F487200
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 974 | 325 | 970 | 66 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10003300|rootL2_1000330018 |
| Length | 62 |
| Sequence | VTGLWDNVVFALALVLIAEGLLPFMSPRSWRRFVAQLSELKDGQLRFVGLALLLIGLLLLAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 3 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 4 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 100 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 242 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 249 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 250 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 251 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 252 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 253 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 324 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0 |
| Rhizoplane | 4.72 |
| Rhizosphere | 88.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10031410 | 3300003316 | Bacteria | 3396 |
| 2 | rootL2_10003300 | 3300003322 | Bacteria | 21471 |
| 3 | JGI26145J50221_1001962 | 3300003371 | Bacteria | 1616 |
| 4 | Ga0065165_1003031 | 3300005262 | Bacteria | 12647 |
| 5 | Ga0065712_10056070 | 3300005290 | Bacteria | 659 |
| 6 | Ga0065715_10120848 | 3300005293 | Bacteria | 2246 |
| 7 | Ga0070658_10182587 | 3300005327 | Bacteria | 1766 |
| 8 | Ga0070658_10289100 | 3300005327 | Bacteria | 1396 |
| 9 | Ga0070658_10613061 | 3300005327 | Bacteria | 943 |
| 10 | Ga0070676_10007895 | 3300005328 | Bacteria | 5719 |
| 11 | Ga0070676_10011958 | 3300005328 | Bacteria | 4731 |
| 12 | Ga0070676_10030674 | 3300005328 | Bacteria | 3067 |
| 13 | Ga0070676_10152281 | 3300005328 | Bacteria | 1481 |
| 14 | Ga0070676_10165762 | 3300005328 | Bacteria | 1425 |
| 15 | Ga0070676_10202608 | 3300005328 | Bacteria | 1301 |
| 16 | Ga0070676_10235372 | 3300005328 | Bacteria | 1216 |
| 17 | Ga0070676_10278163 | 3300005328 | Bacteria | 1127 |
| 18 | Ga0070683_100039749 | 3300005329 | Bacteria | 4321 |
| 19 | Ga0070683_100557719 | 3300005329 | Bacteria | 1095 |
| 20 | Ga0070683_101344516 | 3300005329 | Bacteria | 687 |
| 21 | Ga0070690_100116392 | 3300005330 | Bacteria | 1789 |
| 22 | Ga0070690_100367271 | 3300005330 | Bacteria | 1049 |
| 23 | Ga0070690_100558543 | 3300005330 | Bacteria | 864 |
| 24 | Ga0070670_100000334 | 3300005331 | Bacteria | 39594 |
| 25 | Ga0070670_100044516 | 3300005331 | Bacteria | 3816 |
| 26 | Ga0070670_100060634 | 3300005331 | Bacteria | 3248 |
| 27 | Ga0070670_100075077 | 3300005331 | Bacteria | 2904 |
| 28 | Ga0070670_100087706 | 3300005331 | Bacteria | 2674 |
| 29 | Ga0070670_100220336 | 3300005331 | Bacteria | 1651 |
| 30 | Ga0070670_100645234 | 3300005331 | Bacteria | 949 |
| 31 | Ga0070670_100864623 | 3300005331 | Bacteria | 818 |
| 32 | Ga0070670_101289499 | 3300005331 | Bacteria | 668 |
| 33 | Ga0070677_10006421 | 3300005333 | Bacteria | 3906 |
| 34 | Ga0070677_10006836 | 3300005333 | Bacteria | 3791 |
| 35 | Ga0070677_10008378 | 3300005333 | Bacteria | 3477 |
| 36 | Ga0070677_10081611 | 3300005333 | Bacteria | 1385 |
| 37 | Ga0070677_10096075 | 3300005333 | Bacteria | 1298 |
| 38 | Ga0070677_10117753 | 3300005333 | Bacteria | 1195 |
| 39 | Ga0070677_10137535 | 3300005333 | Bacteria | 1123 |
| 40 | Ga0070677_10213302 | 3300005333 | Bacteria | 939 |
| 41 | Ga0070677_10245694 | 3300005333 | Bacteria | 886 |
| 42 | Ga0070677_10450072 | 3300005333 | Bacteria | 689 |
| 43 | Ga0068869_100013349 | 3300005334 | Bacteria | 5461 |
| 44 | Ga0068869_100284837 | 3300005334 | Bacteria | 1330 |
| 45 | Ga0068869_100378101 | 3300005334 | Bacteria | 1160 |
| 46 | Ga0068869_100611001 | 3300005334 | Bacteria | 922 |
| 47 | Ga0068869_100802983 | 3300005334 | Bacteria | 809 |
| 48 | Ga0070666_10003466 | 3300005335 | Bacteria | 9561 |
| 49 | Ga0070666_10596720 | 3300005335 | Bacteria | 806 |
| 50 | Ga0070666_10635016 | 3300005335 | Bacteria | 780 |
| 51 | Ga0070666_10677108 | 3300005335 | Bacteria | 755 |
| 52 | Ga0070666_11039612 | 3300005335 | Bacteria | 608 |
| 53 | Ga0070680_100012537 | 3300005336 | Bacteria | 6588 |
| 54 | Ga0068868_100010821 | 3300005338 | Bacteria | 6618 |
| 55 | Ga0068868_100055602 | 3300005338 | Bacteria | 3123 |
| 56 | Ga0068868_100079519 | 3300005338 | Bacteria | 2626 |
| 57 | Ga0068868_100336794 | 3300005338 | Bacteria | 1289 |
| 58 | Ga0068868_100400257 | 3300005338 | Bacteria | 1185 |
| 59 | Ga0068868_100656203 | 3300005338 | Bacteria | 935 |
| 60 | Ga0068868_100856291 | 3300005338 | Bacteria | 824 |
| 61 | Ga0068868_100893892 | 3300005338 | Bacteria | 807 |
| 62 | Ga0070660_100120719 | 3300005339 | Bacteria | 2091 |
| 63 | Ga0070660_100293410 | 3300005339 | Bacteria | 1332 |
| 64 | Ga0070660_100618286 | 3300005339 | Bacteria | 906 |
| 65 | Ga0070689_100252613 | 3300005340 | Bacteria | 1455 |
| 66 | Ga0070689_100564921 | 3300005340 | Bacteria | 982 |
| 67 | Ga0070687_100105520 | 3300005343 | Bacteria | 1586 |
| 68 | Ga0070687_100367005 | 3300005343 | Bacteria | 934 |
| 69 | Ga0070687_100694693 | 3300005343 | Bacteria | 710 |
| 70 | Ga0070687_101539852 | 3300005343 | Bacteria | 501 |
| 71 | Ga0070661_100022092 | 3300005344 | Bacteria | 4551 |
| 72 | Ga0070661_100123527 | 3300005344 | Bacteria | 1940 |
| 73 | Ga0070661_100150066 | 3300005344 | Bacteria | 1762 |
| 74 | Ga0070661_100323746 | 3300005344 | Bacteria | 1204 |
| 75 | Ga0070661_100595266 | 3300005344 | Unclassified | 893 |
| 76 | Ga0070661_101402844 | 3300005344 | Bacteria | 588 |
| 77 | Ga0070692_10358886 | 3300005345 | Bacteria | 908 |
| 78 | Ga0070692_11380430 | 3300005345 | Bacteria | 508 |
| 79 | Ga0070668_100030279 | 3300005347 | Bacteria | 4115 |
| 80 | Ga0070668_100064311 | 3300005347 | Bacteria | 2844 |
| 81 | Ga0070668_100526822 | 3300005347 | Bacteria | 1026 |
| 82 | Ga0070668_100860308 | 3300005347 | Bacteria | 808 |
| 83 | Ga0070668_101247167 | 3300005347 | Bacteria | 675 |
| 84 | Ga0070669_100046349 | 3300005353 | Bacteria | 3170 |
| 85 | Ga0070669_100118475 | 3300005353 | Bacteria | 2017 |
| 86 | Ga0070669_100148531 | 3300005353 | Bacteria | 1813 |
| 87 | Ga0070669_100398760 | 3300005353 | Bacteria | 1125 |
| 88 | Ga0070669_101096316 | 3300005353 | Bacteria | 685 |
| 89 | Ga0070675_100009823 | 3300005354 | Bacteria | 7457 |
| 90 | Ga0070675_100037083 | 3300005354 | Bacteria | 3969 |
| 91 | Ga0070675_100048867 | 3300005354 | Bacteria | 3470 |
| 92 | Ga0070675_100072089 | 3300005354 | Bacteria | 2867 |
| 93 | Ga0070675_100095821 | 3300005354 | Bacteria | 2492 |
| 94 | Ga0070675_100145848 | 3300005354 | Bacteria | 2026 |
| 95 | Ga0070675_100161112 | 3300005354 | Bacteria | 1929 |
| 96 | Ga0070675_100671595 | 3300005354 | Bacteria | 942 |
| 97 | Ga0070675_101026303 | 3300005354 | Bacteria | 757 |
| 98 | Ga0070675_101329059 | 3300005354 | Bacteria | 662 |
| 99 | Ga0070675_101827236 | 3300005354 | Bacteria | 560 |
| 100 | Ga0070671_100004257 | 3300005355 | Bacteria | 11325 |
| 101 | Ga0070671_100010829 | 3300005355 | Bacteria | 7317 |
| 102 | Ga0070671_100010852 | 3300005355 | Bacteria | 7310 |
| 103 | Ga0070671_100035500 | 3300005355 | Bacteria | 4130 |
| 104 | Ga0070671_100054208 | 3300005355 | Bacteria | 3333 |
| 105 | Ga0070671_100151034 | 3300005355 | Bacteria | 1961 |
| 106 | Ga0070671_100352284 | 3300005355 | Bacteria | 1256 |
| 107 | Ga0070671_100431186 | 3300005355 | Bacteria | 1130 |
| 108 | Ga0070671_100541482 | 3300005355 | Bacteria | 1003 |
| 109 | Ga0070671_100549835 | 3300005355 | Bacteria | 995 |
| 110 | Ga0070671_100601713 | 3300005355 | Bacteria | 950 |
| 111 | Ga0070671_100621150 | 3300005355 | Bacteria | 934 |
| 112 | Ga0070671_100746480 | 3300005355 | Bacteria | 850 |
| 113 | Ga0070671_100853014 | 3300005355 | Bacteria | 794 |
| 114 | Ga0070674_100000872 | 3300005356 | Bacteria | 15687 |
| 115 | Ga0070674_100017499 | 3300005356 | Bacteria | 4511 |
| 116 | Ga0070674_100020439 | 3300005356 | Bacteria | 4231 |
| 117 | Ga0070674_100042928 | 3300005356 | Bacteria | 3074 |
| 118 | Ga0070674_100061607 | 3300005356 | Bacteria | 2619 |
| 119 | Ga0070674_100422050 | 3300005356 | Bacteria | 1094 |
| 120 | Ga0070674_100780396 | 3300005356 | Bacteria | 823 |
| 121 | Ga0070674_100790631 | 3300005356 | Bacteria | 818 |
| 122 | Ga0070673_100002229 | 3300005364 | Bacteria | 11725 |
| 123 | Ga0070673_100029463 | 3300005364 | Bacteria | 4093 |
| 124 | Ga0070673_100209803 | 3300005364 | Bacteria | 1681 |
| 125 | Ga0070673_100283599 | 3300005364 | Bacteria | 1453 |
| 126 | Ga0070673_100482213 | 3300005364 | Bacteria | 1119 |
| 127 | Ga0070673_100917931 | 3300005364 | Bacteria | 812 |
| 128 | Ga0070673_101102563 | 3300005364 | Bacteria | 741 |
| 129 | Ga0070673_101157201 | 3300005364 | Bacteria | 724 |
| 130 | Ga0070688_100227549 | 3300005365 | Bacteria | 1318 |
| 131 | Ga0070659_100052563 | 3300005366 | Bacteria | 3205 |
| 132 | Ga0070659_100238971 | 3300005366 | Bacteria | 1502 |
| 133 | Ga0070659_100896862 | 3300005366 | Bacteria | 775 |
| 134 | Ga0070659_101373298 | 3300005366 | Bacteria | 627 |
| 135 | Ga0070659_102036705 | 3300005366 | Bacteria | 516 |
| 136 | Ga0070667_100001505 | 3300005367 | Bacteria | 20850 |
| 137 | Ga0070667_100032551 | 3300005367 | Bacteria | 4349 |
| 138 | Ga0070667_100063471 | 3300005367 | Bacteria | 3130 |
| 139 | Ga0070667_100177233 | 3300005367 | Bacteria | 1884 |
| 140 | Ga0070667_100282605 | 3300005367 | Bacteria | 1490 |
| 141 | Ga0070667_101867480 | 3300005367 | Bacteria | 565 |
| 142 | Ga0070701_10412031 | 3300005438 | Bacteria | 859 |
| 143 | Ga0070705_100773616 | 3300005440 | Bacteria | 761 |
| 144 | Ga0070700_100486279 | 3300005441 | Bacteria | 947 |
| 145 | Ga0070700_100511520 | 3300005441 | Bacteria | 926 |
| 146 | Ga0070700_100735827 | 3300005441 | Bacteria | 788 |
| 147 | Ga0070663_100022288 | 3300005455 | Bacteria | 4232 |
| 148 | Ga0070663_100122435 | 3300005455 | Bacteria | 1966 |
| 149 | Ga0070663_100416214 | 3300005455 | Bacteria | 1102 |
| 150 | Ga0070663_100780688 | 3300005455 | Bacteria | 818 |
| 151 | Ga0070663_100848311 | 3300005455 | Bacteria | 786 |
| 152 | Ga0070678_100017379 | 3300005456 | Bacteria | 4630 |
| 153 | Ga0070678_100093244 | 3300005456 | Bacteria | 2315 |
| 154 | Ga0070678_100185327 | 3300005456 | Bacteria | 1707 |
| 155 | Ga0070678_100322701 | 3300005456 | Bacteria | 1319 |
| 156 | Ga0070678_100721715 | 3300005456 | Bacteria | 899 |
| 157 | Ga0070678_100743803 | 3300005456 | Bacteria | 886 |
| 158 | Ga0070678_100757931 | 3300005456 | Bacteria | 878 |
| 159 | Ga0070678_100966038 | 3300005456 | Bacteria | 782 |
| 160 | Ga0070678_101937979 | 3300005456 | Bacteria | 557 |
| 161 | Ga0070662_100029907 | 3300005457 | Bacteria | 3806 |
| 162 | Ga0070662_100213825 | 3300005457 | Bacteria | 1535 |
| 163 | Ga0070662_100310989 | 3300005457 | Bacteria | 1282 |
| 164 | Ga0070662_100759759 | 3300005457 | Bacteria | 822 |
| 165 | Ga0070662_101136506 | 3300005457 | Bacteria | 671 |
| 166 | Ga0070662_101239250 | 3300005457 | Bacteria | 641 |
| 167 | Ga0070662_101297301 | 3300005457 | Bacteria | 626 |
| 168 | Ga0070681_10177627 | 3300005458 | Bacteria | 2051 |
| 169 | Ga0070681_10410491 | 3300005458 | Bacteria | 1266 |
| 170 | Ga0068867_100010980 | 3300005459 | Bacteria | 6384 |
| 171 | Ga0068867_100011650 | 3300005459 | Bacteria | 6209 |
| 172 | Ga0068867_100027355 | 3300005459 | Bacteria | 4097 |
| 173 | Ga0068867_100029135 | 3300005459 | Bacteria | 3977 |
| 174 | Ga0068867_100138386 | 3300005459 | Bacteria | 1900 |
| 175 | Ga0068867_100314874 | 3300005459 | Bacteria | 1294 |
| 176 | Ga0068867_100987307 | 3300005459 | Bacteria | 763 |
| 177 | Ga0068867_101212099 | 3300005459 | Bacteria | 694 |
| 178 | Ga0068867_101993781 | 3300005459 | Bacteria | 548 |
| 179 | Ga0070685_10082173 | 3300005466 | Bacteria | 1933 |
| 180 | Ga0070699_100317735 | 3300005518 | Bacteria | 1399 |
| 181 | Ga0070679_100000691 | 3300005530 | Bacteria | 28927 |
| 182 | Ga0070679_100159319 | 3300005530 | Bacteria | 2231 |
| 183 | Ga0070679_100940739 | 3300005530 | Bacteria | 808 |
| 184 | Ga0070684_100054576 | 3300005535 | Bacteria | 3481 |
| 185 | Ga0068853_100076200 | 3300005539 | Bacteria | 2928 |
| 186 | Ga0068853_100102309 | 3300005539 | Bacteria | 2535 |
| 187 | Ga0068853_100170182 | 3300005539 | Bacteria | 1971 |
| 188 | Ga0068853_100345747 | 3300005539 | Bacteria | 1383 |
| 189 | Ga0068853_100652212 | 3300005539 | Bacteria | 1002 |
| 190 | Ga0068853_100816421 | 3300005539 | Bacteria | 893 |
| 191 | Ga0068853_101437684 | 3300005539 | Bacteria | 667 |
| 192 | Ga0068853_101617743 | 3300005539 | Bacteria | 628 |
| 193 | Ga0068853_101716184 | 3300005539 | Bacteria | 609 |
| 194 | Ga0068853_101757731 | 3300005539 | Bacteria | 601 |
| 195 | Ga0070672_100012438 | 3300005543 | Bacteria | 5972 |
| 196 | Ga0070672_100019128 | 3300005543 | Bacteria | 4965 |
| 197 | Ga0070672_100021770 | 3300005543 | Bacteria | 4695 |
| 198 | Ga0070672_100080708 | 3300005543 | Bacteria | 2606 |
| 199 | Ga0070672_100096056 | 3300005543 | Bacteria | 2397 |
| 200 | Ga0070672_100132447 | 3300005543 | Bacteria | 2050 |
| 201 | Ga0070672_100189735 | 3300005543 | Bacteria | 1715 |
| 202 | Ga0070672_100198784 | 3300005543 | Bacteria | 1676 |
| 203 | Ga0070672_100364095 | 3300005543 | Bacteria | 1234 |
| 204 | Ga0070672_100540986 | 3300005543 | Bacteria | 1010 |
| 205 | Ga0070672_100636990 | 3300005543 | Bacteria | 930 |
| 206 | Ga0070672_100796211 | 3300005543 | Bacteria | 831 |
| 207 | Ga0070672_101648803 | 3300005543 | Bacteria | 576 |
| 208 | Ga0070686_100446543 | 3300005544 | Bacteria | 993 |
| 209 | Ga0070686_100856101 | 3300005544 | Bacteria | 737 |
| 210 | Ga0070686_101555188 | 3300005544 | Bacteria | 559 |
| 211 | Ga0070686_101577993 | 3300005544 | Bacteria | 555 |
| 212 | Ga0070695_100279361 | 3300005545 | Bacteria | 1226 |
| 213 | Ga0070693_100030221 | 3300005547 | Bacteria | 2961 |
| 214 | Ga0070693_100111203 | 3300005547 | Bacteria | 1685 |
| 215 | Ga0070693_100671530 | 3300005547 | Bacteria | 756 |
| 216 | Ga0070665_100073467 | 3300005548 | Bacteria | 3425 |
| 217 | Ga0070665_100526607 | 3300005548 | Bacteria | 1194 |
| 218 | Ga0070665_100806133 | 3300005548 | Bacteria | 952 |
| 219 | Ga0070665_100819728 | 3300005548 | Bacteria | 944 |
| 220 | Ga0070665_101247166 | 3300005548 | Bacteria | 754 |
| 221 | Ga0070665_101909177 | 3300005548 | Bacteria | 600 |
| 222 | Ga0070665_102106153 | 3300005548 | Bacteria | 569 |
| 223 | Ga0068855_100224232 | 3300005563 | Bacteria | 2107 |
| 224 | Ga0070664_100175279 | 3300005564 | Bacteria | 1903 |
| 225 | Ga0070664_100224547 | 3300005564 | Bacteria | 1681 |
| 226 | Ga0070664_100533145 | 3300005564 | Bacteria | 1084 |
| 227 | Ga0070664_100540979 | 3300005564 | Bacteria | 1076 |
| 228 | Ga0070664_101200706 | 3300005564 | Bacteria | 715 |
| 229 | Ga0070664_101369863 | 3300005564 | Bacteria | 668 |
| 230 | Ga0070664_102074130 | 3300005564 | Bacteria | 540 |
| 231 | Ga0068857_100302591 | 3300005577 | Bacteria | 1474 |
| 232 | Ga0068857_100771888 | 3300005577 | Bacteria | 916 |
| 233 | Ga0068857_101253612 | 3300005577 | Bacteria | 719 |
| 234 | Ga0068857_102213244 | 3300005577 | Bacteria | 540 |
| 235 | Ga0068854_100066733 | 3300005578 | Bacteria | 2619 |
| 236 | Ga0068854_100111211 | 3300005578 | Bacteria | 2066 |
| 237 | Ga0068854_100114061 | 3300005578 | Bacteria | 2042 |
| 238 | Ga0068854_100129258 | 3300005578 | Bacteria | 1927 |
| 239 | Ga0068854_100273394 | 3300005578 | Bacteria | 1357 |
| 240 | Ga0068854_101407492 | 3300005578 | Bacteria | 631 |
| 241 | Ga0068856_100259013 | 3300005614 | Bacteria | 1755 |
| 242 | Ga0068856_100793270 | 3300005614 | Bacteria | 967 |
| 243 | Ga0070702_100119007 | 3300005615 | Bacteria | 1650 |
| 244 | Ga0070702_101699598 | 3300005615 | Bacteria | 525 |
| 245 | Ga0070702_101862658 | 3300005615 | Bacteria | 504 |
| 246 | Ga0068852_100030611 | 3300005616 | Bacteria | 4433 |
| 247 | Ga0068852_100117867 | 3300005616 | Bacteria | 2425 |
| 248 | Ga0068852_100141286 | 3300005616 | Bacteria | 2229 |
| 249 | Ga0068852_100326162 | 3300005616 | Bacteria | 1492 |
| 250 | Ga0068852_100328621 | 3300005616 | Bacteria | 1487 |
| 251 | Ga0068852_100661751 | 3300005616 | Bacteria | 1052 |
| 252 | Ga0068852_101191661 | 3300005616 | Bacteria | 782 |
| 253 | Ga0068852_101241726 | 3300005616 | Bacteria | 766 |
