F487221

General Info

Members Datasets Scaffolds Average Seq Length
975 282 1950 159

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10395210|Ga0065715_103952101
Length 189
Sequence MLSLECGALAPLWPKRRQGGAPQDHSTEIPMPKDAHEMTENEIRSRIITLAFGADERLFIAFYRKLQQGLPEGTGIVLRGSVITNKRHEDGEPFDSQGKNTSDLDVTLVGSKVMEAWNSDAYYIPGLHTKPLCDKDPDIAPSLKSLRESLQELVGRPVNFQATSSLVLYGRDVLFGETYYVVVPAGEGA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
225 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
226 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
227 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
228 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
237 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
238 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
239 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
240 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
245 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
250 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
251 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
252 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
253 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
254 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
261 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
262 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
263 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
264 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
265 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
266 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
267 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
268 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
269 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 35.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10395210 3300005293 Bacteria 877
2 SwRhRL2b_contig_19469 2162886007 Unclassified 898
3 SwRhRL2b_contig_940246 2162886007 Bacteria 3786
4 MBSR1b_contig_11702357 2162886012 Bacteria 1007
5 MBSR1b_contig_357108 2162886012 Unclassified 1788
6 MBSR1b_contig_931085 2162886012 Bacteria 965
7 CNAas_1000523 3300000532 Unclassified 3737
8 JGI24751J29686_10000038 3300002459 Bacteria 80932
9 JGI25406J46586_10010758 3300003203 Bacteria 4042
10 rootL2_10087314 3300003322 Bacteria 1027
11 Ga0065714_10064462 3300005288 Bacteria 66145
12 Ga0065714_10176383 3300005288 Unclassified 981
13 Ga0065714_10385164 3300005288 Bacteria 603
14 Ga0065704_10001276 3300005289 Bacteria 8813
15 Ga0065704_10093146 3300005289 Bacteria 2601
16 Ga0065712_10000135 3300005290 Bacteria 66145
17 Ga0065712_10004694 3300005290 Bacteria 4792
18 Ga0065712_10115832 3300005290 Unclassified 1745
19 Ga0065712_10198370 3300005290 Unclassified 1118
20 Ga0065712_10202013 3300005290 Unclassified 1105
21 Ga0065715_10000518 3300005293 Bacteria 21761
22 Ga0065715_10018641 3300005293 Bacteria 2392
23 Ga0065715_10095497 3300005293 Bacteria 4073
24 Ga0065715_10224383 3300005293 Bacteria 1249
25 Ga0065715_10226068 3300005293 Bacteria 1245
26 Ga0065715_10301402 3300005293 Unclassified 1040
27 Ga0065715_10768521 3300005293 Unclassified 623
28 Ga0065707_10004228 3300005295 Bacteria 5872
29 Ga0065707_10109526 3300005295 Bacteria 2466
30 Ga0065707_10145753 3300005295 Bacteria 1716
31 Ga0065707_10186190 3300005295 Bacteria 1387
32 Ga0065707_10216166 3300005295 Bacteria 1244
33 Ga0065707_10253401 3300005295 Bacteria 1118
34 Ga0070683_101486319 3300005329 Unclassified 651
35 Ga0070690_100086887 3300005330 Bacteria 2053
36 Ga0070690_100162010 3300005330 Bacteria 1533
37 Ga0070690_100190557 3300005330 Unclassified 1421
38 Ga0070670_100000073 3300005331 Bacteria 98443
39 Ga0070670_100023928 3300005331 Bacteria 5255
40 Ga0070670_100071727 3300005331 Bacteria 2974
41 Ga0070670_100090104 3300005331 Bacteria 2636
42 Ga0070670_100139848 3300005331 Bacteria 2094
43 Ga0070670_100140563 3300005331 Unclassified 2087
44 Ga0070670_100629051 3300005331 Unclassified 962
45 Ga0070670_100691233 3300005331 Unclassified 917
46 Ga0068869_100575570 3300005334 Unclassified 949
47 Ga0068869_100637198 3300005334 Unclassified 904
48 Ga0068869_101643464 3300005334 Unclassified 573
49 Ga0070666_10076489 3300005335 Bacteria 2284
50 Ga0070666_10908078 3300005335 Unclassified 651
51 Ga0070680_100010009 3300005336 Bacteria 7305
52 Ga0070680_100323922 3300005336 Unclassified 1308
53 Ga0070680_100544429 3300005336 Unclassified 995
54 Ga0070680_100560753 3300005336 Unclassified 979
55 Ga0070682_100020890 3300005337 Bacteria 3859
56 Ga0070682_100090743 3300005337 Bacteria 1999
57 Ga0070682_100578339 3300005337 Bacteria 883
58 Ga0068868_100003205 3300005338 Bacteria 11387
59 Ga0068868_100073287 3300005338 Unclassified 2734
60 Ga0068868_101041328 3300005338 Unclassified 750
61 Ga0068868_101180516 3300005338 Unclassified 707
62 Ga0068868_101320787 3300005338 Unclassified 670
63 Ga0070660_100009748 3300005339 Bacteria 6769
64 Ga0070689_100002495 3300005340 Bacteria 12028
65 Ga0070689_100389217 3300005340 Bacteria 1176
66 Ga0070689_100539628 3300005340 Bacteria 1004
67 Ga0070689_101661283 3300005340 Bacteria 581
68 Ga0070687_100005568 3300005343 Bacteria 5108
69 Ga0070687_100109669 3300005343 Unclassified 1560
70 Ga0070687_100129962 3300005343 Bacteria 1453
71 Ga0070687_101133694 3300005343 Unclassified 574
72 Ga0070661_100007782 3300005344 Bacteria 7395
73 Ga0070661_100414086 3300005344 Unclassified 1067
74 Ga0070692_10010809 3300005345 Bacteria 4172
75 Ga0070692_10047386 3300005345 Bacteria 2224
76 Ga0070692_10889857 3300005345 Unclassified 615
77 Ga0070668_100033595 3300005347 Bacteria 3907
78 Ga0070668_100191704 3300005347 Unclassified 1674
79 Ga0070669_100051938 3300005353 Bacteria 2997
80 Ga0070669_100060441 3300005353 Bacteria 2783
81 Ga0070669_100110428 3300005353 Unclassified 2086
82 Ga0070675_100005020 3300005354 Bacteria 10104
83 Ga0070675_100160397 3300005354 Bacteria 1933
84 Ga0070675_100296737 3300005354 Bacteria 1423
85 Ga0070671_100016102 3300005355 Bacteria 6045
86 Ga0070671_100193278 3300005355 Unclassified 1725
87 Ga0070671_100754616 3300005355 Bacteria 846
88 Ga0070674_100392644 3300005356 Unclassified 1132
89 Ga0070674_100486285 3300005356 Unclassified 1025
90 Ga0070673_100011196 3300005364 Bacteria 6116
91 Ga0070673_100082774 3300005364 Bacteria 2605
92 Ga0070673_100151043 3300005364 Bacteria 1967
93 Ga0070673_100278136 3300005364 Unclassified 1467
94 Ga0070673_100521158 3300005364 Bacteria 1077
95 Ga0070673_100717608 3300005364 Unclassified 919
96 Ga0070688_100095477 3300005365 Bacteria 1951
97 Ga0070688_100481383 3300005365 Bacteria 933
98 Ga0070688_100619932 3300005365 Unclassified 830
99 Ga0070659_100006362 3300005366 Bacteria 8529
100 Ga0070659_100028181 3300005366 Bacteria 4335
101 Ga0070659_100999367 3300005366 Unclassified 734
102 Ga0070667_100040149 3300005367 Bacteria 3924
103 Ga0070667_100144424 3300005367 Bacteria 2086
104 Ga0070703_10003811 3300005406 Bacteria 4267
105 Ga0070701_10021145 3300005438 Unclassified 3101
106 Ga0070701_10135429 3300005438 Bacteria 1403
107 Ga0070701_10874208 3300005438 Bacteria 619
108 Ga0070705_100027760 3300005440 Bacteria 3093
109 Ga0070705_100029045 3300005440 Bacteria 3036
110 Ga0070705_100033473 3300005440 Bacteria 2865
111 Ga0070705_100183086 3300005440 Bacteria 1421
112 Ga0070705_100383366 3300005440 Bacteria 1035
113 Ga0070705_101260757 3300005440 Unclassified 611
114 Ga0070700_100000036 3300005441 Bacteria 111099
115 Ga0070700_100022252 3300005441 Bacteria 3694
116 Ga0070700_100024136 3300005441 Bacteria 3566
117 Ga0070700_100090395 3300005441 Bacteria 1997
118 Ga0070700_100165686 3300005441 Bacteria 1526
119 Ga0070700_100169080 3300005441 Bacteria 1512
120 Ga0070700_100169455 3300005441 Bacteria 1511
121 Ga0070700_100764474 3300005441 Bacteria 774
122 Ga0070694_100012909 3300005444 Bacteria 5209
123 Ga0070694_100020194 3300005444 Unclassified 4246
124 Ga0070694_100021886 3300005444 Bacteria 4091
125 Ga0070694_100037254 3300005444 Bacteria 3225
126 Ga0070694_100056887 3300005444 Bacteria 2658
127 Ga0070694_100058711 3300005444 Unclassified 2618
128 Ga0070694_100061940 3300005444 Bacteria 2555
129 Ga0070694_100102226 3300005444 Bacteria 2029
130 Ga0070694_100122869 3300005444 Bacteria 1865
131 Ga0070694_100147135 3300005444 Unclassified 1717
132 Ga0070694_100198773 3300005444 Bacteria 1493
133 Ga0070694_100852355 3300005444 Unclassified 750
134 Ga0070694_100856652 3300005444 Unclassified 748
135 Ga0070708_100000754 3300005445 Bacteria 24432
136 Ga0070708_100568345 3300005445 Unclassified 1069
137 Ga0070678_100529771 3300005456 Unclassified 1043
138 Ga0070662_100055184 3300005457 Bacteria 2882
139 Ga0070662_100073820 3300005457 Unclassified 2521
140 Ga0070662_100295688 3300005457 Unclassified 1314
141 Ga0070681_10004646 3300005458 Bacteria 13115
142 Ga0070681_10023868 3300005458 Bacteria 6157
143 Ga0070681_10045973 3300005458 Unclassified 4366
144 Ga0068867_100112707 3300005459 Bacteria 2091
145 Ga0068867_100257141 3300005459 Unclassified 1422
146 Ga0068867_100264883 3300005459 Unclassified 1403
147 Ga0068867_100425844 3300005459 Bacteria 1125
148 Ga0068867_100653003 3300005459 Unclassified 923
149 Ga0068867_100931404 3300005459 Unclassified 784
150 Ga0070685_10098747 3300005466 Bacteria 1779
151 Ga0070685_10130436 3300005466 Bacteria 1571
152 Ga0070706_100000015 3300005467 Bacteria 188425
153 Ga0070706_100028134 3300005467 Bacteria 5173
