F487200

General Info

Members Datasets Scaffolds Average Seq Length
974 325 970 66

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10003300|rootL2_1000330018
Length 62
Sequence VTGLWDNVVFALALVLIAEGLLPFMSPRSWRRFVAQLSELKDGQLRFVGLALLLIGLLLLAL

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
3 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
4 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
98 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
99 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
233 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
236 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
249 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
250 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
251 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
323 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
324 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 4.72
Rhizosphere 88.6
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10031410 3300003316 Bacteria 3396
2 rootL2_10003300 3300003322 Bacteria 21471
3 JGI26145J50221_1001962 3300003371 Bacteria 1616
4 Ga0065165_1003031 3300005262 Bacteria 12647
5 Ga0065712_10056070 3300005290 Bacteria 659
6 Ga0065715_10120848 3300005293 Bacteria 2246
7 Ga0070658_10182587 3300005327 Bacteria 1766
8 Ga0070658_10289100 3300005327 Bacteria 1396
9 Ga0070658_10613061 3300005327 Bacteria 943
10 Ga0070676_10007895 3300005328 Bacteria 5719
11 Ga0070676_10011958 3300005328 Bacteria 4731
12 Ga0070676_10030674 3300005328 Bacteria 3067
13 Ga0070676_10152281 3300005328 Bacteria 1481
14 Ga0070676_10165762 3300005328 Bacteria 1425
15 Ga0070676_10202608 3300005328 Bacteria 1301
16 Ga0070676_10235372 3300005328 Bacteria 1216
17 Ga0070676_10278163 3300005328 Bacteria 1127
18 Ga0070683_100039749 3300005329 Bacteria 4321
19 Ga0070683_100557719 3300005329 Bacteria 1095
20 Ga0070683_101344516 3300005329 Bacteria 687
21 Ga0070690_100116392 3300005330 Bacteria 1789
22 Ga0070690_100367271 3300005330 Bacteria 1049
23 Ga0070690_100558543 3300005330 Bacteria 864
24 Ga0070670_100000334 3300005331 Bacteria 39594
25 Ga0070670_100044516 3300005331 Bacteria 3816
26 Ga0070670_100060634 3300005331 Bacteria 3248
27 Ga0070670_100075077 3300005331 Bacteria 2904
28 Ga0070670_100087706 3300005331 Bacteria 2674
29 Ga0070670_100220336 3300005331 Bacteria 1651
30 Ga0070670_100645234 3300005331 Bacteria 949
31 Ga0070670_100864623 3300005331 Bacteria 818
32 Ga0070670_101289499 3300005331 Bacteria 668
33 Ga0070677_10006421 3300005333 Bacteria 3906
34 Ga0070677_10006836 3300005333 Bacteria 3791
35 Ga0070677_10008378 3300005333 Bacteria 3477
36 Ga0070677_10081611 3300005333 Bacteria 1385
37 Ga0070677_10096075 3300005333 Bacteria 1298
38 Ga0070677_10117753 3300005333 Bacteria 1195
39 Ga0070677_10137535 3300005333 Bacteria 1123
40 Ga0070677_10213302 3300005333 Bacteria 939
41 Ga0070677_10245694 3300005333 Bacteria 886
42 Ga0070677_10450072 3300005333 Bacteria 689
43 Ga0068869_100013349 3300005334 Bacteria 5461
44 Ga0068869_100284837 3300005334 Bacteria 1330
45 Ga0068869_100378101 3300005334 Bacteria 1160
46 Ga0068869_100611001 3300005334 Bacteria 922
47 Ga0068869_100802983 3300005334 Bacteria 809
48 Ga0070666_10003466 3300005335 Bacteria 9561
49 Ga0070666_10596720 3300005335 Bacteria 806
50 Ga0070666_10635016 3300005335 Bacteria 780
51 Ga0070666_10677108 3300005335 Bacteria 755
52 Ga0070666_11039612 3300005335 Bacteria 608
53 Ga0070680_100012537 3300005336 Bacteria 6588
54 Ga0068868_100010821 3300005338 Bacteria 6618
55 Ga0068868_100055602 3300005338 Bacteria 3123
56 Ga0068868_100079519 3300005338 Bacteria 2626
57 Ga0068868_100336794 3300005338 Bacteria 1289
58 Ga0068868_100400257 3300005338 Bacteria 1185
59 Ga0068868_100656203 3300005338 Bacteria 935
60 Ga0068868_100856291 3300005338 Bacteria 824
61 Ga0068868_100893892 3300005338 Bacteria 807
62 Ga0070660_100120719 3300005339 Bacteria 2091
63 Ga0070660_100293410 3300005339 Bacteria 1332
64 Ga0070660_100618286 3300005339 Bacteria 906
65 Ga0070689_100252613 3300005340 Bacteria 1455
66 Ga0070689_100564921 3300005340 Bacteria 982
67 Ga0070687_100105520 3300005343 Bacteria 1586
68 Ga0070687_100367005 3300005343 Bacteria 934
69 Ga0070687_100694693 3300005343 Bacteria 710
70 Ga0070687_101539852 3300005343 Bacteria 501
71 Ga0070661_100022092 3300005344 Bacteria 4551
72 Ga0070661_100123527 3300005344 Bacteria 1940
73 Ga0070661_100150066 3300005344 Bacteria 1762
74 Ga0070661_100323746 3300005344 Bacteria 1204
75 Ga0070661_100595266 3300005344 Unclassified 893
76 Ga0070661_101402844 3300005344 Bacteria 588
77 Ga0070692_10358886 3300005345 Bacteria 908
78 Ga0070692_11380430 3300005345 Bacteria 508
79 Ga0070668_100030279 3300005347 Bacteria 4115
80 Ga0070668_100064311 3300005347 Bacteria 2844
81 Ga0070668_100526822 3300005347 Bacteria 1026
82 Ga0070668_100860308 3300005347 Bacteria 808
83 Ga0070668_101247167 3300005347 Bacteria 675
84 Ga0070669_100046349 3300005353 Bacteria 3170
85 Ga0070669_100118475 3300005353 Bacteria 2017
86 Ga0070669_100148531 3300005353 Bacteria 1813
87 Ga0070669_100398760 3300005353 Bacteria 1125
88 Ga0070669_101096316 3300005353 Bacteria 685
89 Ga0070675_100009823 3300005354 Bacteria 7457
90 Ga0070675_100037083 3300005354 Bacteria 3969
91 Ga0070675_100048867 3300005354 Bacteria 3470
92 Ga0070675_100072089 3300005354 Bacteria 2867
93 Ga0070675_100095821 3300005354 Bacteria 2492
94 Ga0070675_100145848 3300005354 Bacteria 2026
95 Ga0070675_100161112 3300005354 Bacteria 1929
96 Ga0070675_100671595 3300005354 Bacteria 942
97 Ga0070675_101026303 3300005354 Bacteria 757
98 Ga0070675_101329059 3300005354 Bacteria 662
99 Ga0070675_101827236 3300005354 Bacteria 560
100 Ga0070671_100004257 3300005355 Bacteria 11325
101 Ga0070671_100010829 3300005355 Bacteria 7317
102 Ga0070671_100010852 3300005355 Bacteria 7310
103 Ga0070671_100035500 3300005355 Bacteria 4130
104 Ga0070671_100054208 3300005355 Bacteria 3333
105 Ga0070671_100151034 3300005355 Bacteria 1961
106 Ga0070671_100352284 3300005355 Bacteria 1256
107 Ga0070671_100431186 3300005355 Bacteria 1130
108 Ga0070671_100541482 3300005355 Bacteria 1003
109 Ga0070671_100549835 3300005355 Bacteria 995
110 Ga0070671_100601713 3300005355 Bacteria 950
111 Ga0070671_100621150 3300005355 Bacteria 934
112 Ga0070671_100746480 3300005355 Bacteria 850
113 Ga0070671_100853014 3300005355 Bacteria 794
114 Ga0070674_100000872 3300005356 Bacteria 15687
115 Ga0070674_100017499 3300005356 Bacteria 4511
116 Ga0070674_100020439 3300005356 Bacteria 4231
117 Ga0070674_100042928 3300005356 Bacteria 3074
118 Ga0070674_100061607 3300005356 Bacteria 2619
119 Ga0070674_100422050 3300005356 Bacteria 1094
120 Ga0070674_100780396 3300005356 Bacteria 823
121 Ga0070674_100790631 3300005356 Bacteria 818
122 Ga0070673_100002229 3300005364 Bacteria 11725
123 Ga0070673_100029463 3300005364 Bacteria 4093
124 Ga0070673_100209803 3300005364 Bacteria 1681
125 Ga0070673_100283599 3300005364 Bacteria 1453
126 Ga0070673_100482213 3300005364 Bacteria 1119
127 Ga0070673_100917931 3300005364 Bacteria 812
128 Ga0070673_101102563 3300005364 Bacteria 741
129 Ga0070673_101157201 3300005364 Bacteria 724
130 Ga0070688_100227549 3300005365 Bacteria 1318
131 Ga0070659_100052563 3300005366 Bacteria 3205
132 Ga0070659_100238971 3300005366 Bacteria 1502
133 Ga0070659_100896862 3300005366 Bacteria 775
134 Ga0070659_101373298 3300005366 Bacteria 627
135 Ga0070659_102036705 3300005366 Bacteria 516
136 Ga0070667_100001505 3300005367 Bacteria 20850
137 Ga0070667_100032551 3300005367 Bacteria 4349
138 Ga0070667_100063471 3300005367 Bacteria 3130
139 Ga0070667_100177233 3300005367 Bacteria 1884
140 Ga0070667_100282605 3300005367 Bacteria 1490
141 Ga0070667_101867480 3300005367 Bacteria 565
142 Ga0070701_10412031 3300005438 Bacteria 859
143 Ga0070705_100773616 3300005440 Bacteria 761
144 Ga0070700_100486279 3300005441 Bacteria 947
145 Ga0070700_100511520 3300005441 Bacteria 926
146 Ga0070700_100735827 3300005441 Bacteria 788
147 Ga0070663_100022288 3300005455 Bacteria 4232
148 Ga0070663_100122435 3300005455 Bacteria 1966
149 Ga0070663_100416214 3300005455 Bacteria 1102
150 Ga0070663_100780688 3300005455 Bacteria 818
151 Ga0070663_100848311 3300005455 Bacteria 786
152 Ga0070678_100017379 3300005456 Bacteria 4630
153 Ga0070678_100093244 3300005456 Bacteria 2315
154 Ga0070678_100185327 3300005456 Bacteria 1707
155 Ga0070678_100322701 3300005456 Bacteria 1319
156 Ga0070678_100721715 3300005456 Bacteria 899
157 Ga0070678_100743803 3300005456 Bacteria 886
158 Ga0070678_100757931 3300005456 Bacteria 878
159 Ga0070678_100966038 3300005456 Bacteria 782
160 Ga0070678_101937979 3300005456 Bacteria 557
161 Ga0070662_100029907 3300005457 Bacteria 3806
162 Ga0070662_100213825 3300005457 Bacteria 1535
163 Ga0070662_100310989 3300005457 Bacteria 1282
164 Ga0070662_100759759 3300005457 Bacteria 822
165 Ga0070662_101136506 3300005457 Bacteria 671
166 Ga0070662_101239250 3300005457 Bacteria 641
167 Ga0070662_101297301 3300005457 Bacteria 626
168 Ga0070681_10177627 3300005458 Bacteria 2051
169 Ga0070681_10410491 3300005458 Bacteria 1266
170 Ga0068867_100010980 3300005459 Bacteria 6384
171 Ga0068867_100011650 3300005459 Bacteria 6209
172 Ga0068867_100027355 3300005459 Bacteria 4097
173 Ga0068867_100029135 3300005459 Bacteria 3977
174 Ga0068867_100138386 3300005459 Bacteria 1900
175 Ga0068867_100314874 3300005459 Bacteria 1294
176 Ga0068867_100987307 3300005459 Bacteria 763
177 Ga0068867_101212099 3300005459 Bacteria 694
178 Ga0068867_101993781 3300005459 Bacteria 548
179 Ga0070685_10082173 3300005466 Bacteria 1933
180 Ga0070699_100317735 3300005518 Bacteria 1399
181 Ga0070679_100000691 3300005530 Bacteria 28927
182 Ga0070679_100159319 3300005530 Bacteria 2231
183 Ga0070679_100940739 3300005530 Bacteria 808
184 Ga0070684_100054576 3300005535 Bacteria 3481
185 Ga0068853_100076200 3300005539 Bacteria 2928
186 Ga0068853_100102309 3300005539 Bacteria 2535
187 Ga0068853_100170182 3300005539 Bacteria 1971
188 Ga0068853_100345747 3300005539 Bacteria 1383
189 Ga0068853_100652212 3300005539 Bacteria 1002
190 Ga0068853_100816421 3300005539 Bacteria 893
191 Ga0068853_101437684 3300005539 Bacteria 667
192 Ga0068853_101617743 3300005539 Bacteria 628
193 Ga0068853_101716184 3300005539 Bacteria 609
194 Ga0068853_101757731 3300005539 Bacteria 601
195 Ga0070672_100012438 3300005543 Bacteria 5972
196 Ga0070672_100019128 3300005543 Bacteria 4965
197 Ga0070672_100021770 3300005543 Bacteria 4695
198 Ga0070672_100080708 3300005543 Bacteria 2606
199 Ga0070672_100096056 3300005543 Bacteria 2397
200 Ga0070672_100132447 3300005543 Bacteria 2050
201 Ga0070672_100189735 3300005543 Bacteria 1715
202 Ga0070672_100198784 3300005543 Bacteria 1676
203 Ga0070672_100364095 3300005543 Bacteria 1234
204 Ga0070672_100540986 3300005543 Bacteria 1010
205 Ga0070672_100636990 3300005543 Bacteria 930
206 Ga0070672_100796211 3300005543 Bacteria 831
207 Ga0070672_101648803 3300005543 Bacteria 576
208 Ga0070686_100446543 3300005544 Bacteria 993
209 Ga0070686_100856101 3300005544 Bacteria 737
210 Ga0070686_101555188 3300005544 Bacteria 559
211 Ga0070686_101577993 3300005544 Bacteria 555
212 Ga0070695_100279361 3300005545 Bacteria 1226
213 Ga0070693_100030221 3300005547 Bacteria 2961
214 Ga0070693_100111203 3300005547 Bacteria 1685
215 Ga0070693_100671530 3300005547 Bacteria 756
216 Ga0070665_100073467 3300005548 Bacteria 3425
217 Ga0070665_100526607 3300005548 Bacteria 1194
218 Ga0070665_100806133 3300005548 Bacteria 952
219 Ga0070665_100819728 3300005548 Bacteria 944
220 Ga0070665_101247166 3300005548 Bacteria 754
221 Ga0070665_101909177 3300005548 Bacteria 600
222 Ga0070665_102106153 3300005548 Bacteria 569
223 Ga0068855_100224232 3300005563 Bacteria 2107
224 Ga0070664_100175279 3300005564 Bacteria 1903
225 Ga0070664_100224547 3300005564 Bacteria 1681
226 Ga0070664_100533145 3300005564 Bacteria 1084
227 Ga0070664_100540979 3300005564 Bacteria 1076
228 Ga0070664_101200706 3300005564 Bacteria 715
229 Ga0070664_101369863 3300005564 Bacteria 668
230 Ga0070664_102074130 3300005564 Bacteria 540
231 Ga0068857_100302591 3300005577 Bacteria 1474
232 Ga0068857_100771888 3300005577 Bacteria 916
233 Ga0068857_101253612 3300005577 Bacteria 719
234 Ga0068857_102213244 3300005577 Bacteria 540
235 Ga0068854_100066733 3300005578 Bacteria 2619
236 Ga0068854_100111211 3300005578 Bacteria 2066
237 Ga0068854_100114061 3300005578 Bacteria 2042
238 Ga0068854_100129258 3300005578 Bacteria 1927
239 Ga0068854_100273394 3300005578 Bacteria 1357
240 Ga0068854_101407492 3300005578 Bacteria 631
241 Ga0068856_100259013 3300005614 Bacteria 1755
242 Ga0068856_100793270 3300005614 Bacteria 967
243 Ga0070702_100119007 3300005615 Bacteria 1650
244 Ga0070702_101699598 3300005615 Bacteria 525
245 Ga0070702_101862658 3300005615 Bacteria 504
246 Ga0068852_100030611 3300005616 Bacteria 4433
247 Ga0068852_100117867 3300005616 Bacteria 2425
248 Ga0068852_100141286 3300005616 Bacteria 2229
249 Ga0068852_100326162 3300005616 Bacteria 1492
250 Ga0068852_100328621 3300005616 Bacteria 1487
251 Ga0068852_100661751 3300005616 Bacteria 1052
252 Ga0068852_101191661 3300005616 Bacteria 782
253 Ga0068852_101241726 3300005616 Bacteria 766
254 Ga0068852_101462184 3300005616 Bacteria 706
255 Ga0068852_101511748 3300005616 Bacteria 694