| 254 | Ga0068852_101462184 | 3300005616 | Bacteria | 706 |
| 255 | Ga0068852_101511748 | 3300005616 | Bacteria | 694 |
| 256 | Ga0068852_101694245 | 3300005616 | Bacteria | 655 |
| 257 | Ga0068859_100121582 | 3300005617 | Bacteria | 2678 |
| 258 | Ga0068859_100238610 | 3300005617 | Bacteria | 1907 |
| 259 | Ga0068859_100685257 | 3300005617 | Bacteria | 1116 |
| 260 | Ga0068859_101688161 | 3300005617 | Bacteria | 700 |
| 261 | Ga0068864_100007117 | 3300005618 | Bacteria | 9189 |
| 262 | Ga0068864_100032020 | 3300005618 | Bacteria | 4464 |
| 263 | Ga0068864_100377487 | 3300005618 | Bacteria | 1343 |
| 264 | Ga0068864_100380656 | 3300005618 | Bacteria | 1337 |
| 265 | Ga0068864_100604369 | 3300005618 | Bacteria | 1064 |
| 266 | Ga0068864_100673773 | 3300005618 | Bacteria | 1008 |
| 267 | Ga0068864_101029247 | 3300005618 | Bacteria | 818 |
| 268 | Ga0068864_101794862 | 3300005618 | Bacteria | 619 |
| 269 | Ga0068866_10007228 | 3300005718 | Bacteria | 4645 |
| 270 | Ga0068866_10195782 | 3300005718 | Bacteria | 1204 |
| 271 | Ga0068866_10564443 | 3300005718 | Bacteria | 763 |
| 272 | Ga0068861_100000343 | 3300005719 | Bacteria | 26498 |
| 273 | Ga0068861_100011955 | 3300005719 | Bacteria | 6045 |
| 274 | Ga0068861_100321369 | 3300005719 | Bacteria | 1348 |
| 275 | Ga0068861_101121144 | 3300005719 | Bacteria | 757 |
| 276 | Ga0068861_102572670 | 3300005719 | Bacteria | 513 |
| 277 | Ga0068851_10002903 | 3300005834 | Bacteria | 7573 |
| 278 | Ga0068851_10010554 | 3300005834 | Bacteria | 4313 |
| 279 | Ga0068851_10056524 | 3300005834 | Bacteria | 2002 |
| 280 | Ga0068851_10133644 | 3300005834 | Bacteria | 1344 |
| 281 | Ga0068851_10164200 | 3300005834 | Bacteria | 1222 |
| 282 | Ga0068851_10193935 | 3300005834 | Bacteria | 1130 |
| 283 | Ga0068851_10507855 | 3300005834 | Bacteria | 724 |
| 284 | Ga0068851_10812046 | 3300005834 | Bacteria | 581 |
| 285 | Ga0068870_10063592 | 3300005840 | Bacteria | 1991 |
| 286 | Ga0068870_10118521 | 3300005840 | Bacteria | 1521 |
| 287 | Ga0068870_10897942 | 3300005840 | Bacteria | 626 |
| 288 | Ga0068863_100065326 | 3300005841 | Bacteria | 3442 |
| 289 | Ga0068863_100115186 | 3300005841 | Bacteria | 2561 |
| 290 | Ga0068863_100130049 | 3300005841 | Bacteria | 2403 |
| 291 | Ga0068863_100177120 | 3300005841 | Bacteria | 2047 |
| 292 | Ga0068863_100413570 | 3300005841 | Bacteria | 1320 |
| 293 | Ga0068863_101323130 | 3300005841 | Bacteria | 728 |
| 294 | Ga0068863_102318511 | 3300005841 | Bacteria | 546 |
| 295 | Ga0068858_100001875 | 3300005842 | Bacteria | 21440 |
| 296 | Ga0068858_100005928 | 3300005842 | Bacteria | 11931 |
| 297 | Ga0068858_100261499 | 3300005842 | Bacteria | 1645 |
| 298 | Ga0068858_100652105 | 3300005842 | Bacteria | 1023 |
| 299 | Ga0068860_100000707 | 3300005843 | Bacteria | 38265 |
| 300 | Ga0068860_100000715 | 3300005843 | Bacteria | 37986 |
| 301 | Ga0068860_100104922 | 3300005843 | Bacteria | 2698 |
| 302 | Ga0068860_100189597 | 3300005843 | Bacteria | 1989 |
| 303 | Ga0068862_100011541 | 3300005844 | Bacteria | 7290 |
| 304 | Ga0068862_100014347 | 3300005844 | Bacteria | 6572 |
| 305 | Ga0068862_100068622 | 3300005844 | Bacteria | 3059 |
| 306 | Ga0068862_100415803 | 3300005844 | Bacteria | 1261 |
| 307 | Ga0070717_11540018 | 3300006028 | Bacteria | 603 |
| 308 | Ga0075368_10088381 | 3300006042 | Bacteria | 1266 |
| 309 | Ga0075363_100328174 | 3300006048 | Bacteria | 891 |
| 310 | Ga0070715_10096131 | 3300006163 | Bacteria | 1373 |
| 311 | Ga0070715_10253411 | 3300006163 | Bacteria | 921 |
| 312 | Ga0070715_10931147 | 3300006163 | Bacteria | 537 |
| 313 | Ga0075362_10086726 | 3300006177 | Bacteria | 1449 |
| 314 | Ga0075362_10277468 | 3300006177 | Bacteria | 828 |
| 315 | Ga0075362_10458263 | 3300006177 | Bacteria | 648 |
| 316 | Ga0075362_10545978 | 3300006177 | Bacteria | 596 |
| 317 | Ga0075367_10496110 | 3300006178 | Bacteria | 774 |
| 318 | Ga0075366_10170362 | 3300006195 | Bacteria | 1321 |
| 319 | Ga0075366_10541221 | 3300006195 | Bacteria | 721 |
| 320 | Ga0075366_10607848 | 3300006195 | Bacteria | 678 |
| 321 | Ga0075366_10640360 | 3300006195 | Bacteria | 659 |
| 322 | Ga0075366_10779250 | 3300006195 | Bacteria | 594 |
| 323 | Ga0097621_100011190 | 3300006237 | Bacteria | 6605 |
| 324 | Ga0097621_100044489 | 3300006237 | Bacteria | 3582 |
| 325 | Ga0097621_100044639 | 3300006237 | Bacteria | 3576 |
| 326 | Ga0097621_100093928 | 3300006237 | Bacteria | 2514 |
| 327 | Ga0097621_102331765 | 3300006237 | Bacteria | 512 |
| 328 | Ga0068871_100020020 | 3300006358 | Bacteria | 5119 |
| 329 | Ga0068871_100277044 | 3300006358 | Bacteria | 1466 |
| 330 | Ga0068871_100373397 | 3300006358 | Bacteria | 1265 |
| 331 | Ga0068871_100484828 | 3300006358 | Bacteria | 1112 |
| 332 | Ga0068871_101751292 | 3300006358 | Bacteria | 590 |
| 333 | Ga0068865_100007045 | 3300006881 | Bacteria | 6901 |
| 334 | Ga0068865_100024062 | 3300006881 | Bacteria | 3992 |
| 335 | Ga0068865_100046341 | 3300006881 | Bacteria | 2983 |
| 336 | Ga0068865_100092367 | 3300006881 | Bacteria | 2198 |
| 337 | Ga0068865_100267267 | 3300006881 | Bacteria | 1356 |
| 338 | Ga0097620_100121581 | 3300006931 | Bacteria | 2678 |
| 339 | Ga0097620_100238594 | 3300006931 | Bacteria | 1907 |
| 340 | Ga0097620_100685274 | 3300006931 | Bacteria | 1116 |
| 341 | Ga0097620_101688261 | 3300006931 | Bacteria | 700 |
| 342 | Ga0075435_100172515 | 3300007076 | Bacteria | 1825 |
| 343 | Ga0105250_10473094 | 3300009092 | Bacteria | 565 |
| 344 | Ga0105240_10055798 | 3300009093 | Bacteria | 4946 |
| 345 | Ga0105240_10277408 | 3300009093 | Bacteria | 1927 |
| 346 | Ga0105240_12534235 | 3300009093 | Bacteria | 530 |
| 347 | Ga0111539_11849977 | 3300009094 | Bacteria | 700 |
| 348 | Ga0105245_10064976 | 3300009098 | Bacteria | 3299 |
| 349 | Ga0105245_10329579 | 3300009098 | Bacteria | 1506 |
| 350 | Ga0105245_12341658 | 3300009098 | Bacteria | 588 |
| 351 | Ga0105247_10067959 | 3300009101 | Bacteria | 2221 |
| 352 | Ga0105247_11447209 | 3300009101 | Bacteria | 558 |
| 353 | Ga0105247_11489538 | 3300009101 | Bacteria | 551 |
| 354 | Ga0114129_11646705 | 3300009147 | Bacteria | 784 |
| 355 | Ga0105243_10113425 | 3300009148 | Bacteria | 2273 |
| 356 | Ga0105243_10132427 | 3300009148 | Bacteria | 2117 |
| 357 | Ga0105243_10341295 | 3300009148 | Bacteria | 1372 |
| 358 | Ga0105243_10870838 | 3300009148 | Bacteria | 894 |
| 359 | Ga0105243_11316347 | 3300009148 | Bacteria | 740 |
| 360 | Ga0105241_10371778 | 3300009174 | Bacteria | 1247 |
| 361 | Ga0105241_11742821 | 3300009174 | Bacteria | 606 |
| 362 | Ga0105242_10305956 | 3300009176 | Bacteria | 1453 |
| 363 | Ga0105242_10709211 | 3300009176 | Bacteria | 985 |
| 364 | Ga0105242_11118956 | 3300009176 | Bacteria | 802 |
| 365 | Ga0105242_11582279 | 3300009176 | Bacteria | 689 |
| 366 | Ga0105242_12948473 | 3300009176 | Bacteria | 526 |
| 367 | Ga0105248_10002863 | 3300009177 | Bacteria | 19149 |
| 368 | Ga0105248_10059166 | 3300009177 | Bacteria | 4303 |
| 369 | Ga0105248_10617720 | 3300009177 | Bacteria | 1223 |
| 370 | Ga0105248_10714340 | 3300009177 | Bacteria | 1131 |
| 371 | Ga0105248_10715923 | 3300009177 | Bacteria | 1129 |
| 372 | Ga0105237_10000367 | 3300009545 | Bacteria | 63983 |
| 373 | Ga0105238_10040068 | 3300009551 | Bacteria | 4749 |
| 374 | Ga0105238_10401529 | 3300009551 | Bacteria | 1364 |
| 375 | Ga0105238_10487169 | 3300009551 | Bacteria | 1233 |
| 376 | Ga0105238_10940719 | 3300009551 | Bacteria | 884 |
| 377 | Ga0105238_12134239 | 3300009551 | Bacteria | 595 |
| 378 | Ga0105249_10089453 | 3300009553 | Bacteria | 2877 |
| 379 | Ga0105249_10133828 | 3300009553 | Bacteria | 2370 |
| 380 | Ga0105249_10631708 | 3300009553 | Bacteria | 1127 |
| 381 | Ga0105249_10669065 | 3300009553 | Bacteria | 1097 |
| 382 | Ga0105249_11228564 | 3300009553 | Bacteria | 821 |
| 383 | Ga0105249_12146313 | 3300009553 | Bacteria | 631 |
| 384 | Ga0105239_10000150 | 3300010375 | Bacteria | 100349 |
| 385 | Ga0105239_10276434 | 3300010375 | Bacteria | 1890 |
| 386 | Ga0105246_10352684 | 3300011119 | Bacteria | 1206 |
| 387 | Ga0105246_10761488 | 3300011119 | Bacteria | 855 |
| 388 | Ga0105246_11093499 | 3300011119 | Bacteria | 727 |
| 389 | Ga0105246_11817416 | 3300011119 | Bacteria | 583 |
| 390 | Ga0157337_1038356 | 3300012483 | Unclassified | 519 |
| 391 | Ga0157324_1038928 | 3300012506 | Bacteria | 574 |
| 392 | Ga0157342_1031486 | 3300012507 | Bacteria | 670 |
| 393 | Ga0157327_1075180 | 3300012512 | Bacteria | 533 |
| 394 | Ga0157373_10025385 | 3300013100 | Bacteria | 4286 |
| 395 | Ga0157373_10186599 | 3300013100 | Bacteria | 1461 |
| 396 | Ga0157371_10072827 | 3300013102 | Bacteria | 2433 |
| 397 | Ga0157371_10128765 | 3300013102 | Bacteria | 1800 |
| 398 | Ga0157370_10185786 | 3300013104 | Bacteria | 1930 |
| 399 | Ga0157370_10216969 | 3300013104 | Bacteria | 1773 |
| 400 | Ga0157370_10808849 | 3300013104 | Bacteria | 853 |
| 401 | Ga0157369_10304210 | 3300013105 | Bacteria | 1658 |
| 402 | Ga0157369_10473092 | 3300013105 | Bacteria | 1297 |
| 403 | Ga0157369_11770209 | 3300013105 | Bacteria | 628 |
| 404 | Ga0157369_11993140 | 3300013105 | Bacteria | 589 |
| 405 | Ga0157374_10011711 | 3300013296 | Bacteria | 7608 |
| 406 | Ga0157374_10167425 | 3300013296 | Bacteria | 2142 |
| 407 | Ga0157374_10497068 | 3300013296 | Bacteria | 1224 |
| 408 | Ga0157374_10866612 | 3300013296 | Bacteria | 920 |
| 409 | Ga0157378_10009725 | 3300013297 | Bacteria | 8376 |
| 410 | Ga0157378_10128783 | 3300013297 | Bacteria | 2340 |
| 411 | Ga0157378_10770619 | 3300013297 | Bacteria | 986 |
| 412 | Ga0157378_11235427 | 3300013297 | Bacteria | 787 |
| 413 | Ga0163162_10005242 | 3300013306 | Bacteria | 12495 |
| 414 | Ga0163162_10033576 | 3300013306 | Bacteria | 5100 |
| 415 | Ga0163162_10060697 | 3300013306 | Bacteria | 3817 |
| 416 | Ga0163162_10087073 | 3300013306 | Bacteria | 3202 |
| 417 | Ga0163162_10445140 | 3300013306 | Bacteria | 1427 |
| 418 | Ga0163162_10771061 | 3300013306 | Bacteria | 1080 |
| 419 | Ga0163162_10934425 | 3300013306 | Bacteria | 979 |
| 420 | Ga0163162_11106003 | 3300013306 | Bacteria | 898 |
| 421 | Ga0157372_10155294 | 3300013307 | Bacteria | 2643 |
| 422 | Ga0157372_10324538 | 3300013307 | Bacteria | 1792 |
| 423 | Ga0157372_10683649 | 3300013307 | Bacteria | 1194 |
| 424 | Ga0157372_10688085 | 3300013307 | Bacteria | 1190 |
| 425 | Ga0157375_10050873 | 3300013308 | Bacteria | 4066 |
| 426 | Ga0157375_10075875 | 3300013308 | Bacteria | 3387 |
| 427 | Ga0157375_10159639 | 3300013308 | Bacteria | 2396 |
| 428 | Ga0157375_10234397 | 3300013308 | Bacteria | 1995 |
| 429 | Ga0157375_10387830 | 3300013308 | Bacteria | 1564 |
| 430 | Ga0157375_10496673 | 3300013308 | Bacteria | 1384 |
| 431 | Ga0157375_10916976 | 3300013308 | Bacteria | 1019 |
| 432 | Ga0157375_11111808 | 3300013308 | Bacteria | 925 |
| 433 | Ga0157375_11532370 | 3300013308 | Bacteria | 787 |
| 434 | Ga0157375_11561389 | 3300013308 | Bacteria | 780 |
| 435 | Ga0163163_10014367 | 3300014325 | Bacteria | 7279 |
| 436 | Ga0163163_10529428 | 3300014325 | Bacteria | 1241 |
| 437 | Ga0163163_11098699 | 3300014325 | Bacteria | 858 |
| 438 | Ga0163163_11138890 | 3300014325 | Bacteria | 843 |
| 439 | Ga0163163_11420162 | 3300014325 | Bacteria | 756 |
| 440 | Ga0163163_12367296 | 3300014325 | Bacteria | 590 |
| 441 | Ga0163163_12479108 | 3300014325 | Bacteria | 577 |
| 442 | Ga0157380_10011753 | 3300014326 | Bacteria | 6331 |
| 443 | Ga0157380_10021172 | 3300014326 | Bacteria | 4874 |
| 444 | Ga0157380_10061204 | 3300014326 | Bacteria | 3011 |
| 445 | Ga0157380_10166331 | 3300014326 | Bacteria | 1922 |
| 446 | Ga0157380_10281277 | 3300014326 | Bacteria | 1522 |
| 447 | Ga0157380_10625553 | 3300014326 | Bacteria | 1069 |
| 448 | Ga0157380_11209550 | 3300014326 | Bacteria | 799 |
| 449 | Ga0157380_12583851 | 3300014326 | Unclassified | 574 |
| 450 | Ga0157377_10017799 | 3300014745 | Bacteria | 3683 |
| 451 | Ga0157377_10296155 | 3300014745 | Bacteria | 1066 |
| 452 | Ga0157377_11613543 | 3300014745 | Bacteria | 520 |
| 453 | Ga0157379_10000528 | 3300014968 | Bacteria | 30947 |
| 454 | Ga0157379_10034268 | 3300014968 | Bacteria | 4526 |
| 455 | Ga0157379_10034425 | 3300014968 | Bacteria | 4517 |
| 456 | Ga0157379_10376614 | 3300014968 | Bacteria | 1302 |
| 457 | Ga0157379_10411811 | 3300014968 | Bacteria | 1244 |
| 458 | Ga0157379_10809452 | 3300014968 | Bacteria | 885 |
| 459 | Ga0157379_11107729 | 3300014968 | Bacteria | 759 |
| 460 | Ga0157376_10014036 | 3300014969 | Bacteria | 5997 |
| 461 | Ga0157376_10130516 | 3300014969 | Bacteria | 2241 |
| 462 | Ga0157376_10199089 | 3300014969 | Bacteria | 1841 |
| 463 | Ga0157376_10762639 | 3300014969 | Bacteria | 977 |
| 464 | Ga0157376_11214602 | 3300014969 | Bacteria | 782 |
| 465 | Ga0157376_11397944 | 3300014969 | Bacteria | 731 |
| 466 | Ga0182005_1053602 | 3300015265 | Bacteria | 1098 |
| 467 | Ga0163161_10005129 | 3300017792 | Bacteria | 9108 |
| 468 | Ga0163161_10085881 | 3300017792 | Bacteria | 2322 |
| 469 | Ga0163161_10484359 | 3300017792 | Bacteria | 1005 |
| 470 | Ga0163161_10830353 | 3300017792 | Bacteria | 778 |
| 471 | Ga0163161_11527848 | 3300017792 | Bacteria | 587 |
| 472 | Ga0163161_12049609 | 3300017792 | Bacteria | 509 |
| 473 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 474 | Ga0213876_10055319 | 3300021384 | Bacteria | 2095 |
| 475 | Ga0209565_1070607 | 3300025263 | Bacteria | 590 |
| 476 | Ga0209673_1027766 | 3300025273 | Bacteria | 1835 |
| 477 | Ga0209758_1006025 | 3300025297 | Bacteria | 8954 |
| 478 | Ga0209050_1001091 | 3300025298 | Bacteria | 32964 |
| 479 | Ga0209257_1102802 | 3300025304 | Bacteria | 694 |
| 480 | Ga0207697_10096614 | 3300025315 | Bacteria | 1256 |
| 481 | Ga0207697_10290377 | 3300025315 | Bacteria | 725 |
| 482 | Ga0207697_10296289 | 3300025315 | Bacteria | 717 |
| 483 | Ga0207656_10106981 | 3300025321 | Bacteria | 1288 |
| 484 | Ga0207656_10138223 | 3300025321 | Bacteria | 1147 |
| 485 | Ga0207656_10151740 | 3300025321 | Bacteria | 1098 |
| 486 | Ga0207656_10156984 | 3300025321 | Bacteria | 1080 |
| 487 | Ga0207656_10178943 | 3300025321 | Bacteria | 1017 |
| 488 | Ga0207656_10211827 | 3300025321 | Bacteria | 939 |
| 489 | Ga0207656_10348212 | 3300025321 | Bacteria | 739 |
| 490 | Ga0207682_10000725 | 3300025893 | Bacteria | 15303 |
| 491 | Ga0207682_10003929 | 3300025893 | Bacteria | 6347 |
| 492 | Ga0207682_10028381 | 3300025893 | Bacteria | 2233 |
| 493 | Ga0207682_10069616 | 3300025893 | Bacteria | 1488 |
| 494 | Ga0207642_10006251 | 3300025899 | Bacteria | 3951 |
| 495 | Ga0207710_10134024 | 3300025900 | Bacteria | 1191 |
| 496 | Ga0207688_10022082 | 3300025901 | Bacteria | 3482 |
| 497 | Ga0207688_10397661 | 3300025901 | Bacteria | 854 |
| 498 | Ga0207680_10012299 | 3300025903 | Bacteria | 4355 |
| 499 | Ga0207680_10028426 | 3300025903 | Bacteria | 3128 |
| 500 | Ga0207680_10175924 | 3300025903 | Bacteria | 1444 |
| 501 | Ga0207680_10384721 | 3300025903 | Bacteria | 990 |
| 502 | Ga0207685_10010306 | 3300025905 | Bacteria | 2753 |
| 503 | Ga0207685_10809541 | 3300025905 | Bacteria | 516 |
| 504 | Ga0207645_10017365 | 3300025907 | Bacteria | 4750 |
| 505 | Ga0207645_10043897 | 3300025907 | Bacteria | 2861 |
| 506 | Ga0207645_10044206 | 3300025907 | Bacteria | 2851 |
| 507 | Ga0207645_10207552 | 3300025907 | Bacteria | 1290 |
| 508 | Ga0207645_10880130 | 3300025907 | Bacteria | 609 |
| 509 | Ga0207643_10454013 | 3300025908 | Bacteria | 816 |
| 510 | Ga0207643_10924215 | 3300025908 | Bacteria | 565 |
| 511 | Ga0207705_10199362 | 3300025909 | Bacteria | 1516 |
| 512 | Ga0207705_10276262 | 3300025909 | Bacteria | 1285 |
| 513 | Ga0207705_10371493 | 3300025909 | Bacteria | 1104 |
| 514 | Ga0207705_10623561 | 3300025909 | Bacteria | 839 |
| 515 | Ga0207654_10184095 | 3300025911 | Bacteria | 1364 |
| 516 | Ga0207707_10315409 | 3300025912 | Bacteria | 1350 |
| 517 | Ga0207707_11387295 | 3300025912 | Bacteria | 561 |
| 518 | Ga0207695_10123068 | 3300025913 | Bacteria | 2560 |
| 519 | Ga0207695_10985088 | 3300025913 | Bacteria | 723 |
| 520 | Ga0207671_10000808 | 3300025914 | Bacteria | 39539 |
| 521 | Ga0207671_10563606 | 3300025914 | Bacteria | 908 |
| 522 | Ga0207660_10050947 | 3300025917 | Bacteria | 2942 |
| 523 | Ga0207662_10008920 | 3300025918 | Bacteria | 5502 |
