1926 | nmdc:mga0n895_262588_c1 | |||
| 1927 | nmdc:mga0n895_281620_c1 | |||
| 1928 | nmdc:mga0n895_333904_c1 | |||
| 1929 | nmdc:mga0n895_536797_c1 | |||
| 1930 | nmdc:mga0n895_53683_c1 | |||
| 1931 | nmdc:mga0n895_763564_c1 | |||
| 1932 | nmdc:mga0n895_767241_c1 | |||
| 1933 | nmdc:mga0rr50_166505_c1 | |||
| 1934 | nmdc:mga0rr50_19621_c1 | |||
| 1935 | nmdc:mga0rr50_301315_c1 | |||
| 1936 | nmdc:mga08x19_7479_c1 | |||
| 1937 | nmdc:mga0a205_101889_c1 | |||
| 1938 | nmdc:mga0a205_134664_c1 | |||
| 1939 | nmdc:mga0a205_167735_c1 | |||
| 1940 | nmdc:mga0a205_207241_c1 | |||
| 1941 | nmdc:mga0a205_21072_c1 | |||
| 1942 | nmdc:mga0a205_337620_c1 | |||
| 1943 | nmdc:mga0a205_392130_c1 | |||
| 1944 | nmdc:mga0a205_59234_c1 | |||
| 1945 | nmdc:mga0a205_717968_c1 | |||
| 1946 | Ga0501084_0230351 | |||
| 1947 | Ga0501084_0626117 | |||
| 1948 | Ga0587091_157000 | |||
| 1949 | Ga0501082_0589232 | |||
| 1950 | Ga0530510_0583283 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2uzh-assembly1.cif.gz_C | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.7379 | 73 | 135 |
| 2uzh-assembly1.cif.gz_B | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.7352 | 73 | 135 |
| 7unu-assembly1.cif.gz_c | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.7119 | 73 | 134 |
| 5iqr-assembly1.cif.gz_h | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.702 | 19 | 134 |
| 7nhn-assembly1.cif.gz_d | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.6677 | 26 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2uzhA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.7043 | 73 | 135 | 3.30.1330.50 |
| af_Q2FW12_17_106_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.6704 | 22 | 134 | 3.30.300.20 |
| af_Q57606_1_96_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.6284 | 26 | 136 | 3.30.460.10 |
| af_Q58021_1_93_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.624 | 26 | 143 | 3.30.460.10 |
| 3gqwB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.6135 | 30 | 134 | 3.30.300.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V2R5P6-F1-model_v4 | Uncharacterized protein | 0.9683 | 2 | 159 |
|
| AF-A0A838P503-F1-model_v4 | Uncharacterized protein | 0.9667 | 1 | 78 |
|
| AF-A0A7R8AYD1-F1-model_v4 | deleted | 0.9641 | 8 | 154 |
|
| AF-A0A538U4W8-F1-model_v4 | Nucleotidyltransferase domain-containing protein | 0.9608 | 14 | 159 |
|
| AF-A0A2V7U6R0-F1-model_v4 | Nucleotidyltransferase domain-containing protein | 0.9577 | 8 | 159 |
|