256 Ga0068852_101694245 3300005616 Bacteria 655
257 Ga0068859_100121582 3300005617 Bacteria 2678
258 Ga0068859_100238610 3300005617 Bacteria 1907
259 Ga0068859_100685257 3300005617 Bacteria 1116
260 Ga0068859_101688161 3300005617 Bacteria 700
261 Ga0068864_100007117 3300005618 Bacteria 9189
262 Ga0068864_100032020 3300005618 Bacteria 4464
263 Ga0068864_100377487 3300005618 Bacteria 1343
264 Ga0068864_100380656 3300005618 Bacteria 1337
265 Ga0068864_100604369 3300005618 Bacteria 1064
266 Ga0068864_100673773 3300005618 Bacteria 1008
267 Ga0068864_101029247 3300005618 Bacteria 818
268 Ga0068864_101794862 3300005618 Bacteria 619
269 Ga0068866_10007228 3300005718 Bacteria 4645
270 Ga0068866_10195782 3300005718 Bacteria 1204
271 Ga0068866_10564443 3300005718 Bacteria 763
272 Ga0068861_100000343 3300005719 Bacteria 26498
273 Ga0068861_100011955 3300005719 Bacteria 6045
274 Ga0068861_100321369 3300005719 Bacteria 1348
275 Ga0068861_101121144 3300005719 Bacteria 757
276 Ga0068861_102572670 3300005719 Bacteria 513
277 Ga0068851_10002903 3300005834 Bacteria 7573
278 Ga0068851_10010554 3300005834 Bacteria 4313
279 Ga0068851_10056524 3300005834 Bacteria 2002
280 Ga0068851_10133644 3300005834 Bacteria 1344
281 Ga0068851_10164200 3300005834 Bacteria 1222
282 Ga0068851_10193935 3300005834 Bacteria 1130
283 Ga0068851_10507855 3300005834 Bacteria 724
284 Ga0068851_10812046 3300005834 Bacteria 581
285 Ga0068870_10063592 3300005840 Bacteria 1991
286 Ga0068870_10118521 3300005840 Bacteria 1521
287 Ga0068870_10897942 3300005840 Bacteria 626
288 Ga0068863_100065326 3300005841 Bacteria 3442
289 Ga0068863_100115186 3300005841 Bacteria 2561
290 Ga0068863_100130049 3300005841 Bacteria 2403
291 Ga0068863_100177120 3300005841 Bacteria 2047
292 Ga0068863_100413570 3300005841 Bacteria 1320
293 Ga0068863_101323130 3300005841 Bacteria 728
294 Ga0068863_102318511 3300005841 Bacteria 546
295 Ga0068858_100001875 3300005842 Bacteria 21440
296 Ga0068858_100005928 3300005842 Bacteria 11931
297 Ga0068858_100261499 3300005842 Bacteria 1645
298 Ga0068858_100652105 3300005842 Bacteria 1023
299 Ga0068860_100000707 3300005843 Bacteria 38265
300 Ga0068860_100000715 3300005843 Bacteria 37986
301 Ga0068860_100104922 3300005843 Bacteria 2698
302 Ga0068860_100189597 3300005843 Bacteria 1989
303 Ga0068862_100011541 3300005844 Bacteria 7290
304 Ga0068862_100014347 3300005844 Bacteria 6572
305 Ga0068862_100068622 3300005844 Bacteria 3059
306 Ga0068862_100415803 3300005844 Bacteria 1261
307 Ga0070717_11540018 3300006028 Bacteria 603
308 Ga0075368_10088381 3300006042 Bacteria 1266
309 Ga0075363_100328174 3300006048 Bacteria 891
310 Ga0070715_10096131 3300006163 Bacteria 1373
311 Ga0070715_10253411 3300006163 Bacteria 921
312 Ga0070715_10931147 3300006163 Bacteria 537
313 Ga0075362_10086726 3300006177 Bacteria 1449
314 Ga0075362_10277468 3300006177 Bacteria 828
315 Ga0075362_10458263 3300006177 Bacteria 648
316 Ga0075362_10545978 3300006177 Bacteria 596
317 Ga0075367_10496110 3300006178 Bacteria 774
318 Ga0075366_10170362 3300006195 Bacteria 1321
319 Ga0075366_10541221 3300006195 Bacteria 721
320 Ga0075366_10607848 3300006195 Bacteria 678
321 Ga0075366_10640360 3300006195 Bacteria 659
322 Ga0075366_10779250 3300006195 Bacteria 594
323 Ga0097621_100011190 3300006237 Bacteria 6605
324 Ga0097621_100044489 3300006237 Bacteria 3582
325 Ga0097621_100044639 3300006237 Bacteria 3576
326 Ga0097621_100093928 3300006237 Bacteria 2514
327 Ga0097621_102331765 3300006237 Bacteria 512
328 Ga0068871_100020020 3300006358 Bacteria 5119
329 Ga0068871_100277044 3300006358 Bacteria 1466
330 Ga0068871_100373397 3300006358 Bacteria 1265
331 Ga0068871_100484828 3300006358 Bacteria 1112
332 Ga0068871_101751292 3300006358 Bacteria 590
333 Ga0068865_100007045 3300006881 Bacteria 6901
334 Ga0068865_100024062 3300006881 Bacteria 3992
335 Ga0068865_100046341 3300006881 Bacteria 2983
336 Ga0068865_100092367 3300006881 Bacteria 2198
337 Ga0068865_100267267 3300006881 Bacteria 1356
338 Ga0097620_100121581 3300006931 Bacteria 2678
339 Ga0097620_100238594 3300006931 Bacteria 1907
340 Ga0097620_100685274 3300006931 Bacteria 1116
341 Ga0097620_101688261 3300006931 Bacteria 700
342 Ga0075435_100172515 3300007076 Bacteria 1825
343 Ga0105250_10473094 3300009092 Bacteria 565
344 Ga0105240_10055798 3300009093 Bacteria 4946
345 Ga0105240_10277408 3300009093 Bacteria 1927
346 Ga0105240_12534235 3300009093 Bacteria 530
347 Ga0111539_11849977 3300009094 Bacteria 700
348 Ga0105245_10064976 3300009098 Bacteria 3299
349 Ga0105245_10329579 3300009098 Bacteria 1506
350 Ga0105245_12341658 3300009098 Bacteria 588
351 Ga0105247_10067959 3300009101 Bacteria 2221
352 Ga0105247_11447209 3300009101 Bacteria 558
353 Ga0105247_11489538 3300009101 Bacteria 551
354 Ga0114129_11646705 3300009147 Bacteria 784
355 Ga0105243_10113425 3300009148 Bacteria 2273
356 Ga0105243_10132427 3300009148 Bacteria 2117
357 Ga0105243_10341295 3300009148 Bacteria 1372
358 Ga0105243_10870838 3300009148 Bacteria 894
359 Ga0105243_11316347 3300009148 Bacteria 740
360 Ga0105241_10371778 3300009174 Bacteria 1247
361 Ga0105241_11742821 3300009174 Bacteria 606
362 Ga0105242_10305956 3300009176 Bacteria 1453
363 Ga0105242_10709211 3300009176 Bacteria 985
364 Ga0105242_11118956 3300009176 Bacteria 802
365 Ga0105242_11582279 3300009176 Bacteria 689
366 Ga0105242_12948473 3300009176 Bacteria 526
367 Ga0105248_10002863 3300009177 Bacteria 19149
368 Ga0105248_10059166 3300009177 Bacteria 4303
369 Ga0105248_10617720 3300009177 Bacteria 1223
370 Ga0105248_10714340 3300009177 Bacteria 1131
371 Ga0105248_10715923 3300009177 Bacteria 1129
372 Ga0105237_10000367 3300009545 Bacteria 63983
373 Ga0105238_10040068 3300009551 Bacteria 4749
374 Ga0105238_10401529 3300009551 Bacteria 1364
375 Ga0105238_10487169 3300009551 Bacteria 1233
376 Ga0105238_10940719 3300009551 Bacteria 884
377 Ga0105238_12134239 3300009551 Bacteria 595
378 Ga0105249_10089453 3300009553 Bacteria 2877
379 Ga0105249_10133828 3300009553 Bacteria 2370
380 Ga0105249_10631708 3300009553 Bacteria 1127
381 Ga0105249_10669065 3300009553 Bacteria 1097
382 Ga0105249_11228564 3300009553 Bacteria 821
383 Ga0105249_12146313 3300009553 Bacteria 631
384 Ga0105239_10000150 3300010375 Bacteria 100349
385 Ga0105239_10276434 3300010375 Bacteria 1890
386 Ga0105246_10352684 3300011119 Bacteria 1206
387 Ga0105246_10761488 3300011119 Bacteria 855
388 Ga0105246_11093499 3300011119 Bacteria 727
389 Ga0105246_11817416 3300011119 Bacteria 583
390 Ga0157337_1038356 3300012483 Unclassified 519
391 Ga0157324_1038928 3300012506 Bacteria 574
392 Ga0157342_1031486 3300012507 Bacteria 670
393 Ga0157327_1075180 3300012512 Bacteria 533
394 Ga0157373_10025385 3300013100 Bacteria 4286
395 Ga0157373_10186599 3300013100 Bacteria 1461
396 Ga0157371_10072827 3300013102 Bacteria 2433
397 Ga0157371_10128765 3300013102 Bacteria 1800
398 Ga0157370_10185786 3300013104 Bacteria 1930
399 Ga0157370_10216969 3300013104 Bacteria 1773
400 Ga0157370_10808849 3300013104 Bacteria 853
401 Ga0157369_10304210 3300013105 Bacteria 1658
402 Ga0157369_10473092 3300013105 Bacteria 1297
403 Ga0157369_11770209 3300013105 Bacteria 628
404 Ga0157369_11993140 3300013105 Bacteria 589
405 Ga0157374_10011711 3300013296 Bacteria 7608
406 Ga0157374_10167425 3300013296 Bacteria 2142
407 Ga0157374_10497068 3300013296 Bacteria 1224
408 Ga0157374_10866612 3300013296 Bacteria 920
409 Ga0157378_10009725 3300013297 Bacteria 8376
410 Ga0157378_10128783 3300013297 Bacteria 2340
411 Ga0157378_10770619 3300013297 Bacteria 986
412 Ga0157378_11235427 3300013297 Bacteria 787
413 Ga0163162_10005242 3300013306 Bacteria 12495
414 Ga0163162_10033576 3300013306 Bacteria 5100
415 Ga0163162_10060697 3300013306 Bacteria 3817
416 Ga0163162_10087073 3300013306 Bacteria 3202
417 Ga0163162_10445140 3300013306 Bacteria 1427
418 Ga0163162_10771061 3300013306 Bacteria 1080
419 Ga0163162_10934425 3300013306 Bacteria 979
420 Ga0163162_11106003 3300013306 Bacteria 898
421 Ga0157372_10155294 3300013307 Bacteria 2643
422 Ga0157372_10324538 3300013307 Bacteria 1792
423 Ga0157372_10683649 3300013307 Bacteria 1194
424 Ga0157372_10688085 3300013307 Bacteria 1190
425 Ga0157375_10050873 3300013308 Bacteria 4066
426 Ga0157375_10075875 3300013308 Bacteria 3387
427 Ga0157375_10159639 3300013308 Bacteria 2396
428 Ga0157375_10234397 3300013308 Bacteria 1995
429 Ga0157375_10387830 3300013308 Bacteria 1564
430 Ga0157375_10496673 3300013308 Bacteria 1384
431 Ga0157375_10916976 3300013308 Bacteria 1019
432 Ga0157375_11111808 3300013308 Bacteria 925
433 Ga0157375_11532370 3300013308 Bacteria 787
434 Ga0157375_11561389 3300013308 Bacteria 780
435 Ga0163163_10014367 3300014325 Bacteria 7279
436 Ga0163163_10529428 3300014325 Bacteria 1241
437 Ga0163163_11098699 3300014325 Bacteria 858
438 Ga0163163_11138890 3300014325 Bacteria 843
439 Ga0163163_11420162 3300014325 Bacteria 756
440 Ga0163163_12367296 3300014325 Bacteria 590
441 Ga0163163_12479108 3300014325 Bacteria 577
442 Ga0157380_10011753 3300014326 Bacteria 6331
443 Ga0157380_10021172 3300014326 Bacteria 4874
444 Ga0157380_10061204 3300014326 Bacteria 3011
445 Ga0157380_10166331 3300014326 Bacteria 1922
446 Ga0157380_10281277 3300014326 Bacteria 1522
447 Ga0157380_10625553 3300014326 Bacteria 1069
448 Ga0157380_11209550 3300014326 Bacteria 799
449 Ga0157380_12583851 3300014326 Unclassified 574
450 Ga0157377_10017799 3300014745 Bacteria 3683
451 Ga0157377_10296155 3300014745 Bacteria 1066
452 Ga0157377_11613543 3300014745 Bacteria 520
453 Ga0157379_10000528 3300014968 Bacteria 30947
454 Ga0157379_10034268 3300014968 Bacteria 4526
455 Ga0157379_10034425 3300014968 Bacteria 4517
456 Ga0157379_10376614 3300014968 Bacteria 1302
457 Ga0157379_10411811 3300014968 Bacteria 1244
458 Ga0157379_10809452 3300014968 Bacteria 885
459 Ga0157379_11107729 3300014968 Bacteria 759
460 Ga0157376_10014036 3300014969 Bacteria 5997
461 Ga0157376_10130516 3300014969 Bacteria 2241
462 Ga0157376_10199089 3300014969 Bacteria 1841
463 Ga0157376_10762639 3300014969 Bacteria 977
464 Ga0157376_11214602 3300014969 Bacteria 782
465 Ga0157376_11397944 3300014969 Bacteria 731
466 Ga0182005_1053602 3300015265 Bacteria 1098
467 Ga0163161_10005129 3300017792 Bacteria 9108
468 Ga0163161_10085881 3300017792 Bacteria 2322
469 Ga0163161_10484359 3300017792 Bacteria 1005
470 Ga0163161_10830353 3300017792 Bacteria 778
471 Ga0163161_11527848 3300017792 Bacteria 587
472 Ga0163161_12049609 3300017792 Bacteria 509
473 Ga0213872_10000016 3300021361 Bacteria 180524
474 Ga0213876_10055319 3300021384 Bacteria 2095
475 Ga0209565_1070607 3300025263 Bacteria 590
476 Ga0209673_1027766 3300025273 Bacteria 1835
477 Ga0209758_1006025 3300025297 Bacteria 8954
478 Ga0209050_1001091 3300025298 Bacteria 32964
479 Ga0209257_1102802 3300025304 Bacteria 694
480 Ga0207697_10096614 3300025315 Bacteria 1256
481 Ga0207697_10290377 3300025315 Bacteria 725
482 Ga0207697_10296289 3300025315 Bacteria 717
483 Ga0207656_10106981 3300025321 Bacteria 1288
484 Ga0207656_10138223 3300025321 Bacteria 1147
485 Ga0207656_10151740 3300025321 Bacteria 1098
486 Ga0207656_10156984 3300025321 Bacteria 1080
487 Ga0207656_10178943 3300025321 Bacteria 1017
488 Ga0207656_10211827 3300025321 Bacteria 939
489 Ga0207656_10348212 3300025321 Bacteria 739
490 Ga0207682_10000725 3300025893 Bacteria 15303
491 Ga0207682_10003929 3300025893 Bacteria 6347
492 Ga0207682_10028381 3300025893 Bacteria 2233
493 Ga0207682_10069616 3300025893 Bacteria 1488
494 Ga0207642_10006251 3300025899 Bacteria 3951
495 Ga0207710_10134024 3300025900 Bacteria 1191
496 Ga0207688_10022082 3300025901 Bacteria 3482
497 Ga0207688_10397661 3300025901 Bacteria 854
498 Ga0207680_10012299 3300025903 Bacteria 4355
499 Ga0207680_10028426 3300025903 Bacteria 3128
500 Ga0207680_10175924 3300025903 Bacteria 1444
501 Ga0207680_10384721 3300025903 Bacteria 990
502 Ga0207685_10010306 3300025905 Bacteria 2753
503 Ga0207685_10809541 3300025905 Bacteria 516
504 Ga0207645_10017365 3300025907 Bacteria 4750
505 Ga0207645_10043897 3300025907 Bacteria 2861
506 Ga0207645_10044206 3300025907 Bacteria 2851
507 Ga0207645_10207552 3300025907 Bacteria 1290
508 Ga0207645_10880130 3300025907 Bacteria 609
509 Ga0207643_10454013 3300025908 Bacteria 816
510 Ga0207643_10924215 3300025908 Bacteria 565
511 Ga0207705_10199362 3300025909 Bacteria 1516
512 Ga0207705_10276262 3300025909 Bacteria 1285
513 Ga0207705_10371493 3300025909 Bacteria 1104
514 Ga0207705_10623561 3300025909 Bacteria 839
515 Ga0207654_10184095 3300025911 Bacteria 1364
516 Ga0207707_10315409 3300025912 Bacteria 1350
517 Ga0207707_11387295 3300025912 Bacteria 561
518 Ga0207695_10123068 3300025913 Bacteria 2560
519 Ga0207695_10985088 3300025913 Bacteria 723
520 Ga0207671_10000808 3300025914 Bacteria 39539
521 Ga0207671_10563606 3300025914 Bacteria 908
522 Ga0207660_10050947 3300025917 Bacteria 2942
523 Ga0207662_10008920 3300025918 Bacteria 5502
524 Ga0207662_10391099 3300025918 Bacteria 941
525 Ga0207662_10476268 3300025918 Bacteria 857
526 Ga0207657_10590231 3300025919 Bacteria 867
527 Ga0207657_10593843 3300025919 Bacteria 864
528 Ga0207649_10003067 3300025920 Bacteria 9172
529 Ga0207649_10046343 3300025920 Bacteria 2670
530 Ga0207649_10331111 3300025920 Bacteria 1122
531 Ga0207649_10592186 3300025920 Bacteria 852
532 Ga0207649_10679938 3300025920 Bacteria 797