| 524 | Ga0207662_10391099 | 3300025918 | Bacteria | 941 |
| 525 | Ga0207662_10476268 | 3300025918 | Bacteria | 857 |
| 526 | Ga0207657_10590231 | 3300025919 | Bacteria | 867 |
| 527 | Ga0207657_10593843 | 3300025919 | Bacteria | 864 |
| 528 | Ga0207649_10003067 | 3300025920 | Bacteria | 9172 |
| 529 | Ga0207649_10046343 | 3300025920 | Bacteria | 2670 |
| 530 | Ga0207649_10331111 | 3300025920 | Bacteria | 1122 |
| 531 | Ga0207649_10592186 | 3300025920 | Bacteria | 852 |
| 532 | Ga0207649_10679938 | 3300025920 | Bacteria | 797 |
| 533 | Ga0207649_10904275 | 3300025920 | Bacteria | 692 |
| 534 | Ga0207649_11135429 | 3300025920 | Bacteria | 617 |
| 535 | Ga0207649_11421429 | 3300025920 | Bacteria | 549 |
| 536 | Ga0207652_10003994 | 3300025921 | Bacteria | 12057 |
| 537 | Ga0207652_11033990 | 3300025921 | Bacteria | 721 |
| 538 | Ga0207652_11362930 | 3300025921 | Unclassified | 612 |
| 539 | Ga0207681_10078779 | 3300025923 | Bacteria | 2320 |
| 540 | Ga0207681_10128908 | 3300025923 | Bacteria | 1867 |
| 541 | Ga0207681_10283872 | 3300025923 | Bacteria | 1304 |
| 542 | Ga0207694_10037673 | 3300025924 | Bacteria | 3715 |
| 543 | Ga0207694_10432688 | 3300025924 | Bacteria | 1097 |
| 544 | Ga0207694_10698338 | 3300025924 | Bacteria | 856 |
| 545 | Ga0207694_10906448 | 3300025924 | Bacteria | 745 |
| 546 | Ga0207650_10000913 | 3300025925 | Bacteria | 22271 |
| 547 | Ga0207650_10009570 | 3300025925 | Bacteria | 6627 |
| 548 | Ga0207650_10033279 | 3300025925 | Bacteria | 3732 |
| 549 | Ga0207650_10157405 | 3300025925 | Bacteria | 1797 |
| 550 | Ga0207650_10301228 | 3300025925 | Bacteria | 1309 |
| 551 | Ga0207659_10000189 | 3300025926 | Bacteria | 36771 |
| 552 | Ga0207659_10028616 | 3300025926 | Bacteria | 3789 |
| 553 | Ga0207659_10088146 | 3300025926 | Bacteria | 2311 |
| 554 | Ga0207659_10098332 | 3300025926 | Bacteria | 2200 |
| 555 | Ga0207659_10142039 | 3300025926 | Bacteria | 1865 |
| 556 | Ga0207659_10521296 | 3300025926 | Bacteria | 1008 |
| 557 | Ga0207687_10090230 | 3300025927 | Bacteria | 2233 |
| 558 | Ga0207644_10018141 | 3300025931 | Bacteria | 4758 |
| 559 | Ga0207644_10032530 | 3300025931 | Bacteria | 3639 |
| 560 | Ga0207644_10040242 | 3300025931 | Bacteria | 3303 |
| 561 | Ga0207644_10176881 | 3300025931 | Bacteria | 1670 |
| 562 | Ga0207644_10363015 | 3300025931 | Bacteria | 1178 |
| 563 | Ga0207644_10695873 | 3300025931 | Bacteria | 847 |
| 564 | Ga0207644_10893404 | 3300025931 | Bacteria | 744 |
| 565 | Ga0207644_11360521 | 3300025931 | Bacteria | 596 |
| 566 | Ga0207690_10180979 | 3300025932 | Bacteria | 1587 |
| 567 | Ga0207690_10317820 | 3300025932 | Bacteria | 1223 |
| 568 | Ga0207690_10977548 | 3300025932 | Bacteria | 704 |
| 569 | Ga0207690_10987519 | 3300025932 | Bacteria | 700 |
| 570 | Ga0207690_11633755 | 3300025932 | Bacteria | 538 |
| 571 | Ga0207706_10019673 | 3300025933 | Bacteria | 6074 |
| 572 | Ga0207706_10046513 | 3300025933 | Bacteria | 3841 |
| 573 | Ga0207706_10056711 | 3300025933 | Bacteria | 3453 |
| 574 | Ga0207706_10249464 | 3300025933 | Bacteria | 1551 |
| 575 | Ga0207706_10375740 | 3300025933 | Bacteria | 1234 |
| 576 | Ga0207706_10557269 | 3300025933 | Bacteria | 986 |
| 577 | Ga0207706_10776691 | 3300025933 | Bacteria | 815 |
| 578 | Ga0207706_11333898 | 3300025933 | Bacteria | 592 |
| 579 | Ga0207706_11526059 | 3300025933 | Bacteria | 544 |
| 580 | Ga0207686_10057830 | 3300025934 | Bacteria | 2443 |
| 581 | Ga0207686_10455454 | 3300025934 | Bacteria | 985 |
| 582 | Ga0207709_10249456 | 3300025935 | Bacteria | 1296 |
| 583 | Ga0207709_10375095 | 3300025935 | Bacteria | 1081 |
| 584 | Ga0207709_10941137 | 3300025935 | Bacteria | 704 |
| 585 | Ga0207709_11641056 | 3300025935 | Bacteria | 534 |
| 586 | Ga0207670_10420861 | 3300025936 | Bacteria | 1072 |
| 587 | Ga0207670_10726512 | 3300025936 | Bacteria | 823 |
| 588 | Ga0207669_10251821 | 3300025937 | Bacteria | 1315 |
| 589 | Ga0207669_10290215 | 3300025937 | Bacteria | 1238 |
| 590 | Ga0207669_10355436 | 3300025937 | Bacteria | 1133 |
| 591 | Ga0207669_10355444 | 3300025937 | Bacteria | 1133 |
| 592 | Ga0207669_10356794 | 3300025937 | Bacteria | 1131 |
| 593 | Ga0207669_10483492 | 3300025937 | Bacteria | 987 |
| 594 | Ga0207669_10722280 | 3300025937 | Bacteria | 820 |
| 595 | Ga0207704_10003998 | 3300025938 | Bacteria | 6711 |
| 596 | Ga0207704_10051709 | 3300025938 | Bacteria | 2486 |
| 597 | Ga0207704_10247305 | 3300025938 | Bacteria | 1336 |
| 598 | Ga0207704_10463995 | 3300025938 | Bacteria | 1013 |
| 599 | Ga0207704_10629573 | 3300025938 | Bacteria | 881 |
| 600 | Ga0207665_10067160 | 3300025939 | Bacteria | 2441 |
| 601 | Ga0207691_10002491 | 3300025940 | Bacteria | 18008 |
| 602 | Ga0207691_10022344 | 3300025940 | Bacteria | 5967 |
| 603 | Ga0207691_10036304 | 3300025940 | Bacteria | 4566 |
| 604 | Ga0207691_10046984 | 3300025940 | Bacteria | 3964 |
| 605 | Ga0207691_10060239 | 3300025940 | Bacteria | 3449 |
| 606 | Ga0207691_10064120 | 3300025940 | Bacteria | 3330 |
| 607 | Ga0207691_10115269 | 3300025940 | Bacteria | 2386 |
| 608 | Ga0207691_10276681 | 3300025940 | Bacteria | 1445 |
| 609 | Ga0207691_10416591 | 3300025940 | Bacteria | 1145 |
| 610 | Ga0207691_10538816 | 3300025940 | Bacteria | 990 |
| 611 | Ga0207691_11295023 | 3300025940 | Bacteria | 602 |
| 612 | Ga0207691_11332922 | 3300025940 | Bacteria | 592 |
| 613 | Ga0207711_10175231 | 3300025941 | Bacteria | 1948 |
| 614 | Ga0207711_10199640 | 3300025941 | Bacteria | 1825 |
| 615 | Ga0207711_10432966 | 3300025941 | Bacteria | 1224 |
| 616 | Ga0207711_10905306 | 3300025941 | Bacteria | 820 |
| 617 | Ga0207689_10023257 | 3300025942 | Bacteria | 5204 |
| 618 | Ga0207689_10030492 | 3300025942 | Bacteria | 4494 |
| 619 | Ga0207689_10604887 | 3300025942 | Bacteria | 922 |
| 620 | Ga0207661_10025979 | 3300025944 | Bacteria | 4457 |
| 621 | Ga0207661_10104735 | 3300025944 | Bacteria | 2382 |
| 622 | Ga0207679_10294931 | 3300025945 | Bacteria | 1395 |
| 623 | Ga0207679_10936490 | 3300025945 | Bacteria | 793 |
| 624 | Ga0207679_11172985 | 3300025945 | Bacteria | 705 |
| 625 | Ga0207679_12167833 | 3300025945 | Bacteria | 504 |
| 626 | Ga0207667_10238026 | 3300025949 | Bacteria | 1863 |
| 627 | Ga0207651_10006755 | 3300025960 | Bacteria | 6045 |
| 628 | Ga0207651_10036579 | 3300025960 | Bacteria | 3206 |
| 629 | Ga0207651_10261065 | 3300025960 | Bacteria | 1422 |
| 630 | Ga0207651_10384276 | 3300025960 | Bacteria | 1190 |
| 631 | Ga0207651_10663526 | 3300025960 | Bacteria | 916 |
| 632 | Ga0207651_11726224 | 3300025960 | Bacteria | 564 |
| 633 | Ga0207712_10158752 | 3300025961 | Bacteria | 1755 |
| 634 | Ga0207712_10365122 | 3300025961 | Bacteria | 1204 |
| 635 | Ga0207668_10154213 | 3300025972 | Bacteria | 1782 |
| 636 | Ga0207668_10239930 | 3300025972 | Bacteria | 1466 |
| 637 | Ga0207668_10581705 | 3300025972 | Bacteria | 973 |
| 638 | Ga0207668_11032804 | 3300025972 | Bacteria | 735 |
| 639 | Ga0207640_10064285 | 3300025981 | Bacteria | 2442 |
| 640 | Ga0207640_10106518 | 3300025981 | Bacteria | 1978 |
| 641 | Ga0207640_10345483 | 3300025981 | Bacteria | 1193 |
| 642 | Ga0207640_10464869 | 3300025981 | Bacteria | 1046 |
| 643 | Ga0207640_10727442 | 3300025981 | Bacteria | 853 |
| 644 | Ga0207640_11092677 | 3300025981 | Bacteria | 705 |
| 645 | Ga0207658_10259502 | 3300025986 | Bacteria | 1480 |
| 646 | Ga0207658_10356188 | 3300025986 | Bacteria | 1275 |
| 647 | Ga0207677_10006180 | 3300026023 | Bacteria | 6546 |
| 648 | Ga0207677_10008231 | 3300026023 | Bacteria | 5812 |
| 649 | Ga0207677_10243194 | 3300026023 | Bacteria | 1457 |
| 650 | Ga0207677_10249684 | 3300026023 | Bacteria | 1440 |
| 651 | Ga0207677_10374579 | 3300026023 | Bacteria | 1200 |
| 652 | Ga0207677_10576931 | 3300026023 | Bacteria | 984 |
| 653 | Ga0207677_10746347 | 3300026023 | Bacteria | 872 |
| 654 | Ga0207677_10865955 | 3300026023 | Bacteria | 813 |
| 655 | Ga0207703_10019219 | 3300026035 | Bacteria | 5337 |
| 656 | Ga0207639_10168564 | 3300026041 | Bacteria | 1852 |
| 657 | Ga0207639_10182817 | 3300026041 | Bacteria | 1785 |
| 658 | Ga0207639_10393961 | 3300026041 | Bacteria | 1246 |
| 659 | Ga0207639_10612436 | 3300026041 | Bacteria | 1005 |
| 660 | Ga0207639_10765798 | 3300026041 | Bacteria | 898 |
| 661 | Ga0207639_11162988 | 3300026041 | Bacteria | 724 |
| 662 | Ga0207678_10098284 | 3300026067 | Bacteria | 2501 |
| 663 | Ga0207678_10433145 | 3300026067 | Bacteria | 1141 |
| 664 | Ga0207678_10809591 | 3300026067 | Bacteria | 827 |
| 665 | Ga0207678_10856175 | 3300026067 | Bacteria | 803 |
| 666 | Ga0207708_10033764 | 3300026075 | Bacteria | 3889 |
| 667 | Ga0207708_10613258 | 3300026075 | Bacteria | 923 |
| 668 | Ga0207708_10623155 | 3300026075 | Bacteria | 916 |
| 669 | Ga0207702_10159617 | 3300026078 | Bacteria | 2058 |
| 670 | Ga0207702_10629741 | 3300026078 | Bacteria | 1054 |
| 671 | Ga0207702_10821268 | 3300026078 | Bacteria | 919 |
| 672 | Ga0207702_10900339 | 3300026078 | Bacteria | 877 |
| 673 | Ga0207702_11058535 | 3300026078 | Bacteria | 805 |
| 674 | Ga0207641_10102813 | 3300026088 | Bacteria | 2520 |
| 675 | Ga0207641_10145771 | 3300026088 | Bacteria | 2141 |
| 676 | Ga0207641_10243287 | 3300026088 | Bacteria | 1677 |
| 677 | Ga0207641_10853699 | 3300026088 | Bacteria | 902 |
| 678 | Ga0207648_10001050 | 3300026089 | Bacteria | 30933 |
| 679 | Ga0207648_10017069 | 3300026089 | Bacteria | 6617 |
| 680 | Ga0207648_10020934 | 3300026089 | Bacteria | 5889 |
| 681 | Ga0207648_10025462 | 3300026089 | Bacteria | 5269 |
| 682 | Ga0207648_10038664 | 3300026089 | Bacteria | 4198 |
| 683 | Ga0207648_10062807 | 3300026089 | Bacteria | 3238 |
| 684 | Ga0207648_10077331 | 3300026089 | Bacteria | 2901 |
| 685 | Ga0207648_10292324 | 3300026089 | Bacteria | 1459 |
| 686 | Ga0207648_12067787 | 3300026089 | Bacteria | 531 |
| 687 | Ga0207676_10010740 | 3300026095 | Bacteria | 6529 |
| 688 | Ga0207676_10012969 | 3300026095 | Bacteria | 5985 |
| 689 | Ga0207676_10017091 | 3300026095 | Bacteria | 5255 |
| 690 | Ga0207676_10112784 | 3300026095 | Bacteria | 2278 |
| 691 | Ga0207676_10365923 | 3300026095 | Bacteria | 1338 |
| 692 | Ga0207676_10714042 | 3300026095 | Bacteria | 972 |
| 693 | Ga0207676_11128801 | 3300026095 | Bacteria | 775 |
| 694 | Ga0207676_11427397 | 3300026095 | Bacteria | 688 |
| 695 | Ga0207674_10037357 | 3300026116 | Bacteria | 5052 |
| 696 | Ga0207674_10284228 | 3300026116 | Bacteria | 1603 |
| 697 | Ga0207674_11617705 | 3300026116 | Unclassified | 616 |
| 698 | Ga0207675_100009210 | 3300026118 | Bacteria | 9259 |
| 699 | Ga0207675_100013996 | 3300026118 | Bacteria | 7479 |
| 700 | Ga0207675_100017970 | 3300026118 | Bacteria | 6596 |
| 701 | Ga0207675_100112605 | 3300026118 | Bacteria | 2568 |
| 702 | Ga0207675_100174563 | 3300026118 | Bacteria | 2056 |
| 703 | Ga0207675_101810132 | 3300026118 | Bacteria | 630 |
| 704 | Ga0207683_10040810 | 3300026121 | Bacteria | 4052 |
| 705 | Ga0207683_10111933 | 3300026121 | Bacteria | 2445 |
| 706 | Ga0207683_10126252 | 3300026121 | Bacteria | 2299 |
| 707 | Ga0207683_10153083 | 3300026121 | Bacteria | 2082 |
| 708 | Ga0207683_10218485 | 3300026121 | Bacteria | 1736 |
| 709 | Ga0207683_10374633 | 3300026121 | Bacteria | 1308 |
| 710 | Ga0207683_10386693 | 3300026121 | Bacteria | 1286 |
| 711 | Ga0207683_10488608 | 3300026121 | Bacteria | 1137 |
| 712 | Ga0207683_10488687 | 3300026121 | Bacteria | 1136 |
| 713 | Ga0207683_10899242 | 3300026121 | Bacteria | 822 |
| 714 | Ga0207683_12163852 | 3300026121 | Bacteria | 504 |
| 715 | Ga0207683_12165804 | 3300026121 | Bacteria | 504 |
| 716 | Ga0207698_10208020 | 3300026142 | Bacteria | 1758 |
| 717 | Ga0207698_10446682 | 3300026142 | Bacteria | 1247 |
| 718 | Ga0207698_10505164 | 3300026142 | Bacteria | 1177 |
| 719 | Ga0207698_10671196 | 3300026142 | Bacteria | 1029 |
| 720 | Ga0207698_11049577 | 3300026142 | Bacteria | 827 |
| 721 | Ga0207698_11255847 | 3300026142 | Bacteria | 755 |
| 722 | Ga0207698_11448840 | 3300026142 | Bacteria | 702 |
| 723 | Ga0209971_1176159 | 3300027682 | Bacteria | 527 |
| 724 | Ga0209998_10190354 | 3300027717 | Bacteria | 535 |
| 725 | Ga0209974_10453080 | 3300027876 | Bacteria | 509 |
| 726 | Ga0268266_10186889 | 3300028379 | Bacteria | 1890 |
| 727 | Ga0268266_10196117 | 3300028379 | Bacteria | 1846 |
| 728 | Ga0268266_10415357 | 3300028379 | Bacteria | 1274 |
| 729 | Ga0268266_10483353 | 3300028379 | Bacteria | 1181 |
| 730 | Ga0268266_10588612 | 3300028379 | Bacteria | 1068 |
| 731 | Ga0268266_10766275 | 3300028379 | Bacteria | 932 |
| 732 | Ga0268265_10130233 | 3300028380 | Bacteria | 2089 |
| 733 | Ga0268265_10155930 | 3300028380 | Bacteria | 1932 |
| 734 | Ga0268265_10302348 | 3300028380 | Bacteria | 1441 |
| 735 | Ga0268265_10329869 | 3300028380 | Bacteria | 1385 |
| 736 | Ga0268264_10010116 | 3300028381 | Bacteria | 7806 |
| 737 | Ga0268264_10216090 | 3300028381 | Bacteria | 1762 |
| 738 | Ga0268264_10430402 | 3300028381 | Bacteria | 1274 |
| 739 | Ga0268264_10483122 | 3300028381 | Bacteria | 1205 |
| 740 | Ga0307517_10219604 | 3300028786 | Bacteria | 1157 |
| 741 | Ga0307515_10000191 | 3300028794 | Bacteria | 149201 |
| 742 | Ga0307515_10204109 | 3300028794 | Bacteria | 1843 |
| 743 | Ga0307513_10241228 | 3300031456 | Bacteria | 1612 |
| 744 | Ga0307513_10866818 | 3300031456 | Bacteria | 610 |
| 745 | Ga0307509_10079558 | 3300031507 | Bacteria | 3393 |
| 746 | Ga0307408_100087773 | 3300031548 | Bacteria | 2341 |
| 747 | Ga0307516_10000254 | 3300031730 | Bacteria | 68771 |
| 748 | Ga0307516_10031298 | 3300031730 | Bacteria | 5363 |
| 749 | Ga0307405_10019062 | 3300031731 | Bacteria | 3801 |
| 750 | Ga0307405_10231283 | 3300031731 | Bacteria | 1363 |
| 751 | Ga0307405_10610104 | 3300031731 | Bacteria | 892 |
| 752 | Ga0307413_10038148 | 3300031824 | Bacteria | 2782 |
| 753 | Ga0307413_10328609 | 3300031824 | Bacteria | 1171 |
| 754 | Ga0307413_11204990 | 3300031824 | Bacteria | 658 |
| 755 | Ga0307410_10012223 | 3300031852 | Bacteria | 4953 |
| 756 | Ga0307410_10099902 | 3300031852 | Bacteria | 2078 |
| 757 | Ga0307410_11527741 | 3300031852 | Bacteria | 589 |
| 758 | Ga0307406_10022580 | 3300031901 | Bacteria | 3734 |
| 759 | Ga0307406_10184957 | 3300031901 | Bacteria | 1520 |
| 760 | Ga0307407_10033866 | 3300031903 | Bacteria | 2791 |
| 761 | Ga0307407_10239113 | 3300031903 | Bacteria | 1238 |
| 762 | Ga0307407_10313447 | 3300031903 | Bacteria | 1098 |
| 763 | Ga0307412_10016388 | 3300031911 | Bacteria | 4414 |
| 764 | Ga0307412_10274935 | 3300031911 | Bacteria | 1320 |
| 765 | Ga0307412_10314711 | 3300031911 | Bacteria | 1243 |
| 766 | Ga0307412_11516339 | 3300031911 | Bacteria | 610 |
| 767 | Ga0307409_100001576 | 3300031995 | Bacteria | 11368 |
| 768 | Ga0307409_100300756 | 3300031995 | Bacteria | 1492 |
| 769 | Ga0307409_100843065 | 3300031995 | Bacteria | 927 |
| 770 | Ga0307409_100939520 | 3300031995 | Bacteria | 880 |
| 771 | Ga0307416_100001923 | 3300032002 | Bacteria | 11600 |
| 772 | Ga0307416_100076333 | 3300032002 | Bacteria | 2808 |
| 773 | Ga0307416_100419595 | 3300032002 | Bacteria | 1382 |
| 774 | Ga0307416_101245998 | 3300032002 | Bacteria | 849 |
| 775 | Ga0307416_102148113 | 3300032002 | Bacteria | 660 |
| 776 | Ga0307411_10009826 | 3300032005 | Bacteria | 5059 |
| 777 | Ga0307411_10024755 | 3300032005 | Bacteria | 3584 |
| 778 | Ga0307411_11067351 | 3300032005 | Bacteria | 726 |
| 779 | Ga0307411_11218013 | 3300032005 | Bacteria | 683 |
| 780 | Ga0307411_11313255 | 3300032005 | Bacteria | 659 |
| 781 | Ga0307415_100074130 | 3300032126 | Bacteria | 2404 |
| 782 | Ga0373930_0076066 | 3300034816 | Bacteria | 770 |
| 783 | Ga0373948_0048606 | 3300034817 | Bacteria | 906 |
| 784 | Ga0373959_0091513 | 3300034820 | Bacteria | 713 |
| 785 | Ga0373938_0011101 | 3300034957 | Bacteria | 1669 |
| 786 | Ga0373926_0070870 | 3300035083 | Bacteria | 1280 |
| 787 | Ga0373940_0083197 | 3300035088 | Bacteria | 949 |
| 788 | Ga0373944_0010740 | 3300035089 | Bacteria | 2501 |
| 789 | Ga0373944_0160282 | 3300035089 | Bacteria | 798 |
| 790 | Ga0373949_0024439 | 3300035090 | Bacteria | 1405 |
| 791 | Ga0373951_0229139 | 3300035091 | Bacteria | 551 |
| 792 | Ga0373952_0077468 | 3300035092 | Bacteria | 842 |
| 793 | Ga0373923_0118788 | 3300035111 | Bacteria | 1180 |
| 794 | Ga0373939_0411611 | 3300035114 | Bacteria | 562 |