154 Ga0070706_100332487 3300005467 Bacteria 1417
155 Ga0070706_100515067 3300005467 Unclassified 1113
156 Ga0070707_100255809 3300005468 Bacteria 1704
157 Ga0070707_100257648 3300005468 Unclassified 1697
158 Ga0070707_100724730 3300005468 Bacteria 957
159 Ga0070698_100007009 3300005471 Bacteria 12208
160 Ga0070698_100008421 3300005471 Bacteria 11147
161 Ga0070698_100028005 3300005471 Bacteria 5856
162 Ga0070698_100181594 3300005471 Bacteria 2042
163 Ga0070699_100006181 3300005518 Bacteria 10463
164 Ga0070699_100031705 3300005518 Bacteria 4563
165 Ga0070699_100239523 3300005518 Bacteria 1619
166 Ga0070699_100257822 3300005518 Bacteria 1559
167 Ga0070699_100484971 3300005518 Bacteria 1122
168 Ga0070699_100711902 3300005518 Bacteria 917
169 Ga0070699_100741382 3300005518 Bacteria 898
170 Ga0070679_100036868 3300005530 Bacteria 4854
171 Ga0070679_100110587 3300005530 Bacteria 2734
172 Ga0070697_100007769 3300005536 Bacteria 8351
173 Ga0070697_100057188 3300005536 Bacteria 3174
174 Ga0070697_100148942 3300005536 Bacteria 1972
175 Ga0070697_100269151 3300005536 Unclassified 1460
176 Ga0070697_100836497 3300005536 Unclassified 815
177 Ga0068853_100004345 3300005539 Bacteria 10966
178 Ga0068853_100015636 3300005539 Bacteria 6233
179 Ga0068853_100607973 3300005539 Unclassified 1038
180 Ga0070672_100010581 3300005543 Bacteria 6403
181 Ga0070672_100193118 3300005543 Bacteria 1701
182 Ga0070686_100038592 3300005544 Bacteria 2970
183 Ga0070695_100020513 3300005545 Bacteria 4035
184 Ga0070695_100024122 3300005545 Bacteria 3745
185 Ga0070695_100050997 3300005545 Bacteria 2654
186 Ga0070695_100138975 3300005545 Bacteria 1682
187 Ga0070695_100154880 3300005545 Bacteria 1603
188 Ga0070695_100175716 3300005545 Bacteria 1514
189 Ga0070695_100479223 3300005545 Unclassified 959
190 Ga0070695_100806617 3300005545 Unclassified 752
191 Ga0070695_101441891 3300005545 Unclassified 572
192 Ga0070696_100031402 3300005546 Bacteria 3640
193 Ga0070696_100058455 3300005546 Bacteria 2693
194 Ga0070696_100059835 3300005546 Unclassified 2663
195 Ga0070696_100309618 3300005546 Unclassified 1212
196 Ga0070696_100339030 3300005546 Unclassified 1161
197 Ga0070696_100400255 3300005546 Unclassified 1074
198 Ga0070696_100535977 3300005546 Bacteria 936
199 Ga0070696_100698140 3300005546 Bacteria 827
200 Ga0070693_100000775 3300005547 Bacteria 14086
201 Ga0070693_100011909 3300005547 Bacteria 4389
202 Ga0070693_100015356 3300005547 Unclassified 3941
203 Ga0070693_100016559 3300005547 Bacteria 3818
204 Ga0070693_100061355 3300005547 Unclassified 2185
205 Ga0070693_100178780 3300005547 Bacteria 1365
206 Ga0070693_101021390 3300005547 Bacteria 627
207 Ga0070665_100158496 3300005548 Bacteria 2265
208 Ga0070704_100091555 3300005549 Bacteria 2268
209 Ga0070704_100104193 3300005549 Bacteria 2144
210 Ga0070704_100133812 3300005549 Bacteria 1926
211 Ga0070704_100217426 3300005549 Unclassified 1552
212 Ga0070704_100282971 3300005549 Bacteria 1375
213 Ga0070704_100467630 3300005549 Bacteria 1089
214 Ga0070704_100535327 3300005549 Unclassified 1022
215 Ga0070704_100739543 3300005549 Bacteria 875
216 Ga0068855_100137573 3300005563 Bacteria 2786
217 Ga0068855_100609218 3300005563 Bacteria 1177
218 Ga0070664_100002580 3300005564 Bacteria 14610
219 Ga0070664_100267875 3300005564 Bacteria 1538
220 Ga0070664_100452627 3300005564 Bacteria 1179
221 Ga0070664_100596456 3300005564 Bacteria 1024
222 Ga0070664_100843478 3300005564 Unclassified 858
223 Ga0070664_100928563 3300005564 Unclassified 816
224 Ga0068857_100002670 3300005577 Bacteria 14644
225 Ga0068857_100046286 3300005577 Bacteria 3861
226 Ga0068857_100127827 3300005577 Bacteria 2290
227 Ga0068857_100140490 3300005577 Bacteria 2183
228 Ga0068857_100204067 3300005577 Bacteria 1802
229 Ga0068857_100816659 3300005577 Bacteria 891
230 Ga0068857_100829651 3300005577 Unclassified 884
231 Ga0068857_100874264 3300005577 Unclassified 861
232 Ga0068854_100056797 3300005578 Unclassified 2822
233 Ga0068854_100120815 3300005578 Bacteria 1989
234 Ga0068854_100229047 3300005578 Unclassified 1474
235 Ga0068854_100309478 3300005578 Unclassified 1281
236 Ga0068854_100336401 3300005578 Unclassified 1232
237 Ga0068854_100902874 3300005578 Bacteria 777
238 Ga0068854_101097304 3300005578 Unclassified 709
239 Ga0068856_100005300 3300005614 Bacteria 12724
240 Ga0070702_100003492 3300005615 Bacteria 7036
241 Ga0070702_100079893 3300005615 Bacteria 1956
242 Ga0070702_100115532 3300005615 Bacteria 1672
243 Ga0070702_100301659 3300005615 Unclassified 1108
244 Ga0070702_100451768 3300005615 Bacteria 932
245 Ga0070702_100462172 3300005615 Unclassified 923
246 Ga0070702_101057559 3300005615 Unclassified 646
247 Ga0068852_100236357 3300005616 Unclassified 1744
248 Ga0068852_100350256 3300005616 Bacteria 1442
249 Ga0068852_100369808 3300005616 Unclassified 1404
250 Ga0068852_100429403 3300005616 Bacteria 1304
251 Ga0068852_100713297 3300005616 Bacteria 1014
252 Ga0068852_101105028 3300005616 Bacteria 813
253 Ga0068859_100007922 3300005617 Bacteria 10774
254 Ga0068859_100013228 3300005617 Bacteria 8279
255 Ga0068859_100036108 3300005617 Unclassified 4960
256 Ga0068859_100043033 3300005617 Bacteria 4538
257 Ga0068859_100086985 3300005617 Bacteria 3172
258 Ga0068859_100131954 3300005617 Bacteria 2570
259 Ga0068859_100193692 3300005617 Bacteria 2117
260 Ga0068859_100405841 3300005617 Unclassified 1459
261 Ga0068859_101222223 3300005617 Unclassified 828
262 Ga0068859_101388807 3300005617 Bacteria 774
263 Ga0068859_101392126 3300005617 Unclassified 773
264 Ga0068859_101402539 3300005617 Bacteria 770
265 Ga0068859_101454652 3300005617 Unclassified 756
266 Ga0068859_102095814 3300005617 Unclassified 624
267 Ga0068864_100001219 3300005618 Bacteria 21368
268 Ga0068864_100018626 3300005618 Bacteria 5802
269 Ga0068864_100025577 3300005618 Bacteria 4973
270 Ga0068864_100190372 3300005618 Bacteria 1880
271 Ga0068864_100192015 3300005618 Bacteria 1873
272 Ga0068864_100229083 3300005618 Bacteria 1718
273 Ga0068864_100231901 3300005618 Unclassified 1708
274 Ga0068864_100260504 3300005618 Bacteria 1613
275 Ga0068864_100269194 3300005618 Bacteria 1587
276 Ga0068864_100282780 3300005618 Bacteria 1549
277 Ga0068864_100310682 3300005618 Bacteria 1478
278 Ga0068864_100531623 3300005618 Bacteria 1135
279 Ga0068864_100652749 3300005618 Unclassified 1025
280 Ga0068864_102034065 3300005618 Unclassified 581
281 Ga0068866_10005031 3300005718 Bacteria 5442
282 Ga0068861_100008097 3300005719 Bacteria 7232
283 Ga0068861_100022748 3300005719 Bacteria 4520
284 Ga0068861_100028715 3300005719 Unclassified 4061
285 Ga0068861_100062703 3300005719 Unclassified 2856
286 Ga0068861_100249023 3300005719 Bacteria 1515
287 Ga0068861_100504958 3300005719 Unclassified 1094
288 Ga0068861_101759260 3300005719 Unclassified 614
289 Ga0068851_10013712 3300005834 Bacteria 3837
290 Ga0068870_10028203 3300005840 Bacteria 2817
291 Ga0068870_10156000 3300005840 Bacteria 1349
292 Ga0068870_10229281 3300005840 Unclassified 1141
293 Ga0068870_10742931 3300005840 Bacteria 681
294 Ga0068863_100146705 3300005841 Unclassified 2257
295 Ga0068863_100190549 3300005841 Unclassified 1970
296 Ga0068863_100241479 3300005841 Unclassified 1743
297 Ga0068863_100580132 3300005841 Bacteria 1109
298 Ga0068858_100058113 3300005842 Bacteria 3576
299 Ga0068858_100069609 3300005842 Bacteria 3262
300 Ga0068858_100117601 3300005842 Bacteria 2485
301 Ga0068858_100139032 3300005842 Bacteria 2280
302 Ga0068858_100167819 3300005842 Bacteria 2069
303 Ga0068858_100206124 3300005842 Bacteria 1860
304 Ga0068858_100239355 3300005842 Unclassified 1722
305 Ga0068858_100270339 3300005842 Bacteria 1617
306 Ga0068858_100326388 3300005842 Unclassified 1467
307 Ga0068858_100476366 3300005842 Bacteria 1204
308 Ga0068858_102363058 3300005842 Unclassified 525
309 Ga0068860_100078315 3300005843 Bacteria 3143
310 Ga0068860_100213204 3300005843 Bacteria 1873
311 Ga0068860_100289930 3300005843 Bacteria 1601
312 Ga0068860_100347761 3300005843 Bacteria 1458
313 Ga0068860_100585163 3300005843 Bacteria 1121
314 Ga0068860_100833533 3300005843 Bacteria 936
315 Ga0068860_100936601 3300005843 Unclassified 883
316 Ga0068860_101267648 3300005843 Unclassified 758
317 Ga0068862_100018132 3300005844 Bacteria 5861
318 Ga0068862_100029245 3300005844 Unclassified 4642
319 Ga0068862_100095055 3300005844 Bacteria 2599
320 Ga0068862_100239530 3300005844 Bacteria 1649
321 Ga0068862_100429975 3300005844 Bacteria 1241
322 Ga0068862_100467340 3300005844 Bacteria 1192
323 Ga0068862_101175652 3300005844 Unclassified 765
324 Ga0068862_101198384 3300005844 Bacteria 758
325 Ga0081539_10000487 3300005985 Bacteria 83994
326 Ga0081539_10003495 3300005985 Bacteria 19198
327 Ga0075432_10043540 3300006058 Unclassified 1573
328 Ga0070716_100229478 3300006173 Unclassified 1252
329 Ga0070716_100366417 3300006173 Unclassified 1025
330 Ga0097621_100001343 3300006237 Bacteria 16907
331 Ga0097621_100019601 3300006237 Bacteria 5196
332 Ga0097621_100031588 3300006237 Bacteria 4203
333 Ga0097621_100438482 3300006237 Bacteria 1175
334 Ga0068871_100007860 3300006358 Bacteria 7641
335 Ga0068871_100043720 3300006358 Bacteria 3599
336 Ga0068871_100047482 3300006358 Unclassified 3463
337 Ga0068871_100127451 3300006358 Bacteria 2156
338 Ga0068871_100468125 3300006358 Unclassified 1132
339 Ga0075428_100081296 3300006844 Bacteria 3536
340 Ga0075428_100083970 3300006844 Bacteria 3474
341 Ga0075428_100911329 3300006844 Unclassified 932