533 Ga0207649_10904275 3300025920 Bacteria 692
534 Ga0207649_11135429 3300025920 Bacteria 617
535 Ga0207649_11421429 3300025920 Bacteria 549
536 Ga0207652_10003994 3300025921 Bacteria 12057
537 Ga0207652_11033990 3300025921 Bacteria 721
538 Ga0207652_11362930 3300025921 Unclassified 612
539 Ga0207681_10078779 3300025923 Bacteria 2320
540 Ga0207681_10128908 3300025923 Bacteria 1867
541 Ga0207681_10283872 3300025923 Bacteria 1304
542 Ga0207694_10037673 3300025924 Bacteria 3715
543 Ga0207694_10432688 3300025924 Bacteria 1097
544 Ga0207694_10698338 3300025924 Bacteria 856
545 Ga0207694_10906448 3300025924 Bacteria 745
546 Ga0207650_10000913 3300025925 Bacteria 22271
547 Ga0207650_10009570 3300025925 Bacteria 6627
548 Ga0207650_10033279 3300025925 Bacteria 3732
549 Ga0207650_10157405 3300025925 Bacteria 1797
550 Ga0207650_10301228 3300025925 Bacteria 1309
551 Ga0207659_10000189 3300025926 Bacteria 36771
552 Ga0207659_10028616 3300025926 Bacteria 3789
553 Ga0207659_10088146 3300025926 Bacteria 2311
554 Ga0207659_10098332 3300025926 Bacteria 2200
555 Ga0207659_10142039 3300025926 Bacteria 1865
556 Ga0207659_10521296 3300025926 Bacteria 1008
557 Ga0207687_10090230 3300025927 Bacteria 2233
558 Ga0207644_10018141 3300025931 Bacteria 4758
559 Ga0207644_10032530 3300025931 Bacteria 3639
560 Ga0207644_10040242 3300025931 Bacteria 3303
561 Ga0207644_10176881 3300025931 Bacteria 1670
562 Ga0207644_10363015 3300025931 Bacteria 1178
563 Ga0207644_10695873 3300025931 Bacteria 847
564 Ga0207644_10893404 3300025931 Bacteria 744
565 Ga0207644_11360521 3300025931 Bacteria 596
566 Ga0207690_10180979 3300025932 Bacteria 1587
567 Ga0207690_10317820 3300025932 Bacteria 1223
568 Ga0207690_10977548 3300025932 Bacteria 704
569 Ga0207690_10987519 3300025932 Bacteria 700
570 Ga0207690_11633755 3300025932 Bacteria 538
571 Ga0207706_10019673 3300025933 Bacteria 6074
572 Ga0207706_10046513 3300025933 Bacteria 3841
573 Ga0207706_10056711 3300025933 Bacteria 3453
574 Ga0207706_10249464 3300025933 Bacteria 1551
575 Ga0207706_10375740 3300025933 Bacteria 1234
576 Ga0207706_10557269 3300025933 Bacteria 986
577 Ga0207706_10776691 3300025933 Bacteria 815
578 Ga0207706_11333898 3300025933 Bacteria 592
579 Ga0207706_11526059 3300025933 Bacteria 544
580 Ga0207686_10057830 3300025934 Bacteria 2443
581 Ga0207686_10455454 3300025934 Bacteria 985
582 Ga0207709_10249456 3300025935 Bacteria 1296
583 Ga0207709_10375095 3300025935 Bacteria 1081
584 Ga0207709_10941137 3300025935 Bacteria 704
585 Ga0207709_11641056 3300025935 Bacteria 534
586 Ga0207670_10420861 3300025936 Bacteria 1072
587 Ga0207670_10726512 3300025936 Bacteria 823
588 Ga0207669_10251821 3300025937 Bacteria 1315
589 Ga0207669_10290215 3300025937 Bacteria 1238
590 Ga0207669_10355436 3300025937 Bacteria 1133
591 Ga0207669_10355444 3300025937 Bacteria 1133
592 Ga0207669_10356794 3300025937 Bacteria 1131
593 Ga0207669_10483492 3300025937 Bacteria 987
594 Ga0207669_10722280 3300025937 Bacteria 820
595 Ga0207704_10003998 3300025938 Bacteria 6711
596 Ga0207704_10051709 3300025938 Bacteria 2486
597 Ga0207704_10247305 3300025938 Bacteria 1336
598 Ga0207704_10463995 3300025938 Bacteria 1013
599 Ga0207704_10629573 3300025938 Bacteria 881
600 Ga0207665_10067160 3300025939 Bacteria 2441
601 Ga0207691_10002491 3300025940 Bacteria 18008
602 Ga0207691_10022344 3300025940 Bacteria 5967
603 Ga0207691_10036304 3300025940 Bacteria 4566
604 Ga0207691_10046984 3300025940 Bacteria 3964
605 Ga0207691_10060239 3300025940 Bacteria 3449
606 Ga0207691_10064120 3300025940 Bacteria 3330
607 Ga0207691_10115269 3300025940 Bacteria 2386
608 Ga0207691_10276681 3300025940 Bacteria 1445
609 Ga0207691_10416591 3300025940 Bacteria 1145
610 Ga0207691_10538816 3300025940 Bacteria 990
611 Ga0207691_11295023 3300025940 Bacteria 602
612 Ga0207691_11332922 3300025940 Bacteria 592
613 Ga0207711_10175231 3300025941 Bacteria 1948
614 Ga0207711_10199640 3300025941 Bacteria 1825
615 Ga0207711_10432966 3300025941 Bacteria 1224
616 Ga0207711_10905306 3300025941 Bacteria 820
617 Ga0207689_10023257 3300025942 Bacteria 5204
618 Ga0207689_10030492 3300025942 Bacteria 4494
619 Ga0207689_10604887 3300025942 Bacteria 922
620 Ga0207661_10025979 3300025944 Bacteria 4457
621 Ga0207661_10104735 3300025944 Bacteria 2382
622 Ga0207679_10294931 3300025945 Bacteria 1395
623 Ga0207679_10936490 3300025945 Bacteria 793
624 Ga0207679_11172985 3300025945 Bacteria 705
625 Ga0207679_12167833 3300025945 Bacteria 504
626 Ga0207667_10238026 3300025949 Bacteria 1863
627 Ga0207651_10006755 3300025960 Bacteria 6045
628 Ga0207651_10036579 3300025960 Bacteria 3206
629 Ga0207651_10261065 3300025960 Bacteria 1422
630 Ga0207651_10384276 3300025960 Bacteria 1190
631 Ga0207651_10663526 3300025960 Bacteria 916
632 Ga0207651_11726224 3300025960 Bacteria 564
633 Ga0207712_10158752 3300025961 Bacteria 1755
634 Ga0207712_10365122 3300025961 Bacteria 1204
635 Ga0207668_10154213 3300025972 Bacteria 1782
636 Ga0207668_10239930 3300025972 Bacteria 1466
637 Ga0207668_10581705 3300025972 Bacteria 973
638 Ga0207668_11032804 3300025972 Bacteria 735
639 Ga0207640_10064285 3300025981 Bacteria 2442
640 Ga0207640_10106518 3300025981 Bacteria 1978
641 Ga0207640_10345483 3300025981 Bacteria 1193
642 Ga0207640_10464869 3300025981 Bacteria 1046
643 Ga0207640_10727442 3300025981 Bacteria 853
644 Ga0207640_11092677 3300025981 Bacteria 705
645 Ga0207658_10259502 3300025986 Bacteria 1480
646 Ga0207658_10356188 3300025986 Bacteria 1275
647 Ga0207677_10006180 3300026023 Bacteria 6546
648 Ga0207677_10008231 3300026023 Bacteria 5812
649 Ga0207677_10243194 3300026023 Bacteria 1457
650 Ga0207677_10249684 3300026023 Bacteria 1440
651 Ga0207677_10374579 3300026023 Bacteria 1200
652 Ga0207677_10576931 3300026023 Bacteria 984
653 Ga0207677_10746347 3300026023 Bacteria 872
654 Ga0207677_10865955 3300026023 Bacteria 813
655 Ga0207703_10019219 3300026035 Bacteria 5337
656 Ga0207639_10168564 3300026041 Bacteria 1852
657 Ga0207639_10182817 3300026041 Bacteria 1785
658 Ga0207639_10393961 3300026041 Bacteria 1246
659 Ga0207639_10612436 3300026041 Bacteria 1005
660 Ga0207639_10765798 3300026041 Bacteria 898
661 Ga0207639_11162988 3300026041 Bacteria 724
662 Ga0207678_10098284 3300026067 Bacteria 2501
663 Ga0207678_10433145 3300026067 Bacteria 1141
664 Ga0207678_10809591 3300026067 Bacteria 827
665 Ga0207678_10856175 3300026067 Bacteria 803
666 Ga0207708_10033764 3300026075 Bacteria 3889
667 Ga0207708_10613258 3300026075 Bacteria 923
668 Ga0207708_10623155 3300026075 Bacteria 916
669 Ga0207702_10159617 3300026078 Bacteria 2058
670 Ga0207702_10629741 3300026078 Bacteria 1054
671 Ga0207702_10821268 3300026078 Bacteria 919
672 Ga0207702_10900339 3300026078 Bacteria 877
673 Ga0207702_11058535 3300026078 Bacteria 805
674 Ga0207641_10102813 3300026088 Bacteria 2520
675 Ga0207641_10145771 3300026088 Bacteria 2141
676 Ga0207641_10243287 3300026088 Bacteria 1677
677 Ga0207641_10853699 3300026088 Bacteria 902
678 Ga0207648_10001050 3300026089 Bacteria 30933
679 Ga0207648_10017069 3300026089 Bacteria 6617
680 Ga0207648_10020934 3300026089 Bacteria 5889
681 Ga0207648_10025462 3300026089 Bacteria 5269
682 Ga0207648_10038664 3300026089 Bacteria 4198
683 Ga0207648_10062807 3300026089 Bacteria 3238
684 Ga0207648_10077331 3300026089 Bacteria 2901
685 Ga0207648_10292324 3300026089 Bacteria 1459
686 Ga0207648_12067787 3300026089 Bacteria 531
687 Ga0207676_10010740 3300026095 Bacteria 6529
688 Ga0207676_10012969 3300026095 Bacteria 5985
689 Ga0207676_10017091 3300026095 Bacteria 5255
690 Ga0207676_10112784 3300026095 Bacteria 2278
691 Ga0207676_10365923 3300026095 Bacteria 1338
692 Ga0207676_10714042 3300026095 Bacteria 972
693 Ga0207676_11128801 3300026095 Bacteria 775
694 Ga0207676_11427397 3300026095 Bacteria 688
695 Ga0207674_10037357 3300026116 Bacteria 5052
696 Ga0207674_10284228 3300026116 Bacteria 1603
697 Ga0207674_11617705 3300026116 Unclassified 616
698 Ga0207675_100009210 3300026118 Bacteria 9259
699 Ga0207675_100013996 3300026118 Bacteria 7479
700 Ga0207675_100017970 3300026118 Bacteria 6596
701 Ga0207675_100112605 3300026118 Bacteria 2568
702 Ga0207675_100174563 3300026118 Bacteria 2056
703 Ga0207675_101810132 3300026118 Bacteria 630
704 Ga0207683_10040810 3300026121 Bacteria 4052
705 Ga0207683_10111933 3300026121 Bacteria 2445
706 Ga0207683_10126252 3300026121 Bacteria 2299
707 Ga0207683_10153083 3300026121 Bacteria 2082
708 Ga0207683_10218485 3300026121 Bacteria 1736
709 Ga0207683_10374633 3300026121 Bacteria 1308
710 Ga0207683_10386693 3300026121 Bacteria 1286
711 Ga0207683_10488608 3300026121 Bacteria 1137
712 Ga0207683_10488687 3300026121 Bacteria 1136
713 Ga0207683_10899242 3300026121 Bacteria 822
714 Ga0207683_12163852 3300026121 Bacteria 504
715 Ga0207683_12165804 3300026121 Bacteria 504
716 Ga0207698_10208020 3300026142 Bacteria 1758
717 Ga0207698_10446682 3300026142 Bacteria 1247
718 Ga0207698_10505164 3300026142 Bacteria 1177
719 Ga0207698_10671196 3300026142 Bacteria 1029
720 Ga0207698_11049577 3300026142 Bacteria 827
721 Ga0207698_11255847 3300026142 Bacteria 755
722 Ga0207698_11448840 3300026142 Bacteria 702
723 Ga0209971_1176159 3300027682 Bacteria 527
724 Ga0209998_10190354 3300027717 Bacteria 535
725 Ga0209974_10453080 3300027876 Bacteria 509
726 Ga0268266_10186889 3300028379 Bacteria 1890
727 Ga0268266_10196117 3300028379 Bacteria 1846
728 Ga0268266_10415357 3300028379 Bacteria 1274
729 Ga0268266_10483353 3300028379 Bacteria 1181
730 Ga0268266_10588612 3300028379 Bacteria 1068
731 Ga0268266_10766275 3300028379 Bacteria 932
732 Ga0268265_10130233 3300028380 Bacteria 2089
733 Ga0268265_10155930 3300028380 Bacteria 1932
734 Ga0268265_10302348 3300028380 Bacteria 1441
735 Ga0268265_10329869 3300028380 Bacteria 1385
736 Ga0268264_10010116 3300028381 Bacteria 7806
737 Ga0268264_10216090 3300028381 Bacteria 1762
738 Ga0268264_10430402 3300028381 Bacteria 1274
739 Ga0268264_10483122 3300028381 Bacteria 1205
740 Ga0307517_10219604 3300028786 Bacteria 1157
741 Ga0307515_10000191 3300028794 Bacteria 149201
742 Ga0307515_10204109 3300028794 Bacteria 1843
743 Ga0307513_10241228 3300031456 Bacteria 1612
744 Ga0307513_10866818 3300031456 Bacteria 610
745 Ga0307509_10079558 3300031507 Bacteria 3393
746 Ga0307408_100087773 3300031548 Bacteria 2341
747 Ga0307516_10000254 3300031730 Bacteria 68771
748 Ga0307516_10031298 3300031730 Bacteria 5363
749 Ga0307405_10019062 3300031731 Bacteria 3801
750 Ga0307405_10231283 3300031731 Bacteria 1363
751 Ga0307405_10610104 3300031731 Bacteria 892
752 Ga0307413_10038148 3300031824 Bacteria 2782
753 Ga0307413_10328609 3300031824 Bacteria 1171
754 Ga0307413_11204990 3300031824 Bacteria 658
755 Ga0307410_10012223 3300031852 Bacteria 4953
756 Ga0307410_10099902 3300031852 Bacteria 2078
757 Ga0307410_11527741 3300031852 Bacteria 589
758 Ga0307406_10022580 3300031901 Bacteria 3734
759 Ga0307406_10184957 3300031901 Bacteria 1520
760 Ga0307407_10033866 3300031903 Bacteria 2791
761 Ga0307407_10239113 3300031903 Bacteria 1238
762 Ga0307407_10313447 3300031903 Bacteria 1098
763 Ga0307412_10016388 3300031911 Bacteria 4414
764 Ga0307412_10274935 3300031911 Bacteria 1320
765 Ga0307412_10314711 3300031911 Bacteria 1243
766 Ga0307412_11516339 3300031911 Bacteria 610
767 Ga0307409_100001576 3300031995 Bacteria 11368
768 Ga0307409_100300756 3300031995 Bacteria 1492
769 Ga0307409_100843065 3300031995 Bacteria 927
770 Ga0307409_100939520 3300031995 Bacteria 880
771 Ga0307416_100001923 3300032002 Bacteria 11600
772 Ga0307416_100076333 3300032002 Bacteria 2808
773 Ga0307416_100419595 3300032002 Bacteria 1382
774 Ga0307416_101245998 3300032002 Bacteria 849
775 Ga0307416_102148113 3300032002 Bacteria 660
776 Ga0307411_10009826 3300032005 Bacteria 5059
777 Ga0307411_10024755 3300032005 Bacteria 3584
778 Ga0307411_11067351 3300032005 Bacteria 726
779 Ga0307411_11218013 3300032005 Bacteria 683
780 Ga0307411_11313255 3300032005 Bacteria 659
781 Ga0307415_100074130 3300032126 Bacteria 2404
782 Ga0373930_0076066 3300034816 Bacteria 770
783 Ga0373948_0048606 3300034817 Bacteria 906
784 Ga0373959_0091513 3300034820 Bacteria 713
785 Ga0373938_0011101 3300034957 Bacteria 1669
786 Ga0373926_0070870 3300035083 Bacteria 1280
787 Ga0373940_0083197 3300035088 Bacteria 949
788 Ga0373944_0010740 3300035089 Bacteria 2501
789 Ga0373944_0160282 3300035089 Bacteria 798
790 Ga0373949_0024439 3300035090 Bacteria 1405
791 Ga0373951_0229139 3300035091 Bacteria 551
792 Ga0373952_0077468 3300035092 Bacteria 842
793 Ga0373923_0118788 3300035111 Bacteria 1180
794 Ga0373939_0411611 3300035114 Bacteria 562
795 Ga0373954_0269983 3300035118 Bacteria 838
796 Ga0373956_0036705 3300035119 Bacteria 2164
797 Ga0373946_0111453 3300035171 Bacteria 1239
798 Ga0373946_0162806 3300035171 Bacteria 1049
799 Ga0373946_0525150 3300035171 Bacteria 609
800 Ga0373955_0214586 3300035172 Bacteria 1148
801 Ga0373955_0244715 3300035172 Bacteria 1075
802 Ga0373961_0160173 3300035241 Bacteria 772
803 Ga0373924_0564452 3300035410 Bacteria 513
804 Ga0373931_0004801 3300035691 Bacteria 6204
805 Ga0373935_0030710 3300035692 Bacteria 3331
806 Ga0373927_0439112 3300035695 Bacteria 862
807 Ga0373933_0292065 3300035724 Bacteria 1054
808 Ga0373933_0383816 3300035724 Bacteria 915
809 Ga0373947_0666259 3300035725 Bacteria 710
810 Ga0373937_0161905 3300036401 Bacteria 2098