| 795 | Ga0373954_0269983 | 3300035118 | Bacteria | 838 |
| 796 | Ga0373956_0036705 | 3300035119 | Bacteria | 2164 |
| 797 | Ga0373946_0111453 | 3300035171 | Bacteria | 1239 |
| 798 | Ga0373946_0162806 | 3300035171 | Bacteria | 1049 |
| 799 | Ga0373946_0525150 | 3300035171 | Bacteria | 609 |
| 800 | Ga0373955_0214586 | 3300035172 | Bacteria | 1148 |
| 801 | Ga0373955_0244715 | 3300035172 | Bacteria | 1075 |
| 802 | Ga0373961_0160173 | 3300035241 | Bacteria | 772 |
| 803 | Ga0373924_0564452 | 3300035410 | Bacteria | 513 |
| 804 | Ga0373931_0004801 | 3300035691 | Bacteria | 6204 |
| 805 | Ga0373935_0030710 | 3300035692 | Bacteria | 3331 |
| 806 | Ga0373927_0439112 | 3300035695 | Bacteria | 862 |
| 807 | Ga0373933_0292065 | 3300035724 | Bacteria | 1054 |
| 808 | Ga0373933_0383816 | 3300035724 | Bacteria | 915 |
| 809 | Ga0373947_0666259 | 3300035725 | Bacteria | 710 |
| 810 | Ga0373937_0161905 | 3300036401 | Bacteria | 2098 |
| 811 | Ga0373937_0210205 | 3300036401 | Bacteria | 1831 |
| 812 | Ga0373937_1129495 | 3300036401 | Bacteria | 732 |
| 813 | Ga0373937_1531714 | 3300036401 | Bacteria | 614 |
| 814 | Ga0373925_0004683 | 3300037068 | Bacteria | 10322 |
| 815 | Ga0373925_0239360 | 3300037068 | Bacteria | 1453 |
| 816 | Ga0373925_0295789 | 3300037068 | Bacteria | 1306 |
| 817 | Ga0436365_1570775 | 3300039437 | Bacteria | 807 |
| 818 | Ga0436365_1878872 | 3300039437 | Bacteria | 4411 |
| 819 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 820 | Ga0436363_1315143 | 3300039450 | Bacteria | 4526 |
| 821 | Ga0451789_1257448 | 3300041443 | Bacteria | 581 |
| 822 | Ga0451791_1178732 | 3300041451 | Bacteria | 826 |
| 823 | Ga0451797_0024097 | 3300041453 | Bacteria | 662 |
| 824 | Ga0451797_0182074 | 3300041453 | Bacteria | 793 |
| 825 | Ga0451795_1526863 | 3300041456 | Bacteria | 551 |
| 826 | Ga0451795_1640012 | 3300041456 | Bacteria | 584 |
| 827 | Ga0451798_0162675 | 3300041458 | Unclassified | 629 |
| 828 | Ga0451798_0537668 | 3300041458 | Bacteria | 1903 |
| 829 | Ga0451800_0361784 | 3300041459 | Bacteria | 749 |
| 830 | Ga0451800_0425630 | 3300041459 | Bacteria | 808 |
| 831 | Ga0451802_0181316 | 3300041460 | Bacteria | 671 |
| 832 | Ga0451802_0227888 | 3300041460 | Bacteria | 586 |
| 833 | Ga0451802_1108283 | 3300041460 | Bacteria | 3753 |
| 834 | Ga0451804_0420921 | 3300041463 | Bacteria | 1853 |
| 835 | Ga0451804_1130280 | 3300041463 | Bacteria | 863 |
| 836 | Ga0451807_2633116 | 3300041486 | Bacteria | 568 |
| 837 | Ga0451841_0660538 | 3300041498 | Bacteria | 1024 |
| 838 | Ga0451841_0913474 | 3300041498 | Bacteria | 508 |
| 839 | Ga0451847_0580709 | 3300041503 | Bacteria | 754 |
| 840 | Ga0451849_1316584 | 3300041505 | Bacteria | 630 |
| 841 | Ga0451851_0104455 | 3300041507 | Bacteria | 2301 |
| 842 | Ga0451851_0279755 | 3300041507 | Bacteria | 520 |
| 843 | Ga0451853_0463049 | 3300041512 | Bacteria | 855 |
| 844 | Ga0451853_2526968 | 3300041512 | Bacteria | 757 |
| 845 | Ga0451853_3410975 | 3300041512 | Bacteria | 882 |
| 846 | Ga0439441_072363 | 3300042001 | Bacteria | 741 |
| 847 | Ga0439448_0265163 | 3300042005 | Bacteria | 607 |
| 848 | Ga0439456_176370 | 3300042013 | Bacteria | 503 |
| 849 | Ga0450888_075937 | 3300042126 | Bacteria | 511 |
| 850 | Ga0450897_015541 | 3300042128 | Bacteria | 778 |
| 851 | Ga0439458_0162222 | 3300042157 | Bacteria | 602 |
| 852 | Ga0439464_0019626 | 3300042439 | Bacteria | 1846 |
| 853 | Ga0439464_0193506 | 3300042439 | Bacteria | 647 |
| 854 | Ga0439464_0212305 | 3300042439 | Bacteria | 619 |
| 855 | Ga0450918_000075 | 3300042531 | Bacteria | 20738 |
| 856 | Ga0451577_0001353 | 3300042876 | Bacteria | 33109 |
| 857 | Ga0451577_1257332 | 3300042876 | Bacteria | 659 |
| 858 | Ga0439440_0164943 | 3300042993 | Bacteria | 641 |
| 859 | Ga0453684_0006474 | 3300044712 | Bacteria | 22221 |
| 860 | Ga0466968_0025097 | 3300044735 | Bacteria | 2439 |
| 861 | Ga0495629_0411126 | 3300046459 | Bacteria | 919 |
| 862 | Ga0495580_0035100 | 3300046472 | Bacteria | 3606 |
| 863 | Ga0495582_0122099 | 3300046473 | Bacteria | 1468 |
| 864 | Ga0495662_0150853 | 3300046476 | Bacteria | 1145 |
| 865 | Ga0495610_0018172 | 3300046512 | Bacteria | 3979 |
| 866 | Ga0495620_0145710 | 3300046515 | Bacteria | 925 |
| 867 | Ga0495620_0354768 | 3300046515 | Bacteria | 556 |
| 868 | Ga0495628_0425675 | 3300046516 | Bacteria | 967 |
| 869 | Ga0495628_1154398 | 3300046516 | Bacteria | 527 |
| 870 | Ga0495632_0107252 | 3300046519 | Bacteria | 1313 |
| 871 | Ga0495654_0236292 | 3300046530 | Bacteria | 767 |
| 872 | Ga0495640_0211526 | 3300046533 | Bacteria | 1226 |
| 873 | Ga0495640_0553282 | 3300046533 | Bacteria | 697 |
| 874 | Ga0495586_0101742 | 3300046535 | Bacteria | 1595 |
| 875 | Ga0495587_0734277 | 3300046536 | Unclassified | 541 |
| 876 | Ga0495598_0303288 | 3300046537 | Bacteria | 605 |
| 877 | Ga0495621_0177144 | 3300046539 | Bacteria | 849 |
| 878 | Ga0495621_0457265 | 3300046539 | Bacteria | 547 |
| 879 | Ga0495645_0218962 | 3300046543 | Bacteria | 1281 |
| 880 | Ga0495645_0966754 | 3300046543 | Bacteria | 502 |
| 881 | Ga0495633_0364923 | 3300046558 | Bacteria | 654 |
| 882 | Ga0495656_0650507 | 3300046615 | Bacteria | 566 |
| 883 | Ga0495668_0520039 | 3300046616 | Bacteria | 656 |
| 884 | Ga0495611_0274090 | 3300046648 | Bacteria | 780 |
| 885 | Ga0495625_0005772 | 3300046660 | Bacteria | 11192 |
| 886 | Ga0495635_0497593 | 3300046663 | Bacteria | 803 |
| 887 | Ga0495635_0962027 | 3300046663 | Bacteria | 545 |
| 888 | Ga0495623_0369829 | 3300046679 | Bacteria | 777 |
| 889 | Ga0495647_0038717 | 3300046681 | Bacteria | 1804 |
| 890 | Ga0495647_0166447 | 3300046681 | Bacteria | 953 |
| 891 | Ga0495658_0015916 | 3300046683 | Bacteria | 3866 |
| 892 | Ga0495658_0075446 | 3300046683 | Bacteria | 1968 |
| 893 | Ga0495658_0174708 | 3300046683 | Bacteria | 1331 |
| 894 | Ga0495658_0274123 | 3300046683 | Bacteria | 1064 |
| 895 | Ga0495658_0362831 | 3300046683 | Bacteria | 921 |
| 896 | Ga0495658_0532797 | 3300046683 | Bacteria | 752 |
| 897 | Ga0495613_0084712 | 3300046689 | Bacteria | 2301 |
| 898 | Ga0495613_1093267 | 3300046689 | Unclassified | 509 |
| 899 | Ga0495670_0306392 | 3300046691 | Bacteria | 852 |
| 900 | Ga0495676_0382241 | 3300047321 | Bacteria | 937 |
| 901 | Ga0495681_0393987 | 3300047470 | Bacteria | 519 |
| 902 | Ga0495684_0108451 | 3300047471 | Bacteria | 2097 |
| 903 | Ga0495686_0130669 | 3300047472 | Bacteria | 1489 |
| 904 | Ga0495615_0139808 | 3300048090 | Bacteria | 714 |
| 905 | Ga0496100_0323352 | 3300048903 | Bacteria | 1159 |
| 906 | Ga0496100_0549204 | 3300048903 | Bacteria | 894 |
| 907 | Ga0496100_0998384 | 3300048903 | Bacteria | 659 |
| 908 | Ga0496101_0119392 | 3300048904 | Bacteria | 1992 |
| 909 | Ga0496103_0324954 | 3300048906 | Bacteria | 989 |
| 910 | Ga0496104_0008841 | 3300048907 | Bacteria | 8953 |
| 911 | Ga0496104_0147333 | 3300048907 | Bacteria | 2261 |
| 912 | Ga0496104_0397604 | 3300048907 | Bacteria | 1290 |
| 913 | Ga0496105_0059786 | 3300048908 | Bacteria | 3145 |
| 914 | Ga0496105_0154988 | 3300048908 | Bacteria | 1882 |
| 915 | Ga0496105_0825661 | 3300048908 | Bacteria | 703 |
| 916 | Ga0496106_0192393 | 3300048909 | Bacteria | 1622 |
| 917 | Ga0496106_0278486 | 3300048909 | Bacteria | 1340 |
| 918 | Ga0496107_0119919 | 3300048910 | Bacteria | 1937 |
| 919 | Ga0496108_0130837 | 3300048911 | Bacteria | 2157 |
| 920 | Ga0496108_0204984 | 3300048911 | Bacteria | 1711 |
| 921 | Ga0496108_1503077 | 3300048911 | Bacteria | 560 |
| 922 | Ga0496109_0098011 | 3300048912 | Bacteria | 2718 |
| 923 | Ga0496109_0162683 | 3300048912 | Bacteria | 2091 |
| 924 | Ga0496109_0627133 | 3300048912 | Bacteria | 1012 |
| 925 | Ga0496110_0167874 | 3300048913 | Bacteria | 1990 |
| 926 | Ga0496110_0172128 | 3300048913 | Bacteria | 1965 |
| 927 | Ga0496110_0422460 | 3300048913 | Bacteria | 1215 |
| 928 | Ga0496111_0794761 | 3300048914 | Bacteria | 685 |
| 929 | Ga0496113_0228840 | 3300048916 | Bacteria | 1482 |
| 930 | Ga0496114_0052168 | 3300048917 | Bacteria | 3407 |
| 931 | Ga0496114_0797284 | 3300048917 | Bacteria | 823 |
| 932 | Ga0496114_1268649 | 3300048917 | Bacteria | 623 |
| 933 | Ga0496115_0030587 | 3300048918 | Bacteria | 4237 |
| 934 | Ga0496115_1459923 | 3300048918 | Bacteria | 503 |
| 935 | Ga0496125_0331353 | 3300048928 | Bacteria | 918 |
| 936 | Ga0501079_1672772 | 3300049741 | Bacteria | 500 |
| 937 | Ga0501081_0748108 | 3300049743 | Bacteria | 735 |
| 938 | nmdc:mga03683_47620_c2 | 3300050489 | Bacteria | 998 |
| 939 | nmdc:mga03n38_119825_c1 | 3300050490 | Bacteria | 1292 |
| 940 | nmdc:mga03n38_651268_c1 | 3300050490 | Bacteria | 604 |
| 941 | nmdc:mga03n38_902856_c1 | 3300050490 | Bacteria | 519 |
| 942 | nmdc:mga00v17_1011743_c1 | 3300050491 | Bacteria | 523 |
| 943 | nmdc:mga0k408_213015_c1 | 3300050493 | Bacteria | 1154 |
| 944 | nmdc:mga0k408_261538_c1 | 3300050493 | Bacteria | 1033 |
| 945 | nmdc:mga0k408_2772_c1 | 3300050493 | Bacteria | 9313 |
| 946 | nmdc:mga0k408_33626_c1 | 3300050493 | Bacteria | 2933 |
| 947 | nmdc:mga0k408_48695_c1 | 3300050493 | Bacteria | 2452 |
| 948 | nmdc:mga0k408_698136_c1 | 3300050493 | Bacteria | 595 |
| 949 | nmdc:mga0k408_859493_c1 | 3300050493 | Bacteria | 527 |
| 950 | nmdc:mga0k408_88833_c1 | 3300050493 | Bacteria | 1815 |
| 951 | nmdc:mga06z11_431626_c1 | 3300050494 | Bacteria | 795 |
| 952 | nmdc:mga05p37_1271046_c1 | 3300050507 | Bacteria | 753 |
| 953 | nmdc:mga08y16_1323210_c1 | 3300050511 | Bacteria | 686 |
| 954 | nmdc:mga08y16_369155_c1 | 3300050511 | Bacteria | 1472 |
| 955 | nmdc:mga0n895_103732_c1 | 3300050512 | Bacteria | 2855 |
| 956 | nmdc:mga0rr50_1274026_c1 | 3300050513 | Bacteria | 624 |
| 957 | nmdc:mga0sz30_288303_c1 | 3300050516 | Bacteria | 731 |
| 958 | Ga0495601_0024573 | 3300053077 | Bacteria | 3712 |
| 959 | Ga0495612_0109924 | 3300053078 | Bacteria | 1179 |
| 960 | Ga0495612_0420894 | 3300053078 | Bacteria | 608 |
| 961 | Ga0495595_0190648 | 3300053084 | Bacteria | 1019 |
| 962 | Ga0495595_0406689 | 3300053084 | Bacteria | 690 |
| 963 | Ga0495619_0155441 | 3300053085 | Bacteria | 1578 |
| 964 | Ga0500578_0000002 | 3300053086 | Bacteria | 293507 |
| 965 | Ga0500578_0773424 | 3300053086 | Bacteria | 510 |
| 966 | Ga0500658_0012730 | 3300053134 | Bacteria | 3106 |
| 967 | Ga0500604_0325706 | 3300053151 | Bacteria | 533 |
| 968 | Ga0500587_000275 | 3300053739 | Bacteria | 5679 |
| 969 | Ga0590071_000456 | 3300059421 | Bacteria | 11882 |
| 970 | Ga0590074_051835 | 3300059423 | Bacteria | 752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1570775 | Ga0436365_1570775_538_711 | 55 |
| 2 | iso_pu_bacteria | 2643221592 | 2643969512 | 55 |
| 3 | iso_pu_bacteria | 2643221625 | 2644143812 | 55 |
| 4 | iso_pu_bacteria | 2643221648 | 2644276482 | 55 |
| 5 | 3300005327 | Ga0070658_10289100 | Ga0070658_102891002 | 56 |
| 6 | 3300005331 | Ga0070670_100864623 | Ga0070670_1008646231 | 56 |
| 7 | 3300005333 | Ga0070677_10213302 | Ga0070677_102133022 | 56 |
| 8 | 3300005334 | Ga0068869_100802983 | Ga0068869_1008029831 | 56 |
| 9 | 3300005335 | Ga0070666_10596720 | Ga0070666_105967202 | 56 |
| 10 | 3300005344 | Ga0070661_100595266 | Ga0070661_1005952662 | 56 |
| 11 | 3300005347 | Ga0070668_101247167 | Ga0070668_1012471672 | 56 |
| 12 | 3300005354 | Ga0070675_100161112 | Ga0070675_1001611122 | 56 |
| 13 | 3300005354 | Ga0070675_101329059 | Ga0070675_1013290591 | 56 |
| 14 | 3300005355 | Ga0070671_100853014 | Ga0070671_1008530142 | 56 |
| 15 | 3300005356 | Ga0070674_100790631 | Ga0070674_1007906312 | 56 |
| 16 | 3300005364 | Ga0070673_101102563 | Ga0070673_1011025632 | 56 |
| 17 | 3300005366 | Ga0070659_100896862 | Ga0070659_1008968622 | 56 |
| 18 | 3300005456 | Ga0070678_100721715 | Ga0070678_1007217151 | 56 |
| 19 | 3300005457 | Ga0070662_101136506 | Ga0070662_1011365061 | 56 |
| 20 | 3300005539 | Ga0068853_101617743 | Ga0068853_1016177431 | 56 |
| 21 | 3300005543 | Ga0070672_100796211 | Ga0070672_1007962111 | 56 |
| 22 | 3300005547 | Ga0070693_100671530 | Ga0070693_1006715302 | 56 |
| 23 | 3300005616 | Ga0068852_100117867 | Ga0068852_1001178672 | 56 |
| 24 | 3300005834 | Ga0068851_10164200 | Ga0068851_101642002 | 56 |
| 25 | 3300009101 | Ga0105247_11447209 | Ga0105247_114472091 | 56 |
| 26 | 3300009176 | Ga0105242_11582279 | Ga0105242_115822792 | 56 |
| 27 | 3300011119 | Ga0105246_10352684 | Ga0105246_103526842 | 56 |
| 28 | 3300013306 | Ga0163162_10934425 | Ga0163162_109344252 | 56 |
| 29 | 3300013308 | Ga0157375_10496673 | Ga0157375_104966731 | 56 |
| 30 | 3300014326 | Ga0157380_10625553 | Ga0157380_106255532 | 56 |
| 31 | 3300025321 | Ga0207656_10348212 | Ga0207656_103482122 | 56 |
| 32 | 3300025901 | Ga0207688_10397661 | Ga0207688_103976612 | 56 |
| 33 | 3300025908 | Ga0207643_10454013 | Ga0207643_104540132 | 56 |
| 34 | 3300025931 | Ga0207644_11360521 | Ga0207644_113605211 | 56 |
| 35 | 3300025932 | Ga0207690_10987519 | Ga0207690_109875192 | 56 |
| 36 | 3300025933 | Ga0207706_10056711 | Ga0207706_100567113 | 56 |
| 37 | 3300025940 | Ga0207691_10416591 | Ga0207691_104165912 | 56 |
| 38 | 3300025945 | Ga0207679_10294931 | Ga0207679_102949312 | 56 |
| 39 | 3300025981 | Ga0207640_10106518 | Ga0207640_101065182 | 56 |
| 40 | 3300026142 | Ga0207698_11255847 | Ga0207698_112558472 | 56 |
| 41 | iso_pu_bacteria | 2585428062 | 2587755163 | 56 |
| 42 | 3300003371 | JGI26145J50221_1001962 | JGI26145J50221_10019622 | 59 |
| 43 | 3300005262 | Ga0065165_1003031 | Ga0065165_100303112 | 59 |
| 44 | 3300005330 | Ga0070690_100558543 | Ga0070690_1005585432 | 59 |
| 45 | 3300005333 | Ga0070677_10117753 | Ga0070677_101177532 | 59 |
| 46 | 3300005334 | Ga0068869_100611001 | Ga0068869_1006110012 | 59 |
| 47 | 3300005343 | Ga0070687_101539852 | Ga0070687_1015398521 | 59 |
| 48 | 3300005345 | Ga0070692_11380430 | Ga0070692_113804302 | 59 |
| 49 | 3300005347 | Ga0070668_100030279 | Ga0070668_1000302793 | 59 |
| 50 | 3300005353 | Ga0070669_100046349 | Ga0070669_1000463492 | 59 |
| 51 | 3300005355 | Ga0070671_100601713 | Ga0070671_1006017132 | 59 |
| 52 | 3300005356 | Ga0070674_100061607 | Ga0070674_1000616072 | 59 |
| 53 | 3300005367 | Ga0070667_100177233 | Ga0070667_1001772332 | 59 |
| 54 | 3300005441 | Ga0070700_100735827 | Ga0070700_1007358272 | 59 |
| 55 | 3300005459 | Ga0068867_100011650 | Ga0068867_1000116503 | 59 |
| 56 | 3300005518 | Ga0070699_100317735 | Ga0070699_1003177352 | 59 |
| 57 | 3300005539 | Ga0068853_100102309 | Ga0068853_1001023092 | 59 |
| 58 | 3300005539 | Ga0068853_101437684 | Ga0068853_1014376842 | 59 |
| 59 | 3300005543 | Ga0070672_100080708 | Ga0070672_1000807081 | 59 |
| 60 | 3300005544 | Ga0070686_100446543 | Ga0070686_1004465431 | 59 |
| 61 | 3300005548 | Ga0070665_100806133 | Ga0070665_1008061332 | 59 |
| 62 | 3300005548 | Ga0070665_100819728 | Ga0070665_1008197282 | 59 |
| 63 | 3300005548 | Ga0070665_101247166 | Ga0070665_1012471661 | 59 |
| 64 | 3300005616 | Ga0068852_100328621 | Ga0068852_1003286212 | 59 |
| 65 | 3300005617 | Ga0068859_100121582 | Ga0068859_1001215821 | 59 |
| 66 | 3300005617 | Ga0068859_100685257 | Ga0068859_1006852572 | 59 |
| 67 | 3300005718 | Ga0068866_10007228 | Ga0068866_100072282 | 59 |
| 68 | 3300005718 | Ga0068866_10564443 | Ga0068866_105644432 | 59 |
| 69 | 3300005719 | Ga0068861_100000343 | Ga0068861_1000003432 | 59 |
| 70 | 3300005719 | Ga0068861_100321369 | Ga0068861_1003213692 | 59 |
| 71 | 3300005834 | Ga0068851_10507855 | Ga0068851_105078552 | 59 |
| 72 | 3300005842 | Ga0068858_100261499 | Ga0068858_1002614992 | 59 |
| 73 | 3300005842 | Ga0068858_100652105 | Ga0068858_1006521051 | 59 |
| 74 | 3300005843 | Ga0068860_100000715 | Ga0068860_10000071523 | 59 |
| 75 | 3300005843 | Ga0068860_100189597 | Ga0068860_1001895972 | 59 |
| 76 | 3300005844 | Ga0068862_100011541 | Ga0068862_1000115417 | 59 |
| 77 | 3300005844 | Ga0068862_100068622 | Ga0068862_1000686223 | 59 |
| 78 | 3300006042 | Ga0075368_10088381 | Ga0075368_100883812 | 59 |
| 79 | 3300006177 | Ga0075362_10277468 | Ga0075362_102774681 | 59 |
| 80 | 3300006177 | Ga0075362_10458263 | Ga0075362_104582632 | 59 |
| 81 | 3300006178 | Ga0075367_10496110 | Ga0075367_104961102 | 59 |
| 82 | 3300006195 | Ga0075366_10779250 | Ga0075366_107792502 | 59 |
| 83 | 3300006881 | Ga0068865_100007045 | Ga0068865_1000070458 | 59 |