342 Ga0075430_100458873 3300006846 Unclassified 1051
343 Ga0075431_100073125 3300006847 Unclassified 3537
344 Ga0075431_100188611 3300006847 Bacteria 2113
345 Ga0075431_100790428 3300006847 Unclassified 923
346 Ga0075433_10006875 3300006852 Bacteria 9016
347 Ga0075433_10013861 3300006852 Bacteria 6572
348 Ga0075433_10031197 3300006852 Unclassified 4554
349 Ga0075433_10050622 3300006852 Bacteria 3616
350 Ga0075433_10153666 3300006852 Bacteria 2047
351 Ga0075433_10180526 3300006852 Bacteria 1878
352 Ga0075433_10194957 3300006852 Unclassified 1802
353 Ga0075433_10220696 3300006852 Bacteria 1684
354 Ga0075433_10730423 3300006852 Bacteria 867
355 Ga0075434_100043034 3300006871 Unclassified 4478
356 Ga0075434_100049269 3300006871 Bacteria 4182
357 Ga0075434_100348874 3300006871 Bacteria 1501
358 Ga0075434_100539747 3300006871 Bacteria 1186
359 Ga0075434_100593309 3300006871 Unclassified 1127
360 Ga0075434_101473349 3300006871 Unclassified 690
361 Ga0075429_100015591 3300006880 Bacteria 6587
362 Ga0075429_100106679 3300006880 Bacteria 2447
363 Ga0075429_100121025 3300006880 Bacteria 2288
364 Ga0075429_100144798 3300006880 Unclassified 2080
365 Ga0068865_100160008 3300006881 Unclassified 1717
366 Ga0068865_100329059 3300006881 Bacteria 1231
367 Ga0068865_100477519 3300006881 Bacteria 1035
368 Ga0075436_100023126 3300006914 Bacteria 4269
369 Ga0097620_100007923 3300006931 Bacteria 10774
370 Ga0097620_100013228 3300006931 Bacteria 8279
371 Ga0097620_100036109 3300006931 Unclassified 4960
372 Ga0097620_100043031 3300006931 Bacteria 4538
373 Ga0097620_100086983 3300006931 Bacteria 3172
374 Ga0097620_100131950 3300006931 Bacteria 2570
375 Ga0097620_100193666 3300006931 Bacteria 2117
376 Ga0097620_100405880 3300006931 Unclassified 1459
377 Ga0097620_101222255 3300006931 Unclassified 828
378 Ga0097620_101388775 3300006931 Bacteria 774
379 Ga0097620_101392138 3300006931 Unclassified 773
380 Ga0097620_101402532 3300006931 Bacteria 770
381 Ga0097620_101454374 3300006931 Unclassified 756
382 Ga0097620_102095773 3300006931 Unclassified 624
383 Ga0075435_100006392 3300007076 Bacteria 8330
384 Ga0075435_100590130 3300007076 Unclassified 963
385 Ga0099794_10566226 3300007265 Unclassified 600
386 Ga0105251_10129543 3300009011 Unclassified 1144
387 Ga0105251_10265475 3300009011 Bacteria 775
388 Ga0105240_10134905 3300009093 Viruses 2957
389 Ga0111539_10079327 3300009094 Bacteria 3862
390 Ga0111539_10154246 3300009094 Bacteria 2688
391 Ga0111539_10159347 3300009094 Bacteria 2640
392 Ga0105245_10249548 3300009098 Bacteria 1723
393 Ga0105245_10528738 3300009098 Unclassified 1199
394 Ga0105245_10602225 3300009098 Bacteria 1125
395 Ga0105245_10685058 3300009098 Bacteria 1057
396 Ga0105245_10768395 3300009098 Bacteria 1000
397 Ga0105245_10812780 3300009098 Unclassified 973
398 Ga0105247_10037314 3300009101 Bacteria 2965
399 Ga0105247_10056096 3300009101 Unclassified 2432
400 Ga0105247_10062815 3300009101 Unclassified 2304
401 Ga0105247_10079635 3300009101 Bacteria 2062
402 Ga0105247_10523647 3300009101 Bacteria 867
403 Ga0105247_11149579 3300009101 Unclassified 615
404 Ga0114129_10004897 3300009147 Bacteria 18898
405 Ga0114129_10108771 3300009147 Bacteria 3827
406 Ga0114129_10109956 3300009147 Bacteria 3804
407 Ga0114129_10227794 3300009147 Bacteria 2511
408 Ga0114129_10253051 3300009147 Bacteria 2364
409 Ga0114129_10268134 3300009147 Bacteria 2285
410 Ga0114129_11286659 3300009147 Bacteria 907
411 Ga0114129_11397339 3300009147 Bacteria 864
412 Ga0114129_12078280 3300009147 Unclassified 686
413 Ga0105243_10001952 3300009148 Bacteria 17560
414 Ga0105243_10011066 3300009148 Viruses 6825
415 Ga0105243_10133105 3300009148 Unclassified 2112
416 Ga0105243_10236103 3300009148 Bacteria 1624
417 Ga0105243_10309892 3300009148 Bacteria 1434
418 Ga0105243_10580888 3300009148 Bacteria 1076
419 Ga0105241_10019131 3300009174 Bacteria 5050
420 Ga0105241_10020033 3300009174 Bacteria 4940
421 Ga0105241_10056913 3300009174 Bacteria 2998
422 Ga0105241_10101685 3300009174 Unclassified 2286
423 Ga0105241_10279458 3300009174 Unclassified 1425
424 Ga0105241_10344228 3300009174 Bacteria 1293
425 Ga0105241_10384564 3300009174 Unclassified 1227
426 Ga0105241_10527537 3300009174 Bacteria 1057
427 Ga0105241_10613536 3300009174 Unclassified 984
428 Ga0105241_10641696 3300009174 Unclassified 963
429 Ga0105241_10896005 3300009174 Unclassified 823
430 Ga0105241_10916105 3300009174 Bacteria 815
431 Ga0105241_11135029 3300009174 Unclassified 737
432 Ga0105241_11538070 3300009174 Unclassified 641
433 Ga0105242_10132200 3300009176 Bacteria 2155
434 Ga0105242_10150841 3300009176 Unclassified 2026
435 Ga0105242_10204557 3300009176 Unclassified 1755
436 Ga0105242_10265263 3300009176 Viruses 1553
437 Ga0105242_10793254 3300009176 Bacteria 937
438 Ga0105242_11249826 3300009176 Bacteria 764
439 Ga0105248_10005050 3300009177 Bacteria 14571
440 Ga0105248_10007877 3300009177 Bacteria 11702
441 Ga0105248_10092690 3300009177 Unclassified 3402
442 Ga0105248_10111760 3300009177 Unclassified 3081
443 Ga0105248_10119835 3300009177 Unclassified 2968
444 Ga0105248_10182462 3300009177 Bacteria 2365
445 Ga0105248_10258325 3300009177 Bacteria 1961
446 Ga0105248_10610498 3300009177 Bacteria 1231
447 Ga0105248_10649135 3300009177 Bacteria 1191
448 Ga0105248_11028285 3300009177 Bacteria 931
449 Ga0105248_11031255 3300009177 Bacteria 929
450 Ga0105248_11113475 3300009177 Unclassified 892
451 Ga0105248_11380131 3300009177 Unclassified 797
452 Ga0105248_11767455 3300009177 Bacteria 701
453 Ga0105237_10001132 3300009545 Bacteria 35782
454 Ga0105237_10042047 3300009545 Bacteria 4609
455 Ga0105237_10080027 3300009545 Bacteria 3258
456 Ga0105237_11488175 3300009545 Bacteria 684
457 Ga0105238_10002642 3300009551 Bacteria 17857
458 Ga0105238_10006395 3300009551 Bacteria 11722
459 Ga0105249_10000029 3300009553 Bacteria 227479
460 Ga0105249_10011040 3300009553 Bacteria 7936
461 Ga0105249_10044992 3300009553 Bacteria 4014
462 Ga0105249_10075873 3300009553 Bacteria 3114
463 Ga0105249_10174903 3300009553 Bacteria 2084
464 Ga0105249_10221788 3300009553 Unclassified 1861
465 Ga0105249_10502725 3300009553 Unclassified 1257
466 Ga0105249_10558796 3300009553 Bacteria 1196
467 Ga0105249_11759623 3300009553 Unclassified 692
468 Ga0099796_10062247 3300010159 Unclassified 1326
469 Ga0105239_10101185 3300010375 Bacteria 3188
470 Ga0105239_10145157 3300010375 Unclassified 2646
471 Ga0105239_10580804 3300010375 Bacteria 1277
472 Ga0105239_10801409 3300010375 Bacteria 1079
473 Ga0105246_10105079 3300011119 Bacteria 2063
474 Ga0105246_10153661 3300011119 Bacteria 1745
475 Ga0105246_10242148 3300011119 Unclassified 1426
476 Ga0105246_10361028 3300011119 Unclassified 1194
477 Ga0105246_10400032 3300011119 Bacteria 1140
478 Ga0105246_10885543 3300011119 Bacteria 799
479 Ga0105246_11028925 3300011119 Unclassified 747
480 Ga0105246_11777870 3300011119 Bacteria 588
481 Ga0157373_10006338 3300013100 Bacteria 8839
482 Ga0157373_10009488 3300013100 Bacteria 7189
483 Ga0157373_10017090 3300013100 Bacteria 5283
484 Ga0157373_10095244 3300013100 Unclassified 2095
485 Ga0157373_10698240 3300013100 Unclassified 743
486 Ga0157373_10772813 3300013100 Unclassified 707
487 Ga0157373_10957197 3300013100 Unclassified 637
488 Ga0157371_10158534 3300013102 Bacteria 1616
489 Ga0157371_10825009 3300013102 Bacteria 700
490 Ga0157374_10022626 3300013296 Bacteria 5608
491 Ga0157374_10032330 3300013296 Unclassified 4762
492 Ga0157374_11721782 3300013296 Unclassified 652
493 Ga0157374_12018549 3300013296 Unclassified 603
494 Ga0157374_12177566 3300013296 Unclassified 581
495 Ga0157378_10010378 3300013297 Bacteria 8131
496 Ga0157378_10015544 3300013297 Bacteria 6666
497 Ga0157378_10025558 3300013297 Bacteria 5200
498 Ga0157378_10053702 3300013297 Bacteria 3588
499 Ga0157378_10179805 3300013297 Bacteria 1989
500 Ga0157378_10512108 3300013297 Bacteria 1200
501 Ga0157378_10649952 3300013297 Unclassified 1070
502 Ga0157378_11082420 3300013297 Unclassified 838
503 Ga0163162_10000009 3300013306 Bacteria 316099
504 Ga0163162_10008612 3300013306 Bacteria 9941
505 Ga0163162_10010879 3300013306 Bacteria 8856
506 Ga0163162_10041507 3300013306 Bacteria 4604
507 Ga0163162_10053986 3300013306 Bacteria 4040
508 Ga0163162_10508634 3300013306 Unclassified 1335
509 Ga0163162_10662578 3300013306 Bacteria 1167
510 Ga0163162_10672833 3300013306 Bacteria 1158
511 Ga0163162_10684081 3300013306 Bacteria 1148
512 Ga0163162_10781228 3300013306 Bacteria 1073
513 Ga0157372_10033659 3300013307 Bacteria 5631
514 Ga0157372_10420145 3300013307 Unclassified 1558
515 Ga0157372_10471524 3300013307 Bacteria 1463
516 Ga0157372_10565087 3300013307 Unclassified 1326
517 Ga0157372_11281273 3300013307 Bacteria 846
518 Ga0157372_12362863 3300013307 Bacteria 610
519 Ga0157375_10009777 3300013308 Bacteria 8431
520 Ga0157375_10018218 3300013308 Bacteria 6364
521 Ga0157375_10128892 3300013308 Bacteria 2648
522 Ga0157375_10226322 3300013308 Bacteria 2029
523 Ga0157375_10284166 3300013308 Unclassified 1818
524 Ga0157375_10382809 3300013308 Bacteria 1573
525 Ga0157375_10413504 3300013308 Unclassified 1515
526 Ga0157375_10454290 3300013308 Unclassified 1447
527 Ga0157375_10788697 3300013308 Unclassified 1099
528 Ga0157375_10859873 3300013308 Bacteria 1053
529 Ga0157375_10899652 3300013308 Bacteria 1029
530 Ga0157375_11375474 3300013308 Unclassified 831
531 Ga0163163_10000466 3300014325 Bacteria 36943