811 Ga0373937_0210205 3300036401 Bacteria 1831
812 Ga0373937_1129495 3300036401 Bacteria 732
813 Ga0373937_1531714 3300036401 Bacteria 614
814 Ga0373925_0004683 3300037068 Bacteria 10322
815 Ga0373925_0239360 3300037068 Bacteria 1453
816 Ga0373925_0295789 3300037068 Bacteria 1306
817 Ga0436365_1570775 3300039437 Bacteria 807
818 Ga0436365_1878872 3300039437 Bacteria 4411
819 Ga0436361_0376061 3300039447 Bacteria 200571
820 Ga0436363_1315143 3300039450 Bacteria 4526
821 Ga0451789_1257448 3300041443 Bacteria 581
822 Ga0451791_1178732 3300041451 Bacteria 826
823 Ga0451797_0024097 3300041453 Bacteria 662
824 Ga0451797_0182074 3300041453 Bacteria 793
825 Ga0451795_1526863 3300041456 Bacteria 551
826 Ga0451795_1640012 3300041456 Bacteria 584
827 Ga0451798_0162675 3300041458 Unclassified 629
828 Ga0451798_0537668 3300041458 Bacteria 1903
829 Ga0451800_0361784 3300041459 Bacteria 749
830 Ga0451800_0425630 3300041459 Bacteria 808
831 Ga0451802_0181316 3300041460 Bacteria 671
832 Ga0451802_0227888 3300041460 Bacteria 586
833 Ga0451802_1108283 3300041460 Bacteria 3753
834 Ga0451804_0420921 3300041463 Bacteria 1853
835 Ga0451804_1130280 3300041463 Bacteria 863
836 Ga0451807_2633116 3300041486 Bacteria 568
837 Ga0451841_0660538 3300041498 Bacteria 1024
838 Ga0451841_0913474 3300041498 Bacteria 508
839 Ga0451847_0580709 3300041503 Bacteria 754
840 Ga0451849_1316584 3300041505 Bacteria 630
841 Ga0451851_0104455 3300041507 Bacteria 2301
842 Ga0451851_0279755 3300041507 Bacteria 520
843 Ga0451853_0463049 3300041512 Bacteria 855
844 Ga0451853_2526968 3300041512 Bacteria 757
845 Ga0451853_3410975 3300041512 Bacteria 882
846 Ga0439441_072363 3300042001 Bacteria 741
847 Ga0439448_0265163 3300042005 Bacteria 607
848 Ga0439456_176370 3300042013 Bacteria 503
849 Ga0450888_075937 3300042126 Bacteria 511
850 Ga0450897_015541 3300042128 Bacteria 778
851 Ga0439458_0162222 3300042157 Bacteria 602
852 Ga0439464_0019626 3300042439 Bacteria 1846
853 Ga0439464_0193506 3300042439 Bacteria 647
854 Ga0439464_0212305 3300042439 Bacteria 619
855 Ga0450918_000075 3300042531 Bacteria 20738
856 Ga0451577_0001353 3300042876 Bacteria 33109
857 Ga0451577_1257332 3300042876 Bacteria 659
858 Ga0439440_0164943 3300042993 Bacteria 641
859 Ga0453684_0006474 3300044712 Bacteria 22221
860 Ga0466968_0025097 3300044735 Bacteria 2439
861 Ga0495629_0411126 3300046459 Bacteria 919
862 Ga0495580_0035100 3300046472 Bacteria 3606
863 Ga0495582_0122099 3300046473 Bacteria 1468
864 Ga0495662_0150853 3300046476 Bacteria 1145
865 Ga0495610_0018172 3300046512 Bacteria 3979
866 Ga0495620_0145710 3300046515 Bacteria 925
867 Ga0495620_0354768 3300046515 Bacteria 556
868 Ga0495628_0425675 3300046516 Bacteria 967
869 Ga0495628_1154398 3300046516 Bacteria 527
870 Ga0495632_0107252 3300046519 Bacteria 1313
871 Ga0495654_0236292 3300046530 Bacteria 767
872 Ga0495640_0211526 3300046533 Bacteria 1226
873 Ga0495640_0553282 3300046533 Bacteria 697
874 Ga0495586_0101742 3300046535 Bacteria 1595
875 Ga0495587_0734277 3300046536 Unclassified 541
876 Ga0495598_0303288 3300046537 Bacteria 605
877 Ga0495621_0177144 3300046539 Bacteria 849
878 Ga0495621_0457265 3300046539 Bacteria 547
879 Ga0495645_0218962 3300046543 Bacteria 1281
880 Ga0495645_0966754 3300046543 Bacteria 502
881 Ga0495633_0364923 3300046558 Bacteria 654
882 Ga0495656_0650507 3300046615 Bacteria 566
883 Ga0495668_0520039 3300046616 Bacteria 656
884 Ga0495611_0274090 3300046648 Bacteria 780
885 Ga0495625_0005772 3300046660 Bacteria 11192
886 Ga0495635_0497593 3300046663 Bacteria 803
887 Ga0495635_0962027 3300046663 Bacteria 545
888 Ga0495623_0369829 3300046679 Bacteria 777
889 Ga0495647_0038717 3300046681 Bacteria 1804
890 Ga0495647_0166447 3300046681 Bacteria 953
891 Ga0495658_0015916 3300046683 Bacteria 3866
892 Ga0495658_0075446 3300046683 Bacteria 1968
893 Ga0495658_0174708 3300046683 Bacteria 1331
894 Ga0495658_0274123 3300046683 Bacteria 1064
895 Ga0495658_0362831 3300046683 Bacteria 921
896 Ga0495658_0532797 3300046683 Bacteria 752
897 Ga0495613_0084712 3300046689 Bacteria 2301
898 Ga0495613_1093267 3300046689 Unclassified 509
899 Ga0495670_0306392 3300046691 Bacteria 852
900 Ga0495676_0382241 3300047321 Bacteria 937
901 Ga0495681_0393987 3300047470 Bacteria 519
902 Ga0495684_0108451 3300047471 Bacteria 2097
903 Ga0495686_0130669 3300047472 Bacteria 1489
904 Ga0495615_0139808 3300048090 Bacteria 714
905 Ga0496100_0323352 3300048903 Bacteria 1159
906 Ga0496100_0549204 3300048903 Bacteria 894
907 Ga0496100_0998384 3300048903 Bacteria 659
908 Ga0496101_0119392 3300048904 Bacteria 1992
909 Ga0496103_0324954 3300048906 Bacteria 989
910 Ga0496104_0008841 3300048907 Bacteria 8953
911 Ga0496104_0147333 3300048907 Bacteria 2261
912 Ga0496104_0397604 3300048907 Bacteria 1290
913 Ga0496105_0059786 3300048908 Bacteria 3145
914 Ga0496105_0154988 3300048908 Bacteria 1882
915 Ga0496105_0825661 3300048908 Bacteria 703
916 Ga0496106_0192393 3300048909 Bacteria 1622
917 Ga0496106_0278486 3300048909 Bacteria 1340
918 Ga0496107_0119919 3300048910 Bacteria 1937
919 Ga0496108_0130837 3300048911 Bacteria 2157
920 Ga0496108_0204984 3300048911 Bacteria 1711
921 Ga0496108_1503077 3300048911 Bacteria 560
922 Ga0496109_0098011 3300048912 Bacteria 2718
923 Ga0496109_0162683 3300048912 Bacteria 2091
924 Ga0496109_0627133 3300048912 Bacteria 1012
925 Ga0496110_0167874 3300048913 Bacteria 1990
926 Ga0496110_0172128 3300048913 Bacteria 1965
927 Ga0496110_0422460 3300048913 Bacteria 1215
928 Ga0496111_0794761 3300048914 Bacteria 685
929 Ga0496113_0228840 3300048916 Bacteria 1482
930 Ga0496114_0052168 3300048917 Bacteria 3407
931 Ga0496114_0797284 3300048917 Bacteria 823
932 Ga0496114_1268649 3300048917 Bacteria 623
933 Ga0496115_0030587 3300048918 Bacteria 4237
934 Ga0496115_1459923 3300048918 Bacteria 503
935 Ga0496125_0331353 3300048928 Bacteria 918
936 Ga0501079_1672772 3300049741 Bacteria 500
937 Ga0501081_0748108 3300049743 Bacteria 735
938 nmdc:mga03683_47620_c2 3300050489 Bacteria 998
939 nmdc:mga03n38_119825_c1 3300050490 Bacteria 1292
940 nmdc:mga03n38_651268_c1 3300050490 Bacteria 604
941 nmdc:mga03n38_902856_c1 3300050490 Bacteria 519
942 nmdc:mga00v17_1011743_c1 3300050491 Bacteria 523
943 nmdc:mga0k408_213015_c1 3300050493 Bacteria 1154
944 nmdc:mga0k408_261538_c1 3300050493 Bacteria 1033
945 nmdc:mga0k408_2772_c1 3300050493 Bacteria 9313
946 nmdc:mga0k408_33626_c1 3300050493 Bacteria 2933
947 nmdc:mga0k408_48695_c1 3300050493 Bacteria 2452
948 nmdc:mga0k408_698136_c1 3300050493 Bacteria 595
949 nmdc:mga0k408_859493_c1 3300050493 Bacteria 527
950 nmdc:mga0k408_88833_c1 3300050493 Bacteria 1815
951 nmdc:mga06z11_431626_c1 3300050494 Bacteria 795
952 nmdc:mga05p37_1271046_c1 3300050507 Bacteria 753
953 nmdc:mga08y16_1323210_c1 3300050511 Bacteria 686
954 nmdc:mga08y16_369155_c1 3300050511 Bacteria 1472
955 nmdc:mga0n895_103732_c1 3300050512 Bacteria 2855
956 nmdc:mga0rr50_1274026_c1 3300050513 Bacteria 624
957 nmdc:mga0sz30_288303_c1 3300050516 Bacteria 731
958 Ga0495601_0024573 3300053077 Bacteria 3712
959 Ga0495612_0109924 3300053078 Bacteria 1179
960 Ga0495612_0420894 3300053078 Bacteria 608
961 Ga0495595_0190648 3300053084 Bacteria 1019
962 Ga0495595_0406689 3300053084 Bacteria 690
963 Ga0495619_0155441 3300053085 Bacteria 1578
964 Ga0500578_0000002 3300053086 Bacteria 293507
965 Ga0500578_0773424 3300053086 Bacteria 510
966 Ga0500658_0012730 3300053134 Bacteria 3106
967 Ga0500604_0325706 3300053151 Bacteria 533
968 Ga0500587_000275 3300053739 Bacteria 5679
969 Ga0590071_000456 3300059421 Bacteria 11882
970 Ga0590074_051835 3300059423 Bacteria 752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1570775 Ga0436365_1570775_538_711 55
2 iso_pu_bacteria 2643221592 2643969512 55
3 iso_pu_bacteria 2643221625 2644143812 55
4 iso_pu_bacteria 2643221648 2644276482 55
5 3300005327 Ga0070658_10289100 Ga0070658_102891002 56
6 3300005331 Ga0070670_100864623 Ga0070670_1008646231 56
7 3300005333 Ga0070677_10213302 Ga0070677_102133022 56
8 3300005334 Ga0068869_100802983 Ga0068869_1008029831 56
9 3300005335 Ga0070666_10596720 Ga0070666_105967202 56
10 3300005344 Ga0070661_100595266 Ga0070661_1005952662 56
11 3300005347 Ga0070668_101247167 Ga0070668_1012471672 56
12 3300005354 Ga0070675_100161112 Ga0070675_1001611122 56
13 3300005354 Ga0070675_101329059 Ga0070675_1013290591 56
14 3300005355 Ga0070671_100853014 Ga0070671_1008530142 56
15 3300005356 Ga0070674_100790631 Ga0070674_1007906312 56
16 3300005364 Ga0070673_101102563 Ga0070673_1011025632 56
17 3300005366 Ga0070659_100896862 Ga0070659_1008968622 56
18 3300005456 Ga0070678_100721715 Ga0070678_1007217151 56
19 3300005457 Ga0070662_101136506 Ga0070662_1011365061 56
20 3300005539 Ga0068853_101617743 Ga0068853_1016177431 56
21 3300005543 Ga0070672_100796211 Ga0070672_1007962111 56
22 3300005547 Ga0070693_100671530 Ga0070693_1006715302 56
23 3300005616 Ga0068852_100117867 Ga0068852_1001178672 56
24 3300005834 Ga0068851_10164200 Ga0068851_101642002 56
25 3300009101 Ga0105247_11447209 Ga0105247_114472091 56
26 3300009176 Ga0105242_11582279 Ga0105242_115822792 56
27 3300011119 Ga0105246_10352684 Ga0105246_103526842 56
28 3300013306 Ga0163162_10934425 Ga0163162_109344252 56
29 3300013308 Ga0157375_10496673 Ga0157375_104966731 56
30 3300014326 Ga0157380_10625553 Ga0157380_106255532 56
31 3300025321 Ga0207656_10348212 Ga0207656_103482122 56
32 3300025901 Ga0207688_10397661 Ga0207688_103976612 56
33 3300025908 Ga0207643_10454013 Ga0207643_104540132 56
34 3300025931 Ga0207644_11360521 Ga0207644_113605211 56
35 3300025932 Ga0207690_10987519 Ga0207690_109875192 56
36 3300025933 Ga0207706_10056711 Ga0207706_100567113 56
37 3300025940 Ga0207691_10416591 Ga0207691_104165912 56
38 3300025945 Ga0207679_10294931 Ga0207679_102949312 56
39 3300025981 Ga0207640_10106518 Ga0207640_101065182 56
40 3300026142 Ga0207698_11255847 Ga0207698_112558472 56
41 iso_pu_bacteria 2585428062 2587755163 56
42 3300003371 JGI26145J50221_1001962 JGI26145J50221_10019622 59
43 3300005262 Ga0065165_1003031 Ga0065165_100303112 59
44 3300005330 Ga0070690_100558543 Ga0070690_1005585432 59
45 3300005333 Ga0070677_10117753 Ga0070677_101177532 59
46 3300005334 Ga0068869_100611001 Ga0068869_1006110012 59
47 3300005343 Ga0070687_101539852 Ga0070687_1015398521 59
48 3300005345 Ga0070692_11380430 Ga0070692_113804302 59
49 3300005347 Ga0070668_100030279 Ga0070668_1000302793 59
50 3300005353 Ga0070669_100046349 Ga0070669_1000463492 59
51 3300005355 Ga0070671_100601713 Ga0070671_1006017132 59
52 3300005356 Ga0070674_100061607 Ga0070674_1000616072 59
53 3300005367 Ga0070667_100177233 Ga0070667_1001772332 59
54 3300005441 Ga0070700_100735827 Ga0070700_1007358272 59
55 3300005459 Ga0068867_100011650 Ga0068867_1000116503 59
56 3300005518 Ga0070699_100317735 Ga0070699_1003177352 59
57 3300005539 Ga0068853_100102309 Ga0068853_1001023092 59
58 3300005539 Ga0068853_101437684 Ga0068853_1014376842 59
59 3300005543 Ga0070672_100080708 Ga0070672_1000807081 59
60 3300005544 Ga0070686_100446543 Ga0070686_1004465431 59
61 3300005548 Ga0070665_100806133 Ga0070665_1008061332 59
62 3300005548 Ga0070665_100819728 Ga0070665_1008197282 59
63 3300005548 Ga0070665_101247166 Ga0070665_1012471661 59
64 3300005616 Ga0068852_100328621 Ga0068852_1003286212 59
65 3300005617 Ga0068859_100121582 Ga0068859_1001215821 59
66 3300005617 Ga0068859_100685257 Ga0068859_1006852572 59
67 3300005718 Ga0068866_10007228 Ga0068866_100072282 59
68 3300005718 Ga0068866_10564443 Ga0068866_105644432 59
69 3300005719 Ga0068861_100000343 Ga0068861_1000003432 59
70 3300005719 Ga0068861_100321369 Ga0068861_1003213692 59
71 3300005834 Ga0068851_10507855 Ga0068851_105078552 59
72 3300005842 Ga0068858_100261499 Ga0068858_1002614992 59
73 3300005842 Ga0068858_100652105 Ga0068858_1006521051 59
74 3300005843 Ga0068860_100000715 Ga0068860_10000071523 59
75 3300005843 Ga0068860_100189597 Ga0068860_1001895972 59
76 3300005844 Ga0068862_100011541 Ga0068862_1000115417 59
77 3300005844 Ga0068862_100068622 Ga0068862_1000686223 59
78 3300006042 Ga0075368_10088381 Ga0075368_100883812 59
79 3300006177 Ga0075362_10277468 Ga0075362_102774681 59
80 3300006177 Ga0075362_10458263 Ga0075362_104582632 59
81 3300006178 Ga0075367_10496110 Ga0075367_104961102 59
82 3300006195 Ga0075366_10779250 Ga0075366_107792502 59
83 3300006881 Ga0068865_100007045 Ga0068865_1000070458 59
84 3300006931 Ga0097620_100121581 Ga0097620_1001215811 59
85 3300006931 Ga0097620_100685274 Ga0097620_1006852742 59
86 3300009092 Ga0105250_10473094 Ga0105250_104730941 59
87 3300009093 Ga0105240_10055798 Ga0105240_100557983 59
88 3300009101 Ga0105247_11489538 Ga0105247_114895381 59
89 3300009148 Ga0105243_10113425 Ga0105243_101134252 59
90 3300009148 Ga0105243_10870838 Ga0105243_108708382 59
91 3300009174 Ga0105241_10371778 Ga0105241_103717781 59
92 3300009176 Ga0105242_11118956 Ga0105242_111189562 59
93 3300009545 Ga0105237_10000367 Ga0105237_1000036750 59
94 3300009551 Ga0105238_10040068 Ga0105238_100400683 59
95 3300009551 Ga0105238_10401529 Ga0105238_104015292 59
96 3300009553 Ga0105249_10133828 Ga0105249_101338281 59
97 3300009553 Ga0105249_12146313 Ga0105249_121463131 59
98 3300010375 Ga0105239_10000150 Ga0105239_1000015064 59
99 3300011119 Ga0105246_11093499 Ga0105246_110934992 59
100 3300013297 Ga0157378_10009725 Ga0157378_100097252 59