| 84 | 3300006931 | Ga0097620_100121581 | Ga0097620_1001215811 | 59 |
| 85 | 3300006931 | Ga0097620_100685274 | Ga0097620_1006852742 | 59 |
| 86 | 3300009092 | Ga0105250_10473094 | Ga0105250_104730941 | 59 |
| 87 | 3300009093 | Ga0105240_10055798 | Ga0105240_100557983 | 59 |
| 88 | 3300009101 | Ga0105247_11489538 | Ga0105247_114895381 | 59 |
| 89 | 3300009148 | Ga0105243_10113425 | Ga0105243_101134252 | 59 |
| 90 | 3300009148 | Ga0105243_10870838 | Ga0105243_108708382 | 59 |
| 91 | 3300009174 | Ga0105241_10371778 | Ga0105241_103717781 | 59 |
| 92 | 3300009176 | Ga0105242_11118956 | Ga0105242_111189562 | 59 |
| 93 | 3300009545 | Ga0105237_10000367 | Ga0105237_1000036750 | 59 |
| 94 | 3300009551 | Ga0105238_10040068 | Ga0105238_100400683 | 59 |
| 95 | 3300009551 | Ga0105238_10401529 | Ga0105238_104015292 | 59 |
| 96 | 3300009553 | Ga0105249_10133828 | Ga0105249_101338281 | 59 |
| 97 | 3300009553 | Ga0105249_12146313 | Ga0105249_121463131 | 59 |
| 98 | 3300010375 | Ga0105239_10000150 | Ga0105239_1000015064 | 59 |
| 99 | 3300011119 | Ga0105246_11093499 | Ga0105246_110934992 | 59 |
| 100 | 3300013297 | Ga0157378_10009725 | Ga0157378_100097252 | 59 |
| 101 | 3300013306 | Ga0163162_10005242 | Ga0163162_1000524210 | 59 |
| 102 | 3300013308 | Ga0157375_10387830 | Ga0157375_103878302 | 59 |
| 103 | 3300014326 | Ga0157380_10011753 | Ga0157380_100117533 | 59 |
| 104 | 3300014968 | Ga0157379_10376614 | Ga0157379_103766142 | 59 |
| 105 | 3300014968 | Ga0157379_11107729 | Ga0157379_111077292 | 59 |
| 106 | 3300021361 | Ga0213872_10000016 | Ga0213872_1000001642 | 59 |
| 107 | 3300025263 | Ga0209565_1070607 | Ga0209565_10706072 | 59 |
| 108 | 3300025273 | Ga0209673_1027766 | Ga0209673_10277663 | 59 |
| 109 | 3300025298 | Ga0209050_1001091 | Ga0209050_100109111 | 59 |
| 110 | 3300025304 | Ga0209257_1102802 | Ga0209257_11028022 | 59 |
| 111 | 3300025321 | Ga0207656_10178943 | Ga0207656_101789431 | 59 |
| 112 | 3300025899 | Ga0207642_10006251 | Ga0207642_100062514 | 59 |
| 113 | 3300025911 | Ga0207654_10184095 | Ga0207654_101840951 | 59 |
| 114 | 3300025913 | Ga0207695_10123068 | Ga0207695_101230683 | 59 |
| 115 | 3300025914 | Ga0207671_10000808 | Ga0207671_100008087 | 59 |
| 116 | 3300025924 | Ga0207694_10037673 | Ga0207694_100376732 | 59 |
| 117 | 3300025935 | Ga0207709_10249456 | Ga0207709_102494562 | 59 |
| 118 | 3300025935 | Ga0207709_10941137 | Ga0207709_109411372 | 59 |
| 119 | 3300025937 | Ga0207669_10483492 | Ga0207669_104834922 | 59 |
| 120 | 3300025938 | Ga0207704_10003998 | Ga0207704_100039986 | 59 |
| 121 | 3300025940 | Ga0207691_10036304 | Ga0207691_100363043 | 59 |
| 122 | 3300025972 | Ga0207668_10154213 | Ga0207668_101542132 | 59 |
| 123 | 3300026035 | Ga0207703_10019219 | Ga0207703_100192195 | 59 |
| 124 | 3300026041 | Ga0207639_10393961 | Ga0207639_103939612 | 59 |
| 125 | 3300026041 | Ga0207639_11162988 | Ga0207639_111629882 | 59 |
| 126 | 3300026075 | Ga0207708_10033764 | Ga0207708_100337642 | 59 |
| 127 | 3300026089 | Ga0207648_10001050 | Ga0207648_1000105012 | 59 |
| 128 | 3300026118 | Ga0207675_100017970 | Ga0207675_1000179706 | 59 |
| 129 | 3300026118 | Ga0207675_100174563 | Ga0207675_1001745632 | 59 |
| 130 | 3300026142 | Ga0207698_10671196 | Ga0207698_106711962 | 59 |
| 131 | 3300026142 | Ga0207698_11448840 | Ga0207698_114488402 | 59 |
| 132 | 3300027682 | Ga0209971_1176159 | Ga0209971_11761591 | 59 |
| 133 | 3300027717 | Ga0209998_10190354 | Ga0209998_101903542 | 59 |
| 134 | 3300027876 | Ga0209974_10453080 | Ga0209974_104530802 | 59 |
| 135 | 3300028379 | Ga0268266_10415357 | Ga0268266_104153572 | 59 |
| 136 | 3300028379 | Ga0268266_10766275 | Ga0268266_107662752 | 59 |
| 137 | 3300028380 | Ga0268265_10130233 | Ga0268265_101302332 | 59 |
| 138 | 3300028380 | Ga0268265_10155930 | Ga0268265_101559301 | 59 |
| 139 | 3300028381 | Ga0268264_10010116 | Ga0268264_100101166 | 59 |
| 140 | 3300028381 | Ga0268264_10430402 | Ga0268264_104304022 | 59 |
| 141 | 3300028786 | Ga0307517_10219604 | Ga0307517_102196042 | 59 |
| 142 | 3300028794 | Ga0307515_10000191 | Ga0307515_1000019122 | 59 |
| 143 | 3300028794 | Ga0307515_10204109 | Ga0307515_102041092 | 59 |
| 144 | 3300031456 | Ga0307513_10241228 | Ga0307513_102412282 | 59 |
| 145 | 3300031507 | Ga0307509_10079558 | Ga0307509_100795583 | 59 |
| 146 | 3300031730 | Ga0307516_10000254 | Ga0307516_1000025418 | 59 |
| 147 | 3300031730 | Ga0307516_10031298 | Ga0307516_100312985 | 59 |
| 148 | 3300031824 | Ga0307413_10328609 | Ga0307413_103286091 | 59 |
| 149 | 3300032005 | Ga0307411_11218013 | Ga0307411_112180132 | 59 |
| 150 | 3300035083 | Ga0373926_0070870 | Ga0373926_0070870_815_1003 | 59 |
| 151 | 3300035171 | Ga0373946_0111453 | Ga0373946_0111453_328_516 | 59 |
| 152 | 3300037068 | Ga0373925_0004683 | Ga0373925_0004683_2413_2601 | 59 |
| 153 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_48980_49168 | 59 |
| 154 | 3300041443 | Ga0451789_1257448 | Ga0451789_1257448_254_445 | 59 |
| 155 | 3300041451 | Ga0451791_1178732 | Ga0451791_1178732_421_612 | 59 |
| 156 | 3300041453 | Ga0451797_0182074 | Ga0451797_0182074_116_307 | 59 |
| 157 | 3300041456 | Ga0451795_1640012 | Ga0451795_1640012_237_428 | 59 |
| 158 | 3300041458 | Ga0451798_0537668 | Ga0451798_0537668_396_584 | 59 |
| 159 | 3300041459 | Ga0451800_0361784 | Ga0451800_0361784_532_720 | 59 |
| 160 | 3300041459 | Ga0451800_0425630 | Ga0451800_0425630_419_610 | 59 |
| 161 | 3300041460 | Ga0451802_0181316 | Ga0451802_0181316_428_619 | 59 |
| 162 | 3300041460 | Ga0451802_1108283 | Ga0451802_1108283_2654_2842 | 59 |
| 163 | 3300041463 | Ga0451804_0420921 | Ga0451804_0420921_676_867 | 59 |
| 164 | 3300041463 | Ga0451804_1130280 | Ga0451804_1130280_129_317 | 59 |
| 165 | 3300041498 | Ga0451841_0660538 | Ga0451841_0660538_603_794 | 59 |
| 166 | 3300041498 | Ga0451841_0913474 | Ga0451841_0913474_62_241 | 59 |
| 167 | 3300041507 | Ga0451851_0104455 | Ga0451851_0104455_1828_2019 | 59 |
| 168 | 3300041512 | Ga0451853_0463049 | Ga0451853_0463049_406_597 | 59 |
| 169 | 3300042126 | Ga0450888_075937 | Ga0450888_075937_183_371 | 59 |
| 170 | 3300042128 | Ga0450897_015541 | Ga0450897_015541_255_443 | 59 |
| 171 | 3300042439 | Ga0439464_0193506 | Ga0439464_0193506_176_361 | 59 |
| 172 | 3300042439 | Ga0439464_0212305 | Ga0439464_0212305_30_218 | 59 |
| 173 | 3300042876 | Ga0451577_0001353 | Ga0451577_0001353_23956_24141 | 59 |
| 174 | 3300042876 | Ga0451577_1257332 | Ga0451577_1257332_451_636 | 59 |
| 175 | 3300044735 | Ga0466968_0025097 | Ga0466968_0025097_513_698 | 59 |
| 176 | 3300046473 | Ga0495582_0122099 | Ga0495582_0122099_1050_1238 | 59 |
| 177 | 3300046512 | Ga0495610_0018172 | Ga0495610_0018172_1026_1217 | 59 |
| 178 | 3300046515 | Ga0495620_0354768 | Ga0495620_0354768_167_358 | 59 |
| 179 | 3300046519 | Ga0495632_0107252 | Ga0495632_0107252_151_342 | 59 |
| 180 | 3300046535 | Ga0495586_0101742 | Ga0495586_0101742_577_765 | 59 |
| 181 | 3300046616 | Ga0495668_0520039 | Ga0495668_0520039_448_639 | 59 |
| 182 | 3300046660 | Ga0495625_0005772 | Ga0495625_0005772_1928_2119 | 59 |
| 183 | 3300046683 | Ga0495658_0075446 | Ga0495658_0075446_1735_1923 | 59 |
| 184 | 3300046691 | Ga0495670_0306392 | Ga0495670_0306392_272_460 | 59 |
| 185 | 3300047472 | Ga0495686_0130669 | Ga0495686_0130669_59_250 | 59 |
| 186 | 3300048911 | Ga0496108_1503077 | Ga0496108_1503077_226_414 | 59 |
| 187 | 3300048928 | Ga0496125_0331353 | Ga0496125_0331353_666_854 | 59 |
| 188 | 3300049741 | Ga0501079_1672772 | Ga0501079_1672772_298_486 | 59 |
| 189 | 3300050489 | nmdc:mga03683_47620_c2 | nmdc:mga03683_47620_c2_16_204 | 59 |
| 190 | 3300050490 | nmdc:mga03n38_119825_c1 | nmdc:mga03n38_119825_c1_1053_1244 | 59 |
| 191 | 3300050490 | nmdc:mga03n38_902856_c1 | nmdc:mga03n38_902856_c1_198_386 | 59 |
| 192 | 3300050493 | nmdc:mga0k408_213015_c1 | nmdc:mga0k408_213015_c1_821_1012 | 59 |
| 193 | 3300050493 | nmdc:mga0k408_261538_c1 | nmdc:mga0k408_261538_c1_813_1001 | 59 |
| 194 | 3300050493 | nmdc:mga0k408_33626_c1 | nmdc:mga0k408_33626_c1_142_333 | 59 |
| 195 | 3300050493 | nmdc:mga0k408_859493_c1 | nmdc:mga0k408_859493_c1_248_436 | 59 |
| 196 | 3300050493 | nmdc:mga0k408_88833_c1 | nmdc:mga0k408_88833_c1_1079_1270 | 59 |
| 197 | 3300050494 | nmdc:mga06z11_431626_c1 | nmdc:mga06z11_431626_c1_550_741 | 59 |
| 198 | 3300050516 | nmdc:mga0sz30_288303_c1 | nmdc:mga0sz30_288303_c1_300_491 | 59 |
| 199 | 3300053086 | Ga0500578_0000002 | Ga0500578_0000002_116094_116282 | 59 |
| 200 | 3300053086 | Ga0500578_0773424 | Ga0500578_0773424_293_484 | 59 |
| 201 | 3300053134 | Ga0500658_0012730 | Ga0500658_0012730_1481_1672 | 59 |
| 202 | 3300053151 | Ga0500604_0325706 | Ga0500604_0325706_318_506 | 59 |
| 203 | 3300053739 | Ga0500587_000275 | Ga0500587_000275_1699_1890 | 59 |
| 204 | 3300059421 | Ga0590071_000456 | Ga0590071_000456_9075_9263 | 59 |
| 205 | 3300059423 | Ga0590074_051835 | Ga0590074_051835_167_355 | 59 |
| 206 | 3300005719 | Ga0068861_102572670 | Ga0068861_1025726702 | 60 |
| 207 | 3300005844 | Ga0068862_100014347 | Ga0068862_1000143473 | 60 |
| 208 | 3300006048 | Ga0075363_100328174 | Ga0075363_1003281742 | 60 |
| 209 | 3300006177 | Ga0075362_10086726 | Ga0075362_100867262 | 60 |
| 210 | 3300006177 | Ga0075362_10545978 | Ga0075362_105459782 | 60 |
| 211 | 3300006195 | Ga0075366_10541221 | Ga0075366_105412212 | 60 |
| 212 | 3300006195 | Ga0075366_10607848 | Ga0075366_106078482 | 60 |
| 213 | 3300009147 | Ga0114129_11646705 | Ga0114129_116467052 | 60 |
| 214 | 3300025297 | Ga0209758_1006025 | Ga0209758_10060256 | 60 |
| 215 | 3300026121 | Ga0207683_10488608 | Ga0207683_104886082 | 60 |
| 216 | 3300028380 | Ga0268265_10329869 | Ga0268265_103298692 | 60 |
| 217 | 3300031911 | Ga0307412_10274935 | Ga0307412_102749352 | 60 |
| 218 | 3300032002 | Ga0307416_100419595 | Ga0307416_1004195952 | 60 |
| 219 | 3300046648 | Ga0495611_0274090 | Ga0495611_0274090_26_217 | 60 |
| 220 | 3300049743 | Ga0501081_0748108 | Ga0501081_0748108_533_724 | 60 |
| 221 | 3300050490 | nmdc:mga03n38_651268_c1 | nmdc:mga03n38_651268_c1_330_521 | 60 |
| 222 | 3300050491 | nmdc:mga00v17_1011743_c1 | nmdc:mga00v17_1011743_c1_272_463 | 60 |
| 223 | 3300050493 | nmdc:mga0k408_698136_c1 | nmdc:mga0k408_698136_c1_143_334 | 60 |
| 224 | 3300050507 | nmdc:mga05p37_1271046_c1 | nmdc:mga05p37_1271046_c1_193_384 | 60 |
| 225 | 3300050511 | nmdc:mga08y16_369155_c1 | nmdc:mga08y16_369155_c1_1159_1350 | 60 |
| 226 | 3300005338 | Ga0068868_100656203 | Ga0068868_1006562031 | 61 |
| 227 | 3300005457 | Ga0070662_100310989 | Ga0070662_1003109892 | 61 |
| 228 | 3300005543 | Ga0070672_100019128 | Ga0070672_1000191282 | 61 |
| 229 | 3300005618 | Ga0068864_100377487 | Ga0068864_1003774872 | 61 |
| 230 | 3300006195 | Ga0075366_10170362 | Ga0075366_101703623 | 61 |
| 231 | 3300006195 | Ga0075366_10640360 | Ga0075366_106403602 | 61 |
| 232 | 3300006881 | Ga0068865_100267267 | Ga0068865_1002672672 | 61 |
| 233 | 3300009176 | Ga0105242_10709211 | Ga0105242_107092111 | 61 |
| 234 | 3300009551 | Ga0105238_12134239 | Ga0105238_121342392 | 61 |
| 235 | 3300013308 | Ga0157375_10916976 | Ga0157375_109169762 | 61 |
| 236 | 3300017792 | Ga0163161_10830353 | Ga0163161_108303531 | 61 |
| 237 | 3300025924 | Ga0207694_10432688 | Ga0207694_104326882 | 61 |
| 238 | 3300025933 | Ga0207706_10375740 | Ga0207706_103757402 | 61 |
| 239 | 3300025934 | Ga0207686_10455454 | Ga0207686_104554541 | 61 |
| 240 | 3300025937 | Ga0207669_10355436 | Ga0207669_103554361 | 61 |
| 241 | 3300025938 | Ga0207704_10247305 | Ga0207704_102473052 | 61 |
| 242 | 3300025940 | Ga0207691_10064120 | Ga0207691_100641204 | 61 |
| 243 | 3300026023 | Ga0207677_10249684 | Ga0207677_102496842 | 61 |
| 244 | 3300026089 | Ga0207648_10077331 | Ga0207648_100773312 | 61 |
| 245 | 3300026095 | Ga0207676_11427397 | Ga0207676_114273971 | 61 |
| 246 | 3300026116 | Ga0207674_11617705 | Ga0207674_116177052 | 61 |
| 247 | 3300042001 | Ga0439441_072363 | Ga0439441_072363_521_715 | 61 |
| 248 | 3300042013 | Ga0439456_176370 | Ga0439456_176370_195_389 | 61 |
| 249 | 3300050493 | nmdc:mga0k408_2772_c1 | nmdc:mga0k408_2772_c1_7016_7210 | 61 |
| 250 | 3300050493 | nmdc:mga0k408_48695_c1 | nmdc:mga0k408_48695_c1_824_1018 | 61 |
| 251 | 3300003316 | rootH1_10031410 | rootH1_100314103 | 62 |
| 252 | 3300003322 | rootL2_10003300 | rootL2_1000330018 | 62 |
| 253 | 3300005290 | Ga0065712_10056070 | Ga0065712_100560702 | 62 |
| 254 | 3300005293 | Ga0065715_10120848 | Ga0065715_101208482 | 62 |
| 255 | 3300005327 | Ga0070658_10182587 | Ga0070658_101825872 | 62 |
| 256 | 3300005327 | Ga0070658_10613061 | Ga0070658_106130612 | 62 |
| 257 | 3300005328 | Ga0070676_10007895 | Ga0070676_100078953 | 62 |
| 258 | 3300005328 | Ga0070676_10011958 | Ga0070676_100119584 | 62 |
| 259 | 3300005328 | Ga0070676_10030674 | Ga0070676_100306743 | 62 |
| 260 | 3300005328 | Ga0070676_10152281 | Ga0070676_101522812 | 62 |
| 261 | 3300005328 | Ga0070676_10165762 | Ga0070676_101657621 | 62 |
| 262 | 3300005328 | Ga0070676_10202608 | Ga0070676_102026082 | 62 |
| 263 | 3300005328 | Ga0070676_10235372 | Ga0070676_102353722 | 62 |
| 264 | 3300005328 | Ga0070676_10278163 | Ga0070676_102781632 | 62 |
| 265 | 3300005329 | Ga0070683_100039749 | Ga0070683_1000397495 | 62 |
| 266 | 3300005329 | Ga0070683_100557719 | Ga0070683_1005577192 | 62 |
| 267 | 3300005329 | Ga0070683_101344516 | Ga0070683_1013445161 | 62 |
| 268 | 3300005330 | Ga0070690_100116392 | Ga0070690_1001163923 | 62 |
| 269 | 3300005330 | Ga0070690_100367271 | Ga0070690_1003672712 | 62 |
| 270 | 3300005331 | Ga0070670_100000334 | Ga0070670_10000033422 | 62 |
| 271 | 3300005331 | Ga0070670_100044516 | Ga0070670_1000445162 | 62 |
| 272 | 3300005331 | Ga0070670_100060634 | Ga0070670_1000606343 | 62 |
| 273 | 3300005331 | Ga0070670_100075077 | Ga0070670_1000750772 | 62 |
| 274 | 3300005331 | Ga0070670_100087706 | Ga0070670_1000877063 | 62 |
| 275 | 3300005331 | Ga0070670_100220336 | Ga0070670_1002203362 | 62 |
| 276 | 3300005331 | Ga0070670_100645234 | Ga0070670_1006452342 | 62 |
| 277 | 3300005331 | Ga0070670_101289499 | Ga0070670_1012894992 | 62 |
| 278 | 3300005333 | Ga0070677_10006421 | Ga0070677_100064214 | 62 |
| 279 | 3300005333 | Ga0070677_10006836 | Ga0070677_100068362 | 62 |
| 280 | 3300005333 | Ga0070677_10008378 | Ga0070677_100083784 | 62 |
| 281 | 3300005333 | Ga0070677_10081611 | Ga0070677_100816112 | 62 |
| 282 | 3300005333 | Ga0070677_10096075 | Ga0070677_100960752 | 62 |
| 283 | 3300005333 | Ga0070677_10137535 | Ga0070677_101375351 | 62 |
| 284 | 3300005333 | Ga0070677_10245694 | Ga0070677_102456941 | 62 |
| 285 | 3300005333 | Ga0070677_10450072 | Ga0070677_104500722 | 62 |
| 286 | 3300005334 | Ga0068869_100013349 | Ga0068869_1000133493 | 62 |
| 287 | 3300005334 | Ga0068869_100284837 | Ga0068869_1002848371 | 62 |
| 288 | 3300005334 | Ga0068869_100378101 | Ga0068869_1003781012 | 62 |
| 289 | 3300005335 | Ga0070666_10003466 | Ga0070666_100034667 | 62 |
| 290 | 3300005335 | Ga0070666_10635016 | Ga0070666_106350162 | 62 |
| 291 | 3300005335 | Ga0070666_10677108 | Ga0070666_106771082 | 62 |
| 292 | 3300005335 | Ga0070666_11039612 | Ga0070666_110396122 | 62 |
| 293 | 3300005336 | Ga0070680_100012537 | Ga0070680_1000125372 | 62 |
| 294 | 3300005338 | Ga0068868_100010821 | Ga0068868_1000108216 | 62 |
| 295 | 3300005338 | Ga0068868_100055602 | Ga0068868_1000556023 | 62 |
| 296 | 3300005338 | Ga0068868_100079519 | Ga0068868_1000795193 | 62 |
| 297 | 3300005338 | Ga0068868_100336794 | Ga0068868_1003367942 | 62 |
| 298 | 3300005338 | Ga0068868_100400257 | Ga0068868_1004002572 | 62 |
| 299 | 3300005338 | Ga0068868_100856291 | Ga0068868_1008562912 | 62 |
| 300 | 3300005338 | Ga0068868_100893892 | Ga0068868_1008938921 | 62 |
| 301 | 3300005339 | Ga0070660_100120719 | Ga0070660_1001207192 | 62 |
| 302 | 3300005339 | Ga0070660_100293410 | Ga0070660_1002934102 | 62 |
| 303 | 3300005339 | Ga0070660_100618286 | Ga0070660_1006182862 | 62 |
| 304 | 3300005340 | Ga0070689_100252613 | Ga0070689_1002526133 | 62 |
| 305 | 3300005340 | Ga0070689_100564921 | Ga0070689_1005649212 | 62 |
| 306 | 3300005343 | Ga0070687_100105520 | Ga0070687_1001055202 | 62 |
| 307 | 3300005343 | Ga0070687_100367005 | Ga0070687_1003670052 | 62 |
| 308 | 3300005343 | Ga0070687_100694693 | Ga0070687_1006946932 | 62 |
| 309 | 3300005344 | Ga0070661_100022092 | Ga0070661_1000220922 | 62 |