532 Ga0163163_10002054 3300014325 Bacteria 16994
533 Ga0163163_10002763 3300014325 Bacteria 14814
534 Ga0163163_10027595 3300014325 Bacteria 5441
535 Ga0163163_10029203 3300014325 Bacteria 5303
536 Ga0163163_10072427 3300014325 Bacteria 3435
537 Ga0163163_10188652 3300014325 Bacteria 2110
538 Ga0163163_10246532 3300014325 Unclassified 1836
539 Ga0163163_10594073 3300014325 Bacteria 1170
540 Ga0163163_10666976 3300014325 Unclassified 1103
541 Ga0163163_10846928 3300014325 Bacteria 978
542 Ga0163163_11525040 3300014325 Bacteria 730
543 Ga0157380_10000188 3300014326 Bacteria 35876
544 Ga0157380_10007110 3300014326 Bacteria 7929
545 Ga0157380_10012447 3300014326 Bacteria 6172
546 Ga0157380_10034924 3300014326 Bacteria 3880
547 Ga0157380_10134421 3300014326 Bacteria 2115
548 Ga0157380_10151479 3300014326 Bacteria 2005
549 Ga0157380_10254915 3300014326 Bacteria 1590
550 Ga0157380_10256447 3300014326 Unclassified 1586
551 Ga0157377_10016406 3300014745 Bacteria 3810
552 Ga0157377_10017921 3300014745 Bacteria 3673
553 Ga0157377_10139754 3300014745 Bacteria 1487
554 Ga0157377_10214093 3300014745 Bacteria 1230
555 Ga0157379_10058845 3300014968 Bacteria 3436
556 Ga0157379_10099538 3300014968 Unclassified 2610
557 Ga0157379_10682695 3300014968 Bacteria 963
558 Ga0157379_10822662 3300014968 Unclassified 878
559 Ga0157376_10055570 3300014969 Unclassified 3304
560 Ga0182007_10135814 3300015262 Bacteria 830
561 Ga0163161_10006702 3300017792 Bacteria 7968
562 Ga0163161_10149121 3300017792 Unclassified 1776
563 Ga0163161_10609462 3300017792 Bacteria 901
564 Ga0207697_10071051 3300025315 Bacteria 1458
565 Ga0207656_10011668 3300025321 Bacteria 3324
566 Ga0207653_10022098 3300025885 Bacteria 2020
567 Ga0207642_10009682 3300025899 Bacteria 3362
568 Ga0207642_10365506 3300025899 Unclassified 855
569 Ga0207642_10956786 3300025899 Unclassified 550
570 Ga0207710_10000389 3300025900 Bacteria 29876
571 Ga0207710_10237708 3300025900 Bacteria 908
572 Ga0207680_10029178 3300025903 Bacteria 3096
573 Ga0207680_10660760 3300025903 Unclassified 748
574 Ga0207680_10735240 3300025903 Unclassified 707
575 Ga0207647_10003482 3300025904 Bacteria 11800
576 Ga0207647_10232088 3300025904 Bacteria 1061
577 Ga0207647_10340864 3300025904 Unclassified 849
578 Ga0207645_10135104 3300025907 Bacteria 1606
579 Ga0207643_10020307 3300025908 Bacteria 3645
580 Ga0207643_10045238 3300025908 Bacteria 2486
581 Ga0207643_10058845 3300025908 Bacteria 2191
582 Ga0207643_10397431 3300025908 Unclassified 871
583 Ga0207684_10000083 3300025910 Bacteria 176092
584 Ga0207684_10082433 3300025910 Archaea 2739
585 Ga0207684_10372382 3300025910 Unclassified 1229
586 Ga0207684_10644840 3300025910 Unclassified 903
587 Ga0207654_10062482 3300025911 Bacteria 2182
588 Ga0207654_10071422 3300025911 Bacteria 2064
589 Ga0207654_10105851 3300025911 Bacteria 1741
590 Ga0207654_10144790 3300025911 Unclassified 1519
591 Ga0207654_10313119 3300025911 Unclassified 1071
592 Ga0207654_10553544 3300025911 Unclassified 817
593 Ga0207654_10741262 3300025911 Bacteria 707
594 Ga0207707_10015795 3300025912 Bacteria 6582
595 Ga0207707_10068064 3300025912 Bacteria 3102
596 Ga0207707_10140489 3300025912 Bacteria 2112
597 Ga0207695_10071094 3300025913 Bacteria 3554
598 Ga0207671_10015690 3300025914 Bacteria 5922
599 Ga0207671_10039720 3300025914 Bacteria 3484
600 Ga0207671_10418663 3300025914 Bacteria 1066
601 Ga0207660_10011883 3300025917 Bacteria 5679
602 Ga0207660_10069429 3300025917 Unclassified 2559
603 Ga0207660_10638869 3300025917 Unclassified 867
604 Ga0207660_10651062 3300025917 Unclassified 859
605 Ga0207662_10031125 3300025918 Bacteria 3100
606 Ga0207662_10063770 3300025918 Unclassified 2216
607 Ga0207662_10149304 3300025918 Bacteria 1485
608 Ga0207662_10152938 3300025918 Unclassified 1469
609 Ga0207657_10021188 3300025919 Bacteria 6123
610 Ga0207652_10052074 3300025921 Bacteria 3512
611 Ga0207646_10023701 3300025922 Bacteria 5634
612 Ga0207646_10534260 3300025922 Bacteria 1055
613 Ga0207681_10014169 3300025923 Unclassified 4948
614 Ga0207681_10031671 3300025923 Bacteria 3456
615 Ga0207681_10186601 3300025923 Unclassified 1583
616 Ga0207681_10957839 3300025923 Unclassified 717
617 Ga0207694_10003054 3300025924 Bacteria 13422
618 Ga0207694_10023376 3300025924 Bacteria 4691
619 Ga0207650_10000006 3300025925 Bacteria 544730
620 Ga0207650_10047907 3300025925 Bacteria 3151
621 Ga0207650_10088478 3300025925 Unclassified 2362
622 Ga0207650_10217418 3300025925 Bacteria 1537
623 Ga0207650_10498990 3300025925 Bacteria 1017
624 Ga0207659_10332538 3300025926 Unclassified 1256
625 Ga0207659_10334316 3300025926 Bacteria 1253
626 Ga0207687_10032505 3300025927 Unclassified 3534
627 Ga0207687_10452239 3300025927 Unclassified 1065
628 Ga0207644_10139909 3300025931 Unclassified 1863
629 Ga0207644_10254492 3300025931 Bacteria 1402
630 Ga0207644_10472962 3300025931 Unclassified 1031
631 Ga0207690_10004343 3300025932 Bacteria 8374
632 Ga0207690_10011300 3300025932 Bacteria 5335
633 Ga0207690_11034294 3300025932 Unclassified 684
634 Ga0207706_10039447 3300025933 Bacteria 4187
635 Ga0207706_10178680 3300025933 Bacteria 1864
636 Ga0207706_10565916 3300025933 Bacteria 978
637 Ga0207686_10069102 3300025934 Bacteria 2265
638 Ga0207686_10230588 3300025934 Bacteria 1342
639 Ga0207686_10627922 3300025934 Bacteria 848
640 Ga0207686_10866607 3300025934 Unclassified 727
641 Ga0207709_10008229 3300025935 Bacteria 5777
642 Ga0207709_10082783 3300025935 Bacteria 2073
643 Ga0207709_10084431 3300025935 Bacteria 2056
644 Ga0207709_10276703 3300025935 Bacteria 1238
645 Ga0207709_10453616 3300025935 Unclassified 992
646 Ga0207709_10976443 3300025935 Unclassified 691
647 Ga0207670_10000236 3300025936 Bacteria 35069
648 Ga0207670_10228939 3300025936 Unclassified 1426
649 Ga0207670_10566286 3300025936 Bacteria 930
650 Ga0207670_11233894 3300025936 Unclassified 633
651 Ga0207704_10020308 3300025938 Unclassified 3511
652 Ga0207704_10106621 3300025938 Bacteria 1883
653 Ga0207704_11362981 3300025938 Unclassified 607
654 Ga0207665_10409240 3300025939 Unclassified 1034
655 Ga0207665_10470168 3300025939 Unclassified 967
656 Ga0207691_10008611 3300025940 Bacteria 9789
657 Ga0207691_10200594 3300025940 Bacteria 1736
658 Ga0207691_10326090 3300025940 Bacteria 1316
659 Ga0207691_10352049 3300025940 Bacteria 1260
660 Ga0207711_10001380 3300025941 Bacteria 22853
661 Ga0207711_10007092 3300025941 Bacteria 9387
662 Ga0207711_10028460 3300025941 Bacteria 4702
663 Ga0207711_10126284 3300025941 Bacteria 2288
664 Ga0207711_10348650 3300025941 Unclassified 1371
665 Ga0207711_11534406 3300025941 Unclassified 609
666 Ga0207689_10002536 3300025942 Bacteria 16961
667 Ga0207689_10054287 3300025942 Bacteria 3300
668 Ga0207689_10091962 3300025942 Bacteria 2492
669 Ga0207689_10110088 3300025942 Bacteria 2263
670 Ga0207689_10263012 3300025942 Bacteria 1427
671 Ga0207689_10291320 3300025942 Unclassified 1352
672 Ga0207689_10478842 3300025942 Bacteria 1042
673 Ga0207679_10005396 3300025945 Bacteria 8007
674 Ga0207667_10664522 3300025949 Bacteria 1047
675 Ga0207667_10706308 3300025949 Bacteria 1010
676 Ga0207651_10027295 3300025960 Unclassified 3584
677 Ga0207651_10121347 3300025960 Unclassified 1983
678 Ga0207651_10422784 3300025960 Bacteria 1138
679 Ga0207651_10553878 3300025960 Bacteria 1000
680 Ga0207651_10606725 3300025960 Unclassified 957
681 Ga0207651_11048986 3300025960 Unclassified 730
682 Ga0207651_11075327 3300025960 Unclassified 720
683 Ga0207712_10000366 3300025961 Bacteria 40009
684 Ga0207712_10017290 3300025961 Bacteria 4682
685 Ga0207712_10085159 3300025961 Unclassified 2312
686 Ga0207712_10726315 3300025961 Unclassified 868
687 Ga0207712_11061774 3300025961 Unclassified 720
688 Ga0207712_11365686 3300025961 Unclassified 634
689 Ga0207668_10022918 3300025972 Unclassified 4004
690 Ga0207640_10116792 3300025981 Bacteria 1903
691 Ga0207640_10374069 3300025981 Bacteria 1152
692 Ga0207640_10400251 3300025981 Bacteria 1118
693 Ga0207640_10475619 3300025981 Unclassified 1035
694 Ga0207640_10527606 3300025981 Unclassified 988
695 Ga0207658_10034157 3300025986 Bacteria 3633
696 Ga0207703_10109086 3300026035 Bacteria 2358
697 Ga0207703_10117939 3300026035 Bacteria 2275
698 Ga0207703_10260901 3300026035 Bacteria 1566
699 Ga0207703_10415234 3300026035 Bacteria 1251
700 Ga0207703_10420524 3300026035 Bacteria 1243
701 Ga0207703_10602196 3300026035 Bacteria 1039
702 Ga0207703_11035470 3300026035 Bacteria 788
703 Ga0207703_11393924 3300026035 Unclassified 674
704 Ga0207639_10015732 3300026041 Bacteria 5338
705 Ga0207639_10215500 3300026041 Bacteria 1655
706 Ga0207639_10344909 3300026041 Bacteria 1328
707 Ga0207708_10000016 3300026075 Bacteria 193989
708 Ga0207708_10005449 3300026075 Bacteria 9387
709 Ga0207708_10012864 3300026075 Bacteria 6243
710 Ga0207708_10038646 3300026075 Bacteria 3635
711 Ga0207708_10041802 3300026075 Bacteria 3495
712 Ga0207708_10098792 3300026075 Bacteria 2257
713 Ga0207708_10111097 3300026075 Bacteria 2128
714 Ga0207708_10157002 3300026075 Unclassified 1794
715 Ga0207708_10157968 3300026075 Bacteria 1789
716 Ga0207708_10177232 3300026075 Bacteria 1691
717 Ga0207702_10025855 3300026078 Unclassified 4873
718 Ga0207641_10019825 3300026088 Bacteria 5520
719 Ga0207641_10066218 3300026088 Bacteria 3092
720 Ga0207641_10331451 3300026088 Bacteria 1446
721 Ga0207641_11955997 3300026088 Unclassified 588