101 3300013306 Ga0163162_10005242 Ga0163162_1000524210 59
102 3300013308 Ga0157375_10387830 Ga0157375_103878302 59
103 3300014326 Ga0157380_10011753 Ga0157380_100117533 59
104 3300014968 Ga0157379_10376614 Ga0157379_103766142 59
105 3300014968 Ga0157379_11107729 Ga0157379_111077292 59
106 3300021361 Ga0213872_10000016 Ga0213872_1000001642 59
107 3300025263 Ga0209565_1070607 Ga0209565_10706072 59
108 3300025273 Ga0209673_1027766 Ga0209673_10277663 59
109 3300025298 Ga0209050_1001091 Ga0209050_100109111 59
110 3300025304 Ga0209257_1102802 Ga0209257_11028022 59
111 3300025321 Ga0207656_10178943 Ga0207656_101789431 59
112 3300025899 Ga0207642_10006251 Ga0207642_100062514 59
113 3300025911 Ga0207654_10184095 Ga0207654_101840951 59
114 3300025913 Ga0207695_10123068 Ga0207695_101230683 59
115 3300025914 Ga0207671_10000808 Ga0207671_100008087 59
116 3300025924 Ga0207694_10037673 Ga0207694_100376732 59
117 3300025935 Ga0207709_10249456 Ga0207709_102494562 59
118 3300025935 Ga0207709_10941137 Ga0207709_109411372 59
119 3300025937 Ga0207669_10483492 Ga0207669_104834922 59
120 3300025938 Ga0207704_10003998 Ga0207704_100039986 59
121 3300025940 Ga0207691_10036304 Ga0207691_100363043 59
122 3300025972 Ga0207668_10154213 Ga0207668_101542132 59
123 3300026035 Ga0207703_10019219 Ga0207703_100192195 59
124 3300026041 Ga0207639_10393961 Ga0207639_103939612 59
125 3300026041 Ga0207639_11162988 Ga0207639_111629882 59
126 3300026075 Ga0207708_10033764 Ga0207708_100337642 59
127 3300026089 Ga0207648_10001050 Ga0207648_1000105012 59
128 3300026118 Ga0207675_100017970 Ga0207675_1000179706 59
129 3300026118 Ga0207675_100174563 Ga0207675_1001745632 59
130 3300026142 Ga0207698_10671196 Ga0207698_106711962 59
131 3300026142 Ga0207698_11448840 Ga0207698_114488402 59
132 3300027682 Ga0209971_1176159 Ga0209971_11761591 59
133 3300027717 Ga0209998_10190354 Ga0209998_101903542 59
134 3300027876 Ga0209974_10453080 Ga0209974_104530802 59
135 3300028379 Ga0268266_10415357 Ga0268266_104153572 59
136 3300028379 Ga0268266_10766275 Ga0268266_107662752 59
137 3300028380 Ga0268265_10130233 Ga0268265_101302332 59
138 3300028380 Ga0268265_10155930 Ga0268265_101559301 59
139 3300028381 Ga0268264_10010116 Ga0268264_100101166 59
140 3300028381 Ga0268264_10430402 Ga0268264_104304022 59
141 3300028786 Ga0307517_10219604 Ga0307517_102196042 59
142 3300028794 Ga0307515_10000191 Ga0307515_1000019122 59
143 3300028794 Ga0307515_10204109 Ga0307515_102041092 59
144 3300031456 Ga0307513_10241228 Ga0307513_102412282 59
145 3300031507 Ga0307509_10079558 Ga0307509_100795583 59
146 3300031730 Ga0307516_10000254 Ga0307516_1000025418 59
147 3300031730 Ga0307516_10031298 Ga0307516_100312985 59
148 3300031824 Ga0307413_10328609 Ga0307413_103286091 59
149 3300032005 Ga0307411_11218013 Ga0307411_112180132 59
150 3300035083 Ga0373926_0070870 Ga0373926_0070870_815_1003 59
151 3300035171 Ga0373946_0111453 Ga0373946_0111453_328_516 59
152 3300037068 Ga0373925_0004683 Ga0373925_0004683_2413_2601 59
153 3300039447 Ga0436361_0376061 Ga0436361_0376061_48980_49168 59
154 3300041443 Ga0451789_1257448 Ga0451789_1257448_254_445 59
155 3300041451 Ga0451791_1178732 Ga0451791_1178732_421_612 59
156 3300041453 Ga0451797_0182074 Ga0451797_0182074_116_307 59
157 3300041456 Ga0451795_1640012 Ga0451795_1640012_237_428 59
158 3300041458 Ga0451798_0537668 Ga0451798_0537668_396_584 59
159 3300041459 Ga0451800_0361784 Ga0451800_0361784_532_720 59
160 3300041459 Ga0451800_0425630 Ga0451800_0425630_419_610 59
161 3300041460 Ga0451802_0181316 Ga0451802_0181316_428_619 59
162 3300041460 Ga0451802_1108283 Ga0451802_1108283_2654_2842 59
163 3300041463 Ga0451804_0420921 Ga0451804_0420921_676_867 59
164 3300041463 Ga0451804_1130280 Ga0451804_1130280_129_317 59
165 3300041498 Ga0451841_0660538 Ga0451841_0660538_603_794 59
166 3300041498 Ga0451841_0913474 Ga0451841_0913474_62_241 59
167 3300041507 Ga0451851_0104455 Ga0451851_0104455_1828_2019 59
168 3300041512 Ga0451853_0463049 Ga0451853_0463049_406_597 59
169 3300042126 Ga0450888_075937 Ga0450888_075937_183_371 59
170 3300042128 Ga0450897_015541 Ga0450897_015541_255_443 59
171 3300042439 Ga0439464_0193506 Ga0439464_0193506_176_361 59
172 3300042439 Ga0439464_0212305 Ga0439464_0212305_30_218 59
173 3300042876 Ga0451577_0001353 Ga0451577_0001353_23956_24141 59
174 3300042876 Ga0451577_1257332 Ga0451577_1257332_451_636 59
175 3300044735 Ga0466968_0025097 Ga0466968_0025097_513_698 59
176 3300046473 Ga0495582_0122099 Ga0495582_0122099_1050_1238 59
177 3300046512 Ga0495610_0018172 Ga0495610_0018172_1026_1217 59
178 3300046515 Ga0495620_0354768 Ga0495620_0354768_167_358 59
179 3300046519 Ga0495632_0107252 Ga0495632_0107252_151_342 59
180 3300046535 Ga0495586_0101742 Ga0495586_0101742_577_765 59
181 3300046616 Ga0495668_0520039 Ga0495668_0520039_448_639 59
182 3300046660 Ga0495625_0005772 Ga0495625_0005772_1928_2119 59
183 3300046683 Ga0495658_0075446 Ga0495658_0075446_1735_1923 59
184 3300046691 Ga0495670_0306392 Ga0495670_0306392_272_460 59
185 3300047472 Ga0495686_0130669 Ga0495686_0130669_59_250 59
186 3300048911 Ga0496108_1503077 Ga0496108_1503077_226_414 59
187 3300048928 Ga0496125_0331353 Ga0496125_0331353_666_854 59
188 3300049741 Ga0501079_1672772 Ga0501079_1672772_298_486 59
189 3300050489 nmdc:mga03683_47620_c2 nmdc:mga03683_47620_c2_16_204 59
190 3300050490 nmdc:mga03n38_119825_c1 nmdc:mga03n38_119825_c1_1053_1244 59
191 3300050490 nmdc:mga03n38_902856_c1 nmdc:mga03n38_902856_c1_198_386 59
192 3300050493 nmdc:mga0k408_213015_c1 nmdc:mga0k408_213015_c1_821_1012 59
193 3300050493 nmdc:mga0k408_261538_c1 nmdc:mga0k408_261538_c1_813_1001 59
194 3300050493 nmdc:mga0k408_33626_c1 nmdc:mga0k408_33626_c1_142_333 59
195 3300050493 nmdc:mga0k408_859493_c1 nmdc:mga0k408_859493_c1_248_436 59
196 3300050493 nmdc:mga0k408_88833_c1 nmdc:mga0k408_88833_c1_1079_1270 59
197 3300050494 nmdc:mga06z11_431626_c1 nmdc:mga06z11_431626_c1_550_741 59
198 3300050516 nmdc:mga0sz30_288303_c1 nmdc:mga0sz30_288303_c1_300_491 59
199 3300053086 Ga0500578_0000002 Ga0500578_0000002_116094_116282 59
200 3300053086 Ga0500578_0773424 Ga0500578_0773424_293_484 59
201 3300053134 Ga0500658_0012730 Ga0500658_0012730_1481_1672 59
202 3300053151 Ga0500604_0325706 Ga0500604_0325706_318_506 59
203 3300053739 Ga0500587_000275 Ga0500587_000275_1699_1890 59
204 3300059421 Ga0590071_000456 Ga0590071_000456_9075_9263 59
205 3300059423 Ga0590074_051835 Ga0590074_051835_167_355 59
206 3300005719 Ga0068861_102572670 Ga0068861_1025726702 60
207 3300005844 Ga0068862_100014347 Ga0068862_1000143473 60
208 3300006048 Ga0075363_100328174 Ga0075363_1003281742 60
209 3300006177 Ga0075362_10086726 Ga0075362_100867262 60
210 3300006177 Ga0075362_10545978 Ga0075362_105459782 60
211 3300006195 Ga0075366_10541221 Ga0075366_105412212 60
212 3300006195 Ga0075366_10607848 Ga0075366_106078482 60
213 3300009147 Ga0114129_11646705 Ga0114129_116467052 60
214 3300025297 Ga0209758_1006025 Ga0209758_10060256 60
215 3300026121 Ga0207683_10488608 Ga0207683_104886082 60
216 3300028380 Ga0268265_10329869 Ga0268265_103298692 60
217 3300031911 Ga0307412_10274935 Ga0307412_102749352 60
218 3300032002 Ga0307416_100419595 Ga0307416_1004195952 60
219 3300046648 Ga0495611_0274090 Ga0495611_0274090_26_217 60
220 3300049743 Ga0501081_0748108 Ga0501081_0748108_533_724 60
221 3300050490 nmdc:mga03n38_651268_c1 nmdc:mga03n38_651268_c1_330_521 60
222 3300050491 nmdc:mga00v17_1011743_c1 nmdc:mga00v17_1011743_c1_272_463 60
223 3300050493 nmdc:mga0k408_698136_c1 nmdc:mga0k408_698136_c1_143_334 60
224 3300050507 nmdc:mga05p37_1271046_c1 nmdc:mga05p37_1271046_c1_193_384 60
225 3300050511 nmdc:mga08y16_369155_c1 nmdc:mga08y16_369155_c1_1159_1350 60
226 3300005338 Ga0068868_100656203 Ga0068868_1006562031 61
227 3300005457 Ga0070662_100310989 Ga0070662_1003109892 61
228 3300005543 Ga0070672_100019128 Ga0070672_1000191282 61
229 3300005618 Ga0068864_100377487 Ga0068864_1003774872 61
230 3300006195 Ga0075366_10170362 Ga0075366_101703623 61
231 3300006195 Ga0075366_10640360 Ga0075366_106403602 61
232 3300006881 Ga0068865_100267267 Ga0068865_1002672672 61
233 3300009176 Ga0105242_10709211 Ga0105242_107092111 61
234 3300009551 Ga0105238_12134239 Ga0105238_121342392 61
235 3300013308 Ga0157375_10916976 Ga0157375_109169762 61
236 3300017792 Ga0163161_10830353 Ga0163161_108303531 61
237 3300025924 Ga0207694_10432688 Ga0207694_104326882 61
238 3300025933 Ga0207706_10375740 Ga0207706_103757402 61
239 3300025934 Ga0207686_10455454 Ga0207686_104554541 61
240 3300025937 Ga0207669_10355436 Ga0207669_103554361 61
241 3300025938 Ga0207704_10247305 Ga0207704_102473052 61
242 3300025940 Ga0207691_10064120 Ga0207691_100641204 61
243 3300026023 Ga0207677_10249684 Ga0207677_102496842 61
244 3300026089 Ga0207648_10077331 Ga0207648_100773312 61
245 3300026095 Ga0207676_11427397 Ga0207676_114273971 61
246 3300026116 Ga0207674_11617705 Ga0207674_116177052 61
247 3300042001 Ga0439441_072363 Ga0439441_072363_521_715 61
248 3300042013 Ga0439456_176370 Ga0439456_176370_195_389 61
249 3300050493 nmdc:mga0k408_2772_c1 nmdc:mga0k408_2772_c1_7016_7210 61
250 3300050493 nmdc:mga0k408_48695_c1 nmdc:mga0k408_48695_c1_824_1018 61
251 3300003316 rootH1_10031410 rootH1_100314103 62
252 3300003322 rootL2_10003300 rootL2_1000330018 62
253 3300005290 Ga0065712_10056070 Ga0065712_100560702 62
254 3300005293 Ga0065715_10120848 Ga0065715_101208482 62
255 3300005327 Ga0070658_10182587 Ga0070658_101825872 62
256 3300005327 Ga0070658_10613061 Ga0070658_106130612 62
257 3300005328 Ga0070676_10007895 Ga0070676_100078953 62
258 3300005328 Ga0070676_10011958 Ga0070676_100119584 62
259 3300005328 Ga0070676_10030674 Ga0070676_100306743 62
260 3300005328 Ga0070676_10152281 Ga0070676_101522812 62
261 3300005328 Ga0070676_10165762 Ga0070676_101657621 62
262 3300005328 Ga0070676_10202608 Ga0070676_102026082 62
263 3300005328 Ga0070676_10235372 Ga0070676_102353722 62
264 3300005328 Ga0070676_10278163 Ga0070676_102781632 62
265 3300005329 Ga0070683_100039749 Ga0070683_1000397495 62
266 3300005329 Ga0070683_100557719 Ga0070683_1005577192 62
267 3300005329 Ga0070683_101344516 Ga0070683_1013445161 62
268 3300005330 Ga0070690_100116392 Ga0070690_1001163923 62
269 3300005330 Ga0070690_100367271 Ga0070690_1003672712 62
270 3300005331 Ga0070670_100000334 Ga0070670_10000033422 62
271 3300005331 Ga0070670_100044516 Ga0070670_1000445162 62
272 3300005331 Ga0070670_100060634 Ga0070670_1000606343 62
273 3300005331 Ga0070670_100075077 Ga0070670_1000750772 62
274 3300005331 Ga0070670_100087706 Ga0070670_1000877063 62
275 3300005331 Ga0070670_100220336 Ga0070670_1002203362 62
276 3300005331 Ga0070670_100645234 Ga0070670_1006452342 62
277 3300005331 Ga0070670_101289499 Ga0070670_1012894992 62
278 3300005333 Ga0070677_10006421 Ga0070677_100064214 62
279 3300005333 Ga0070677_10006836 Ga0070677_100068362 62
280 3300005333 Ga0070677_10008378 Ga0070677_100083784 62
281 3300005333 Ga0070677_10081611 Ga0070677_100816112 62
282 3300005333 Ga0070677_10096075 Ga0070677_100960752 62
283 3300005333 Ga0070677_10137535 Ga0070677_101375351 62
284 3300005333 Ga0070677_10245694 Ga0070677_102456941 62
285 3300005333 Ga0070677_10450072 Ga0070677_104500722 62
286 3300005334 Ga0068869_100013349 Ga0068869_1000133493 62
287 3300005334 Ga0068869_100284837 Ga0068869_1002848371 62
288 3300005334 Ga0068869_100378101 Ga0068869_1003781012 62
289 3300005335 Ga0070666_10003466 Ga0070666_100034667 62
290 3300005335 Ga0070666_10635016 Ga0070666_106350162 62
291 3300005335 Ga0070666_10677108 Ga0070666_106771082 62
292 3300005335 Ga0070666_11039612 Ga0070666_110396122 62
293 3300005336 Ga0070680_100012537 Ga0070680_1000125372 62
294 3300005338 Ga0068868_100010821 Ga0068868_1000108216 62
295 3300005338 Ga0068868_100055602 Ga0068868_1000556023 62
296 3300005338 Ga0068868_100079519 Ga0068868_1000795193 62
297 3300005338 Ga0068868_100336794 Ga0068868_1003367942 62
298 3300005338 Ga0068868_100400257 Ga0068868_1004002572 62
299 3300005338 Ga0068868_100856291 Ga0068868_1008562912 62
300 3300005338 Ga0068868_100893892 Ga0068868_1008938921 62
301 3300005339 Ga0070660_100120719 Ga0070660_1001207192 62
302 3300005339 Ga0070660_100293410 Ga0070660_1002934102 62
303 3300005339 Ga0070660_100618286 Ga0070660_1006182862 62
304 3300005340 Ga0070689_100252613 Ga0070689_1002526133 62
305 3300005340 Ga0070689_100564921 Ga0070689_1005649212 62
306 3300005343 Ga0070687_100105520 Ga0070687_1001055202 62
307 3300005343 Ga0070687_100367005 Ga0070687_1003670052 62
308 3300005343 Ga0070687_100694693 Ga0070687_1006946932 62
309 3300005344 Ga0070661_100022092 Ga0070661_1000220922 62
310 3300005344 Ga0070661_100123527 Ga0070661_1001235272 62
311 3300005344 Ga0070661_100150066 Ga0070661_1001500662 62
312 3300005344 Ga0070661_100323746 Ga0070661_1003237462 62
313 3300005344 Ga0070661_101402844 Ga0070661_1014028442 62
314 3300005345 Ga0070692_10358886 Ga0070692_103588862 62
315 3300005347 Ga0070668_100064311 Ga0070668_1000643113 62
316 3300005347 Ga0070668_100526822 Ga0070668_1005268222 62
317 3300005347 Ga0070668_100860308 Ga0070668_1008603082 62
318 3300005353 Ga0070669_100118475 Ga0070669_1001184752 62
319 3300005353 Ga0070669_100148531 Ga0070669_1001485312 62
320 3300005353 Ga0070669_100398760 Ga0070669_1003987602 62
321 3300005353 Ga0070669_101096316 Ga0070669_1010963161 62