| 310 | 3300005344 | Ga0070661_100123527 | Ga0070661_1001235272 | 62 |
| 311 | 3300005344 | Ga0070661_100150066 | Ga0070661_1001500662 | 62 |
| 312 | 3300005344 | Ga0070661_100323746 | Ga0070661_1003237462 | 62 |
| 313 | 3300005344 | Ga0070661_101402844 | Ga0070661_1014028442 | 62 |
| 314 | 3300005345 | Ga0070692_10358886 | Ga0070692_103588862 | 62 |
| 315 | 3300005347 | Ga0070668_100064311 | Ga0070668_1000643113 | 62 |
| 316 | 3300005347 | Ga0070668_100526822 | Ga0070668_1005268222 | 62 |
| 317 | 3300005347 | Ga0070668_100860308 | Ga0070668_1008603082 | 62 |
| 318 | 3300005353 | Ga0070669_100118475 | Ga0070669_1001184752 | 62 |
| 319 | 3300005353 | Ga0070669_100148531 | Ga0070669_1001485312 | 62 |
| 320 | 3300005353 | Ga0070669_100398760 | Ga0070669_1003987602 | 62 |
| 321 | 3300005353 | Ga0070669_101096316 | Ga0070669_1010963161 | 62 |
| 322 | 3300005354 | Ga0070675_100009823 | Ga0070675_1000098235 | 62 |
| 323 | 3300005354 | Ga0070675_100037083 | Ga0070675_1000370832 | 62 |
| 324 | 3300005354 | Ga0070675_100048867 | Ga0070675_1000488672 | 62 |
| 325 | 3300005354 | Ga0070675_100072089 | Ga0070675_1000720892 | 62 |
| 326 | 3300005354 | Ga0070675_100095821 | Ga0070675_1000958213 | 62 |
| 327 | 3300005354 | Ga0070675_100145848 | Ga0070675_1001458483 | 62 |
| 328 | 3300005354 | Ga0070675_100671595 | Ga0070675_1006715952 | 62 |
| 329 | 3300005354 | Ga0070675_101026303 | Ga0070675_1010263032 | 62 |
| 330 | 3300005354 | Ga0070675_101827236 | Ga0070675_1018272362 | 62 |
| 331 | 3300005355 | Ga0070671_100004257 | Ga0070671_1000042579 | 62 |
| 332 | 3300005355 | Ga0070671_100010829 | Ga0070671_1000108294 | 62 |
| 333 | 3300005355 | Ga0070671_100010852 | Ga0070671_1000108526 | 62 |
| 334 | 3300005355 | Ga0070671_100035500 | Ga0070671_1000355004 | 62 |
| 335 | 3300005355 | Ga0070671_100054208 | Ga0070671_1000542082 | 62 |
| 336 | 3300005355 | Ga0070671_100151034 | Ga0070671_1001510342 | 62 |
| 337 | 3300005355 | Ga0070671_100352284 | Ga0070671_1003522842 | 62 |
| 338 | 3300005355 | Ga0070671_100431186 | Ga0070671_1004311862 | 62 |
| 339 | 3300005355 | Ga0070671_100541482 | Ga0070671_1005414822 | 62 |
| 340 | 3300005355 | Ga0070671_100549835 | Ga0070671_1005498352 | 62 |
| 341 | 3300005355 | Ga0070671_100621150 | Ga0070671_1006211502 | 62 |
| 342 | 3300005355 | Ga0070671_100746480 | Ga0070671_1007464801 | 62 |
| 343 | 3300005356 | Ga0070674_100000872 | Ga0070674_10000087215 | 62 |
| 344 | 3300005356 | Ga0070674_100017499 | Ga0070674_1000174995 | 62 |
| 345 | 3300005356 | Ga0070674_100020439 | Ga0070674_1000204395 | 62 |
| 346 | 3300005356 | Ga0070674_100042928 | Ga0070674_1000429282 | 62 |
| 347 | 3300005356 | Ga0070674_100422050 | Ga0070674_1004220501 | 62 |
| 348 | 3300005356 | Ga0070674_100780396 | Ga0070674_1007803961 | 62 |
| 349 | 3300005364 | Ga0070673_100002229 | Ga0070673_1000022299 | 62 |
| 350 | 3300005364 | Ga0070673_100029463 | Ga0070673_1000294633 | 62 |
| 351 | 3300005364 | Ga0070673_100209803 | Ga0070673_1002098032 | 62 |
| 352 | 3300005364 | Ga0070673_100283599 | Ga0070673_1002835993 | 62 |
| 353 | 3300005364 | Ga0070673_100482213 | Ga0070673_1004822132 | 62 |
| 354 | 3300005364 | Ga0070673_100917931 | Ga0070673_1009179311 | 62 |
| 355 | 3300005364 | Ga0070673_101157201 | Ga0070673_1011572012 | 62 |
| 356 | 3300005365 | Ga0070688_100227549 | Ga0070688_1002275492 | 62 |
| 357 | 3300005366 | Ga0070659_100052563 | Ga0070659_1000525633 | 62 |
| 358 | 3300005366 | Ga0070659_100238971 | Ga0070659_1002389712 | 62 |
| 359 | 3300005366 | Ga0070659_101373298 | Ga0070659_1013732982 | 62 |
| 360 | 3300005366 | Ga0070659_102036705 | Ga0070659_1020367051 | 62 |
| 361 | 3300005367 | Ga0070667_100001505 | Ga0070667_1000015054 | 62 |
| 362 | 3300005367 | Ga0070667_100032551 | Ga0070667_1000325512 | 62 |
| 363 | 3300005367 | Ga0070667_100063471 | Ga0070667_1000634714 | 62 |
| 364 | 3300005367 | Ga0070667_100282605 | Ga0070667_1002826052 | 62 |
| 365 | 3300005367 | Ga0070667_101867480 | Ga0070667_1018674801 | 62 |
| 366 | 3300005438 | Ga0070701_10412031 | Ga0070701_104120311 | 62 |
| 367 | 3300005440 | Ga0070705_100773616 | Ga0070705_1007736162 | 62 |
| 368 | 3300005441 | Ga0070700_100486279 | Ga0070700_1004862792 | 62 |
| 369 | 3300005441 | Ga0070700_100511520 | Ga0070700_1005115202 | 62 |
| 370 | 3300005455 | Ga0070663_100022288 | Ga0070663_1000222882 | 62 |
| 371 | 3300005455 | Ga0070663_100122435 | Ga0070663_1001224352 | 62 |
| 372 | 3300005455 | Ga0070663_100416214 | Ga0070663_1004162142 | 62 |
| 373 | 3300005455 | Ga0070663_100780688 | Ga0070663_1007806881 | 62 |
| 374 | 3300005455 | Ga0070663_100848311 | Ga0070663_1008483111 | 62 |
| 375 | 3300005456 | Ga0070678_100017379 | Ga0070678_1000173794 | 62 |
| 376 | 3300005456 | Ga0070678_100093244 | Ga0070678_1000932443 | 62 |
| 377 | 3300005456 | Ga0070678_100185327 | Ga0070678_1001853272 | 62 |
| 378 | 3300005456 | Ga0070678_100322701 | Ga0070678_1003227012 | 62 |
| 379 | 3300005456 | Ga0070678_100743803 | Ga0070678_1007438031 | 62 |
| 380 | 3300005456 | Ga0070678_100757931 | Ga0070678_1007579312 | 62 |
| 381 | 3300005456 | Ga0070678_100966038 | Ga0070678_1009660381 | 62 |
| 382 | 3300005456 | Ga0070678_101937979 | Ga0070678_1019379792 | 62 |
| 383 | 3300005457 | Ga0070662_100029907 | Ga0070662_1000299072 | 62 |
| 384 | 3300005457 | Ga0070662_100213825 | Ga0070662_1002138252 | 62 |
| 385 | 3300005457 | Ga0070662_100759759 | Ga0070662_1007597592 | 62 |
| 386 | 3300005457 | Ga0070662_101239250 | Ga0070662_1012392502 | 62 |
| 387 | 3300005457 | Ga0070662_101297301 | Ga0070662_1012973011 | 62 |
| 388 | 3300005458 | Ga0070681_10177627 | Ga0070681_101776273 | 62 |
| 389 | 3300005458 | Ga0070681_10410491 | Ga0070681_104104912 | 62 |
| 390 | 3300005459 | Ga0068867_100010980 | Ga0068867_1000109806 | 62 |
| 391 | 3300005459 | Ga0068867_100027355 | Ga0068867_1000273552 | 62 |
| 392 | 3300005459 | Ga0068867_100029135 | Ga0068867_1000291353 | 62 |
| 393 | 3300005459 | Ga0068867_100138386 | Ga0068867_1001383863 | 62 |
| 394 | 3300005459 | Ga0068867_100314874 | Ga0068867_1003148741 | 62 |
| 395 | 3300005459 | Ga0068867_100987307 | Ga0068867_1009873072 | 62 |
| 396 | 3300005459 | Ga0068867_101212099 | Ga0068867_1012120991 | 62 |
| 397 | 3300005459 | Ga0068867_101993781 | Ga0068867_1019937811 | 62 |
| 398 | 3300005466 | Ga0070685_10082173 | Ga0070685_100821732 | 62 |
| 399 | 3300005530 | Ga0070679_100000691 | Ga0070679_10000069119 | 62 |
| 400 | 3300005530 | Ga0070679_100159319 | Ga0070679_1001593194 | 62 |
| 401 | 3300005530 | Ga0070679_100940739 | Ga0070679_1009407392 | 62 |
| 402 | 3300005535 | Ga0070684_100054576 | Ga0070684_1000545762 | 62 |
| 403 | 3300005539 | Ga0068853_100076200 | Ga0068853_1000762002 | 62 |
| 404 | 3300005539 | Ga0068853_100170182 | Ga0068853_1001701822 | 62 |
| 405 | 3300005539 | Ga0068853_100345747 | Ga0068853_1003457472 | 62 |
| 406 | 3300005539 | Ga0068853_100652212 | Ga0068853_1006522122 | 62 |
| 407 | 3300005539 | Ga0068853_100816421 | Ga0068853_1008164211 | 62 |
| 408 | 3300005539 | Ga0068853_101716184 | Ga0068853_1017161841 | 62 |
| 409 | 3300005539 | Ga0068853_101757731 | Ga0068853_1017577311 | 62 |
| 410 | 3300005543 | Ga0070672_100012438 | Ga0070672_1000124384 | 62 |
| 411 | 3300005543 | Ga0070672_100021770 | Ga0070672_1000217705 | 62 |
| 412 | 3300005543 | Ga0070672_100096056 | Ga0070672_1000960562 | 62 |
| 413 | 3300005543 | Ga0070672_100132447 | Ga0070672_1001324473 | 62 |
| 414 | 3300005543 | Ga0070672_100189735 | Ga0070672_1001897352 | 62 |
| 415 | 3300005543 | Ga0070672_100198784 | Ga0070672_1001987843 | 62 |
| 416 | 3300005543 | Ga0070672_100364095 | Ga0070672_1003640952 | 62 |
| 417 | 3300005543 | Ga0070672_100540986 | Ga0070672_1005409862 | 62 |
| 418 | 3300005543 | Ga0070672_100636990 | Ga0070672_1006369901 | 62 |
| 419 | 3300005543 | Ga0070672_101648803 | Ga0070672_1016488031 | 62 |
| 420 | 3300005544 | Ga0070686_100856101 | Ga0070686_1008561012 | 62 |
| 421 | 3300005544 | Ga0070686_101555188 | Ga0070686_1015551881 | 62 |
| 422 | 3300005544 | Ga0070686_101577993 | Ga0070686_1015779931 | 62 |
| 423 | 3300005545 | Ga0070695_100279361 | Ga0070695_1002793612 | 62 |
| 424 | 3300005547 | Ga0070693_100030221 | Ga0070693_1000302213 | 62 |
| 425 | 3300005547 | Ga0070693_100111203 | Ga0070693_1001112033 | 62 |
| 426 | 3300005548 | Ga0070665_100073467 | Ga0070665_1000734671 | 62 |
| 427 | 3300005548 | Ga0070665_100526607 | Ga0070665_1005266072 | 62 |
| 428 | 3300005548 | Ga0070665_101909177 | Ga0070665_1019091771 | 62 |
| 429 | 3300005548 | Ga0070665_102106153 | Ga0070665_1021061531 | 62 |
| 430 | 3300005563 | Ga0068855_100224232 | Ga0068855_1002242323 | 62 |
| 431 | 3300005564 | Ga0070664_100175279 | Ga0070664_1001752792 | 62 |
| 432 | 3300005564 | Ga0070664_100224547 | Ga0070664_1002245472 | 62 |
| 433 | 3300005564 | Ga0070664_100533145 | Ga0070664_1005331452 | 62 |
| 434 | 3300005564 | Ga0070664_100540979 | Ga0070664_1005409792 | 62 |
| 435 | 3300005564 | Ga0070664_101200706 | Ga0070664_1012007062 | 62 |
| 436 | 3300005564 | Ga0070664_101369863 | Ga0070664_1013698632 | 62 |
| 437 | 3300005564 | Ga0070664_102074130 | Ga0070664_1020741302 | 62 |
| 438 | 3300005577 | Ga0068857_100302591 | Ga0068857_1003025912 | 62 |
| 439 | 3300005577 | Ga0068857_100771888 | Ga0068857_1007718882 | 62 |
| 440 | 3300005577 | Ga0068857_101253612 | Ga0068857_1012536122 | 62 |
| 441 | 3300005577 | Ga0068857_102213244 | Ga0068857_1022132441 | 62 |
| 442 | 3300005578 | Ga0068854_100066733 | Ga0068854_1000667332 | 62 |
| 443 | 3300005578 | Ga0068854_100111211 | Ga0068854_1001112113 | 62 |
| 444 | 3300005578 | Ga0068854_100114061 | Ga0068854_1001140612 | 62 |
| 445 | 3300005578 | Ga0068854_100129258 | Ga0068854_1001292582 | 62 |
| 446 | 3300005578 | Ga0068854_100273394 | Ga0068854_1002733942 | 62 |
| 447 | 3300005578 | Ga0068854_101407492 | Ga0068854_1014074921 | 62 |
| 448 | 3300005614 | Ga0068856_100259013 | Ga0068856_1002590132 | 62 |
| 449 | 3300005614 | Ga0068856_100793270 | Ga0068856_1007932702 | 62 |
| 450 | 3300005615 | Ga0070702_100119007 | Ga0070702_1001190072 | 62 |
| 451 | 3300005615 | Ga0070702_101699598 | Ga0070702_1016995981 | 62 |
| 452 | 3300005615 | Ga0070702_101862658 | Ga0070702_1018626582 | 62 |
| 453 | 3300005616 | Ga0068852_100030611 | Ga0068852_1000306115 | 62 |
| 454 | 3300005616 | Ga0068852_100141286 | Ga0068852_1001412862 | 62 |
| 455 | 3300005616 | Ga0068852_100326162 | Ga0068852_1003261623 | 62 |
| 456 | 3300005616 | Ga0068852_100661751 | Ga0068852_1006617512 | 62 |
| 457 | 3300005616 | Ga0068852_101191661 | Ga0068852_1011916612 | 62 |
| 458 | 3300005616 | Ga0068852_101241726 | Ga0068852_1012417262 | 62 |
| 459 | 3300005616 | Ga0068852_101462184 | Ga0068852_1014621842 | 62 |
| 460 | 3300005616 | Ga0068852_101511748 | Ga0068852_1015117482 | 62 |
| 461 | 3300005616 | Ga0068852_101694245 | Ga0068852_1016942452 | 62 |
| 462 | 3300005617 | Ga0068859_100238610 | Ga0068859_1002386102 | 62 |
| 463 | 3300005617 | Ga0068859_101688161 | Ga0068859_1016881611 | 62 |
| 464 | 3300005618 | Ga0068864_100007117 | Ga0068864_1000071174 | 62 |
| 465 | 3300005618 | Ga0068864_100032020 | Ga0068864_1000320203 | 62 |
| 466 | 3300005618 | Ga0068864_100380656 | Ga0068864_1003806562 | 62 |
| 467 | 3300005618 | Ga0068864_100604369 | Ga0068864_1006043691 | 62 |
| 468 | 3300005618 | Ga0068864_100673773 | Ga0068864_1006737732 | 62 |
| 469 | 3300005618 | Ga0068864_101029247 | Ga0068864_1010292472 | 62 |
| 470 | 3300005618 | Ga0068864_101794862 | Ga0068864_1017948621 | 62 |
| 471 | 3300005718 | Ga0068866_10195782 | Ga0068866_101957822 | 62 |
| 472 | 3300005719 | Ga0068861_100011955 | Ga0068861_1000119553 | 62 |
| 473 | 3300005719 | Ga0068861_101121144 | Ga0068861_1011211442 | 62 |
| 474 | 3300005834 | Ga0068851_10002903 | Ga0068851_100029031 | 62 |
| 475 | 3300005834 | Ga0068851_10010554 | Ga0068851_100105545 | 62 |
| 476 | 3300005834 | Ga0068851_10056524 | Ga0068851_100565242 | 62 |
| 477 | 3300005834 | Ga0068851_10133644 | Ga0068851_101336442 | 62 |
| 478 | 3300005834 | Ga0068851_10193935 | Ga0068851_101939352 | 62 |
| 479 | 3300005834 | Ga0068851_10812046 | Ga0068851_108120461 | 62 |
| 480 | 3300005840 | Ga0068870_10063592 | Ga0068870_100635922 | 62 |
| 481 | 3300005840 | Ga0068870_10118521 | Ga0068870_101185212 | 62 |
| 482 | 3300005840 | Ga0068870_10897942 | Ga0068870_108979422 | 62 |
| 483 | 3300005841 | Ga0068863_100065326 | Ga0068863_1000653262 | 62 |
| 484 | 3300005841 | Ga0068863_100115186 | Ga0068863_1001151862 | 62 |
| 485 | 3300005841 | Ga0068863_100130049 | Ga0068863_1001300493 | 62 |
| 486 | 3300005841 | Ga0068863_100177120 | Ga0068863_1001771202 | 62 |
| 487 | 3300005841 | Ga0068863_100413570 | Ga0068863_1004135702 | 62 |
| 488 | 3300005841 | Ga0068863_101323130 | Ga0068863_1013231302 | 62 |
| 489 | 3300005841 | Ga0068863_102318511 | Ga0068863_1023185112 | 62 |
| 490 | 3300005842 | Ga0068858_100001875 | Ga0068858_1000018752 | 62 |
| 491 | 3300005842 | Ga0068858_100005928 | Ga0068858_1000059289 | 62 |
| 492 | 3300005843 | Ga0068860_100000707 | Ga0068860_10000070735 | 62 |
| 493 | 3300005843 | Ga0068860_100104922 | Ga0068860_1001049223 | 62 |
| 494 | 3300005844 | Ga0068862_100415803 | Ga0068862_1004158031 | 62 |
| 495 | 3300006028 | Ga0070717_11540018 | Ga0070717_115400182 | 62 |
| 496 | 3300006163 | Ga0070715_10096131 | Ga0070715_100961312 | 62 |
| 497 | 3300006163 | Ga0070715_10253411 | Ga0070715_102534112 | 62 |
| 498 | 3300006163 | Ga0070715_10931147 | Ga0070715_109311472 | 62 |
| 499 | 3300006237 | Ga0097621_100011190 | Ga0097621_1000111902 | 62 |
| 500 | 3300006237 | Ga0097621_100044489 | Ga0097621_1000444891 | 62 |
| 501 | 3300006237 | Ga0097621_100044639 | Ga0097621_1000446393 | 62 |
| 502 | 3300006237 | Ga0097621_100093928 | Ga0097621_1000939282 | 62 |
| 503 | 3300006237 | Ga0097621_102331765 | Ga0097621_1023317652 | 62 |
| 504 | 3300006358 | Ga0068871_100020020 | Ga0068871_1000200206 | 62 |
| 505 | 3300006358 | Ga0068871_100277044 | Ga0068871_1002770442 | 62 |
| 506 | 3300006358 | Ga0068871_100373397 | Ga0068871_1003733972 | 62 |
| 507 | 3300006358 | Ga0068871_100484828 | Ga0068871_1004848282 | 62 |
| 508 | 3300006358 | Ga0068871_101751292 | Ga0068871_1017512922 | 62 |
| 509 | 3300006881 | Ga0068865_100024062 | Ga0068865_1000240622 | 62 |
| 510 | 3300006881 | Ga0068865_100046341 | Ga0068865_1000463413 | 62 |
| 511 | 3300006881 | Ga0068865_100092367 | Ga0068865_1000923672 | 62 |
| 512 | 3300006931 | Ga0097620_100238594 | Ga0097620_1002385942 | 62 |
| 513 | 3300006931 | Ga0097620_101688261 | Ga0097620_1016882612 | 62 |
| 514 | 3300007076 | Ga0075435_100172515 | Ga0075435_1001725153 | 62 |
| 515 | 3300009093 | Ga0105240_10277408 | Ga0105240_102774083 | 62 |
| 516 | 3300009093 | Ga0105240_12534235 | Ga0105240_125342352 | 62 |
| 517 | 3300009094 | Ga0111539_11849977 | Ga0111539_118499772 | 62 |
| 518 | 3300009098 | Ga0105245_10064976 | Ga0105245_100649763 | 62 |
| 519 | 3300009098 | Ga0105245_10329579 | Ga0105245_103295792 | 62 |
| 520 | 3300009098 | Ga0105245_12341658 | Ga0105245_123416582 | 62 |
| 521 | 3300009101 | Ga0105247_10067959 | Ga0105247_100679592 | 62 |
| 522 | 3300009148 | Ga0105243_10132427 | Ga0105243_101324273 | 62 |
| 523 | 3300009148 | Ga0105243_10341295 | Ga0105243_103412952 | 62 |
| 524 | 3300009148 | Ga0105243_11316347 | Ga0105243_113163472 | 62 |
| 525 | 3300009174 | Ga0105241_11742821 | Ga0105241_117428211 | 62 |
| 526 | 3300009176 | Ga0105242_10305956 | Ga0105242_103059562 | 62 |
| 527 | 3300009176 | Ga0105242_12948473 | Ga0105242_129484732 | 62 |
| 528 | 3300009177 | Ga0105248_10002863 | Ga0105248_1000286319 | 62 |
| 529 | 3300009177 | Ga0105248_10059166 | Ga0105248_100591662 | 62 |
| 530 | 3300009177 | Ga0105248_10617720 | Ga0105248_106177202 | 62 |
| 531 | 3300009177 | Ga0105248_10714340 | Ga0105248_107143402 | 62 |
| 532 | 3300009177 | Ga0105248_10715923 | Ga0105248_107159232 | 62 |
| 533 | 3300009551 | Ga0105238_10487169 | Ga0105238_104871692 | 62 |
| 534 | 3300009551 | Ga0105238_10940719 | Ga0105238_109407192 | 62 |
| 535 | 3300009553 | Ga0105249_10089453 | Ga0105249_100894531 | 62 |
| 536 | 3300009553 | Ga0105249_10631708 | Ga0105249_106317082 | 62 |
| 537 | 3300009553 | Ga0105249_10669065 | Ga0105249_106690652 | 62 |
| 538 | 3300009553 | Ga0105249_11228564 | Ga0105249_112285642 | 62 |