722 Ga0207648_10027694 3300026089 Bacteria 5029
723 Ga0207648_10091227 3300026089 Bacteria 2664
724 Ga0207648_10167620 3300026089 Unclassified 1941
725 Ga0207648_10305198 3300026089 Bacteria 1428
726 Ga0207648_10328246 3300026089 Unclassified 1376
727 Ga0207648_10859179 3300026089 Bacteria 846
728 Ga0207648_10864210 3300026089 Bacteria 844
729 Ga0207648_11306774 3300026089 Unclassified 681
730 Ga0207676_10006815 3300026095 Bacteria 8090
731 Ga0207676_10011201 3300026095 Bacteria 6404
732 Ga0207676_10176041 3300026095 Bacteria 1869
733 Ga0207676_10190228 3300026095 Bacteria 1805
734 Ga0207676_10217862 3300026095 Bacteria 1698
735 Ga0207676_10344813 3300026095 Bacteria 1376
736 Ga0207676_10413572 3300026095 Unclassified 1263
737 Ga0207676_10420825 3300026095 Unclassified 1253
738 Ga0207674_10000834 3300026116 Bacteria 40210
739 Ga0207674_10094378 3300026116 Bacteria 2978
740 Ga0207674_10146258 3300026116 Bacteria 2322
741 Ga0207674_10366955 3300026116 Bacteria 1392
742 Ga0207674_10373283 3300026116 Unclassified 1379
743 Ga0207674_10382951 3300026116 Unclassified 1360
744 Ga0207674_10388551 3300026116 Unclassified 1349
745 Ga0207674_10530946 3300026116 Unclassified 1137
746 Ga0207674_10920194 3300026116 Unclassified 843
747 Ga0207674_11364048 3300026116 Bacteria 678
748 Ga0207675_100003117 3300026118 Bacteria 16262
749 Ga0207675_100012658 3300026118 Bacteria 7882
750 Ga0207675_100046683 3300026118 Unclassified 4047
751 Ga0207675_100056048 3300026118 Bacteria 3677
752 Ga0207675_100159458 3300026118 Unclassified 2151
753 Ga0207675_100419899 3300026118 Unclassified 1321
754 Ga0207675_100672714 3300026118 Bacteria 1042
755 Ga0207675_101361439 3300026118 Unclassified 730
756 Ga0207683_10127280 3300026121 Unclassified 2290
757 Ga0207698_10233540 3300026142 Bacteria 1671
758 Ga0207698_10335443 3300026142 Bacteria 1422
759 Ga0207698_11049058 3300026142 Bacteria 827
760 Ga0209967_1033995 3300027364 Bacteria 767
761 Ga0207428_10054685 3300027907 Bacteria 3178
762 Ga0268266_10141588 3300028379 Bacteria 2159
763 Ga0268265_10033069 3300028380 Bacteria 3756
764 Ga0268265_10087594 3300028380 Bacteria 2478
765 Ga0268265_10208743 3300028380 Bacteria 1700
766 Ga0268265_10591524 3300028380 Bacteria 1059
767 Ga0268265_11066591 3300028380 Unclassified 801
768 Ga0268265_11223928 3300028380 Unclassified 749
769 Ga0268264_10024961 3300028381 Bacteria 4885
770 Ga0268264_10095839 3300028381 Bacteria 2568
771 Ga0268264_10134680 3300028381 Bacteria 2195
772 Ga0268264_10276873 3300028381 Bacteria 1570
773 Ga0268264_10370593 3300028381 Unclassified 1369
774 Ga0268264_10378851 3300028381 Bacteria 1354
775 Ga0268264_10581037 3300028381 Bacteria 1102
776 Ga0268264_11337811 3300028381 Unclassified 727
777 Ga0268264_12089120 3300028381 Unclassified 575
778 Ga0307408_100058290 3300031548 Bacteria 2807
779 Ga0307408_100058786 3300031548 Bacteria 2796
780 Ga0307408_100083651 3300031548 Bacteria 2392
781 Ga0307408_100355205 3300031548 Unclassified 1245
782 Ga0307408_100732165 3300031548 Bacteria 892
783 Ga0307405_10007336 3300031731 Bacteria 5503
784 Ga0307405_10281083 3300031731 Bacteria 1253
785 Ga0307413_10079091 3300031824 Bacteria 2101
786 Ga0307410_10044268 3300031852 Bacteria 2956
787 Ga0307410_10062511 3300031852 Unclassified 2552
788 Ga0307410_10371671 3300031852 Bacteria 1148
789 Ga0307406_10012436 3300031901 Bacteria 4855
790 Ga0307406_10173237 3300031901 Bacteria 1564
791 Ga0307406_10207909 3300031901 Bacteria 1446
792 Ga0307412_10082499 3300031911 Bacteria 2226
793 Ga0307412_10087461 3300031911 Bacteria 2171
794 Ga0307409_100358691 3300031995 Bacteria 1378
795 Ga0307409_100786661 3300031995 Bacteria 958
796 Ga0307416_100083558 3300032002 Bacteria 2710
797 Ga0307416_100103916 3300032002 Unclassified 2482
798 Ga0307414_10021049 3300032004 Unclassified 4081
799 Ga0307414_10224313 3300032004 Bacteria 1545
800 Ga0307414_11548063 3300032004 Unclassified 617
801 Ga0307411_10234703 3300032005 Bacteria 1432
802 Ga0307411_10740545 3300032005 Unclassified 860
803 Ga0307415_100028009 3300032126 Bacteria 3578
804 Ga0307415_100384331 3300032126 Bacteria 1193
805 Ga0307415_100482794 3300032126 Bacteria 1079
806 Ga0307415_101042791 3300032126 Bacteria 762
807 Ga0373940_0043646 3300035088 Unclassified 1240
808 Ga0373949_0058196 3300035090 Bacteria 989
809 Ga0373951_0003140 3300035091 Bacteria 4071
810 Ga0373952_0251776 3300035092 Unclassified 535
811 Ga0373941_0019453 3300035115 Unclassified 1891
812 Ga0373942_0005511 3300035207 Unclassified 2934
813 Ga0373962_0025963 3300035242 Unclassified 1576
814 Ga0373931_0086906 3300035691 Unclassified 1736
815 Ga0373937_0346035 3300036401 Unclassified 1408
816 Ga0395899_0330619 3300037312 Bacteria 1024
817 Ga0395899_0387042 3300037312 Unclassified 928
818 Ga0395900_0244909 3300037418 Unclassified 1797
819 Ga0395900_0726539 3300037418 Unclassified 925
820 Ga0395898_0637714 3300037466 Unclassified 1008
821 Ga0395905_1290733 3300037471 Unclassified 634
822 Ga0395901_0471172 3300038443 Bacteria 1282
823 Ga0395901_0738960 3300038443 Bacteria 978
824 Ga0395901_0814393 3300038443 Unclassified 922
825 Ga0395901_1036785 3300038443 Unclassified 794
826 Ga0242422_04767 3300038699 Bacteria 840
827 Ga0242420_009839 3300038996 Bacteria 1578
828 Ga0439458_0004103 3300042157 Bacteria 3362
829 Ga0453683_0393403 3300044673 Unclassified 893
830 Ga0451576_0325816 3300045051 Bacteria 1608
831 Ga0451576_0350324 3300045051 Bacteria 1546
832 Ga0495582_0231348 3300046473 Unclassified 1058
833 Ga0495658_0081528 3300046683 Bacteria 1900
834 Ga0495669_0659587 3300046684 Unclassified 509
835 Ga0496102_0010938 3300048905 Bacteria 7815
836 Ga0496102_0443468 3300048905 Unclassified 1218
837 Ga0496103_0215791 3300048906 Bacteria 1234
838 Ga0496104_0276520 3300048907 Unclassified 1592
839 Ga0496104_1146128 3300048907 Bacteria 681
840 Ga0496105_0223379 3300048908 Bacteria 1533
841 Ga0496106_0260649 3300048909 Bacteria 1387
842 Ga0496106_0951200 3300048909 Unclassified 677
843 Ga0496107_0449432 3300048910 Bacteria 957
844 Ga0496108_0118307 3300048911 Bacteria 2271
845 Ga0496109_1659987 3300048912 Unclassified 573
846 Ga0496110_0154049 3300048913 Unclassified 2082
847 Ga0496112_0083049 3300048915 Bacteria 3168
848 Ga0496112_0184022 3300048915 Bacteria 2053
849 Ga0496112_0374146 3300048915 Bacteria 1366
850 Ga0496112_0582876 3300048915 Bacteria 1051
851 Ga0496112_1389171 3300048915 Bacteria 617
852 Ga0496113_0137148 3300048916 Bacteria 1923
853 Ga0496113_0622670 3300048916 Unclassified 864
854 Ga0496113_0907532 3300048916 Unclassified 697
855 Ga0501291_021860 3300049514 Viruses 1023
856 Ga0501292_002722 3300049515 Bacteria 2303
857 Ga0501292_007066 3300049515 Bacteria 1615
858 Ga0501292_075040 3300049515 Bacteria 635
859 Ga0501293_007382 3300049516 Unclassified 910
860 Ga0501295_045974 3300049518 Unclassified 921
861 Ga0501297_071120 3300049520 Unclassified 549
862 Ga0501298_001979 3300049521 Bacteria 3064
863 Ga0501298_029368 3300049521 Bacteria 1072
864 Ga0501299_016697 3300049522 Unclassified 1302
865 Ga0501299_021657 3300049522 Bacteria 1180
866 Ga0501300_012114 3300049523 Unclassified 1257
867 Ga0501300_019024 3300049523 Unclassified 1003
868 Ga0501038_0001488 3300049574 Bacteria 21593
869 Ga0501048_0463202 3300049582 Bacteria 908
870 Ga0501076_0953295 3300049592 Unclassified 707
871 Ga0501077_0235325 3300049593 Bacteria 1164
872 Ga0501198_001801 3300049649 Bacteria 2829
873 Ga0501198_049046 3300049649 Unclassified 749
874 Ga0501202_002390 3300049652 Unclassified 3148
875 Ga0501202_010365 3300049652 Bacteria 1728
876 Ga0501207_011242 3300049654 Bacteria 1330
877 Ga0501207_021814 3300049654 Unclassified 1030
878 Ga0501207_059252 3300049654 Unclassified 698
879 Ga0501208_105982 3300049655 Bacteria 607
880 Ga0501209_294549 3300049656 Unclassified 510
881 Ga0501217_006848 3300049661 Bacteria 2432
882 Ga0501217_033331 3300049661 Unclassified 1279
883 Ga0501223_005881 3300049663 Bacteria 2561
884 Ga0501223_008448 3300049663 Bacteria 2099
885 Ga0501227_002240 3300049665 Unclassified 4280
886 Ga0501227_034743 3300049665 Unclassified 1224
887 Ga0501230_053957 3300049667 Unclassified 803
888 Ga0501230_066551 3300049667 Unclassified 736
889 Ga0501233_001572 3300049668 Bacteria 3921
890 Ga0501233_024411 3300049668 Unclassified 1322
891 Ga0501233_030248 3300049668 Bacteria 1219
892 Ga0501233_044325 3300049668 Bacteria 1057
893 Ga0501235_002210 3300049669 Bacteria 4186
894 Ga0501235_007087 3300049669 Unclassified 2442
895 Ga0501235_129563 3300049669 Unclassified 638
896 Ga0501243_007902 3300049675 Bacteria 1633
897 Ga0501243_008184 3300049675 Unclassified 1609
898 Ga0501243_020491 3300049675 Unclassified 1087
899 Ga0501249_099794 3300049679 Unclassified 694
900 Ga0501250_034939 3300049680 Bacteria 714
901 Ga0501253_015593 3300049683 Bacteria 1251
902 Ga0501257_008644 3300049686 Bacteria 2292
903 Ga0501257_024783 3300049686 Unclassified 1425
904 Ga0501257_041005 3300049686 Bacteria 1137
905 Ga0501259_062183 3300049688 Unclassified 782
906 Ga0501260_016444 3300049689 Unclassified 779
907 Ga0501261_018026 3300049690 Unclassified 993
908 Ga0501221_210874 3300049704 Unclassified 544
909 Ga0501225_0003567 3300049705 Bacteria 4695
910 Ga0501225_0007426 3300049705 Bacteria 3174
911 Ga0501225_0008102 3300049705 Bacteria 3023
912 Ga0501234_008102 3300049707 Bacteria 1642
913 Ga0501245_007052 3300049708 Unclassified 1583
914 Ga0501245_010601 3300049708 Bacteria 1333
915 Ga0501079_1322561 3300049741 Unclassified 567
916 Ga0501263_031899 3300049760 Unclassified 747
917 Ga0501270_014283 3300049767 Bacteria 1115
918 Ga0501272_015562 3300049769 Unclassified 886
919 Ga0501273_008681 3300049770 Unclassified 1219
920 Ga0501276_014137 3300049773 Unclassified 706
921 Ga0501283_001695 3300049779 Bacteria 2866
922 Ga0501200_08989 3300049849 Unclassified 527
923 Ga0501212_008410 3300049851 Bacteria 1434
924 Ga0501212_025784 3300049851 Unclassified 929
925 Ga0501220_03647 3300049852 Bacteria 684
926 Ga0501226_002383 3300049853 Bacteria 2304
927 nmdc:mga05p37_102248_c1 3300050507 Bacteria 3529
928 nmdc:mga05p37_103422_c1 3300050507 Bacteria 3506
929 nmdc:mga05p37_106263_c1 3300050507 Bacteria 3453
930 nmdc:mga05p37_1077839_c1 3300050507 Bacteria 844
931 nmdc:mga05p37_1157893_c1 3300050507 Unclassified 804
932 nmdc:mga05p37_238860_c1 3300050507 Unclassified 2186
933 nmdc:mga05p37_388298_c1 3300050507 Unclassified 1633
934 nmdc:mga05p37_439359_c1 3300050507 Bacteria 1513
935 nmdc:mga05p37_509967_c1 3300050507 Bacteria 1378
936 nmdc:mga05p37_842050_c1 3300050507 Bacteria 997
937 nmdc:mga05p37_919854_c1 3300050507 Bacteria 940
938 nmdc:mga09592_116305_c1 3300050508 Bacteria 2295
939 nmdc:mga09592_133127_c1 3300050508 Bacteria 2140
940 nmdc:mga09592_315488_c1 3300050508 Bacteria 1354
941 nmdc:mga09592_403994_c1 3300050508 Unclassified 1181
942 nmdc:mga09592_684220_c1 3300050508 Unclassified 874
943 nmdc:mga0qj67_136954_c1 3300050509 Unclassified 1984
944 nmdc:mga0qj67_315936_c1 3300050509 Unclassified 1265
945 nmdc:mga0qj67_720052_c1 3300050509 Bacteria 793
946 nmdc:mga06r32_308453_c1 3300050510 Bacteria 1568
947 nmdc:mga06r32_420403_c1 3300050510 Bacteria 1318
948 nmdc:mga08y16_23581_c1 3300050511 Bacteria 6500
949 nmdc:mga08y16_691343_c1 3300050511 Unclassified 1021
950 nmdc:mga08y16_86430_c1 3300050511 Unclassified 3268
951 nmdc:mga0n895_262588_c1 3300050512 Bacteria 1752
952 nmdc:mga0n895_281620_c1 3300050512 Bacteria 1686
953 nmdc:mga0n895_333904_c1 3300050512 Unclassified 1536
954 nmdc:mga0n895_536797_c1 3300050512 Bacteria 1176
955 nmdc:mga0n895_53683_c1 3300050512 Bacteria 3961
956 nmdc:mga0n895_763564_c1 3300050512 Unclassified 959
957 nmdc:mga0n895_767241_c1 3300050512 Unclassified 956
958 nmdc:mga0rr50_166505_c1 3300050513 Unclassified 1792
959 nmdc:mga0rr50_19621_c1 3300050513 Bacteria 4569
960 nmdc:mga0rr50_301315_c1 3300050513 Bacteria 1341
961 nmdc:mga08x19_7479_c1 3300050514 Bacteria 6488
962 nmdc:mga0a205_101889_c1 3300050515 Unclassified 2770
963 nmdc:mga0a205_134664_c1 3300050515 Bacteria 2371
964 nmdc:mga0a205_167735_c1 3300050515 Bacteria 2091
965 nmdc:mga0a205_207241_c1 3300050515 Bacteria 1850
966 nmdc:mga0a205_21072_c1 3300050515 Bacteria 6163
967 nmdc:mga0a205_337620_c1 3300050515 Bacteria 1376
968 nmdc:mga0a205_392130_c1 3300050515 Bacteria 1253
969 nmdc:mga0a205_59234_c1 3300050515 Bacteria 3699
970 nmdc:mga0a205_717968_c1 3300050515 Bacteria 849
971 Ga0501084_0230351 3300054114 Unclassified 1564
972 Ga0501084_0626117 3300054114 Unclassified 909
973 Ga0587091_157000 3300059511 Bacteria 582
974 Ga0501082_0589232 3300060353 Unclassified 973
975 Ga0530510_0583283 3300061734 Unclassified 850
976 Ga0065715_10395210
977 SwRhRL2b_contig_19469
978 SwRhRL2b_contig_940246
979 MBSR1b_contig_11702357
980 MBSR1b_contig_357108
981 MBSR1b_contig_931085
982 CNAas_1000523
983 JGI24751J29686_10000038
984 JGI25406J46586_10010758
985 rootL2_10087314
986 Ga0065714_10064462
987 Ga0065714_10176383
988 Ga0065714_10385164
989 Ga0065704_10001276
990 Ga0065704_10093146
991 Ga0065712_10000135
992 Ga0065712_10004694
993 Ga0065712_10115832
994 Ga0065712_10198370
995 Ga0065712_10202013
996 Ga0065715_10000518
997 Ga0065715_10018641
998 Ga0065715_10095497
999 Ga0065715_10224383
1000 Ga0065715_10226068
1001 Ga0065715_10301402
1002 Ga0065715_10768521
1003 Ga0065707_10004228
1004 Ga0065707_10109526
1005 Ga0065707_10145753
1006 Ga0065707_10186190
1007 Ga0065707_10216166
1008 Ga0065707_10253401
1009 Ga0070683_101486319
1010 Ga0070690_100086887
1011 Ga0070690_100162010
1012 Ga0070690_100190557
1013 Ga0070670_100000073
1014 Ga0070670_100023928
1015 Ga0070670_100071727
1016 Ga0070670_100090104
1017 Ga0070670_100139848
1018 Ga0070670_100140563
1019 Ga0070670_100629051
1020 Ga0070670_100691233
1021 Ga0068869_100575570
1022 Ga0068869_100637198
1023 Ga0068869_101643464
1024 Ga0070666_10076489
1025 Ga0070666_10908078
1026 Ga0070680_100010009
1027 Ga0070680_100323922
1028 Ga0070680_100544429
1029 Ga0070680_100560753
1030 Ga0070682_100020890
1031 Ga0070682_100090743
1032 Ga0070682_100578339
1033 Ga0068868_100003205
1034 Ga0068868_100073287
1035 Ga0068868_101041328
1036 Ga0068868_101180516
1037 Ga0068868_101320787
1038 Ga0070660_100009748
1039 Ga0070689_100002495
1040 Ga0070689_100389217
1041 Ga0070689_100539628
1042 Ga0070689_101661283
1043 Ga0070687_100005568
1044 Ga0070687_100109669
1045 Ga0070687_100129962
1046 Ga0070687_101133694
1047 Ga0070661_100007782
1048 Ga0070661_100414086
1049 Ga0070692_10010809
1050 Ga0070692_10047386
1051 Ga0070692_10889857
1052 Ga0070668_100033595
1053 Ga0070668_100191704
1054 Ga0070669_100051938
1055 Ga0070669_100060441
1056 Ga0070669_100110428
1057 Ga0070675_100005020
1058 Ga0070675_100160397
1059 Ga0070675_100296737
1060 Ga0070671_100016102
1061 Ga0070671_100193278
1062 Ga0070671_100754616
1063 Ga0070674_100392644
1064 Ga0070674_100486285
1065 Ga0070673_100011196
1066 Ga0070673_100082774
1067 Ga0070673_100151043
1068 Ga0070673_100278136
1069 Ga0070673_100521158
1070 Ga0070673_100717608
1071 Ga0070688_100095477
1072 Ga0070688_100481383
1073 Ga0070688_100619932
1074 Ga0070659_100006362
1075 Ga0070659_100028181
1076 Ga0070659_100999367
1077 Ga0070667_100040149
1078 Ga0070667_100144424
1079 Ga0070703_10003811
1080 Ga0070701_10021145
1081 Ga0070701_10135429
1082 Ga0070701_10874208
1083 Ga0070705_100027760
1084 Ga0070705_100029045
1085 Ga0070705_100033473
1086 Ga0070705_100183086
1087 Ga0070705_100383366
1088 Ga0070705_101260757
1089 Ga0070700_100000036
1090 Ga0070700_100022252
1091 Ga0070700_100024136
1092 Ga0070700_100090395
1093 Ga0070700_100165686
1094 Ga0070700_100169080
1095 Ga0070700_100169455
1096 Ga0070700_100764474
1097 Ga0070694_100012909
1098 Ga0070694_100020194
1099 Ga0070694_100021886
1100 Ga0070694_100037254
1101 Ga0070694_100056887
1102 Ga0070694_100058711
1103 Ga0070694_100061940
1104 Ga0070694_100102226
1105 Ga0070694_100122869
1106 Ga0070694_100147135
1107 Ga0070694_100198773
1108 Ga0070694_100852355
1109 Ga0070694_100856652
1110 Ga0070708_100000754
1111 Ga0070708_100568345
1112 Ga0070678_100529771
1113 Ga0070662_100055184
1114 Ga0070662_100073820
1115 Ga0070662_100295688
1116 Ga0070681_10004646
1117 Ga0070681_10023868
1118 Ga0070681_10045973
1119 Ga0068867_100112707
1120 Ga0068867_100257141
1121 Ga0068867_100264883
1122 Ga0068867_100425844
1123 Ga0068867_100653003
1124 Ga0068867_100931404
1125 Ga0070685_10098747
1126 Ga0070685_10130436
1127 Ga0070706_100000015
1128 Ga0070706_100028134
1129 Ga0070706_100332487
1130 Ga0070706_100515067
1131 Ga0070707_100255809
1132 Ga0070707_100257648
1133 Ga0070707_100724730
1134 Ga0070698_100007009
1135 Ga0070698_100008421
1136 Ga0070698_100028005
1137 Ga0070698_100181594
1138 Ga0070699_100006181
1139 Ga0070699_100031705
1140 Ga0070699_100239523
1141 Ga0070699_100257822
1142 Ga0070699_100484971
1143 Ga0070699_100711902
1144 Ga0070699_100741382
1145 Ga0070679_100036868
1146 Ga0070679_100110587
1147 Ga0070697_100007769
1148 Ga0070697_100057188
1149 Ga0070697_100148942
1150 Ga0070697_100269151
1151 Ga0070697_100836497
1152 Ga0068853_100004345
1153 Ga0068853_100015636
1154 Ga0068853_100607973
1155 Ga0070672_100010581
1156 Ga0070672_100193118
1157 Ga0070686_100038592
1158 Ga0070695_100020513
1159 Ga0070695_100024122
1160 Ga0070695_100050997
1161 Ga0070695_100138975
1162 Ga0070695_100154880
1163 Ga0070695_100175716
1164 Ga0070695_100479223
1165 Ga0070695_100806617
1166 Ga0070695_101441891
1167 Ga0070696_100031402
1168 Ga0070696_100058455
1169 Ga0070696_100059835
1170 Ga0070696_100309618
1171 Ga0070696_100339030
1172 Ga0070696_100400255
1173 Ga0070696_100535977
1174 Ga0070696_100698140
1175 Ga0070693_100000775
1176 Ga0070693_100011909
1177 Ga0070693_100015356
1178 Ga0070693_100016559
1179 Ga0070693_100061355
1180 Ga0070693_100178780
1181 Ga0070693_101021390
1182 Ga0070665_100158496
1183 Ga0070704_100091555
1184 Ga0070704_100104193
1185 Ga0070704_100133812
1186 Ga0070704_100217426
1187 Ga0070704_100282971
1188 Ga0070704_100467630
1189 Ga0070704_100535327
1190 Ga0070704_100739543
1191 Ga0068855_100137573
1192 Ga0068855_100609218
1193 Ga0070664_100002580
1194 Ga0070664_100267875
1195 Ga0070664_100452627
1196 Ga0070664_100596456
1197 Ga0070664_100843478
1198 Ga0070664_100928563
1199 Ga0068857_100002670
1200 Ga0068857_100046286
1201 Ga0068857_100127827
1202 Ga0068857_100140490
1203 Ga0068857_100204067
1204 Ga0068857_100816659
1205 Ga0068857_100829651
1206 Ga0068857_100874264
1207 Ga0068854_100056797
1208 Ga0068854_100120815
1209 Ga0068854_100229047
1210 Ga0068854_100309478
1211 Ga0068854_100336401
1212 Ga0068854_100902874
1213 Ga0068854_101097304
1214 Ga0068856_100005300
1215 Ga0070702_100003492
1216 Ga0070702_100079893
1217 Ga0070702_100115532
1218 Ga0070702_100301659
1219 Ga0070702_100451768
1220 Ga0070702_100462172
1221 Ga0070702_101057559
1222 Ga0068852_100236357
1223 Ga0068852_100350256
1224 Ga0068852_100369808
1225 Ga0068852_100429403
1226 Ga0068852_100713297
1227 Ga0068852_101105028
1228 Ga0068859_100007922
1229 Ga0068859_100013228
1230 Ga0068859_100036108
1231 Ga0068859_100043033
1232 Ga0068859_100086985
1233 Ga0068859_100131954
1234 Ga0068859_100193692
1235 Ga0068859_100405841
1236 Ga0068859_101222223
1237 Ga0068859_101388807
1238 Ga0068859_101392126
1239 Ga0068859_101402539
1240 Ga0068859_101454652
1241 Ga0068859_102095814
1242 Ga0068864_100001219
1243 Ga0068864_100018626
1244 Ga0068864_100025577
1245 Ga0068864_100190372
1246 Ga0068864_100192015
1247 Ga0068864_100229083
1248 Ga0068864_100231901
1249 Ga0068864_100260504
1250 Ga0068864_100269194
1251 Ga0068864_100282780
1252 Ga0068864_100310682
1253 Ga0068864_100531623
1254 Ga0068864_100652749
1255 Ga0068864_102034065
1256 Ga0068866_10005031
1257 Ga0068861_100008097
1258 Ga0068861_100022748
1259 Ga0068861_100028715
1260 Ga0068861_100062703
1261 Ga0068861_100249023
1262 Ga0068861_100504958
1263 Ga0068861_101759260
1264 Ga0068851_10013712
1265 Ga0068870_10028203
1266 Ga0068870_10156000
1267 Ga0068870_10229281
1268 Ga0068870_10742931
1269 Ga0068863_100146705
1270 Ga0068863_100190549
1271 Ga0068863_100241479
1272 Ga0068863_100580132
1273 Ga0068858_100058113
1274 Ga0068858_100069609
1275 Ga0068858_100117601
1276 Ga0068858_100139032
1277 Ga0068858_100167819
1278 Ga0068858_100206124
1279 Ga0068858_100239355
1280 Ga0068858_100270339
1281 Ga0068858_100326388
1282 Ga0068858_100476366
1283 Ga0068858_102363058
1284 Ga0068860_100078315
1285 Ga0068860_100213204
1286 Ga0068860_100289930
1287 Ga0068860_100347761
1288 Ga0068860_100585163
1289 Ga0068860_100833533
1290 Ga0068860_100936601
1291 Ga0068860_101267648
1292 Ga0068862_100018132
1293 Ga0068862_100029245
1294 Ga0068862_100095055
1295 Ga0068862_100239530
1296 Ga0068862_100429975
1297 Ga0068862_100467340
1298 Ga0068862_101175652
1299 Ga0068862_101198384
1300 Ga0081539_10000487
1301 Ga0081539_10003495
1302 Ga0075432_10043540
1303 Ga0070716_100229478
1304 Ga0070716_100366417
1305 Ga0097621_100001343
1306 Ga0097621_100019601
1307 Ga0097621_100031588
1308 Ga0097621_100438482
1309 Ga0068871_100007860
1310 Ga0068871_100043720
1311 Ga0068871_100047482
1312 Ga0068871_100127451
1313 Ga0068871_100468125
1314 Ga0075428_100081296
1315 Ga0075428_100083970
1316 Ga0075428_100911329
1317 Ga0075430_100458873
1318 Ga0075431_100073125
1319 Ga0075431_100188611
1320 Ga0075431_100790428
1321 Ga0075433_10006875
1322 Ga0075433_10013861
1323 Ga0075433_10031197
1324 Ga0075433_10050622
1325 Ga0075433_10153666
1326 Ga0075433_10180526
1327 Ga0075433_10194957
1328 Ga0075433_10220696
1329 Ga0075433_10730423
1330 Ga0075434_100043034
1331 Ga0075434_100049269
1332 Ga0075434_100348874
1333 Ga0075434_100539747
1334 Ga0075434_100593309
1335 Ga0075434_101473349
1336 Ga0075429_100015591
1337 Ga0075429_100106679
1338 Ga0075429_100121025
1339 Ga0075429_100144798
1340 Ga0068865_100160008
1341 Ga0068865_100329059
1342 Ga0068865_100477519
1343 Ga0075436_100023126
1344 Ga0097620_100007923
1345 Ga0097620_100013228
1346 Ga0097620_100036109
1347 Ga0097620_100043031
1348 Ga0097620_100086983
1349 Ga0097620_100131950
1350 Ga0097620_100193666
1351 Ga0097620_100405880
1352 Ga0097620_101222255
1353 Ga0097620_101388775
1354 Ga0097620_101392138
1355 Ga0097620_101402532
1356 Ga0097620_101454374
1357 Ga0097620_102095773
1358 Ga0075435_100006392
1359 Ga0075435_100590130
1360 Ga0099794_10566226
1361 Ga0105251_10129543
1362 Ga0105251_10265475
1363 Ga0105240_10134905
1364 Ga0111539_10079327
1365 Ga0111539_10154246
1366 Ga0111539_10159347
1367 Ga0105245_10249548
1368 Ga0105245_10528738
1369 Ga0105245_10602225
1370 Ga0105245_10685058
1371 Ga0105245_10768395
1372 Ga0105245_10812780
1373 Ga0105247_10037314
1374 Ga0105247_10056096
1375 Ga0105247_10062815
1376 Ga0105247_10079635
1377 Ga0105247_10523647
1378 Ga0105247_11149579
1379 Ga0114129_10004897
1380 Ga0114129_10108771
1381 Ga0114129_10109956
1382 Ga0114129_10227794
1383 Ga0114129_10253051
1384 Ga0114129_10268134
1385 Ga0114129_11286659
1386 Ga0114129_11397339
1387 Ga0114129_12078280
1388 Ga0105243_10001952
1389 Ga0105243_10011066
1390 Ga0105243_10133105
1391 Ga0105243_10236103
1392 Ga0105243_10309892
1393 Ga0105243_10580888
1394 Ga0105241_10019131
1395 Ga0105241_10020033
1396 Ga0105241_10056913
1397 Ga0105241_10101685
1398 Ga0105241_10279458
1399 Ga0105241_10344228
1400 Ga0105241_10384564
1401 Ga0105241_10527537
1402 Ga0105241_10613536
1403 Ga0105241_10641696
1404 Ga0105241_10896005
1405 Ga0105241_10916105
1406 Ga0105241_11135029
1407 Ga0105241_11538070
1408 Ga0105242_10132200
1409 Ga0105242_10150841
1410 Ga0105242_10204557
1411 Ga0105242_10265263
1412 Ga0105242_10793254
1413 Ga0105242_11249826
1414 Ga0105248_10005050
1415 Ga0105248_10007877
1416 Ga0105248_10092690
1417 Ga0105248_10111760
1418 Ga0105248_10119835
1419 Ga0105248_10182462
1420 Ga0105248_10258325
1421 Ga0105248_10610498
1422 Ga0105248_10649135
1423 Ga0105248_11028285
1424 Ga0105248_11031255
1425 Ga0105248_11113475
1426 Ga0105248_11380131
1427 Ga0105248_11767455
1428 Ga0105237_10001132
1429 Ga0105237_10042047
1430 Ga0105237_10080027
1431 Ga0105237_11488175
1432 Ga0105238_10002642
1433 Ga0105238_10006395
1434 Ga0105249_10000029
1435 Ga0105249_10011040
1436 Ga0105249_10044992
1437 Ga0105249_10075873
1438 Ga0105249_10174903
1439 Ga0105249_10221788
1440 Ga0105249_10502725
1441 Ga0105249_10558796
1442 Ga0105249_11759623
1443 Ga0099796_10062247
1444 Ga0105239_10101185
1445 Ga0105239_10145157
1446 Ga0105239_10580804
1447 Ga0105239_10801409
1448 Ga0105246_10105079
1449 Ga0105246_10153661
1450 Ga0105246_10242148
1451 Ga0105246_10361028
1452 Ga0105246_10400032
1453 Ga0105246_10885543
1454 Ga0105246_11028925
1455 Ga0105246_11777870
1456 Ga0157373_10006338
1457 Ga0157373_10009488
1458 Ga0157373_10017090
1459 Ga0157373_10095244
1460 Ga0157373_10698240
1461 Ga0157373_10772813
1462 Ga0157373_10957197
1463 Ga0157371_10158534
1464 Ga0157371_10825009
1465 Ga0157374_10022626
1466 Ga0157374_10032330
1467 Ga0157374_11721782
1468 Ga0157374_12018549
1469 Ga0157374_12177566
1470 Ga0157378_10010378
1471 Ga0157378_10015544
1472 Ga0157378_10025558
1473 Ga0157378_10053702
1474 Ga0157378_10179805
1475 Ga0157378_10512108
1476 Ga0157378_10649952
1477 Ga0157378_11082420
1478 Ga0163162_10000009
1479 Ga0163162_10008612
1480 Ga0163162_10010879
1481 Ga0163162_10041507
1482 Ga0163162_10053986
1483 Ga0163162_10508634
1484 Ga0163162_10662578
1485 Ga0163162_10672833
1486 Ga0163162_10684081
1487 Ga0163162_10781228
1488 Ga0157372_10033659
1489 Ga0157372_10420145
1490 Ga0157372_10471524
1491 Ga0157372_10565087
1492 Ga0157372_11281273
1493 Ga0157372_12362863
1494 Ga0157375_10009777
1495 Ga0157375_10018218
1496 Ga0157375_10128892
1497 Ga0157375_10226322
1498 Ga0157375_10284166
1499 Ga0157375_10382809
1500 Ga0157375_10413504
1501 Ga0157375_10454290
1502 Ga0157375_10788697
1503 Ga0157375_10859873
1504 Ga0157375_10899652
1505 Ga0157375_11375474
1506 Ga0163163_10000466
1507 Ga0163163_10002054
1508 Ga0163163_10002763
1509 Ga0163163_10027595
1510 Ga0163163_10029203
1511 Ga0163163_10072427
1512 Ga0163163_10188652
1513 Ga0163163_10246532
1514 Ga0163163_10594073
1515 Ga0163163_10666976
1516 Ga0163163_10846928
1517 Ga0163163_11525040
1518 Ga0157380_10000188
1519 Ga0157380_10007110
1520 Ga0157380_10012447
1521 Ga0157380_10034924
1522 Ga0157380_10134421
1523 Ga0157380_10151479
1524 Ga0157380_10254915
1525 Ga0157380_10256447
1526 Ga0157377_10016406
1527 Ga0157377_10017921
1528 Ga0157377_10139754
1529 Ga0157377_10214093
1530 Ga0157379_10058845
1531 Ga0157379_10099538
1532 Ga0157379_10682695
1533 Ga0157379_10822662
1534 Ga0157376_10055570
1535 Ga0182007_10135814
1536 Ga0163161_10006702
1537 Ga0163161_10149121
1538 Ga0163161_10609462
1539 Ga0207697_10071051
1540 Ga0207656_10011668
1541 Ga0207653_10022098
1542 Ga0207642_10009682
1543 Ga0207642_10365506
1544 Ga0207642_10956786
1545 Ga0207710_10000389
1546 Ga0207710_10237708
1547 Ga0207680_10029178
1548 Ga0207680_10660760
1549 Ga0207680_10735240
1550 Ga0207647_10003482
1551 Ga0207647_10232088
1552 Ga0207647_10340864
1553 Ga0207645_10135104
1554 Ga0207643_10020307
1555 Ga0207643_10045238
1556 Ga0207643_10058845
1557 Ga0207643_10397431
1558 Ga0207684_10000083
1559 Ga0207684_10082433
1560 Ga0207684_10372382
1561 Ga0207684_10644840
1562 Ga0207654_10062482
1563 Ga0207654_10071422
1564 Ga0207654_10105851
1565 Ga0207654_10144790
1566 Ga0207654_10313119
1567 Ga0207654_10553544
1568 Ga0207654_10741262
1569 Ga0207707_10015795
1570 Ga0207707_10068064
1571 Ga0207707_10140489
1572 Ga0207695_10071094
1573 Ga0207671_10015690
1574 Ga0207671_10039720
1575 Ga0207671_10418663
1576 Ga0207660_10011883
1577 Ga0207660_10069429
1578 Ga0207660_10638869
1579 Ga0207660_10651062
1580 Ga0207662_10031125
1581 Ga0207662_10063770
1582 Ga0207662_10149304
1583 Ga0207662_10152938
1584 Ga0207657_10021188
1585 Ga0207652_10052074
1586 Ga0207646_10023701
1587 Ga0207646_10534260
1588 Ga0207681_10014169
1589 Ga0207681_10031671
1590 Ga0207681_10186601
1591 Ga0207681_10957839
1592 Ga0207694_10003054
1593 Ga0207694_10023376
1594 Ga0207650_10000006
1595 Ga0207650_10047907
1596 Ga0207650_10088478
1597 Ga0207650_10217418
1598 Ga0207650_10498990
1599 Ga0207659_10332538
1600 Ga0207659_10334316
1601 Ga0207687_10032505
1602 Ga0207687_10452239
1603 Ga0207644_10139909
1604 Ga0207644_10254492
1605 Ga0207644_10472962
1606 Ga0207690_10004343
1607 Ga0207690_10011300
1608 Ga0207690_11034294
1609 Ga0207706_10039447
1610 Ga0207706_10178680
1611 Ga0207706_10565916
1612 Ga0207686_10069102
1613 Ga0207686_10230588
1614 Ga0207686_10627922
1615 Ga0207686_10866607
1616 Ga0207709_10008229
1617 Ga0207709_10082783
1618 Ga0207709_10084431
1619 Ga0207709_10276703
1620 Ga0207709_10453616
1621 Ga0207709_10976443
1622 Ga0207670_10000236
1623 Ga0207670_10228939
1624 Ga0207670_10566286
1625 Ga0207670_11233894
1626 Ga0207704_10020308
1627 Ga0207704_10106621
1628 Ga0207704_11362981
1629 Ga0207665_10409240
1630 Ga0207665_10470168
1631 Ga0207691_10008611
1632 Ga0207691_10200594
1633 Ga0207691_10326090
1634 Ga0207691_10352049
1635 Ga0207711_10001380
1636 Ga0207711_10007092
1637 Ga0207711_10028460
1638 Ga0207711_10126284
1639 Ga0207711_10348650
1640 Ga0207711_11534406
1641 Ga0207689_10002536
1642 Ga0207689_10054287
1643 Ga0207689_10091962
1644 Ga0207689_10110088
1645 Ga0207689_10263012
1646 Ga0207689_10291320
1647 Ga0207689_10478842
1648 Ga0207679_10005396
1649 Ga0207667_10664522
1650 Ga0207667_10706308
1651 Ga0207651_10027295
1652 Ga0207651_10121347
1653 Ga0207651_10422784
1654 Ga0207651_10553878
1655 Ga0207651_10606725
1656 Ga0207651_11048986
1657 Ga0207651_11075327
1658 Ga0207712_10000366
1659 Ga0207712_10017290
1660 Ga0207712_10085159
1661 Ga0207712_10726315
1662 Ga0207712_11061774
1663 Ga0207712_11365686
1664 Ga0207668_10022918
1665 Ga0207640_10116792
1666 Ga0207640_10374069
1667 Ga0207640_10400251
1668 Ga0207640_10475619
1669 Ga0207640_10527606
1670 Ga0207658_10034157
1671 Ga0207703_10109086
1672 Ga0207703_10117939
1673 Ga0207703_10260901
1674 Ga0207703_10415234
1675 Ga0207703_10420524
1676 Ga0207703_10602196
1677 Ga0207703_11035470
1678 Ga0207703_11393924
1679 Ga0207639_10015732
1680 Ga0207639_10215500
1681 Ga0207639_10344909
1682 Ga0207708_10000016
1683 Ga0207708_10005449
1684 Ga0207708_10012864
1685 Ga0207708_10038646
1686 Ga0207708_10041802
1687 Ga0207708_10098792
1688 Ga0207708_10111097
1689 Ga0207708_10157002
1690 Ga0207708_10157968
1691 Ga0207708_10177232
1692 Ga0207702_10025855
1693 Ga0207641_10019825
1694 Ga0207641_10066218
1695 Ga0207641_10331451
1696 Ga0207641_11955997
1697 Ga0207648_10027694
1698 Ga0207648_10091227
1699 Ga0207648_10167620
1700 Ga0207648_10305198
1701 Ga0207648_10328246
1702 Ga0207648_10859179
1703 Ga0207648_10864210
1704 Ga0207648_11306774
1705 Ga0207676_10006815
1706 Ga0207676_10011201
1707 Ga0207676_10176041
1708 Ga0207676_10190228
1709 Ga0207676_10217862
1710 Ga0207676_10344813
1711 Ga0207676_10413572
1712 Ga0207676_10420825
1713 Ga0207674_10000834
1714 Ga0207674_10094378
1715 Ga0207674_10146258
1716 Ga0207674_10366955
1717 Ga0207674_10373283
1718 Ga0207674_10382951
1719 Ga0207674_10388551
1720 Ga0207674_10530946
1721 Ga0207674_10920194
1722 Ga0207674_11364048
1723 Ga0207675_100003117
1724 Ga0207675_100012658
1725 Ga0207675_100046683
1726 Ga0207675_100056048
1727 Ga0207675_100159458
1728 Ga0207675_100419899
1729 Ga0207675_100672714
1730 Ga0207675_101361439
1731 Ga0207683_10127280
1732 Ga0207698_10233540
1733 Ga0207698_10335443
1734 Ga0207698_11049058
1735 Ga0209967_1033995
1736 Ga0207428_10054685
1737 Ga0268266_10141588
1738 Ga0268265_10033069
1739 Ga0268265_10087594
1740 Ga0268265_10208743
1741 Ga0268265_10591524
1742 Ga0268265_11066591
1743 Ga0268265_11223928
1744 Ga0268264_10024961
1745 Ga0268264_10095839
1746 Ga0268264_10134680
1747 Ga0268264_10276873
1748 Ga0268264_10370593
1749 Ga0268264_10378851
1750 Ga0268264_10581037
1751 Ga0268264_11337811
1752 Ga0268264_12089120
1753 Ga0307408_100058290
1754 Ga0307408_100058786
1755 Ga0307408_100083651
1756 Ga0307408_100355205
1757 Ga0307408_100732165
1758 Ga0307405_10007336
1759 Ga0307405_10281083
1760 Ga0307413_10079091
1761 Ga0307410_10044268
1762 Ga0307410_10062511
1763 Ga0307410_10371671
1764 Ga0307406_10012436
1765 Ga0307406_10173237
1766 Ga0307406_10207909
1767 Ga0307412_10082499
1768 Ga0307412_10087461
1769 Ga0307409_100358691
1770 Ga0307409_100786661
1771 Ga0307416_100083558
1772 Ga0307416_100103916
1773 Ga0307414_10021049
1774 Ga0307414_10224313
1775 Ga0307414_11548063
1776 Ga0307411_10234703
1777 Ga0307411_10740545
1778 Ga0307415_100028009
1779 Ga0307415_100384331
1780 Ga0307415_100482794
1781 Ga0307415_101042791
1782 Ga0373940_0043646
1783 Ga0373949_0058196
1784 Ga0373951_0003140
1785 Ga0373952_0251776
1786 Ga0373941_0019453
1787 Ga0373942_0005511
1788 Ga0373962_0025963
1789 Ga0373931_0086906
1790 Ga0373937_0346035
1791 Ga0395899_0330619
1792 Ga0395899_0387042
1793 Ga0395900_0244909
1794 Ga0395900_0726539
1795 Ga0395898_0637714
1796 Ga0395905_1290733
1797 Ga0395901_0471172
1798 Ga0395901_0738960
1799 Ga0395901_0814393
1800 Ga0395901_1036785
1801 Ga0242422_04767
1802 Ga0242420_009839
1803 Ga0439458_0004103
1804 Ga0453683_0393403
1805 Ga0451576_0325816
1806 Ga0451576_0350324
1807 Ga0495582_0231348
1808 Ga0495658_0081528
1809 Ga0495669_0659587
1810 Ga0496102_0010938
1811 Ga0496102_0443468
1812 Ga0496103_0215791
1813 Ga0496104_0276520
1814 Ga0496104_1146128
1815 Ga0496105_0223379
1816 Ga0496106_0260649
1817 Ga0496106_0951200
1818 Ga0496107_0449432
1819 Ga0496108_0118307
1820 Ga0496109_1659987
1821 Ga0496110_0154049
1822 Ga0496112_0083049
1823 Ga0496112_0184022
1824 Ga0496112_0374146
1825 Ga0496112_0582876
1826 Ga0496112_1389171
1827 Ga0496113_0137148
1828 Ga0496113_0622670
1829 Ga0496113_0907532
1830 Ga0501291_021860
1831 Ga0501292_002722
1832 Ga0501292_007066
1833 Ga0501292_075040
1834 Ga0501293_007382
1835 Ga0501295_045974
1836 Ga0501297_071120
1837 Ga0501298_001979
1838 Ga0501298_029368
1839 Ga0501299_016697
1840 Ga0501299_021657
1841 Ga0501300_012114
1842 Ga0501300_019024
1843 Ga0501038_0001488
1844 Ga0501048_0463202
1845 Ga0501076_0953295
1846 Ga0501077_0235325
1847 Ga0501198_001801
1848 Ga0501198_049046
1849 Ga0501202_002390
1850 Ga0501202_010365
1851 Ga0501207_011242
1852 Ga0501207_021814
1853 Ga0501207_059252
1854 Ga0501208_105982
1855 Ga0501209_294549
1856 Ga0501217_006848
1857 Ga0501217_033331
1858 Ga0501223_005881
1859 Ga0501223_008448
1860 Ga0501227_002240
1861 Ga0501227_034743
1862 Ga0501230_053957
1863 Ga0501230_066551
1864 Ga0501233_001572
1865 Ga0501233_024411
1866 Ga0501233_030248
1867 Ga0501233_044325
1868 Ga0501235_002210
1869 Ga0501235_007087
1870 Ga0501235_129563
1871 Ga0501243_007902
1872 Ga0501243_008184
1873 Ga0501243_020491
1874 Ga0501249_099794
1875 Ga0501250_034939
1876 Ga0501253_015593
1877 Ga0501257_008644
1878 Ga0501257_024783
1879 Ga0501257_041005
1880 Ga0501259_062183
1881 Ga0501260_016444
1882 Ga0501261_018026
1883 Ga0501221_210874
1884 Ga0501225_0003567
1885 Ga0501225_0007426
1886 Ga0501225_0008102
1887 Ga0501234_008102
1888 Ga0501245_007052
1889 Ga0501245_010601
1890 Ga0501079_1322561
1891 Ga0501263_031899
1892 Ga0501270_014283
1893 Ga0501272_015562
1894 Ga0501273_008681
1895 Ga0501276_014137
1896 Ga0501283_001695
1897 Ga0501200_08989
1898 Ga0501212_008410
1899 Ga0501212_025784
1900 Ga0501220_03647
1901 Ga0501226_002383
1902 nmdc:mga05p37_102248_c1
1903 nmdc:mga05p37_103422_c1
1904 nmdc:mga05p37_106263_c1
1905 nmdc:mga05p37_1077839_c1
1906 nmdc:mga05p37_1157893_c1
1907 nmdc:mga05p37_238860_c1
1908 nmdc:mga05p37_388298_c1
1909 nmdc:mga05p37_439359_c1
1910 nmdc:mga05p37_509967_c1
1911 nmdc:mga05p37_842050_c1
1912 nmdc:mga05p37_919854_c1
1913 nmdc:mga09592_116305_c1
1914 nmdc:mga09592_133127_c1
1915 nmdc:mga09592_315488_c1
1916 nmdc:mga09592_403994_c1
1917 nmdc:mga09592_684220_c1
1918 nmdc:mga0qj67_136954_c1
1919 nmdc:mga0qj67_315936_c1
1920 nmdc:mga0qj67_720052_c1
1921 nmdc:mga06r32_308453_c1
1922 nmdc:mga06r32_420403_c1
1923 nmdc:mga08y16_23581_c1
1924 nmdc:mga08y16_691343_c1
1925 nmdc:mga08y16_86430_c1
1926 nmdc:mga0n895_262588_c1
1927 nmdc:mga0n895_281620_c1
1928 nmdc:mga0n895_333904_c1
1929 nmdc:mga0n895_536797_c1
1930 nmdc:mga0n895_53683_c1
1931 nmdc:mga0n895_763564_c1
1932 nmdc:mga0n895_767241_c1
1933 nmdc:mga0rr50_166505_c1
1934 nmdc:mga0rr50_19621_c1
1935 nmdc:mga0rr50_301315_c1
1936 nmdc:mga08x19_7479_c1
1937 nmdc:mga0a205_101889_c1
1938 nmdc:mga0a205_134664_c1
1939 nmdc:mga0a205_167735_c1
1940 nmdc:mga0a205_207241_c1
1941 nmdc:mga0a205_21072_c1
1942 nmdc:mga0a205_337620_c1
1943 nmdc:mga0a205_392130_c1
1944 nmdc:mga0a205_59234_c1
1945 nmdc:mga0a205_717968_c1
1946 Ga0501084_0230351
1947 Ga0501084_0626117
1948 Ga0587091_157000
1949 Ga0501082_0589232
1950 Ga0530510_0583283

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.7379 73 135
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.7352 73 135
7unu-assembly1.cif.gz_c pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.7119 73 134
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.702 19 134
7nhn-assembly1.cif.gz_d vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.6677 26 134
ID Description Score Start End Superfamily
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.7043 73 135 3.30.1330.50
af_Q2FW12_17_106_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6704 22 134 3.30.300.20
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6284 26 136 3.30.460.10
af_Q58021_1_93_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.624 26 143 3.30.460.10
3gqwB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.6135 30 134 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A2V2R5P6-F1-model_v4 Uncharacterized protein 0.9683 2 159
AF-A0A838P503-F1-model_v4 Uncharacterized protein 0.9667 1 78
AF-A0A7R8AYD1-F1-model_v4 deleted 0.9641 8 154
AF-A0A538U4W8-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9608 14 159
AF-A0A2V7U6R0-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9577 8 159

Map