322 3300005354 Ga0070675_100009823 Ga0070675_1000098235 62
323 3300005354 Ga0070675_100037083 Ga0070675_1000370832 62
324 3300005354 Ga0070675_100048867 Ga0070675_1000488672 62
325 3300005354 Ga0070675_100072089 Ga0070675_1000720892 62
326 3300005354 Ga0070675_100095821 Ga0070675_1000958213 62
327 3300005354 Ga0070675_100145848 Ga0070675_1001458483 62
328 3300005354 Ga0070675_100671595 Ga0070675_1006715952 62
329 3300005354 Ga0070675_101026303 Ga0070675_1010263032 62
330 3300005354 Ga0070675_101827236 Ga0070675_1018272362 62
331 3300005355 Ga0070671_100004257 Ga0070671_1000042579 62
332 3300005355 Ga0070671_100010829 Ga0070671_1000108294 62
333 3300005355 Ga0070671_100010852 Ga0070671_1000108526 62
334 3300005355 Ga0070671_100035500 Ga0070671_1000355004 62
335 3300005355 Ga0070671_100054208 Ga0070671_1000542082 62
336 3300005355 Ga0070671_100151034 Ga0070671_1001510342 62
337 3300005355 Ga0070671_100352284 Ga0070671_1003522842 62
338 3300005355 Ga0070671_100431186 Ga0070671_1004311862 62
339 3300005355 Ga0070671_100541482 Ga0070671_1005414822 62
340 3300005355 Ga0070671_100549835 Ga0070671_1005498352 62
341 3300005355 Ga0070671_100621150 Ga0070671_1006211502 62
342 3300005355 Ga0070671_100746480 Ga0070671_1007464801 62
343 3300005356 Ga0070674_100000872 Ga0070674_10000087215 62
344 3300005356 Ga0070674_100017499 Ga0070674_1000174995 62
345 3300005356 Ga0070674_100020439 Ga0070674_1000204395 62
346 3300005356 Ga0070674_100042928 Ga0070674_1000429282 62
347 3300005356 Ga0070674_100422050 Ga0070674_1004220501 62
348 3300005356 Ga0070674_100780396 Ga0070674_1007803961 62
349 3300005364 Ga0070673_100002229 Ga0070673_1000022299 62
350 3300005364 Ga0070673_100029463 Ga0070673_1000294633 62
351 3300005364 Ga0070673_100209803 Ga0070673_1002098032 62
352 3300005364 Ga0070673_100283599 Ga0070673_1002835993 62
353 3300005364 Ga0070673_100482213 Ga0070673_1004822132 62
354 3300005364 Ga0070673_100917931 Ga0070673_1009179311 62
355 3300005364 Ga0070673_101157201 Ga0070673_1011572012 62
356 3300005365 Ga0070688_100227549 Ga0070688_1002275492 62
357 3300005366 Ga0070659_100052563 Ga0070659_1000525633 62
358 3300005366 Ga0070659_100238971 Ga0070659_1002389712 62
359 3300005366 Ga0070659_101373298 Ga0070659_1013732982 62
360 3300005366 Ga0070659_102036705 Ga0070659_1020367051 62
361 3300005367 Ga0070667_100001505 Ga0070667_1000015054 62
362 3300005367 Ga0070667_100032551 Ga0070667_1000325512 62
363 3300005367 Ga0070667_100063471 Ga0070667_1000634714 62
364 3300005367 Ga0070667_100282605 Ga0070667_1002826052 62
365 3300005367 Ga0070667_101867480 Ga0070667_1018674801 62
366 3300005438 Ga0070701_10412031 Ga0070701_104120311 62
367 3300005440 Ga0070705_100773616 Ga0070705_1007736162 62
368 3300005441 Ga0070700_100486279 Ga0070700_1004862792 62
369 3300005441 Ga0070700_100511520 Ga0070700_1005115202 62
370 3300005455 Ga0070663_100022288 Ga0070663_1000222882 62
371 3300005455 Ga0070663_100122435 Ga0070663_1001224352 62
372 3300005455 Ga0070663_100416214 Ga0070663_1004162142 62
373 3300005455 Ga0070663_100780688 Ga0070663_1007806881 62
374 3300005455 Ga0070663_100848311 Ga0070663_1008483111 62
375 3300005456 Ga0070678_100017379 Ga0070678_1000173794 62
376 3300005456 Ga0070678_100093244 Ga0070678_1000932443 62
377 3300005456 Ga0070678_100185327 Ga0070678_1001853272 62
378 3300005456 Ga0070678_100322701 Ga0070678_1003227012 62
379 3300005456 Ga0070678_100743803 Ga0070678_1007438031 62
380 3300005456 Ga0070678_100757931 Ga0070678_1007579312 62
381 3300005456 Ga0070678_100966038 Ga0070678_1009660381 62
382 3300005456 Ga0070678_101937979 Ga0070678_1019379792 62
383 3300005457 Ga0070662_100029907 Ga0070662_1000299072 62
384 3300005457 Ga0070662_100213825 Ga0070662_1002138252 62
385 3300005457 Ga0070662_100759759 Ga0070662_1007597592 62
386 3300005457 Ga0070662_101239250 Ga0070662_1012392502 62
387 3300005457 Ga0070662_101297301 Ga0070662_1012973011 62
388 3300005458 Ga0070681_10177627 Ga0070681_101776273 62
389 3300005458 Ga0070681_10410491 Ga0070681_104104912 62
390 3300005459 Ga0068867_100010980 Ga0068867_1000109806 62
391 3300005459 Ga0068867_100027355 Ga0068867_1000273552 62
392 3300005459 Ga0068867_100029135 Ga0068867_1000291353 62
393 3300005459 Ga0068867_100138386 Ga0068867_1001383863 62
394 3300005459 Ga0068867_100314874 Ga0068867_1003148741 62
395 3300005459 Ga0068867_100987307 Ga0068867_1009873072 62
396 3300005459 Ga0068867_101212099 Ga0068867_1012120991 62
397 3300005459 Ga0068867_101993781 Ga0068867_1019937811 62
398 3300005466 Ga0070685_10082173 Ga0070685_100821732 62
399 3300005530 Ga0070679_100000691 Ga0070679_10000069119 62
400 3300005530 Ga0070679_100159319 Ga0070679_1001593194 62
401 3300005530 Ga0070679_100940739 Ga0070679_1009407392 62
402 3300005535 Ga0070684_100054576 Ga0070684_1000545762 62
403 3300005539 Ga0068853_100076200 Ga0068853_1000762002 62
404 3300005539 Ga0068853_100170182 Ga0068853_1001701822 62
405 3300005539 Ga0068853_100345747 Ga0068853_1003457472 62
406 3300005539 Ga0068853_100652212 Ga0068853_1006522122 62
407 3300005539 Ga0068853_100816421 Ga0068853_1008164211 62
408 3300005539 Ga0068853_101716184 Ga0068853_1017161841 62
409 3300005539 Ga0068853_101757731 Ga0068853_1017577311 62
410 3300005543 Ga0070672_100012438 Ga0070672_1000124384 62
411 3300005543 Ga0070672_100021770 Ga0070672_1000217705 62
412 3300005543 Ga0070672_100096056 Ga0070672_1000960562 62
413 3300005543 Ga0070672_100132447 Ga0070672_1001324473 62
414 3300005543 Ga0070672_100189735 Ga0070672_1001897352 62
415 3300005543 Ga0070672_100198784 Ga0070672_1001987843 62
416 3300005543 Ga0070672_100364095 Ga0070672_1003640952 62
417 3300005543 Ga0070672_100540986 Ga0070672_1005409862 62
418 3300005543 Ga0070672_100636990 Ga0070672_1006369901 62
419 3300005543 Ga0070672_101648803 Ga0070672_1016488031 62
420 3300005544 Ga0070686_100856101 Ga0070686_1008561012 62
421 3300005544 Ga0070686_101555188 Ga0070686_1015551881 62
422 3300005544 Ga0070686_101577993 Ga0070686_1015779931 62
423 3300005545 Ga0070695_100279361 Ga0070695_1002793612 62
424 3300005547 Ga0070693_100030221 Ga0070693_1000302213 62
425 3300005547 Ga0070693_100111203 Ga0070693_1001112033 62
426 3300005548 Ga0070665_100073467 Ga0070665_1000734671 62
427 3300005548 Ga0070665_100526607 Ga0070665_1005266072 62
428 3300005548 Ga0070665_101909177 Ga0070665_1019091771 62
429 3300005548 Ga0070665_102106153 Ga0070665_1021061531 62
430 3300005563 Ga0068855_100224232 Ga0068855_1002242323 62
431 3300005564 Ga0070664_100175279 Ga0070664_1001752792 62
432 3300005564 Ga0070664_100224547 Ga0070664_1002245472 62
433 3300005564 Ga0070664_100533145 Ga0070664_1005331452 62
434 3300005564 Ga0070664_100540979 Ga0070664_1005409792 62
435 3300005564 Ga0070664_101200706 Ga0070664_1012007062 62
436 3300005564 Ga0070664_101369863 Ga0070664_1013698632 62
437 3300005564 Ga0070664_102074130 Ga0070664_1020741302 62
438 3300005577 Ga0068857_100302591 Ga0068857_1003025912 62
439 3300005577 Ga0068857_100771888 Ga0068857_1007718882 62
440 3300005577 Ga0068857_101253612 Ga0068857_1012536122 62
441 3300005577 Ga0068857_102213244 Ga0068857_1022132441 62
442 3300005578 Ga0068854_100066733 Ga0068854_1000667332 62
443 3300005578 Ga0068854_100111211 Ga0068854_1001112113 62
444 3300005578 Ga0068854_100114061 Ga0068854_1001140612 62
445 3300005578 Ga0068854_100129258 Ga0068854_1001292582 62
446 3300005578 Ga0068854_100273394 Ga0068854_1002733942 62
447 3300005578 Ga0068854_101407492 Ga0068854_1014074921 62
448 3300005614 Ga0068856_100259013 Ga0068856_1002590132 62
449 3300005614 Ga0068856_100793270 Ga0068856_1007932702 62
450 3300005615 Ga0070702_100119007 Ga0070702_1001190072 62
451 3300005615 Ga0070702_101699598 Ga0070702_1016995981 62
452 3300005615 Ga0070702_101862658 Ga0070702_1018626582 62
453 3300005616 Ga0068852_100030611 Ga0068852_1000306115 62
454 3300005616 Ga0068852_100141286 Ga0068852_1001412862 62
455 3300005616 Ga0068852_100326162 Ga0068852_1003261623 62
456 3300005616 Ga0068852_100661751 Ga0068852_1006617512 62
457 3300005616 Ga0068852_101191661 Ga0068852_1011916612 62
458 3300005616 Ga0068852_101241726 Ga0068852_1012417262 62
459 3300005616 Ga0068852_101462184 Ga0068852_1014621842 62
460 3300005616 Ga0068852_101511748 Ga0068852_1015117482 62
461 3300005616 Ga0068852_101694245 Ga0068852_1016942452 62
462 3300005617 Ga0068859_100238610 Ga0068859_1002386102 62
463 3300005617 Ga0068859_101688161 Ga0068859_1016881611 62
464 3300005618 Ga0068864_100007117 Ga0068864_1000071174 62
465 3300005618 Ga0068864_100032020 Ga0068864_1000320203 62
466 3300005618 Ga0068864_100380656 Ga0068864_1003806562 62
467 3300005618 Ga0068864_100604369 Ga0068864_1006043691 62
468 3300005618 Ga0068864_100673773 Ga0068864_1006737732 62
469 3300005618 Ga0068864_101029247 Ga0068864_1010292472 62
470 3300005618 Ga0068864_101794862 Ga0068864_1017948621 62
471 3300005718 Ga0068866_10195782 Ga0068866_101957822 62
472 3300005719 Ga0068861_100011955 Ga0068861_1000119553 62
473 3300005719 Ga0068861_101121144 Ga0068861_1011211442 62
474 3300005834 Ga0068851_10002903 Ga0068851_100029031 62
475 3300005834 Ga0068851_10010554 Ga0068851_100105545 62
476 3300005834 Ga0068851_10056524 Ga0068851_100565242 62
477 3300005834 Ga0068851_10133644 Ga0068851_101336442 62
478 3300005834 Ga0068851_10193935 Ga0068851_101939352 62
479 3300005834 Ga0068851_10812046 Ga0068851_108120461 62
480 3300005840 Ga0068870_10063592 Ga0068870_100635922 62
481 3300005840 Ga0068870_10118521 Ga0068870_101185212 62
482 3300005840 Ga0068870_10897942 Ga0068870_108979422 62
483 3300005841 Ga0068863_100065326 Ga0068863_1000653262 62
484 3300005841 Ga0068863_100115186 Ga0068863_1001151862 62
485 3300005841 Ga0068863_100130049 Ga0068863_1001300493 62
486 3300005841 Ga0068863_100177120 Ga0068863_1001771202 62
487 3300005841 Ga0068863_100413570 Ga0068863_1004135702 62
488 3300005841 Ga0068863_101323130 Ga0068863_1013231302 62
489 3300005841 Ga0068863_102318511 Ga0068863_1023185112 62
490 3300005842 Ga0068858_100001875 Ga0068858_1000018752 62
491 3300005842 Ga0068858_100005928 Ga0068858_1000059289 62
492 3300005843 Ga0068860_100000707 Ga0068860_10000070735 62
493 3300005843 Ga0068860_100104922 Ga0068860_1001049223 62
494 3300005844 Ga0068862_100415803 Ga0068862_1004158031 62
495 3300006028 Ga0070717_11540018 Ga0070717_115400182 62
496 3300006163 Ga0070715_10096131 Ga0070715_100961312 62
497 3300006163 Ga0070715_10253411 Ga0070715_102534112 62
498 3300006163 Ga0070715_10931147 Ga0070715_109311472 62
499 3300006237 Ga0097621_100011190 Ga0097621_1000111902 62
500 3300006237 Ga0097621_100044489 Ga0097621_1000444891 62
501 3300006237 Ga0097621_100044639 Ga0097621_1000446393 62
502 3300006237 Ga0097621_100093928 Ga0097621_1000939282 62
503 3300006237 Ga0097621_102331765 Ga0097621_1023317652 62
504 3300006358 Ga0068871_100020020 Ga0068871_1000200206 62
505 3300006358 Ga0068871_100277044 Ga0068871_1002770442 62
506 3300006358 Ga0068871_100373397 Ga0068871_1003733972 62
507 3300006358 Ga0068871_100484828 Ga0068871_1004848282 62
508 3300006358 Ga0068871_101751292 Ga0068871_1017512922 62
509 3300006881 Ga0068865_100024062 Ga0068865_1000240622 62
510 3300006881 Ga0068865_100046341 Ga0068865_1000463413 62
511 3300006881 Ga0068865_100092367 Ga0068865_1000923672 62
512 3300006931 Ga0097620_100238594 Ga0097620_1002385942 62
513 3300006931 Ga0097620_101688261 Ga0097620_1016882612 62
514 3300007076 Ga0075435_100172515 Ga0075435_1001725153 62
515 3300009093 Ga0105240_10277408 Ga0105240_102774083 62
516 3300009093 Ga0105240_12534235 Ga0105240_125342352 62
517 3300009094 Ga0111539_11849977 Ga0111539_118499772 62
518 3300009098 Ga0105245_10064976 Ga0105245_100649763 62
519 3300009098 Ga0105245_10329579 Ga0105245_103295792 62
520 3300009098 Ga0105245_12341658 Ga0105245_123416582 62
521 3300009101 Ga0105247_10067959 Ga0105247_100679592 62
522 3300009148 Ga0105243_10132427 Ga0105243_101324273 62
523 3300009148 Ga0105243_10341295 Ga0105243_103412952 62
524 3300009148 Ga0105243_11316347 Ga0105243_113163472 62
525 3300009174 Ga0105241_11742821 Ga0105241_117428211 62
526 3300009176 Ga0105242_10305956 Ga0105242_103059562 62
527 3300009176 Ga0105242_12948473 Ga0105242_129484732 62
528 3300009177 Ga0105248_10002863 Ga0105248_1000286319 62
529 3300009177 Ga0105248_10059166 Ga0105248_100591662 62
530 3300009177 Ga0105248_10617720 Ga0105248_106177202 62
531 3300009177 Ga0105248_10714340 Ga0105248_107143402 62
532 3300009177 Ga0105248_10715923 Ga0105248_107159232 62
533 3300009551 Ga0105238_10487169 Ga0105238_104871692 62
534 3300009551 Ga0105238_10940719 Ga0105238_109407192 62
535 3300009553 Ga0105249_10089453 Ga0105249_100894531 62
536 3300009553 Ga0105249_10631708 Ga0105249_106317082 62
537 3300009553 Ga0105249_10669065 Ga0105249_106690652 62
538 3300009553 Ga0105249_11228564 Ga0105249_112285642 62
539 3300010375 Ga0105239_10276434 Ga0105239_102764343 62
540 3300011119 Ga0105246_10761488 Ga0105246_107614882 62
541 3300011119 Ga0105246_11817416 Ga0105246_118174162 62
542 3300012483 Ga0157337_1038356 Ga0157337_10383562 62
543 3300012506 Ga0157324_1038928 Ga0157324_10389282 62
544 3300012507 Ga0157342_1031486 Ga0157342_10314861 62
545 3300012512 Ga0157327_1075180 Ga0157327_10751802 62
546 3300013100 Ga0157373_10025385 Ga0157373_100253854 62
547 3300013100 Ga0157373_10186599 Ga0157373_101865992 62
548 3300013102 Ga0157371_10072827 Ga0157371_100728273 62