| 539 | 3300010375 | Ga0105239_10276434 | Ga0105239_102764343 | 62 |
| 540 | 3300011119 | Ga0105246_10761488 | Ga0105246_107614882 | 62 |
| 541 | 3300011119 | Ga0105246_11817416 | Ga0105246_118174162 | 62 |
| 542 | 3300012483 | Ga0157337_1038356 | Ga0157337_10383562 | 62 |
| 543 | 3300012506 | Ga0157324_1038928 | Ga0157324_10389282 | 62 |
| 544 | 3300012507 | Ga0157342_1031486 | Ga0157342_10314861 | 62 |
| 545 | 3300012512 | Ga0157327_1075180 | Ga0157327_10751802 | 62 |
| 546 | 3300013100 | Ga0157373_10025385 | Ga0157373_100253854 | 62 |
| 547 | 3300013100 | Ga0157373_10186599 | Ga0157373_101865992 | 62 |
| 548 | 3300013102 | Ga0157371_10072827 | Ga0157371_100728273 | 62 |
| 549 | 3300013102 | Ga0157371_10128765 | Ga0157371_101287653 | 62 |
| 550 | 3300013104 | Ga0157370_10185786 | Ga0157370_101857861 | 62 |
| 551 | 3300013104 | Ga0157370_10216969 | Ga0157370_102169693 | 62 |
| 552 | 3300013104 | Ga0157370_10808849 | Ga0157370_108088492 | 62 |
| 553 | 3300013105 | Ga0157369_10304210 | Ga0157369_103042102 | 62 |
| 554 | 3300013105 | Ga0157369_10473092 | Ga0157369_104730922 | 62 |
| 555 | 3300013105 | Ga0157369_11770209 | Ga0157369_117702092 | 62 |
| 556 | 3300013105 | Ga0157369_11993140 | Ga0157369_119931402 | 62 |
| 557 | 3300013296 | Ga0157374_10011711 | Ga0157374_100117116 | 62 |
| 558 | 3300013296 | Ga0157374_10167425 | Ga0157374_101674252 | 62 |
| 559 | 3300013296 | Ga0157374_10497068 | Ga0157374_104970682 | 62 |
| 560 | 3300013296 | Ga0157374_10866612 | Ga0157374_108666122 | 62 |
| 561 | 3300013297 | Ga0157378_10128783 | Ga0157378_101287832 | 62 |
| 562 | 3300013297 | Ga0157378_10770619 | Ga0157378_107706192 | 62 |
| 563 | 3300013297 | Ga0157378_11235427 | Ga0157378_112354272 | 62 |
| 564 | 3300013306 | Ga0163162_10033576 | Ga0163162_100335765 | 62 |
| 565 | 3300013306 | Ga0163162_10060697 | Ga0163162_100606972 | 62 |
| 566 | 3300013306 | Ga0163162_10087073 | Ga0163162_100870733 | 62 |
| 567 | 3300013306 | Ga0163162_10445140 | Ga0163162_104451402 | 62 |
| 568 | 3300013306 | Ga0163162_10771061 | Ga0163162_107710611 | 62 |
| 569 | 3300013306 | Ga0163162_11106003 | Ga0163162_111060032 | 62 |
| 570 | 3300013307 | Ga0157372_10155294 | Ga0157372_101552943 | 62 |
| 571 | 3300013307 | Ga0157372_10324538 | Ga0157372_103245382 | 62 |
| 572 | 3300013307 | Ga0157372_10683649 | Ga0157372_106836492 | 62 |
| 573 | 3300013307 | Ga0157372_10688085 | Ga0157372_106880852 | 62 |
| 574 | 3300013308 | Ga0157375_10050873 | Ga0157375_100508734 | 62 |
| 575 | 3300013308 | Ga0157375_10075875 | Ga0157375_100758752 | 62 |
| 576 | 3300013308 | Ga0157375_10159639 | Ga0157375_101596393 | 62 |
| 577 | 3300013308 | Ga0157375_10234397 | Ga0157375_102343973 | 62 |
| 578 | 3300013308 | Ga0157375_11111808 | Ga0157375_111118082 | 62 |
| 579 | 3300013308 | Ga0157375_11532370 | Ga0157375_115323702 | 62 |
| 580 | 3300013308 | Ga0157375_11561389 | Ga0157375_115613892 | 62 |
| 581 | 3300014325 | Ga0163163_10014367 | Ga0163163_100143677 | 62 |
| 582 | 3300014325 | Ga0163163_10529428 | Ga0163163_105294282 | 62 |
| 583 | 3300014325 | Ga0163163_11098699 | Ga0163163_110986992 | 62 |
| 584 | 3300014325 | Ga0163163_11138890 | Ga0163163_111388902 | 62 |
| 585 | 3300014325 | Ga0163163_11420162 | Ga0163163_114201622 | 62 |
| 586 | 3300014325 | Ga0163163_12367296 | Ga0163163_123672961 | 62 |
| 587 | 3300014325 | Ga0163163_12479108 | Ga0163163_124791082 | 62 |
| 588 | 3300014326 | Ga0157380_10021172 | Ga0157380_100211723 | 62 |
| 589 | 3300014326 | Ga0157380_10061204 | Ga0157380_100612043 | 62 |
| 590 | 3300014326 | Ga0157380_10166331 | Ga0157380_101663313 | 62 |
| 591 | 3300014326 | Ga0157380_10281277 | Ga0157380_102812773 | 62 |
| 592 | 3300014326 | Ga0157380_11209550 | Ga0157380_112095501 | 62 |
| 593 | 3300014326 | Ga0157380_12583851 | Ga0157380_125838512 | 62 |
| 594 | 3300014745 | Ga0157377_10017799 | Ga0157377_100177993 | 62 |
| 595 | 3300014745 | Ga0157377_10296155 | Ga0157377_102961552 | 62 |
| 596 | 3300014745 | Ga0157377_11613543 | Ga0157377_116135432 | 62 |
| 597 | 3300014968 | Ga0157379_10000528 | Ga0157379_1000052811 | 62 |
| 598 | 3300014968 | Ga0157379_10034268 | Ga0157379_100342683 | 62 |
| 599 | 3300014968 | Ga0157379_10034425 | Ga0157379_100344252 | 62 |
| 600 | 3300014968 | Ga0157379_10411811 | Ga0157379_104118112 | 62 |
| 601 | 3300014968 | Ga0157379_10809452 | Ga0157379_108094521 | 62 |
| 602 | 3300014969 | Ga0157376_10014036 | Ga0157376_100140364 | 62 |
| 603 | 3300014969 | Ga0157376_10130516 | Ga0157376_101305163 | 62 |
| 604 | 3300014969 | Ga0157376_10199089 | Ga0157376_101990893 | 62 |
| 605 | 3300014969 | Ga0157376_10762639 | Ga0157376_107626392 | 62 |
| 606 | 3300014969 | Ga0157376_11214602 | Ga0157376_112146022 | 62 |
| 607 | 3300014969 | Ga0157376_11397944 | Ga0157376_113979441 | 62 |
| 608 | 3300015265 | Ga0182005_1053602 | Ga0182005_10536022 | 62 |
| 609 | 3300017792 | Ga0163161_10005129 | Ga0163161_100051293 | 62 |
| 610 | 3300017792 | Ga0163161_10085881 | Ga0163161_100858812 | 62 |
| 611 | 3300017792 | Ga0163161_10484359 | Ga0163161_104843592 | 62 |
| 612 | 3300017792 | Ga0163161_11527848 | Ga0163161_115278482 | 62 |
| 613 | 3300017792 | Ga0163161_12049609 | Ga0163161_120496091 | 62 |
| 614 | 3300021384 | Ga0213876_10055319 | Ga0213876_100553193 | 62 |
| 615 | 3300025315 | Ga0207697_10096614 | Ga0207697_100966142 | 62 |
| 616 | 3300025315 | Ga0207697_10290377 | Ga0207697_102903771 | 62 |
| 617 | 3300025315 | Ga0207697_10296289 | Ga0207697_102962892 | 62 |
| 618 | 3300025321 | Ga0207656_10106981 | Ga0207656_101069812 | 62 |
| 619 | 3300025321 | Ga0207656_10138223 | Ga0207656_101382232 | 62 |
| 620 | 3300025321 | Ga0207656_10151740 | Ga0207656_101517402 | 62 |
| 621 | 3300025321 | Ga0207656_10156984 | Ga0207656_101569842 | 62 |
| 622 | 3300025321 | Ga0207656_10211827 | Ga0207656_102118271 | 62 |
| 623 | 3300025893 | Ga0207682_10000725 | Ga0207682_100007254 | 62 |
| 624 | 3300025893 | Ga0207682_10003929 | Ga0207682_100039294 | 62 |
| 625 | 3300025893 | Ga0207682_10028381 | Ga0207682_100283812 | 62 |
| 626 | 3300025893 | Ga0207682_10069616 | Ga0207682_100696161 | 62 |
| 627 | 3300025900 | Ga0207710_10134024 | Ga0207710_101340242 | 62 |
| 628 | 3300025901 | Ga0207688_10022082 | Ga0207688_100220823 | 62 |
| 629 | 3300025903 | Ga0207680_10012299 | Ga0207680_100122992 | 62 |
| 630 | 3300025903 | Ga0207680_10028426 | Ga0207680_100284264 | 62 |
| 631 | 3300025903 | Ga0207680_10175924 | Ga0207680_101759243 | 62 |
| 632 | 3300025903 | Ga0207680_10384721 | Ga0207680_103847211 | 62 |
| 633 | 3300025905 | Ga0207685_10010306 | Ga0207685_100103063 | 62 |
| 634 | 3300025905 | Ga0207685_10809541 | Ga0207685_108095411 | 62 |
| 635 | 3300025907 | Ga0207645_10017365 | Ga0207645_100173653 | 62 |
| 636 | 3300025907 | Ga0207645_10043897 | Ga0207645_100438973 | 62 |
| 637 | 3300025907 | Ga0207645_10044206 | Ga0207645_100442063 | 62 |
| 638 | 3300025907 | Ga0207645_10207552 | Ga0207645_102075522 | 62 |
| 639 | 3300025907 | Ga0207645_10880130 | Ga0207645_108801302 | 62 |
| 640 | 3300025908 | Ga0207643_10924215 | Ga0207643_109242151 | 62 |
| 641 | 3300025909 | Ga0207705_10199362 | Ga0207705_101993622 | 62 |
| 642 | 3300025909 | Ga0207705_10276262 | Ga0207705_102762622 | 62 |
| 643 | 3300025909 | Ga0207705_10371493 | Ga0207705_103714932 | 62 |
| 644 | 3300025909 | Ga0207705_10623561 | Ga0207705_106235612 | 62 |
| 645 | 3300025912 | Ga0207707_10315409 | Ga0207707_103154092 | 62 |
| 646 | 3300025912 | Ga0207707_11387295 | Ga0207707_113872952 | 62 |
| 647 | 3300025913 | Ga0207695_10985088 | Ga0207695_109850882 | 62 |
| 648 | 3300025914 | Ga0207671_10563606 | Ga0207671_105636062 | 62 |
| 649 | 3300025917 | Ga0207660_10050947 | Ga0207660_100509473 | 62 |
| 650 | 3300025918 | Ga0207662_10008920 | Ga0207662_100089203 | 62 |
| 651 | 3300025918 | Ga0207662_10391099 | Ga0207662_103910992 | 62 |
| 652 | 3300025918 | Ga0207662_10476268 | Ga0207662_104762682 | 62 |
| 653 | 3300025919 | Ga0207657_10590231 | Ga0207657_105902312 | 62 |
| 654 | 3300025919 | Ga0207657_10593843 | Ga0207657_105938431 | 62 |
| 655 | 3300025920 | Ga0207649_10003067 | Ga0207649_100030677 | 62 |
| 656 | 3300025920 | Ga0207649_10046343 | Ga0207649_100463433 | 62 |
| 657 | 3300025920 | Ga0207649_10331111 | Ga0207649_103311112 | 62 |
| 658 | 3300025920 | Ga0207649_10592186 | Ga0207649_105921862 | 62 |
| 659 | 3300025920 | Ga0207649_10679938 | Ga0207649_106799382 | 62 |
| 660 | 3300025920 | Ga0207649_10904275 | Ga0207649_109042752 | 62 |
| 661 | 3300025920 | Ga0207649_11135429 | Ga0207649_111354291 | 62 |
| 662 | 3300025920 | Ga0207649_11421429 | Ga0207649_114214291 | 62 |
| 663 | 3300025921 | Ga0207652_10003994 | Ga0207652_100039948 | 62 |
| 664 | 3300025921 | Ga0207652_11033990 | Ga0207652_110339902 | 62 |
| 665 | 3300025921 | Ga0207652_11362930 | Ga0207652_113629302 | 62 |
| 666 | 3300025923 | Ga0207681_10078779 | Ga0207681_100787793 | 62 |
| 667 | 3300025923 | Ga0207681_10128908 | Ga0207681_101289082 | 62 |
| 668 | 3300025923 | Ga0207681_10283872 | Ga0207681_102838722 | 62 |
| 669 | 3300025924 | Ga0207694_10698338 | Ga0207694_106983381 | 62 |
| 670 | 3300025924 | Ga0207694_10906448 | Ga0207694_109064482 | 62 |
| 671 | 3300025925 | Ga0207650_10000913 | Ga0207650_100009132 | 62 |
| 672 | 3300025925 | Ga0207650_10009570 | Ga0207650_100095703 | 62 |
| 673 | 3300025925 | Ga0207650_10033279 | Ga0207650_100332793 | 62 |
| 674 | 3300025925 | Ga0207650_10157405 | Ga0207650_101574053 | 62 |
| 675 | 3300025925 | Ga0207650_10301228 | Ga0207650_103012282 | 62 |
| 676 | 3300025926 | Ga0207659_10000189 | Ga0207659_1000018911 | 62 |
| 677 | 3300025926 | Ga0207659_10028616 | Ga0207659_100286164 | 62 |
| 678 | 3300025926 | Ga0207659_10088146 | Ga0207659_100881462 | 62 |
| 679 | 3300025926 | Ga0207659_10098332 | Ga0207659_100983323 | 62 |
| 680 | 3300025926 | Ga0207659_10142039 | Ga0207659_101420392 | 62 |
| 681 | 3300025926 | Ga0207659_10521296 | Ga0207659_105212962 | 62 |
| 682 | 3300025927 | Ga0207687_10090230 | Ga0207687_100902302 | 62 |
| 683 | 3300025931 | Ga0207644_10018141 | Ga0207644_100181412 | 62 |
| 684 | 3300025931 | Ga0207644_10032530 | Ga0207644_100325303 | 62 |
| 685 | 3300025931 | Ga0207644_10040242 | Ga0207644_100402423 | 62 |
| 686 | 3300025931 | Ga0207644_10176881 | Ga0207644_101768813 | 62 |
| 687 | 3300025931 | Ga0207644_10363015 | Ga0207644_103630152 | 62 |
| 688 | 3300025931 | Ga0207644_10695873 | Ga0207644_106958732 | 62 |
| 689 | 3300025931 | Ga0207644_10893404 | Ga0207644_108934041 | 62 |
| 690 | 3300025932 | Ga0207690_10180979 | Ga0207690_101809792 | 62 |
| 691 | 3300025932 | Ga0207690_10317820 | Ga0207690_103178201 | 62 |
| 692 | 3300025932 | Ga0207690_10977548 | Ga0207690_109775482 | 62 |
| 693 | 3300025932 | Ga0207690_11633755 | Ga0207690_116337552 | 62 |
| 694 | 3300025933 | Ga0207706_10019673 | Ga0207706_100196737 | 62 |
| 695 | 3300025933 | Ga0207706_10046513 | Ga0207706_100465134 | 62 |
| 696 | 3300025933 | Ga0207706_10249464 | Ga0207706_102494642 | 62 |
| 697 | 3300025933 | Ga0207706_10557269 | Ga0207706_105572692 | 62 |
| 698 | 3300025933 | Ga0207706_10776691 | Ga0207706_107766912 | 62 |
| 699 | 3300025933 | Ga0207706_11333898 | Ga0207706_113338982 | 62 |
| 700 | 3300025933 | Ga0207706_11526059 | Ga0207706_115260592 | 62 |
| 701 | 3300025934 | Ga0207686_10057830 | Ga0207686_100578303 | 62 |
| 702 | 3300025935 | Ga0207709_10375095 | Ga0207709_103750952 | 62 |
| 703 | 3300025935 | Ga0207709_11641056 | Ga0207709_116410561 | 62 |
| 704 | 3300025936 | Ga0207670_10420861 | Ga0207670_104208611 | 62 |
| 705 | 3300025936 | Ga0207670_10726512 | Ga0207670_107265122 | 62 |
| 706 | 3300025937 | Ga0207669_10251821 | Ga0207669_102518212 | 62 |
| 707 | 3300025937 | Ga0207669_10290215 | Ga0207669_102902152 | 62 |
| 708 | 3300025937 | Ga0207669_10355444 | Ga0207669_103554441 | 62 |
| 709 | 3300025937 | Ga0207669_10356794 | Ga0207669_103567942 | 62 |
| 710 | 3300025937 | Ga0207669_10722280 | Ga0207669_107222802 | 62 |
| 711 | 3300025938 | Ga0207704_10051709 | Ga0207704_100517092 | 62 |
| 712 | 3300025938 | Ga0207704_10463995 | Ga0207704_104639952 | 62 |
| 713 | 3300025938 | Ga0207704_10629573 | Ga0207704_106295732 | 62 |
| 714 | 3300025939 | Ga0207665_10067160 | Ga0207665_100671602 | 62 |
| 715 | 3300025940 | Ga0207691_10002491 | Ga0207691_1000249115 | 62 |
| 716 | 3300025940 | Ga0207691_10022344 | Ga0207691_100223445 | 62 |
| 717 | 3300025940 | Ga0207691_10046984 | Ga0207691_100469845 | 62 |
| 718 | 3300025940 | Ga0207691_10060239 | Ga0207691_100602392 | 62 |
| 719 | 3300025940 | Ga0207691_10115269 | Ga0207691_101152693 | 62 |
| 720 | 3300025940 | Ga0207691_10276681 | Ga0207691_102766812 | 62 |
| 721 | 3300025940 | Ga0207691_10538816 | Ga0207691_105388161 | 62 |
| 722 | 3300025940 | Ga0207691_11295023 | Ga0207691_112950232 | 62 |
| 723 | 3300025940 | Ga0207691_11332922 | Ga0207691_113329222 | 62 |
| 724 | 3300025941 | Ga0207711_10175231 | Ga0207711_101752312 | 62 |
| 725 | 3300025941 | Ga0207711_10199640 | Ga0207711_101996402 | 62 |
| 726 | 3300025941 | Ga0207711_10432966 | Ga0207711_104329662 | 62 |
| 727 | 3300025941 | Ga0207711_10905306 | Ga0207711_109053062 | 62 |
| 728 | 3300025942 | Ga0207689_10023257 | Ga0207689_100232573 | 62 |
| 729 | 3300025942 | Ga0207689_10030492 | Ga0207689_100304923 | 62 |
| 730 | 3300025942 | Ga0207689_10604887 | Ga0207689_106048872 | 62 |
| 731 | 3300025944 | Ga0207661_10025979 | Ga0207661_100259792 | 62 |
| 732 | 3300025944 | Ga0207661_10104735 | Ga0207661_101047353 | 62 |
| 733 | 3300025945 | Ga0207679_10936490 | Ga0207679_109364902 | 62 |
| 734 | 3300025945 | Ga0207679_11172985 | Ga0207679_111729852 | 62 |
| 735 | 3300025945 | Ga0207679_12167833 | Ga0207679_121678332 | 62 |
| 736 | 3300025949 | Ga0207667_10238026 | Ga0207667_102380263 | 62 |
| 737 | 3300025960 | Ga0207651_10006755 | Ga0207651_100067557 | 62 |
| 738 | 3300025960 | Ga0207651_10036579 | Ga0207651_100365793 | 62 |
| 739 | 3300025960 | Ga0207651_10261065 | Ga0207651_102610652 | 62 |
| 740 | 3300025960 | Ga0207651_10384276 | Ga0207651_103842762 | 62 |
| 741 | 3300025960 | Ga0207651_10663526 | Ga0207651_106635262 | 62 |
| 742 | 3300025960 | Ga0207651_11726224 | Ga0207651_117262241 | 62 |
| 743 | 3300025961 | Ga0207712_10158752 | Ga0207712_101587522 | 62 |
| 744 | 3300025961 | Ga0207712_10365122 | Ga0207712_103651221 | 62 |
| 745 | 3300025972 | Ga0207668_10239930 | Ga0207668_102399302 | 62 |
| 746 | 3300025972 | Ga0207668_10581705 | Ga0207668_105817052 | 62 |
| 747 | 3300025972 | Ga0207668_11032804 | Ga0207668_110328041 | 62 |
| 748 | 3300025981 | Ga0207640_10064285 | Ga0207640_100642853 | 62 |
| 749 | 3300025981 | Ga0207640_10345483 | Ga0207640_103454832 | 62 |
| 750 | 3300025981 | Ga0207640_10464869 | Ga0207640_104648692 | 62 |
| 751 | 3300025981 | Ga0207640_10727442 | Ga0207640_107274421 | 62 |
| 752 | 3300025981 | Ga0207640_11092677 | Ga0207640_110926772 | 62 |
| 753 | 3300025986 | Ga0207658_10259502 | Ga0207658_102595022 | 62 |
| 754 | 3300025986 | Ga0207658_10356188 | Ga0207658_103561881 | 62 |
| 755 | 3300026023 | Ga0207677_10006180 | Ga0207677_100061805 | 62 |
| 756 | 3300026023 | Ga0207677_10008231 | Ga0207677_100082315 | 62 |
| 757 | 3300026023 | Ga0207677_10243194 | Ga0207677_102431942 | 62 |
| 758 | 3300026023 | Ga0207677_10374579 | Ga0207677_103745792 | 62 |
| 759 | 3300026023 | Ga0207677_10576931 | Ga0207677_105769312 | 62 |
| 760 | 3300026023 | Ga0207677_10746347 | Ga0207677_107463472 | 62 |
| 761 | 3300026023 | Ga0207677_10865955 | Ga0207677_108659552 | 62 |
| 762 | 3300026041 | Ga0207639_10168564 | Ga0207639_101685643 | 62 |
| 763 | 3300026041 | Ga0207639_10182817 | Ga0207639_101828172 | 62 |
| 764 | 3300026041 | Ga0207639_10612436 | Ga0207639_106124361 | 62 |
| 765 | 3300026041 | Ga0207639_10765798 | Ga0207639_107657981 | 62 |
| 766 | 3300026067 | Ga0207678_10098284 | Ga0207678_100982843 | 62 |
| 767 | 3300026067 | Ga0207678_10433145 | Ga0207678_104331452 | 62 |
| 768 | 3300026067 | Ga0207678_10809591 | Ga0207678_108095912 | 62 |
| 769 | 3300026067 | Ga0207678_10856175 | Ga0207678_108561751 | 62 |
| 770 | 3300026075 | Ga0207708_10613258 | Ga0207708_106132582 | 62 |
| 771 | 3300026075 | Ga0207708_10623155 | Ga0207708_106231551 | 62 |
| 772 | 3300026078 | Ga0207702_10159617 | Ga0207702_101596172 | 62 |