549 3300013102 Ga0157371_10128765 Ga0157371_101287653 62
550 3300013104 Ga0157370_10185786 Ga0157370_101857861 62
551 3300013104 Ga0157370_10216969 Ga0157370_102169693 62
552 3300013104 Ga0157370_10808849 Ga0157370_108088492 62
553 3300013105 Ga0157369_10304210 Ga0157369_103042102 62
554 3300013105 Ga0157369_10473092 Ga0157369_104730922 62
555 3300013105 Ga0157369_11770209 Ga0157369_117702092 62
556 3300013105 Ga0157369_11993140 Ga0157369_119931402 62
557 3300013296 Ga0157374_10011711 Ga0157374_100117116 62
558 3300013296 Ga0157374_10167425 Ga0157374_101674252 62
559 3300013296 Ga0157374_10497068 Ga0157374_104970682 62
560 3300013296 Ga0157374_10866612 Ga0157374_108666122 62
561 3300013297 Ga0157378_10128783 Ga0157378_101287832 62
562 3300013297 Ga0157378_10770619 Ga0157378_107706192 62
563 3300013297 Ga0157378_11235427 Ga0157378_112354272 62
564 3300013306 Ga0163162_10033576 Ga0163162_100335765 62
565 3300013306 Ga0163162_10060697 Ga0163162_100606972 62
566 3300013306 Ga0163162_10087073 Ga0163162_100870733 62
567 3300013306 Ga0163162_10445140 Ga0163162_104451402 62
568 3300013306 Ga0163162_10771061 Ga0163162_107710611 62
569 3300013306 Ga0163162_11106003 Ga0163162_111060032 62
570 3300013307 Ga0157372_10155294 Ga0157372_101552943 62
571 3300013307 Ga0157372_10324538 Ga0157372_103245382 62
572 3300013307 Ga0157372_10683649 Ga0157372_106836492 62
573 3300013307 Ga0157372_10688085 Ga0157372_106880852 62
574 3300013308 Ga0157375_10050873 Ga0157375_100508734 62
575 3300013308 Ga0157375_10075875 Ga0157375_100758752 62
576 3300013308 Ga0157375_10159639 Ga0157375_101596393 62
577 3300013308 Ga0157375_10234397 Ga0157375_102343973 62
578 3300013308 Ga0157375_11111808 Ga0157375_111118082 62
579 3300013308 Ga0157375_11532370 Ga0157375_115323702 62
580 3300013308 Ga0157375_11561389 Ga0157375_115613892 62
581 3300014325 Ga0163163_10014367 Ga0163163_100143677 62
582 3300014325 Ga0163163_10529428 Ga0163163_105294282 62
583 3300014325 Ga0163163_11098699 Ga0163163_110986992 62
584 3300014325 Ga0163163_11138890 Ga0163163_111388902 62
585 3300014325 Ga0163163_11420162 Ga0163163_114201622 62
586 3300014325 Ga0163163_12367296 Ga0163163_123672961 62
587 3300014325 Ga0163163_12479108 Ga0163163_124791082 62
588 3300014326 Ga0157380_10021172 Ga0157380_100211723 62
589 3300014326 Ga0157380_10061204 Ga0157380_100612043 62
590 3300014326 Ga0157380_10166331 Ga0157380_101663313 62
591 3300014326 Ga0157380_10281277 Ga0157380_102812773 62
592 3300014326 Ga0157380_11209550 Ga0157380_112095501 62
593 3300014326 Ga0157380_12583851 Ga0157380_125838512 62
594 3300014745 Ga0157377_10017799 Ga0157377_100177993 62
595 3300014745 Ga0157377_10296155 Ga0157377_102961552 62
596 3300014745 Ga0157377_11613543 Ga0157377_116135432 62
597 3300014968 Ga0157379_10000528 Ga0157379_1000052811 62
598 3300014968 Ga0157379_10034268 Ga0157379_100342683 62
599 3300014968 Ga0157379_10034425 Ga0157379_100344252 62
600 3300014968 Ga0157379_10411811 Ga0157379_104118112 62
601 3300014968 Ga0157379_10809452 Ga0157379_108094521 62
602 3300014969 Ga0157376_10014036 Ga0157376_100140364 62
603 3300014969 Ga0157376_10130516 Ga0157376_101305163 62
604 3300014969 Ga0157376_10199089 Ga0157376_101990893 62
605 3300014969 Ga0157376_10762639 Ga0157376_107626392 62
606 3300014969 Ga0157376_11214602 Ga0157376_112146022 62
607 3300014969 Ga0157376_11397944 Ga0157376_113979441 62
608 3300015265 Ga0182005_1053602 Ga0182005_10536022 62
609 3300017792 Ga0163161_10005129 Ga0163161_100051293 62
610 3300017792 Ga0163161_10085881 Ga0163161_100858812 62
611 3300017792 Ga0163161_10484359 Ga0163161_104843592 62
612 3300017792 Ga0163161_11527848 Ga0163161_115278482 62
613 3300017792 Ga0163161_12049609 Ga0163161_120496091 62
614 3300021384 Ga0213876_10055319 Ga0213876_100553193 62
615 3300025315 Ga0207697_10096614 Ga0207697_100966142 62
616 3300025315 Ga0207697_10290377 Ga0207697_102903771 62
617 3300025315 Ga0207697_10296289 Ga0207697_102962892 62
618 3300025321 Ga0207656_10106981 Ga0207656_101069812 62
619 3300025321 Ga0207656_10138223 Ga0207656_101382232 62
620 3300025321 Ga0207656_10151740 Ga0207656_101517402 62
621 3300025321 Ga0207656_10156984 Ga0207656_101569842 62
622 3300025321 Ga0207656_10211827 Ga0207656_102118271 62
623 3300025893 Ga0207682_10000725 Ga0207682_100007254 62
624 3300025893 Ga0207682_10003929 Ga0207682_100039294 62
625 3300025893 Ga0207682_10028381 Ga0207682_100283812 62
626 3300025893 Ga0207682_10069616 Ga0207682_100696161 62
627 3300025900 Ga0207710_10134024 Ga0207710_101340242 62
628 3300025901 Ga0207688_10022082 Ga0207688_100220823 62
629 3300025903 Ga0207680_10012299 Ga0207680_100122992 62
630 3300025903 Ga0207680_10028426 Ga0207680_100284264 62
631 3300025903 Ga0207680_10175924 Ga0207680_101759243 62
632 3300025903 Ga0207680_10384721 Ga0207680_103847211 62
633 3300025905 Ga0207685_10010306 Ga0207685_100103063 62
634 3300025905 Ga0207685_10809541 Ga0207685_108095411 62
635 3300025907 Ga0207645_10017365 Ga0207645_100173653 62
636 3300025907 Ga0207645_10043897 Ga0207645_100438973 62
637 3300025907 Ga0207645_10044206 Ga0207645_100442063 62
638 3300025907 Ga0207645_10207552 Ga0207645_102075522 62
639 3300025907 Ga0207645_10880130 Ga0207645_108801302 62
640 3300025908 Ga0207643_10924215 Ga0207643_109242151 62
641 3300025909 Ga0207705_10199362 Ga0207705_101993622 62
642 3300025909 Ga0207705_10276262 Ga0207705_102762622 62
643 3300025909 Ga0207705_10371493 Ga0207705_103714932 62
644 3300025909 Ga0207705_10623561 Ga0207705_106235612 62
645 3300025912 Ga0207707_10315409 Ga0207707_103154092 62
646 3300025912 Ga0207707_11387295 Ga0207707_113872952 62
647 3300025913 Ga0207695_10985088 Ga0207695_109850882 62
648 3300025914 Ga0207671_10563606 Ga0207671_105636062 62
649 3300025917 Ga0207660_10050947 Ga0207660_100509473 62
650 3300025918 Ga0207662_10008920 Ga0207662_100089203 62
651 3300025918 Ga0207662_10391099 Ga0207662_103910992 62
652 3300025918 Ga0207662_10476268 Ga0207662_104762682 62
653 3300025919 Ga0207657_10590231 Ga0207657_105902312 62
654 3300025919 Ga0207657_10593843 Ga0207657_105938431 62
655 3300025920 Ga0207649_10003067 Ga0207649_100030677 62
656 3300025920 Ga0207649_10046343 Ga0207649_100463433 62
657 3300025920 Ga0207649_10331111 Ga0207649_103311112 62
658 3300025920 Ga0207649_10592186 Ga0207649_105921862 62
659 3300025920 Ga0207649_10679938 Ga0207649_106799382 62
660 3300025920 Ga0207649_10904275 Ga0207649_109042752 62
661 3300025920 Ga0207649_11135429 Ga0207649_111354291 62
662 3300025920 Ga0207649_11421429 Ga0207649_114214291 62
663 3300025921 Ga0207652_10003994 Ga0207652_100039948 62
664 3300025921 Ga0207652_11033990 Ga0207652_110339902 62
665 3300025921 Ga0207652_11362930 Ga0207652_113629302 62
666 3300025923 Ga0207681_10078779 Ga0207681_100787793 62
667 3300025923 Ga0207681_10128908 Ga0207681_101289082 62
668 3300025923 Ga0207681_10283872 Ga0207681_102838722 62
669 3300025924 Ga0207694_10698338 Ga0207694_106983381 62
670 3300025924 Ga0207694_10906448 Ga0207694_109064482 62
671 3300025925 Ga0207650_10000913 Ga0207650_100009132 62
672 3300025925 Ga0207650_10009570 Ga0207650_100095703 62
673 3300025925 Ga0207650_10033279 Ga0207650_100332793 62
674 3300025925 Ga0207650_10157405 Ga0207650_101574053 62
675 3300025925 Ga0207650_10301228 Ga0207650_103012282 62
676 3300025926 Ga0207659_10000189 Ga0207659_1000018911 62
677 3300025926 Ga0207659_10028616 Ga0207659_100286164 62
678 3300025926 Ga0207659_10088146 Ga0207659_100881462 62
679 3300025926 Ga0207659_10098332 Ga0207659_100983323 62
680 3300025926 Ga0207659_10142039 Ga0207659_101420392 62
681 3300025926 Ga0207659_10521296 Ga0207659_105212962 62
682 3300025927 Ga0207687_10090230 Ga0207687_100902302 62
683 3300025931 Ga0207644_10018141 Ga0207644_100181412 62
684 3300025931 Ga0207644_10032530 Ga0207644_100325303 62
685 3300025931 Ga0207644_10040242 Ga0207644_100402423 62
686 3300025931 Ga0207644_10176881 Ga0207644_101768813 62
687 3300025931 Ga0207644_10363015 Ga0207644_103630152 62
688 3300025931 Ga0207644_10695873 Ga0207644_106958732 62
689 3300025931 Ga0207644_10893404 Ga0207644_108934041 62
690 3300025932 Ga0207690_10180979 Ga0207690_101809792 62
691 3300025932 Ga0207690_10317820 Ga0207690_103178201 62
692 3300025932 Ga0207690_10977548 Ga0207690_109775482 62
693 3300025932 Ga0207690_11633755 Ga0207690_116337552 62
694 3300025933 Ga0207706_10019673 Ga0207706_100196737 62
695 3300025933 Ga0207706_10046513 Ga0207706_100465134 62
696 3300025933 Ga0207706_10249464 Ga0207706_102494642 62
697 3300025933 Ga0207706_10557269 Ga0207706_105572692 62
698 3300025933 Ga0207706_10776691 Ga0207706_107766912 62
699 3300025933 Ga0207706_11333898 Ga0207706_113338982 62
700 3300025933 Ga0207706_11526059 Ga0207706_115260592 62
701 3300025934 Ga0207686_10057830 Ga0207686_100578303 62
702 3300025935 Ga0207709_10375095 Ga0207709_103750952 62
703 3300025935 Ga0207709_11641056 Ga0207709_116410561 62
704 3300025936 Ga0207670_10420861 Ga0207670_104208611 62
705 3300025936 Ga0207670_10726512 Ga0207670_107265122 62
706 3300025937 Ga0207669_10251821 Ga0207669_102518212 62
707 3300025937 Ga0207669_10290215 Ga0207669_102902152 62
708 3300025937 Ga0207669_10355444 Ga0207669_103554441 62
709 3300025937 Ga0207669_10356794 Ga0207669_103567942 62
710 3300025937 Ga0207669_10722280 Ga0207669_107222802 62
711 3300025938 Ga0207704_10051709 Ga0207704_100517092 62
712 3300025938 Ga0207704_10463995 Ga0207704_104639952 62
713 3300025938 Ga0207704_10629573 Ga0207704_106295732 62
714 3300025939 Ga0207665_10067160 Ga0207665_100671602 62
715 3300025940 Ga0207691_10002491 Ga0207691_1000249115 62
716 3300025940 Ga0207691_10022344 Ga0207691_100223445 62
717 3300025940 Ga0207691_10046984 Ga0207691_100469845 62
718 3300025940 Ga0207691_10060239 Ga0207691_100602392 62
719 3300025940 Ga0207691_10115269 Ga0207691_101152693 62
720 3300025940 Ga0207691_10276681 Ga0207691_102766812 62
721 3300025940 Ga0207691_10538816 Ga0207691_105388161 62
722 3300025940 Ga0207691_11295023 Ga0207691_112950232 62
723 3300025940 Ga0207691_11332922 Ga0207691_113329222 62
724 3300025941 Ga0207711_10175231 Ga0207711_101752312 62
725 3300025941 Ga0207711_10199640 Ga0207711_101996402 62
726 3300025941 Ga0207711_10432966 Ga0207711_104329662 62
727 3300025941 Ga0207711_10905306 Ga0207711_109053062 62
728 3300025942 Ga0207689_10023257 Ga0207689_100232573 62
729 3300025942 Ga0207689_10030492 Ga0207689_100304923 62
730 3300025942 Ga0207689_10604887 Ga0207689_106048872 62
731 3300025944 Ga0207661_10025979 Ga0207661_100259792 62
732 3300025944 Ga0207661_10104735 Ga0207661_101047353 62
733 3300025945 Ga0207679_10936490 Ga0207679_109364902 62
734 3300025945 Ga0207679_11172985 Ga0207679_111729852 62
735 3300025945 Ga0207679_12167833 Ga0207679_121678332 62
736 3300025949 Ga0207667_10238026 Ga0207667_102380263 62
737 3300025960 Ga0207651_10006755 Ga0207651_100067557 62
738 3300025960 Ga0207651_10036579 Ga0207651_100365793 62
739 3300025960 Ga0207651_10261065 Ga0207651_102610652 62
740 3300025960 Ga0207651_10384276 Ga0207651_103842762 62
741 3300025960 Ga0207651_10663526 Ga0207651_106635262 62
742 3300025960 Ga0207651_11726224 Ga0207651_117262241 62
743 3300025961 Ga0207712_10158752 Ga0207712_101587522 62
744 3300025961 Ga0207712_10365122 Ga0207712_103651221 62
745 3300025972 Ga0207668_10239930 Ga0207668_102399302 62
746 3300025972 Ga0207668_10581705 Ga0207668_105817052 62
747 3300025972 Ga0207668_11032804 Ga0207668_110328041 62
748 3300025981 Ga0207640_10064285 Ga0207640_100642853 62
749 3300025981 Ga0207640_10345483 Ga0207640_103454832 62
750 3300025981 Ga0207640_10464869 Ga0207640_104648692 62
751 3300025981 Ga0207640_10727442 Ga0207640_107274421 62
752 3300025981 Ga0207640_11092677 Ga0207640_110926772 62
753 3300025986 Ga0207658_10259502 Ga0207658_102595022 62
754 3300025986 Ga0207658_10356188 Ga0207658_103561881 62
755 3300026023 Ga0207677_10006180 Ga0207677_100061805 62
756 3300026023 Ga0207677_10008231 Ga0207677_100082315 62
757 3300026023 Ga0207677_10243194 Ga0207677_102431942 62
758 3300026023 Ga0207677_10374579 Ga0207677_103745792 62
759 3300026023 Ga0207677_10576931 Ga0207677_105769312 62
760 3300026023 Ga0207677_10746347 Ga0207677_107463472 62
761 3300026023 Ga0207677_10865955 Ga0207677_108659552 62
762 3300026041 Ga0207639_10168564 Ga0207639_101685643 62
763 3300026041 Ga0207639_10182817 Ga0207639_101828172 62
764 3300026041 Ga0207639_10612436 Ga0207639_106124361 62
765 3300026041 Ga0207639_10765798 Ga0207639_107657981 62
766 3300026067 Ga0207678_10098284 Ga0207678_100982843 62
767 3300026067 Ga0207678_10433145 Ga0207678_104331452 62
768 3300026067 Ga0207678_10809591 Ga0207678_108095912 62
769 3300026067 Ga0207678_10856175 Ga0207678_108561751 62
770 3300026075 Ga0207708_10613258 Ga0207708_106132582 62
771 3300026075 Ga0207708_10623155 Ga0207708_106231551 62
772 3300026078 Ga0207702_10159617 Ga0207702_101596172 62
773 3300026078 Ga0207702_10629741 Ga0207702_106297412 62
774 3300026078 Ga0207702_10821268 Ga0207702_108212682 62
775 3300026078 Ga0207702_10900339 Ga0207702_109003391 62
776 3300026078 Ga0207702_11058535 Ga0207702_110585352 62
777 3300026088 Ga0207641_10102813 Ga0207641_101028132 62
778 3300026088 Ga0207641_10145771 Ga0207641_101457712 62
779 3300026088 Ga0207641_10243287 Ga0207641_102432872 62
780 3300026088 Ga0207641_10853699 Ga0207641_108536992 62
781 3300026089 Ga0207648_10017069 Ga0207648_100170693 62
782 3300026089 Ga0207648_10020934 Ga0207648_100209343 62
783 3300026089 Ga0207648_10025462 Ga0207648_100254623 62
784 3300026089 Ga0207648_10038664 Ga0207648_100386645 62
785 3300026089 Ga0207648_10062807 Ga0207648_100628073 62
786 3300026089 Ga0207648_10292324 Ga0207648_102923242 62
787 3300026089 Ga0207648_12067787 Ga0207648_120677871 62
788 3300026095 Ga0207676_10010740 Ga0207676_100107403 62
789 3300026095 Ga0207676_10012969 Ga0207676_100129692 62
790 3300026095 Ga0207676_10017091 Ga0207676_100170912 62
791 3300026095 Ga0207676_10112784 Ga0207676_101127842 62
792 3300026095 Ga0207676_10365923 Ga0207676_103659232 62
793 3300026095 Ga0207676_10714042 Ga0207676_107140422 62
794 3300026095 Ga0207676_11128801 Ga0207676_111288012 62
795 3300026116 Ga0207674_10037357 Ga0207674_100373574 62
796 3300026116 Ga0207674_10284228 Ga0207674_102842282 62
797 3300026118 Ga0207675_100009210 Ga0207675_1000092109 62
798 3300026118 Ga0207675_100013996 Ga0207675_1000139965 62
799 3300026118 Ga0207675_100112605 Ga0207675_1001126053 62
800 3300026118 Ga0207675_101810132 Ga0207675_1018101321 62
801 3300026121 Ga0207683_10040810 Ga0207683_100408102 62
802 3300026121 Ga0207683_10111933 Ga0207683_101119332 62
803 3300026121 Ga0207683_10126252 Ga0207683_101262522 62
804 3300026121 Ga0207683_10153083 Ga0207683_101530833 62
805 3300026121 Ga0207683_10218485 Ga0207683_102184851 62
806 3300026121 Ga0207683_10374633 Ga0207683_103746332 62
807 3300026121 Ga0207683_10386693 Ga0207683_103866932 62
808 3300026121 Ga0207683_10488687 Ga0207683_104886872 62
809 3300026121 Ga0207683_10899242 Ga0207683_108992422 62
810 3300026121 Ga0207683_12163852 Ga0207683_121638521 62
811 3300026121 Ga0207683_12165804 Ga0207683_121658042 62
812 3300026142 Ga0207698_10208020 Ga0207698_102080202 62
813 3300026142 Ga0207698_10446682 Ga0207698_104466822 62
814 3300026142 Ga0207698_10505164 Ga0207698_105051642 62
815 3300026142 Ga0207698_11049577 Ga0207698_110495772 62
816 3300028379 Ga0268266_10186889 Ga0268266_101868893 62
817 3300028379 Ga0268266_10196117 Ga0268266_101961172 62
818 3300028379 Ga0268266_10483353 Ga0268266_104833532 62
819 3300028379 Ga0268266_10588612 Ga0268266_105886121 62
820 3300028380 Ga0268265_10302348 Ga0268265_103023482 62
821 3300028381 Ga0268264_10216090 Ga0268264_102160902 62
822 3300028381 Ga0268264_10483122 Ga0268264_104831222 62
823 3300031456 Ga0307513_10866818 Ga0307513_108668182 62
824 3300031548 Ga0307408_100087773 Ga0307408_1000877732 62
825 3300031731 Ga0307405_10019062 Ga0307405_100190624 62
826 3300031731 Ga0307405_10231283 Ga0307405_102312832 62
827 3300031731 Ga0307405_10610104 Ga0307405_106101042 62
828 3300031824 Ga0307413_10038148 Ga0307413_100381483 62
829 3300031824 Ga0307413_11204990 Ga0307413_112049902 62
830 3300031852 Ga0307410_10012223 Ga0307410_100122232 62
831 3300031852 Ga0307410_10099902 Ga0307410_100999022 62
832 3300031852 Ga0307410_11527741 Ga0307410_115277412 62
833 3300031901 Ga0307406_10022580 Ga0307406_100225802 62
834 3300031901 Ga0307406_10184957 Ga0307406_101849572 62
835 3300031903 Ga0307407_10033866 Ga0307407_100338662 62
836 3300031903 Ga0307407_10239113 Ga0307407_102391131 62
837 3300031903 Ga0307407_10313447 Ga0307407_103134472 62
838 3300031911 Ga0307412_10016388 Ga0307412_100163884 62
839 3300031911 Ga0307412_10314711 Ga0307412_103147113 62
840 3300031911 Ga0307412_11516339 Ga0307412_115163392 62
841 3300031995 Ga0307409_100001576 Ga0307409_1000015765 62
842 3300031995 Ga0307409_100300756 Ga0307409_1003007562 62
843 3300031995 Ga0307409_100843065 Ga0307409_1008430652 62
844 3300031995 Ga0307409_100939520 Ga0307409_1009395202 62
845 3300032002 Ga0307416_100001923 Ga0307416_1000019236 62
846 3300032002 Ga0307416_100076333 Ga0307416_1000763334 62
847 3300032002 Ga0307416_101245998 Ga0307416_1012459982 62
848 3300032002 Ga0307416_102148113 Ga0307416_1021481132 62
849 3300032005 Ga0307411_10009826 Ga0307411_100098263 62
850 3300032005 Ga0307411_10024755 Ga0307411_100247553 62
851 3300032005 Ga0307411_11067351 Ga0307411_110673511 62
852 3300032005 Ga0307411_11313255 Ga0307411_113132552 62
853 3300032126 Ga0307415_100074130 Ga0307415_1000741302 62
854 3300034816 Ga0373930_0076066 Ga0373930_0076066_29_232 62
855 3300034817 Ga0373948_0048606 Ga0373948_0048606_469_672 62
856 3300034820 Ga0373959_0091513 Ga0373959_0091513_289_492 62
857 3300034957 Ga0373938_0011101 Ga0373938_0011101_940_1143 62
858 3300035088 Ga0373940_0083197 Ga0373940_0083197_404_607 62
859 3300035089 Ga0373944_0010740 Ga0373944_0010740_413_616 62
860 3300035089 Ga0373944_0160282 Ga0373944_0160282_473_676 62
861 3300035090 Ga0373949_0024439 Ga0373949_0024439_615_818 62
862 3300035091 Ga0373951_0229139 Ga0373951_0229139_117_320 62
863 3300035092 Ga0373952_0077468 Ga0373952_0077468_570_773 62
864 3300035111 Ga0373923_0118788 Ga0373923_0118788_402_605 62
865 3300035114 Ga0373939_0411611 Ga0373939_0411611_46_249 62
866 3300035118 Ga0373954_0269983 Ga0373954_0269983_519_722 62
867 3300035119 Ga0373956_0036705 Ga0373956_0036705_29_232 62
868 3300035171 Ga0373946_0162806 Ga0373946_0162806_362_565 62
869 3300035171 Ga0373946_0525150 Ga0373946_0525150_11_214 62
870 3300035172 Ga0373955_0214586 Ga0373955_0214586_808_1011 62
871 3300035172 Ga0373955_0244715 Ga0373955_0244715_502_705 62
872 3300035241 Ga0373961_0160173 Ga0373961_0160173_120_323 62
873 3300035410 Ga0373924_0564452 Ga0373924_0564452_11_214 62
874 3300035691 Ga0373931_0004801 Ga0373931_0004801_964_1167 62
875 3300035692 Ga0373935_0030710 Ga0373935_0030710_844_1047 62
876 3300035695 Ga0373927_0439112 Ga0373927_0439112_411_614 62
877 3300035724 Ga0373933_0292065 Ga0373933_0292065_11_214 62
878 3300035724 Ga0373933_0383816 Ga0373933_0383816_619_822 62
879 3300035725 Ga0373947_0666259 Ga0373947_0666259_35_238 62
880 3300036401 Ga0373937_0161905 Ga0373937_0161905_1742_1945 62
881 3300036401 Ga0373937_0210205 Ga0373937_0210205_174_377 62
882 3300036401 Ga0373937_1129495 Ga0373937_1129495_239_442 62
883 3300036401 Ga0373937_1531714 Ga0373937_1531714_307_510 62
884 3300037068 Ga0373925_0239360 Ga0373925_0239360_236_439 62
885 3300037068 Ga0373925_0295789 Ga0373925_0295789_240_446 62
886 3300039437 Ga0436365_1878872 Ga0436365_1878872_553_756 62
887 3300039450 Ga0436363_1315143 Ga0436363_1315143_1693_1896 62
888 3300041453 Ga0451797_0024097 Ga0451797_0024097_171_374 62
889 3300041456 Ga0451795_1526863 Ga0451795_1526863_60_263 62
890 3300041458 Ga0451798_0162675 Ga0451798_0162675_95_298 62
891 3300041460 Ga0451802_0227888 Ga0451802_0227888_351_554 62
892 3300041486 Ga0451807_2633116 Ga0451807_2633116_207_413 62
893 3300041503 Ga0451847_0580709 Ga0451847_0580709_364_570 62
894 3300041505 Ga0451849_1316584 Ga0451849_1316584_103_306 62
895 3300041507 Ga0451851_0279755 Ga0451851_0279755_62_265 62
896 3300041512 Ga0451853_2526968 Ga0451853_2526968_298_498 62
897 3300041512 Ga0451853_3410975 Ga0451853_3410975_265_468 62
898 3300042005 Ga0439448_0265163 Ga0439448_0265163_229_435 62
899 3300042157 Ga0439458_0162222 Ga0439458_0162222_256_462 62
900 3300042439 Ga0439464_0019626 Ga0439464_0019626_844_1050 62
901 3300042531 Ga0450918_000075 Ga0450918_000075_17305_17502 62
902 3300042993 Ga0439440_0164943 Ga0439440_0164943_374_580 62
903 3300044712 Ga0453684_0006474 Ga0453684_0006474_4201_4401 62
904 3300046459 Ga0495629_0411126 Ga0495629_0411126_325_528 62
905 3300046472 Ga0495580_0035100 Ga0495580_0035100_1422_1628 62
906 3300046476 Ga0495662_0150853 Ga0495662_0150853_172_375 62
907 3300046515 Ga0495620_0145710 Ga0495620_0145710_189_392 62
908 3300046516 Ga0495628_0425675 Ga0495628_0425675_101_304 62
909 3300046516 Ga0495628_1154398 Ga0495628_1154398_301_504 62
910 3300046530 Ga0495654_0236292 Ga0495654_0236292_371_574 62
911 3300046533 Ga0495640_0211526 Ga0495640_0211526_990_1193 62
912 3300046533 Ga0495640_0553282 Ga0495640_0553282_252_455 62
913 3300046536 Ga0495587_0734277 Ga0495587_0734277_129_332 62
914 3300046537 Ga0495598_0303288 Ga0495598_0303288_377_580 62
915 3300046539 Ga0495621_0177144 Ga0495621_0177144_197_400 62
916 3300046539 Ga0495621_0457265 Ga0495621_0457265_331_534 62
917 3300046543 Ga0495645_0218962 Ga0495645_0218962_840_1043 62
918 3300046543 Ga0495645_0966754 Ga0495645_0966754_160_363 62
919 3300046558 Ga0495633_0364923 Ga0495633_0364923_117_320 62
920 3300046615 Ga0495656_0650507 Ga0495656_0650507_352_555 62
921 3300046663 Ga0495635_0497593 Ga0495635_0497593_165_368 62
922 3300046663 Ga0495635_0962027 Ga0495635_0962027_61_264 62
923 3300046679 Ga0495623_0369829 Ga0495623_0369829_183_386 62
924 3300046681 Ga0495647_0038717 Ga0495647_0038717_766_969 62
925 3300046681 Ga0495647_0166447 Ga0495647_0166447_607_810 62
926 3300046683 Ga0495658_0015916 Ga0495658_0015916_1141_1344 62
927 3300046683 Ga0495658_0174708 Ga0495658_0174708_41_244 62
928 3300046683 Ga0495658_0274123 Ga0495658_0274123_433_636 62
929 3300046683 Ga0495658_0362831 Ga0495658_0362831_369_572 62
930 3300046683 Ga0495658_0532797 Ga0495658_0532797_510_713 62
931 3300046689 Ga0495613_0084712 Ga0495613_0084712_1065_1268 62
932 3300046689 Ga0495613_1093267 Ga0495613_1093267_146_352 62
933 3300047321 Ga0495676_0382241 Ga0495676_0382241_175_378 62
934 3300047470 Ga0495681_0393987 Ga0495681_0393987_278_481 62
935 3300047471 Ga0495684_0108451 Ga0495684_0108451_866_1069 62
936 3300048090 Ga0495615_0139808 Ga0495615_0139808_156_359 62
937 3300048903 Ga0496100_0323352 Ga0496100_0323352_235_438 62
938 3300048903 Ga0496100_0549204 Ga0496100_0549204_401_604 62
939 3300048903 Ga0496100_0998384 Ga0496100_0998384_73_276 62
940 3300048904 Ga0496101_0119392 Ga0496101_0119392_1277_1480 62
941 3300048906 Ga0496103_0324954 Ga0496103_0324954_322_525 62
942 3300048907 Ga0496104_0008841 Ga0496104_0008841_7821_8024 62
943 3300048907 Ga0496104_0147333 Ga0496104_0147333_1261_1464 62
944 3300048907 Ga0496104_0397604 Ga0496104_0397604_387_590 62
945 3300048908 Ga0496105_0059786 Ga0496105_0059786_2155_2358 62
946 3300048908 Ga0496105_0154988 Ga0496105_0154988_757_960 62
947 3300048908 Ga0496105_0825661 Ga0496105_0825661_272_475 62
948 3300048909 Ga0496106_0192393 Ga0496106_0192393_786_989 62
949 3300048909 Ga0496106_0278486 Ga0496106_0278486_843_1046 62
950 3300048910 Ga0496107_0119919 Ga0496107_0119919_692_895 62
951 3300048911 Ga0496108_0130837 Ga0496108_0130837_997_1200 62
952 3300048911 Ga0496108_0204984 Ga0496108_0204984_901_1104 62
953 3300048912 Ga0496109_0098011 Ga0496109_0098011_94_297 62
954 3300048912 Ga0496109_0162683 Ga0496109_0162683_1355_1558 62
955 3300048912 Ga0496109_0627133 Ga0496109_0627133_777_980 62
956 3300048913 Ga0496110_0167874 Ga0496110_0167874_970_1173 62
957 3300048913 Ga0496110_0172128 Ga0496110_0172128_145_348 62
958 3300048913 Ga0496110_0422460 Ga0496110_0422460_482_685 62
959 3300048914 Ga0496111_0794761 Ga0496111_0794761_293_496 62
960 3300048916 Ga0496113_0228840 Ga0496113_0228840_287_490 62
961 3300048917 Ga0496114_0052168 Ga0496114_0052168_2375_2578 62
962 3300048917 Ga0496114_0797284 Ga0496114_0797284_572_775 62
963 3300048917 Ga0496114_1268649 Ga0496114_1268649_311_514 62
964 3300048918 Ga0496115_0030587 Ga0496115_0030587_2461_2664 62
965 3300048918 Ga0496115_1459923 Ga0496115_1459923_160_363 62
966 3300050511 nmdc:mga08y16_1323210_c1 nmdc:mga08y16_1323210_c1_193_396 62
967 3300050512 nmdc:mga0n895_103732_c1 nmdc:mga0n895_103732_c1_927_1130 62
968 3300050513 nmdc:mga0rr50_1274026_c1 nmdc:mga0rr50_1274026_c1_197_400 62
969 3300053077 Ga0495601_0024573 Ga0495601_0024573_1594_1797 62
970 3300053078 Ga0495612_0109924 Ga0495612_0109924_893_1096 62
971 3300053078 Ga0495612_0420894 Ga0495612_0420894_301_504 62
972 3300053084 Ga0495595_0190648 Ga0495595_0190648_624_827 62
973 3300053084 Ga0495595_0406689 Ga0495595_0406689_64_267 62
974 3300053085 Ga0495619_0155441 Ga0495619_0155441_973_1176 62

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09838

DUF2065

Uncharacterized protein conserved in bacteria (DUF2065)

8

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tdd-assembly1.cif.gz_B bam_5924 docking domain 0.7426 28 57
6tdd-assembly1.cif.gz_B bam_5924 docking domain 0.5246 28 57
8oik-assembly2.cif.gz_B d-phat domain (ntd) of human samd4a 0.4644 1 52
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.4122 6 43
8oik-assembly2.cif.gz_B d-phat domain (ntd) of human samd4a 0.3856 1 52
ID Description Score Start End Superfamily
3o3nB01 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4879 15 46 1.20.1270.370
af_F1Q9B1_426_616_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.348 7 58 1.20.1250.20
af_O45806_8_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.336 5 47 1.20.1070.10
af_F1Q9B1_426_616_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2919 7 58 1.20.1250.20
3o3nB01 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.2917 15 46 1.20.1270.370
ID Description Score Start End GO Terms
AF-F7YIS7-F1-model_v4 deleted 0.8481 6 59
AF-A0A1C3H6S6-F1-model_v4 Inner membrane protein YjeT (Clustered with HflC) 0.8438 6 61 GO:0016020
AF-A0A1Y5RGA7-F1-model_v4 DUF2065 domain-containing protein 0.8364 6 59 GO:0016020
AF-A0A1X4J229-F1-model_v4 DUF2065 domain-containing protein 0.8184 6 60 GO:0016020
AF-A0A225NGH8-F1-model_v4 DUF2065 domain-containing protein 0.7839 6 60 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.05 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map