| 773 | 3300026078 | Ga0207702_10629741 | Ga0207702_106297412 | 62 |
| 774 | 3300026078 | Ga0207702_10821268 | Ga0207702_108212682 | 62 |
| 775 | 3300026078 | Ga0207702_10900339 | Ga0207702_109003391 | 62 |
| 776 | 3300026078 | Ga0207702_11058535 | Ga0207702_110585352 | 62 |
| 777 | 3300026088 | Ga0207641_10102813 | Ga0207641_101028132 | 62 |
| 778 | 3300026088 | Ga0207641_10145771 | Ga0207641_101457712 | 62 |
| 779 | 3300026088 | Ga0207641_10243287 | Ga0207641_102432872 | 62 |
| 780 | 3300026088 | Ga0207641_10853699 | Ga0207641_108536992 | 62 |
| 781 | 3300026089 | Ga0207648_10017069 | Ga0207648_100170693 | 62 |
| 782 | 3300026089 | Ga0207648_10020934 | Ga0207648_100209343 | 62 |
| 783 | 3300026089 | Ga0207648_10025462 | Ga0207648_100254623 | 62 |
| 784 | 3300026089 | Ga0207648_10038664 | Ga0207648_100386645 | 62 |
| 785 | 3300026089 | Ga0207648_10062807 | Ga0207648_100628073 | 62 |
| 786 | 3300026089 | Ga0207648_10292324 | Ga0207648_102923242 | 62 |
| 787 | 3300026089 | Ga0207648_12067787 | Ga0207648_120677871 | 62 |
| 788 | 3300026095 | Ga0207676_10010740 | Ga0207676_100107403 | 62 |
| 789 | 3300026095 | Ga0207676_10012969 | Ga0207676_100129692 | 62 |
| 790 | 3300026095 | Ga0207676_10017091 | Ga0207676_100170912 | 62 |
| 791 | 3300026095 | Ga0207676_10112784 | Ga0207676_101127842 | 62 |
| 792 | 3300026095 | Ga0207676_10365923 | Ga0207676_103659232 | 62 |
| 793 | 3300026095 | Ga0207676_10714042 | Ga0207676_107140422 | 62 |
| 794 | 3300026095 | Ga0207676_11128801 | Ga0207676_111288012 | 62 |
| 795 | 3300026116 | Ga0207674_10037357 | Ga0207674_100373574 | 62 |
| 796 | 3300026116 | Ga0207674_10284228 | Ga0207674_102842282 | 62 |
| 797 | 3300026118 | Ga0207675_100009210 | Ga0207675_1000092109 | 62 |
| 798 | 3300026118 | Ga0207675_100013996 | Ga0207675_1000139965 | 62 |
| 799 | 3300026118 | Ga0207675_100112605 | Ga0207675_1001126053 | 62 |
| 800 | 3300026118 | Ga0207675_101810132 | Ga0207675_1018101321 | 62 |
| 801 | 3300026121 | Ga0207683_10040810 | Ga0207683_100408102 | 62 |
| 802 | 3300026121 | Ga0207683_10111933 | Ga0207683_101119332 | 62 |
| 803 | 3300026121 | Ga0207683_10126252 | Ga0207683_101262522 | 62 |
| 804 | 3300026121 | Ga0207683_10153083 | Ga0207683_101530833 | 62 |
| 805 | 3300026121 | Ga0207683_10218485 | Ga0207683_102184851 | 62 |
| 806 | 3300026121 | Ga0207683_10374633 | Ga0207683_103746332 | 62 |
| 807 | 3300026121 | Ga0207683_10386693 | Ga0207683_103866932 | 62 |
| 808 | 3300026121 | Ga0207683_10488687 | Ga0207683_104886872 | 62 |
| 809 | 3300026121 | Ga0207683_10899242 | Ga0207683_108992422 | 62 |
| 810 | 3300026121 | Ga0207683_12163852 | Ga0207683_121638521 | 62 |
| 811 | 3300026121 | Ga0207683_12165804 | Ga0207683_121658042 | 62 |
| 812 | 3300026142 | Ga0207698_10208020 | Ga0207698_102080202 | 62 |
| 813 | 3300026142 | Ga0207698_10446682 | Ga0207698_104466822 | 62 |
| 814 | 3300026142 | Ga0207698_10505164 | Ga0207698_105051642 | 62 |
| 815 | 3300026142 | Ga0207698_11049577 | Ga0207698_110495772 | 62 |
| 816 | 3300028379 | Ga0268266_10186889 | Ga0268266_101868893 | 62 |
| 817 | 3300028379 | Ga0268266_10196117 | Ga0268266_101961172 | 62 |
| 818 | 3300028379 | Ga0268266_10483353 | Ga0268266_104833532 | 62 |
| 819 | 3300028379 | Ga0268266_10588612 | Ga0268266_105886121 | 62 |
| 820 | 3300028380 | Ga0268265_10302348 | Ga0268265_103023482 | 62 |
| 821 | 3300028381 | Ga0268264_10216090 | Ga0268264_102160902 | 62 |
| 822 | 3300028381 | Ga0268264_10483122 | Ga0268264_104831222 | 62 |
| 823 | 3300031456 | Ga0307513_10866818 | Ga0307513_108668182 | 62 |
| 824 | 3300031548 | Ga0307408_100087773 | Ga0307408_1000877732 | 62 |
| 825 | 3300031731 | Ga0307405_10019062 | Ga0307405_100190624 | 62 |
| 826 | 3300031731 | Ga0307405_10231283 | Ga0307405_102312832 | 62 |
| 827 | 3300031731 | Ga0307405_10610104 | Ga0307405_106101042 | 62 |
| 828 | 3300031824 | Ga0307413_10038148 | Ga0307413_100381483 | 62 |
| 829 | 3300031824 | Ga0307413_11204990 | Ga0307413_112049902 | 62 |
| 830 | 3300031852 | Ga0307410_10012223 | Ga0307410_100122232 | 62 |
| 831 | 3300031852 | Ga0307410_10099902 | Ga0307410_100999022 | 62 |
| 832 | 3300031852 | Ga0307410_11527741 | Ga0307410_115277412 | 62 |
| 833 | 3300031901 | Ga0307406_10022580 | Ga0307406_100225802 | 62 |
| 834 | 3300031901 | Ga0307406_10184957 | Ga0307406_101849572 | 62 |
| 835 | 3300031903 | Ga0307407_10033866 | Ga0307407_100338662 | 62 |
| 836 | 3300031903 | Ga0307407_10239113 | Ga0307407_102391131 | 62 |
| 837 | 3300031903 | Ga0307407_10313447 | Ga0307407_103134472 | 62 |
| 838 | 3300031911 | Ga0307412_10016388 | Ga0307412_100163884 | 62 |
| 839 | 3300031911 | Ga0307412_10314711 | Ga0307412_103147113 | 62 |
| 840 | 3300031911 | Ga0307412_11516339 | Ga0307412_115163392 | 62 |
| 841 | 3300031995 | Ga0307409_100001576 | Ga0307409_1000015765 | 62 |
| 842 | 3300031995 | Ga0307409_100300756 | Ga0307409_1003007562 | 62 |
| 843 | 3300031995 | Ga0307409_100843065 | Ga0307409_1008430652 | 62 |
| 844 | 3300031995 | Ga0307409_100939520 | Ga0307409_1009395202 | 62 |
| 845 | 3300032002 | Ga0307416_100001923 | Ga0307416_1000019236 | 62 |
| 846 | 3300032002 | Ga0307416_100076333 | Ga0307416_1000763334 | 62 |
| 847 | 3300032002 | Ga0307416_101245998 | Ga0307416_1012459982 | 62 |
| 848 | 3300032002 | Ga0307416_102148113 | Ga0307416_1021481132 | 62 |
| 849 | 3300032005 | Ga0307411_10009826 | Ga0307411_100098263 | 62 |
| 850 | 3300032005 | Ga0307411_10024755 | Ga0307411_100247553 | 62 |
| 851 | 3300032005 | Ga0307411_11067351 | Ga0307411_110673511 | 62 |
| 852 | 3300032005 | Ga0307411_11313255 | Ga0307411_113132552 | 62 |
| 853 | 3300032126 | Ga0307415_100074130 | Ga0307415_1000741302 | 62 |
| 854 | 3300034816 | Ga0373930_0076066 | Ga0373930_0076066_29_232 | 62 |
| 855 | 3300034817 | Ga0373948_0048606 | Ga0373948_0048606_469_672 | 62 |
| 856 | 3300034820 | Ga0373959_0091513 | Ga0373959_0091513_289_492 | 62 |
| 857 | 3300034957 | Ga0373938_0011101 | Ga0373938_0011101_940_1143 | 62 |
| 858 | 3300035088 | Ga0373940_0083197 | Ga0373940_0083197_404_607 | 62 |
| 859 | 3300035089 | Ga0373944_0010740 | Ga0373944_0010740_413_616 | 62 |
| 860 | 3300035089 | Ga0373944_0160282 | Ga0373944_0160282_473_676 | 62 |
| 861 | 3300035090 | Ga0373949_0024439 | Ga0373949_0024439_615_818 | 62 |
| 862 | 3300035091 | Ga0373951_0229139 | Ga0373951_0229139_117_320 | 62 |
| 863 | 3300035092 | Ga0373952_0077468 | Ga0373952_0077468_570_773 | 62 |
| 864 | 3300035111 | Ga0373923_0118788 | Ga0373923_0118788_402_605 | 62 |
| 865 | 3300035114 | Ga0373939_0411611 | Ga0373939_0411611_46_249 | 62 |
| 866 | 3300035118 | Ga0373954_0269983 | Ga0373954_0269983_519_722 | 62 |
| 867 | 3300035119 | Ga0373956_0036705 | Ga0373956_0036705_29_232 | 62 |
| 868 | 3300035171 | Ga0373946_0162806 | Ga0373946_0162806_362_565 | 62 |
| 869 | 3300035171 | Ga0373946_0525150 | Ga0373946_0525150_11_214 | 62 |
| 870 | 3300035172 | Ga0373955_0214586 | Ga0373955_0214586_808_1011 | 62 |
| 871 | 3300035172 | Ga0373955_0244715 | Ga0373955_0244715_502_705 | 62 |
| 872 | 3300035241 | Ga0373961_0160173 | Ga0373961_0160173_120_323 | 62 |
| 873 | 3300035410 | Ga0373924_0564452 | Ga0373924_0564452_11_214 | 62 |
| 874 | 3300035691 | Ga0373931_0004801 | Ga0373931_0004801_964_1167 | 62 |
| 875 | 3300035692 | Ga0373935_0030710 | Ga0373935_0030710_844_1047 | 62 |
| 876 | 3300035695 | Ga0373927_0439112 | Ga0373927_0439112_411_614 | 62 |
| 877 | 3300035724 | Ga0373933_0292065 | Ga0373933_0292065_11_214 | 62 |
| 878 | 3300035724 | Ga0373933_0383816 | Ga0373933_0383816_619_822 | 62 |
| 879 | 3300035725 | Ga0373947_0666259 | Ga0373947_0666259_35_238 | 62 |
| 880 | 3300036401 | Ga0373937_0161905 | Ga0373937_0161905_1742_1945 | 62 |
| 881 | 3300036401 | Ga0373937_0210205 | Ga0373937_0210205_174_377 | 62 |
| 882 | 3300036401 | Ga0373937_1129495 | Ga0373937_1129495_239_442 | 62 |
| 883 | 3300036401 | Ga0373937_1531714 | Ga0373937_1531714_307_510 | 62 |
| 884 | 3300037068 | Ga0373925_0239360 | Ga0373925_0239360_236_439 | 62 |
| 885 | 3300037068 | Ga0373925_0295789 | Ga0373925_0295789_240_446 | 62 |
| 886 | 3300039437 | Ga0436365_1878872 | Ga0436365_1878872_553_756 | 62 |
| 887 | 3300039450 | Ga0436363_1315143 | Ga0436363_1315143_1693_1896 | 62 |
| 888 | 3300041453 | Ga0451797_0024097 | Ga0451797_0024097_171_374 | 62 |
| 889 | 3300041456 | Ga0451795_1526863 | Ga0451795_1526863_60_263 | 62 |
| 890 | 3300041458 | Ga0451798_0162675 | Ga0451798_0162675_95_298 | 62 |
| 891 | 3300041460 | Ga0451802_0227888 | Ga0451802_0227888_351_554 | 62 |
| 892 | 3300041486 | Ga0451807_2633116 | Ga0451807_2633116_207_413 | 62 |
| 893 | 3300041503 | Ga0451847_0580709 | Ga0451847_0580709_364_570 | 62 |
| 894 | 3300041505 | Ga0451849_1316584 | Ga0451849_1316584_103_306 | 62 |
| 895 | 3300041507 | Ga0451851_0279755 | Ga0451851_0279755_62_265 | 62 |
| 896 | 3300041512 | Ga0451853_2526968 | Ga0451853_2526968_298_498 | 62 |
| 897 | 3300041512 | Ga0451853_3410975 | Ga0451853_3410975_265_468 | 62 |
| 898 | 3300042005 | Ga0439448_0265163 | Ga0439448_0265163_229_435 | 62 |
| 899 | 3300042157 | Ga0439458_0162222 | Ga0439458_0162222_256_462 | 62 |
| 900 | 3300042439 | Ga0439464_0019626 | Ga0439464_0019626_844_1050 | 62 |
| 901 | 3300042531 | Ga0450918_000075 | Ga0450918_000075_17305_17502 | 62 |
| 902 | 3300042993 | Ga0439440_0164943 | Ga0439440_0164943_374_580 | 62 |
| 903 | 3300044712 | Ga0453684_0006474 | Ga0453684_0006474_4201_4401 | 62 |
| 904 | 3300046459 | Ga0495629_0411126 | Ga0495629_0411126_325_528 | 62 |
| 905 | 3300046472 | Ga0495580_0035100 | Ga0495580_0035100_1422_1628 | 62 |
| 906 | 3300046476 | Ga0495662_0150853 | Ga0495662_0150853_172_375 | 62 |
| 907 | 3300046515 | Ga0495620_0145710 | Ga0495620_0145710_189_392 | 62 |
| 908 | 3300046516 | Ga0495628_0425675 | Ga0495628_0425675_101_304 | 62 |
| 909 | 3300046516 | Ga0495628_1154398 | Ga0495628_1154398_301_504 | 62 |
| 910 | 3300046530 | Ga0495654_0236292 | Ga0495654_0236292_371_574 | 62 |
| 911 | 3300046533 | Ga0495640_0211526 | Ga0495640_0211526_990_1193 | 62 |
| 912 | 3300046533 | Ga0495640_0553282 | Ga0495640_0553282_252_455 | 62 |
| 913 | 3300046536 | Ga0495587_0734277 | Ga0495587_0734277_129_332 | 62 |
| 914 | 3300046537 | Ga0495598_0303288 | Ga0495598_0303288_377_580 | 62 |
| 915 | 3300046539 | Ga0495621_0177144 | Ga0495621_0177144_197_400 | 62 |
| 916 | 3300046539 | Ga0495621_0457265 | Ga0495621_0457265_331_534 | 62 |
| 917 | 3300046543 | Ga0495645_0218962 | Ga0495645_0218962_840_1043 | 62 |
| 918 | 3300046543 | Ga0495645_0966754 | Ga0495645_0966754_160_363 | 62 |
| 919 | 3300046558 | Ga0495633_0364923 | Ga0495633_0364923_117_320 | 62 |
| 920 | 3300046615 | Ga0495656_0650507 | Ga0495656_0650507_352_555 | 62 |
| 921 | 3300046663 | Ga0495635_0497593 | Ga0495635_0497593_165_368 | 62 |
| 922 | 3300046663 | Ga0495635_0962027 | Ga0495635_0962027_61_264 | 62 |
| 923 | 3300046679 | Ga0495623_0369829 | Ga0495623_0369829_183_386 | 62 |
| 924 | 3300046681 | Ga0495647_0038717 | Ga0495647_0038717_766_969 | 62 |
| 925 | 3300046681 | Ga0495647_0166447 | Ga0495647_0166447_607_810 | 62 |
| 926 | 3300046683 | Ga0495658_0015916 | Ga0495658_0015916_1141_1344 | 62 |
| 927 | 3300046683 | Ga0495658_0174708 | Ga0495658_0174708_41_244 | 62 |
| 928 | 3300046683 | Ga0495658_0274123 | Ga0495658_0274123_433_636 | 62 |
| 929 | 3300046683 | Ga0495658_0362831 | Ga0495658_0362831_369_572 | 62 |
| 930 | 3300046683 | Ga0495658_0532797 | Ga0495658_0532797_510_713 | 62 |
| 931 | 3300046689 | Ga0495613_0084712 | Ga0495613_0084712_1065_1268 | 62 |
| 932 | 3300046689 | Ga0495613_1093267 | Ga0495613_1093267_146_352 | 62 |
| 933 | 3300047321 | Ga0495676_0382241 | Ga0495676_0382241_175_378 | 62 |
| 934 | 3300047470 | Ga0495681_0393987 | Ga0495681_0393987_278_481 | 62 |
| 935 | 3300047471 | Ga0495684_0108451 | Ga0495684_0108451_866_1069 | 62 |
| 936 | 3300048090 | Ga0495615_0139808 | Ga0495615_0139808_156_359 | 62 |
| 937 | 3300048903 | Ga0496100_0323352 | Ga0496100_0323352_235_438 | 62 |
| 938 | 3300048903 | Ga0496100_0549204 | Ga0496100_0549204_401_604 | 62 |
| 939 | 3300048903 | Ga0496100_0998384 | Ga0496100_0998384_73_276 | 62 |
| 940 | 3300048904 | Ga0496101_0119392 | Ga0496101_0119392_1277_1480 | 62 |
| 941 | 3300048906 | Ga0496103_0324954 | Ga0496103_0324954_322_525 | 62 |
| 942 | 3300048907 | Ga0496104_0008841 | Ga0496104_0008841_7821_8024 | 62 |
| 943 | 3300048907 | Ga0496104_0147333 | Ga0496104_0147333_1261_1464 | 62 |
| 944 | 3300048907 | Ga0496104_0397604 | Ga0496104_0397604_387_590 | 62 |
| 945 | 3300048908 | Ga0496105_0059786 | Ga0496105_0059786_2155_2358 | 62 |
| 946 | 3300048908 | Ga0496105_0154988 | Ga0496105_0154988_757_960 | 62 |
| 947 | 3300048908 | Ga0496105_0825661 | Ga0496105_0825661_272_475 | 62 |
| 948 | 3300048909 | Ga0496106_0192393 | Ga0496106_0192393_786_989 | 62 |
| 949 | 3300048909 | Ga0496106_0278486 | Ga0496106_0278486_843_1046 | 62 |
| 950 | 3300048910 | Ga0496107_0119919 | Ga0496107_0119919_692_895 | 62 |
| 951 | 3300048911 | Ga0496108_0130837 | Ga0496108_0130837_997_1200 | 62 |
| 952 | 3300048911 | Ga0496108_0204984 | Ga0496108_0204984_901_1104 | 62 |
| 953 | 3300048912 | Ga0496109_0098011 | Ga0496109_0098011_94_297 | 62 |
| 954 | 3300048912 | Ga0496109_0162683 | Ga0496109_0162683_1355_1558 | 62 |
| 955 | 3300048912 | Ga0496109_0627133 | Ga0496109_0627133_777_980 | 62 |
| 956 | 3300048913 | Ga0496110_0167874 | Ga0496110_0167874_970_1173 | 62 |
| 957 | 3300048913 | Ga0496110_0172128 | Ga0496110_0172128_145_348 | 62 |
| 958 | 3300048913 | Ga0496110_0422460 | Ga0496110_0422460_482_685 | 62 |
| 959 | 3300048914 | Ga0496111_0794761 | Ga0496111_0794761_293_496 | 62 |
| 960 | 3300048916 | Ga0496113_0228840 | Ga0496113_0228840_287_490 | 62 |
| 961 | 3300048917 | Ga0496114_0052168 | Ga0496114_0052168_2375_2578 | 62 |
| 962 | 3300048917 | Ga0496114_0797284 | Ga0496114_0797284_572_775 | 62 |
| 963 | 3300048917 | Ga0496114_1268649 | Ga0496114_1268649_311_514 | 62 |
| 964 | 3300048918 | Ga0496115_0030587 | Ga0496115_0030587_2461_2664 | 62 |
| 965 | 3300048918 | Ga0496115_1459923 | Ga0496115_1459923_160_363 | 62 |
| 966 | 3300050511 | nmdc:mga08y16_1323210_c1 | nmdc:mga08y16_1323210_c1_193_396 | 62 |
| 967 | 3300050512 | nmdc:mga0n895_103732_c1 | nmdc:mga0n895_103732_c1_927_1130 | 62 |
| 968 | 3300050513 | nmdc:mga0rr50_1274026_c1 | nmdc:mga0rr50_1274026_c1_197_400 | 62 |
| 969 | 3300053077 | Ga0495601_0024573 | Ga0495601_0024573_1594_1797 | 62 |
| 970 | 3300053078 | Ga0495612_0109924 | Ga0495612_0109924_893_1096 | 62 |
| 971 | 3300053078 | Ga0495612_0420894 | Ga0495612_0420894_301_504 | 62 |
| 972 | 3300053084 | Ga0495595_0190648 | Ga0495595_0190648_624_827 | 62 |
| 973 | 3300053084 | Ga0495595_0406689 | Ga0495595_0406689_64_267 | 62 |
| 974 | 3300053085 | Ga0495619_0155441 | Ga0495619_0155441_973_1176 | 62 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tdd-assembly1.cif.gz_B | bam_5924 docking domain | 0.7426 | 28 | 57 |
| 6tdd-assembly1.cif.gz_B | bam_5924 docking domain | 0.5246 | 28 | 57 |
| 8oik-assembly2.cif.gz_B | d-phat domain (ntd) of human samd4a | 0.4644 | 1 | 52 |
| 8d8l-assembly1.cif.gz_D | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.4122 | 6 | 43 |
| 8oik-assembly2.cif.gz_B | d-phat domain (ntd) of human samd4a | 0.3856 | 1 | 52 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o3nB01 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4879 | 15 | 46 | 1.20.1270.370 |
| af_F1Q9B1_426_616_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.348 | 7 | 58 | 1.20.1250.20 |
| af_O45806_8_315_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.336 | 5 | 47 | 1.20.1070.10 |
| af_F1Q9B1_426_616_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2919 | 7 | 58 | 1.20.1250.20 |
| 3o3nB01 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.2917 | 15 | 46 | 1.20.1270.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F7YIS7-F1-model_v4 | deleted | 0.8481 | 6 | 59 |
|
| AF-A0A1C3H6S6-F1-model_v4 | Inner membrane protein YjeT (Clustered with HflC) | 0.8438 | 6 | 61 |
GO:0016020
|
| AF-A0A1Y5RGA7-F1-model_v4 | DUF2065 domain-containing protein | 0.8364 | 6 | 59 |
GO:0016020
|
| AF-A0A1X4J229-F1-model_v4 | DUF2065 domain-containing protein | 0.8184 | 6 | 60 |
GO:0016020
|
| AF-A0A225NGH8-F1-model_v4 | DUF2065 domain-containing protein | 0.7839 | 6 | 60 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar