F487199

General Info

Members Datasets Scaffolds Average Seq Length
973 779 439 147

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255279|2601607992
Length 169
Sequence VDSIVSAASKPSAFHPGVAMSIPFPSAPADKEVLENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAEALSLTLETGIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFYRTVELSNGDAVTKITDDTRHFDPATTYSNT

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
22 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
23 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
24 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
25 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
26 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
30 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
31 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
32 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
33 2516143018 Ensifer sp. BR816 Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
36 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
37 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
38 2519899620 Rhizobium sp. Pop5 Isolate Nodule
39 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
40 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
41 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
42 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
43 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
44 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
45 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
46 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
47 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
51 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
52 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
53 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
54 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
55 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
56 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
57 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
58 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
59 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
60 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
61 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
62 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
63 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
64 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
65 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
66 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
67 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
68 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
69 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
70 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
71 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
72 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
73 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
74 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
75 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
76 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
77 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
78 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
79 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
80 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
81 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
82 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
83 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
84 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
85 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
86 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
87 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
88 2643221557 Ensifer sp. Root558 Isolate Unclassified
89 2643221558 Rhizobium sp. Root149 Isolate Unclassified
90 2643221568 Rhizobium sp. Root564 Isolate Unclassified
91 2643221582 Rhizobium sp. Root651 Isolate Unclassified
92 2643221610 Ensifer sp. Root74 Isolate Unclassified
93 2643221618 Ensifer sp. Root231 Isolate Unclassified
94 2643221626 Ensifer sp. Root31 Isolate Unclassified
95 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
96 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
97 2643221655 Ensifer sp. Root1252 Isolate Unclassified
98 2643221659 Ensifer sp. Root127 Isolate Unclassified
99 2643221668 Ensifer sp. Root423 Isolate Unclassified
100 2643221675 Ensifer sp. Root1298 Isolate Unclassified
101 2643221680 Ensifer sp. Root1312 Isolate Unclassified
102 2643221688 Rhizobium sp. Root482 Isolate Unclassified
103 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
104 2643221693 Rhizobium sp. Root491 Isolate Unclassified
105 2643221698 Ensifer sp. Root142 Isolate Unclassified
106 2643221712 Ensifer sp. Root258 Isolate Unclassified
107 2643221718 Rhizobium sp. Root268 Isolate Unclassified
108 2643221719 Rhizobium sp. Root274 Isolate Unclassified
109 2643221723 Ensifer sp. Root278 Isolate Unclassified
110 2643221726 Ensifer sp. Root954 Isolate Unclassified
111 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
112 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
113 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
114 2718217882 Rhizobium sp. N741 Isolate Nodule
115 2718217927 Rhizobium sp. N324 Isolate Nodule
116 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
117 2718218009 Rhizobium sp. N561 Isolate Nodule
118 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
119 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
120 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
121 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
122 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
123 2718218363 Rhizobium sp. N113 Isolate Nodule
124 2718218365 Rhizobium sp. N731 Isolate Nodule
125 2718218366 Rhizobium sp. N621 Isolate Nodule
126 2718218423 Rhizobium sp. N941 Isolate Nodule
127 2721755514 Rhizobium sp. N6212 Isolate Nodule
128 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
129 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
130 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
131 2721755809 Rhizobium sp. N541 Isolate Nodule
132 2721755810 Rhizobium sp. N871 Isolate Nodule
133 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
134 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
135 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
136 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
137 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
138 2728369365 Rhizobium sp. N1341 Isolate Nodule
139 2728369397 Rhizobium sp. N1314 Isolate Nodule
140 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
141 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
142 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
143 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
144 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
145 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
146 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
147 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
148 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
149 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
150 2791355256 Rhizobium sp. M10 Isolate Nodule
151 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
152 2791355260 Rhizobium sp. L9 Isolate Nodule
153 2791355261 Rhizobium sp. J15 Isolate Nodule
154 2791355262 Rhizobium sp. M1 Isolate Nodule
155 2791355263 Rhizobium chutanense C5 Isolate Nodule
156 2791355264 Rhizobium sp. S9 Isolate Nodule
157 2791355265 Rhizobium sp. H4 Isolate Nodule
158 2791355266 Rhizobium sp. L43 Isolate Nodule
159 2791355267 Rhizobium sp. L18 Isolate Nodule
160 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
161 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
162 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
163 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
164 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
165 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
166 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
167 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
168 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
169 2802429633 Rhizobium anhuiense J3 Isolate Nodule
170 2802429634 Rhizobium anhuiense S10 Isolate Nodule
171 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
172 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
173 2802429637 Rhizobium anhuiense C15 Isolate Nodule
174 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
175 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
176 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
177 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
178 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
179 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
180 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
181 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
182 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
183 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
184 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
185 2838048938 Rhizobium pisi 27/80 Isolate Nodule
186 2838061910 Rhizobium phaseoli L15 Isolate Nodule
187 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
188 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
189 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
190 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
191 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
192 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
193 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
194 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
195 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
196 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
197 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
198 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
199 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
200 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
201 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
202 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
203 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
204 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
205 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
206 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
207 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
208 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
209 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
210 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
211 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
212 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
213 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
214 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
215 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
216 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
217 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
218 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
219 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
220 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
221 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
222 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
223 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
224 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
225 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
226 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
227 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
228 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
229 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
230 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
231 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
232 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
233 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
234 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
235 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
236 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
237 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
238 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
239 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
240 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
241 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
242 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
243 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
244 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
245 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
246 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
247 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
248 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
249 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
250 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
251 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
252 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
253 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
254 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
255 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
256 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
257 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
258 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
259 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
260 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
261 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
262 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
263 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
264 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
265 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
266 2844163670 Ensifer sp. 1H6 Isolate Unclassified
267 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
268 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
269 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
270 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
271 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
272 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
273 2854911287 Brucella lupini LUP21 Isolate Unclassified
274 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
275 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
276 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
277 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
278 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
279 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
280 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
281 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
282 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
283 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
284 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
285 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
286 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
287 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
288 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
289 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
290 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
291 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
292 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
293 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
294 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
295 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
296 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
297 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
298 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
299 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
300 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
301 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
302 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
303 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
304 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
305 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
306 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
307 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
308 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
309 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
310 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
311 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
312 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
313 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
314 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
315 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
316 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
317 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
318 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
319 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
320 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
321 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
322 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
323 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
324 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
325 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
326 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
327 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
328 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
329 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
330 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
331 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
332 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
333 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
334 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
335 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
336 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
337 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
338 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
339 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
340 2933599457 Rhizobium phaseoli M3 Isolate Nodule
341 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
342 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
343 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
344 2936381700 Rhizobium chutanense C16 Isolate Unclassified
345 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
346 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
347 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
348 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
349 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
350 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
351 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
352 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
353 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
354 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
355 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
356 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
357 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
358 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
359 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
360 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
361 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
362 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
363 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
364 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
365 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
366 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
367 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
368 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
369 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
370 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
371 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
372 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
373 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
374 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
375 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
376 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
377 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
378 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
379 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
380 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
381 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
382 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
383 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
384 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
385 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
386 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
387 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
388 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
389 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
390 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
391 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
392 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
393 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
394 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
395 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
396 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
397 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
398 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
399 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
400 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
401 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
402 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
403 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
404 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
405 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
406 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
407 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
408 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
409 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
410 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
411 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
412 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
413 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
414 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
415 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
416 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
417 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
418 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
419 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
420 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
421 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
422 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
423 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
424 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
425 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
426 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
427 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
428 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
429 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
430 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
431 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
432 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
433 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
434 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
435 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
436 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
437 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
438 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
439 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
440 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
441 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
442 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
443 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
444 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
445 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
446 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
447 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
448 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
449 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
450 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
451 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
452 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
453 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
454 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
455 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
456 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
457 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
458 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
459 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
460 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
461 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
462 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
463 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
464 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
465 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
466 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
467 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
468 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
469 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
470 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
471 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
472 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
473 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
474 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
475 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
476 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
477 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
478 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
479 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
480 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
481 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
482 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
483 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
484 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
485 2996893221 Rhizobium sp. R635 Isolate Nodule
486 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
487 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
488 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
489 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
490 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
491 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
492 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
493 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
494 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
495 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
496 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
497 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
498 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
499 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
500 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
501 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
502 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
503 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
504 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
505 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
506 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
507 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
508 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
509 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
510 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
511 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
512 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
513 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
514 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
515 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
516 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
517 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
518 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
519 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
520 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
521 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
522 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
523 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
524 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
525 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
526 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
527 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
528 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
529 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
530 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
531 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
532 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
533 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
534 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
535 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
536 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
537 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
538 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
539 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
540 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
541 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
542 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
543 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
544 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
545 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
546 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
547 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
548 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
549 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
550 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
551 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
552 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
553 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
554 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
555 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
558 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
560 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
561 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
562 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
564 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
565 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
566 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
567 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
568 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
570 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
571 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
572 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
573 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
575 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
576 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
578 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
588 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
589 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
590 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
591 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
593 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
594 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
595 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
596 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
597 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
598 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
599 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
600 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
601 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
602 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
603 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
604 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
605 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
606 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
607 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
608 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
609 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
610 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
611 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
612 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
613 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
614 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
615 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
616 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
617 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
618 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
619 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
620 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
621 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
622 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
623 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
624 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
625 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
626 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
627 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
628 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
629 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
630 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
631 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
632 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
633 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
634 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
635 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
636 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
637 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
638 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
639 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
640 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
641 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
642 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
643 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
644 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
645 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
646 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
647 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
648 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
649 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
650 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
651 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
652 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
653 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
654 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
655 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
656 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
657 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
658 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
659 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
660 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
661 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
662 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
663 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
664 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
665 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
666 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
667 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
668 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
669 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
670 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
671 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
672 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
673 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
674 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
675 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
676 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
677 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
678 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
679 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
680 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
681 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
683 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
684 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
685 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
689 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
691 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
692 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
693 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
694 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
695 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
696 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
697 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
698 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
699 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
700 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
701 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
702 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
703 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
704 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
705 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
706 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
707 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
708 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
709 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
710 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
711 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
712 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
713 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
714 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
715 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
716 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
717 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
718 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
719 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
720 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
721 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
722 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
723 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
724 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
725 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
726 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
727 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
733 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
734 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
735 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
736 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
737 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
738 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
739 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
740 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
741 8005275841 Rhizobium sp. N4311 Isolate Nodule
742 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
743 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
744 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
745 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
746 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
747 8005382845 Rhizobium sp. R634 Isolate Nodule
748 8005395548 Rhizobium sp. R339 Isolate Nodule
749 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
750 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
751 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
752 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
753 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
754 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
755 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
756 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
757 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
758 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
759 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
760 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
761 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
762 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
763 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
764 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
765 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
766 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
767 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
768 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
769 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
770 8024501048 Rhizobium sp. H4 Isolate Nodule
771 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
772 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
773 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
774 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
775 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
776 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
777 8056382006 Rhizobium croatiense 13T Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.88
Metatranscriptomes 1.23
Isolates 54.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 15.62
Nodule 41.42
Rhizoplane 2.06
Rhizosphere 21.27
Stem 0
Stem Tuber 0
Unclassified 19.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C9452 2010549000 Bacteria 1300
2 JGI24740J21852_10000240 3300001979 Bacteria 23152
3 JGI25155J39150_1000058 3300002704 Bacteria 72188
4 JGI25156J39149_1000080 3300002705 Bacteria 72430
5 JGI25162J39368_1000798 3300002737 Bacteria 21041
6 JGI25162J39368_1000942 3300002737 Bacteria 18688
7 JGI25162J39368_1002903 3300002737 Bacteria 5848
8 JGI25162J39368_1003447 3300002737 Bacteria 4568
9 JGI25154J39366_1000224 3300002738 Bacteria 38440
10 JGI25157J39369_1000101 3300002741 Bacteria 72430
11 JGI25152J39213_1006003 3300002773 Bacteria 3405
12 JGI25152J39213_1027029 3300002773 Bacteria 928
13 JGI25152J39213_1027068 3300002773 Bacteria 927
14 JGI25150J39212_1011557 3300002774 Bacteria 1594
15 JGI25159J45721_1000006 3300002987 Bacteria 188201
16 JGI25151J46595_10010040 3300003187 Bacteria 4435
17 JGI25151J46595_10037454 3300003187 Bacteria 1819
18 JGI25151J46595_10045366 3300003187 Bacteria 1552
19 JGI25165J46597_1000747 3300003214 Bacteria 25073
20 JGI25165J46597_1001007 3300003214 Bacteria 18684
21 JGI25165J46597_1008197 3300003214 Bacteria 1659
22 JGI25153J46596_10004125 3300003215 Bacteria 7905
23 JGI25153J46596_10068665 3300003215 Bacteria 928
24 JGI25153J46596_10068750 3300003215 Bacteria 927
25 rootH1_10058669 3300003316 Bacteria 2282
26 rootH2_10006547 3300003320 Bacteria 2155
27 rootL2_10001427 3300003322 Bacteria 10865
28 rootL2_10141239 3300003322 Bacteria 2047
29 rootH1_10087504 3300003323 Bacteria 1107
30 rootH1_10140377 3300003323 Bacteria 2152
31 JGI25160J50197_1000019 3300003354 Bacteria 233980
32 JGI25160J50197_1002563 3300003354 Bacteria 8406
33 JGI25161J50226_1000157 3300003374 Bacteria 47443
34 JGI25161J50226_1000346 3300003374 Bacteria 24757
35 Ga0055539_1006528 3300003752 Bacteria 1490
36 Ga0055526_1006233 3300003771 Bacteria 6540
37 Ga0055526_1008270 3300003771 Bacteria 5221
38 Ga0055526_1020769 3300003771 Bacteria 2316
39 Ga0055524_1001008 3300003775 Bacteria 17483
40 Ga0055524_1001365 3300003775 Bacteria 14165
41 Ga0055524_1024519 3300003775 Bacteria 1911
42 Ga0055524_1032341 3300003775 Bacteria 1485
43 Ga0055536_1000645 3300003781 Bacteria 23637
44 Ga0055528_1000851 3300003790 Bacteria 20725
45 Ga0055530_10004713 3300003791 Bacteria 6900
46 Ga0055530_10065194 3300003791 Bacteria 800
47 Ga0055540_1001322 3300003792 Bacteria 14966
48 Ga0055540_1001521 3300003792 Bacteria 13669
49 Ga0055540_1012369 3300003792 Bacteria 2683
50 Ga0055531_10001888 3300003794 Bacteria 14671
51 Ga0055531_10002873 3300003794 Bacteria 11229
52 Ga0055531_10067209 3300003794 Bacteria 843
53 Ga0055543_1000032 3300004625 Bacteria 130218
54 Ga0055543_1000145 3300004625 Bacteria 58910
55 Ga0058859_11670122 3300004798 Bacteria 1326
56 Ga0065165_1000180 3300005262 Bacteria 111768
57 Ga0065165_1003840 3300005262 Bacteria 10003
58 Ga0070670_100000603 3300005331 Bacteria 28216
59 Ga0070682_100207910 3300005337 Bacteria 1385
60 Ga0070669_100597990 3300005353 Bacteria 924
61 Ga0070671_100130749 3300005355 Bacteria 2114
62 Ga0070665_100284105 3300005548 Bacteria 1657
63 Ga0068854_100043013 3300005578 Bacteria 3200
64 Ga0068856_100033811 3300005614 Bacteria 5007
65 Ga0068856_100946695 3300005614 Bacteria 880
66 Ga0068852_100041122 3300005616 Bacteria 3905
67 Ga0081455_10210237 3300005937 Bacteria 1450
68 Ga0075365_10027350 3300006038 Bacteria 3629
69 Ga0075365_10505039 3300006038 Bacteria 855
70 Ga0075364_10000170 3300006051 Bacteria 29008
71 Ga0075364_10054934 3300006051 Bacteria 2605
72 Ga0075364_11005233 3300006051 Bacteria 567
73 Ga0075369_10018019 3300006186 Bacteria 2871
74 Ga0075366_10224069 3300006195 Bacteria 1146
75 Ga0075370_10011896 3300006353 Bacteria 4584
76 Ga0075370_10319958 3300006353 Bacteria 924
77 Ga0075370_10815880 3300006353 Bacteria 569
78 Ga0075434_100106989 3300006871 Bacteria 2807
79 Ga0079104_1011892 3300006946 Bacteria 2768
80 Ga0105240_10000005 3300009093 Bacteria 702630
81 Ga0105237_10001344 3300009545 Bacteria 32586
82 Ga0105239_10003591 3300010375 Bacteria 18945
83 Ga0105239_10329586 3300010375 Bacteria 1722
84 Ga0157319_1002443 3300012497 Bacteria 1069
85 Ga0157371_10012507 3300013102 Bacteria 6486
86 Ga0157370_10000948 3300013104 Bacteria 36781
87 Ga0157369_10096384 3300013105 Bacteria 3156
88 Ga0157369_10158503 3300013105 Bacteria 2390
89 Ga0171463_1011 3300013249 Bacteria 230603
90 Ga0157378_11306727 3300013297 Bacteria 767
91 Ga0163162_10316912 3300013306 Bacteria 1692
92 Ga0182008_10078580 3300014497 Bacteria 1623
93 Ga0182007_10002187 3300015262 Bacteria 9922
94 Ga0182005_1003334 3300015265 Bacteria 5475
95 Ga0183363_1430 3300015690 Bacteria 3144
96 Ga0163161_11422499 3300017792 Bacteria 606
97 Ga0214544_1000265 3300021320 Bacteria 87060
98 Ga0214542_1000015 3300021321 Bacteria 227912
99 Ga0214542_1020378 3300021321 Bacteria 4884
100 Ga0214543_1000011 3300021327 Bacteria 344093
101 Ga0214543_1000032 3300021327 Bacteria 200766
102 Ga0209435_100045 3300025206 Bacteria 96483
103 Ga0209760_107039 3300025207 Bacteria 871
104 Ga0209436_100001 3300025208 Bacteria 304543
105 Ga0209436_100333 3300025208 Bacteria 21394
106 Ga0209672_102875 3300025228 Bacteria 3868
107 Ga0209672_117561 3300025228 Bacteria 753
108 Ga0209563_103879 3300025230 Bacteria 2978
109 Ga0207427_106592 3300025231 Bacteria 1452
110 Ga0209437_100047 3300025233 Bacteria 405163
111 Ga0209437_100122 3300025233 Bacteria 201364
112 Ga0207425_1002752 3300025245 Bacteria 5980
113 Ga0207425_1045841 3300025245 Bacteria 816
114 Ga0207425_1059235 3300025245 Bacteria 679
115 Ga0209646_1000154 3300025246 Bacteria 96483
116 Ga0209646_1003813 3300025246 Bacteria 2877
117 Ga0209026_1000177 3300025250 Bacteria 96629
118 Ga0209677_100440 3300025253 Bacteria 24115
119 Ga0209759_1000274 3300025256 Bacteria 72593
120 Ga0209759_1041180 3300025256 Bacteria 794
121 Ga0209129_1002592 3300025258 Bacteria 8661
122 Ga0209129_1003488 3300025258 Bacteria 6797
123 Ga0209129_1003511 3300025258 Bacteria 6776
124 Ga0209129_1005991 3300025258 Bacteria 4082
125 Ga0209233_1000048 3300025261 Bacteria 453669
126 Ga0209233_1000170 3300025261 Bacteria 147527
127 Ga0209233_1001493 3300025261 Bacteria 9197
128 Ga0209565_1070826 3300025263 Bacteria 588
129 Ga0209673_1000013 3300025273 Bacteria 571633
130 Ga0209673_1001787 3300025273 Bacteria 17792
131 Ga0209673_1022246 3300025273 Bacteria 2192
132 Ga0209130_1000004 3300025284 Bacteria 633436
133 Ga0209130_1000007 3300025284 Bacteria 591584
134 Ga0209130_1034287 3300025284 Bacteria 1023
135 Ga0209676_1000399 3300025292 Bacteria 79312
136 Ga0209676_1013109 3300025292 Bacteria 3206
137 Ga0209025_1000787 3300025294 Bacteria 52060
138 Ga0209025_1000870 3300025294 Bacteria 47707
139 Ga0209025_1007264 3300025294 Bacteria 8325
140 Ga0209025_1027407 3300025294 Bacteria 2826
141 Ga0209025_1029520 3300025294 Bacteria 2650
142 Ga0209564_1000140 3300025295 Bacteria 179856
143 Ga0209564_1000566 3300025295 Bacteria 58647
144 Ga0209564_1000906 3300025295 Bacteria 38845
145 Ga0209758_1000977 3300025297 Bacteria 38489
146 Ga0209758_1001265 3300025297 Bacteria 31307
147 Ga0209758_1001420 3300025297 Bacteria 28346
148 Ga0209758_1002711 3300025297 Bacteria 17455
149 Ga0209758_1008178 3300025297 Bacteria 6861
150 Ga0209758_1055124 3300025297 Bacteria 1353
151 Ga0209050_1000906 3300025298 Bacteria 39206
152 Ga0209050_1001733 3300025298 Bacteria 21711
153 Ga0209256_1000606 3300025299 Bacteria 49790
154 Ga0209256_1000947 3300025299 Bacteria 35197
155 Ga0209256_1001532 3300025299 Bacteria 23262
156 Ga0209256_1002736 3300025299 Bacteria 13634
157 Ga0209256_1010200 3300025299 Bacteria 3976
158 Ga0207426_1000003 3300025302 Bacteria 1063212
159 Ga0207426_1000111 3300025302 Bacteria 234032
160 Ga0209051_1001061 3300025303 Bacteria 25637
161 Ga0209051_1002566 3300025303 Bacteria 12821
162 Ga0209051_1003671 3300025303 Bacteria 9931
163 Ga0209051_1045274 3300025303 Bacteria 1524
164 Ga0209257_1001014 3300025304 Bacteria 37770
165 Ga0209257_1001423 3300025304 Bacteria 28423
166 Ga0209257_1057234 3300025304 Bacteria 1073
167 Ga0207695_10000011 3300025913 Bacteria 910221
168 Ga0207671_10000314 3300025914 Bacteria 71414
169 Ga0207649_10300260 3300025920 Bacteria 1174
170 Ga0207681_10513840 3300025923 Bacteria 982
171 Ga0207650_10001911 3300025925 Bacteria 14671
172 Ga0207644_10420203 3300025931 Bacteria 1095
173 Ga0207712_10139481 3300025961 Bacteria 1859
174 Ga0207640_10036793 3300025981 Bacteria 3076
175 Ga0207702_10016488 3300026078 Bacteria 6114
176 Ga0207702_10355219 3300026078 Bacteria 1403
177 Ga0207698_10795544 3300026142 Bacteria 947
178 Ga0209281_1000334 3300027111 Bacteria 81109
179 Ga0209281_1000361 3300027111 Bacteria 74287
180 Ga0209371_1011930 3300027312 Bacteria 2548
181 Ga0209282_1000073 3300027666 Bacteria 81125
182 Ga0209282_1000095 3300027666 Bacteria 60099
183 Ga0268266_10202752 3300028379 Bacteria 1816
184 Ga0307515_10001215 3300028794 Bacteria 58879
185 Ga0307515_10001393 3300028794 Bacteria 54715
186 Ga0307515_10038442 3300028794 Bacteria 7655
187 Ga0307515_10258924 3300028794 Bacteria 1479
188 Ga0268256_1012987 3300030500 Bacteria 2548
189 Ga0307513_10046052 3300031456 Bacteria 4761
190 Ga0307405_11246188 3300031731 Bacteria 645
191 Ga0307412_10563049 3300031911 Bacteria 959
192 Ga0307416_102118423 3300032002 Bacteria 664
193 Ga0307414_12071045 3300032004 Bacteria 531
194 Ga0315913_1000129 3300033430 Bacteria 48181
195 Ga0373932_0422585 3300035112 Bacteria 519
196 Ga0316574_0981343 3300035398 Bacteria 509
197 Ga0316582_0250613 3300036647 Bacteria 1213
198 Ga0395905_0000827 3300037471 Bacteria 40424
199 Ga0395905_0006518 3300037471 Bacteria 11738
200 Ga0395905_0609660 3300037471 Bacteria 993
201 Ga0395905_1124358 3300037471 Bacteria 689
202 Ga0395901_0447926 3300038443 Bacteria 1321
203 Ga0439436_0112232 3300041404 Bacteria 761
204 Ga0439438_070849 3300041405 Bacteria 863
205 Ga0439461_0049033 3300041410 Bacteria 932
206 Ga0439466_0114642 3300041411 Bacteria 834
207 Ga0439465_0044118 3300041413 Bacteria 1448
208 Ga0439465_0094279 3300041413 Bacteria 1027
209 Ga0451793_1771588 3300041452 Bacteria 2505
210 Ga0451833_1006218 3300041491 Bacteria 517
211 Ga0451835_0689076 3300041492 Bacteria 2775
212 Ga0451840_12231 3300041497 Bacteria 1258
213 Ga0451841_0183806 3300041498 Bacteria 1424
214 Ga0451846_02444 3300041502 Bacteria 1556
215 Ga0451847_0483869 3300041503 Bacteria 603
216 Ga0451847_0486657 3300041503 Bacteria 2072
217 Ga0451848_08423 3300041504 Bacteria 784
218 Ga0451849_0137763 3300041505 Bacteria 1088
219 Ga0451850_51725 3300041506 Bacteria 1527
220 Ga0451851_0203844 3300041507 Bacteria 774
221 Ga0451854_17026 3300041510 Bacteria 1526
222 Ga0451855_0606958 3300041511 Bacteria 985
223 Ga0451853_3234756 3300041512 Bacteria 2743
224 Ga0439449_0005864 3300042007 Bacteria 4695
225 Ga0439457_017484 3300042014 Bacteria 1593
226 Ga0466965_0188862 3300044683 Bacteria 1089
227 Ga0466971_0319425 3300044719 Bacteria 748
228 Ga0466968_0013912 3300044735 Bacteria 3172
229 Ga0466970_0001159 3300044765 Bacteria 12775
230 Ga0466957_0323890 3300044842 Bacteria 1040
231 Ga0466959_0155850 3300045049 Bacteria 1607
232 Ga0466958_0306419 3300045836 Bacteria 1020
233 Ga0466967_0389383 3300045976 Bacteria 1355
234 Ga0495638_0000597 3300046460 Bacteria 40647
235 Ga0495638_0065247 3300046460 Bacteria 2241
236 Ga0495650_0082159 3300046471 Bacteria 1240
237 Ga0495585_0114385 3300046492 Bacteria 1432
238 Ga0495596_0340851 3300046500 Bacteria 583
239 Ga0495607_0014939 3300046501 Bacteria 5048
240 Ga0495583_0047246 3300046506 Bacteria 1981
241 Ga0495606_0005935 3300046507 Bacteria 11467
242 Ga0495606_0031156 3300046507 Bacteria 3712
243 Ga0495606_0065151 3300046507 Bacteria 2316
244 Ga0495606_0377080 3300046507 Bacteria 745
245 Ga0495610_0031394 3300046512 Bacteria 2772
246 Ga0495610_0048705 3300046512 Bacteria 2079
247 Ga0495616_0023559 3300046513 Bacteria 3310
248 Ga0495616_0058559 3300046513 Bacteria 1897
249 Ga0495620_0012510 3300046515 Bacteria 4378
250 Ga0495631_0035705 3300046518 Bacteria 2222
251 Ga0495632_0040920 3300046519 Bacteria 2331
252 Ga0495632_0211342 3300046519 Bacteria 880
253 Ga0495643_0036606 3300046522 Bacteria 2695
254 Ga0495643_0083423 3300046522 Bacteria 1659
255 Ga0495643_0142369 3300046522 Bacteria 1194
256 Ga0495643_0316035 3300046522 Bacteria 707
257 Ga0495654_0000641 3300046530 Bacteria 27579
258 Ga0495654_0130829 3300046530 Bacteria 1127
259 Ga0495597_0010628 3300046542 Bacteria 4490
260 Ga0495597_0046866 3300046542 Bacteria 1915
261 Ga0495668_0184666 3300046616 Bacteria 1142
262 Ga0495625_0038160 3300046660 Bacteria 3518
263 Ga0495625_0132496 3300046660 Bacteria 1687
264 Ga0495625_0284198 3300046660 Bacteria 1063
265 Ga0495625_0285028 3300046660 Bacteria 1062
266 Ga0495625_0368167 3300046660 Bacteria 904
267 Ga0495670_0118813 3300046691 Bacteria 1372
268 Ga0495671_0060942 3300046692 Bacteria 1862
269 Ga0495649_0060150 3300046694 Bacteria 2044
270 Ga0495636_0141114 3300047318 Bacteria 1076
271 Ga0495636_0330062 3300047318 Bacteria 717
272 Ga0495672_0020846 3300047320 Bacteria 4287
273 Ga0495687_203038 3300047443 Bacteria 628
274 Ga0495679_072035 3300047446 Bacteria 994
275 Ga0495681_0079294 3300047470 Bacteria 1469
276 Ga0495686_0003870 3300047472 Bacteria 12635
277 Ga0495686_0015546 3300047472 Bacteria 5190
278 Ga0495686_0018766 3300047472 Bacteria 4633
279 Ga0495686_0056345 3300047472 Bacteria 2456
280 Ga0495686_0099843 3300047472 Bacteria 1752
281 Ga0495686_0115104 3300047472 Bacteria 1609
282 Ga0495615_0014893 3300048090 Bacteria 1652
283 Ga0495615_0113248 3300048090 Bacteria 778
284 Ga0496100_0607993 3300048903 Bacteria 849
285 Ga0496102_0053430 3300048905 Bacteria 3682
286 Ga0496103_0011652 3300048906 Bacteria 5215
287 Ga0496106_0000801 3300048909 Bacteria 22763
288 Ga0496106_0381654 3300048909 Bacteria 1132
289 Ga0496106_0756981 3300048909 Bacteria 772
290 Ga0496110_0061950 3300048913 Bacteria 3303
291 Ga0496111_0018396 3300048914 Bacteria 4840
292 Ga0496113_0136267 3300048916 Bacteria 1929
293 Ga0496116_0050273 3300048919 Bacteria 2778
294 Ga0496116_0110497 3300048919 Bacteria 1617
295 Ga0496116_0260180 3300048919 Bacteria 856
296 Ga0496117_0000641 3300048920 Bacteria 56335
297 Ga0496117_0002492 3300048920 Bacteria 23104
298 Ga0496117_0032556 3300048920 Bacteria 3959
299 Ga0496117_0044740 3300048920 Bacteria 3204
300 Ga0496117_0119160 3300048920 Bacteria 1626
301 Ga0496118_0002255 3300048921 Bacteria 26416
302 Ga0496118_0002788 3300048921 Bacteria 22874
303 Ga0496118_0021378 3300048921 Bacteria 5697
304 Ga0496118_0056313 3300048921 Bacteria 2957
305 Ga0496118_0165800 3300048921 Bacteria 1358
306 Ga0496118_0283407 3300048921 Bacteria 921
307 Ga0496119_0032601 3300048922 Bacteria 3469
308 Ga0496119_0033903 3300048922 Bacteria 3374
309 Ga0496119_0058911 3300048922 Bacteria 2311
310 Ga0496120_0011601 3300048923 Bacteria 6050
311 Ga0496120_0030634 3300048923 Bacteria 3266
312 Ga0496120_0045117 3300048923 Bacteria 2556
313 Ga0496121_0000003 3300048924 Bacteria 1191431
314 Ga0496121_0000751 3300048924 Bacteria 59594
315 Ga0496121_0003358 3300048924 Bacteria 22960
316 Ga0496121_0015611 3300048924 Bacteria 7931
317 Ga0496121_0031398 3300048924 Bacteria 4853
318 Ga0496121_0091314 3300048924 Bacteria 2378
319 Ga0496121_0189522 3300048924 Bacteria 1476
320 Ga0496122_0000025 3300048925 Bacteria 362915
321 Ga0496122_0000399 3300048925 Bacteria 92476
322 Ga0496122_0003165 3300048925 Bacteria 21967
323 Ga0496122_0007138 3300048925 Bacteria 12531
324 Ga0496122_0008228 3300048925 Bacteria 11322
325 Ga0496122_0016386 3300048925 Bacteria 7015
326 Ga0496122_0074908 3300048925 Bacteria 2391
327 Ga0496122_0122567 3300048925 Bacteria 1672
328 Ga0496123_0000054 3300048926 Bacteria 234046
329 Ga0496123_0002112 3300048926 Bacteria 25505
330 Ga0496123_0010688 3300048926 Bacteria 8073
331 Ga0496123_0018189 3300048926 Bacteria 5605
332 Ga0496123_0049479 3300048926 Bacteria 2817
333 Ga0496123_0065931 3300048926 Bacteria 2297
334 Ga0496123_0129005 3300048926 Bacteria 1405
335 Ga0496123_0359006 3300048926 Bacteria 675
336 Ga0496124_0002648 3300048927 Bacteria 23011
337 Ga0496124_0008646 3300048927 Bacteria 10606
338 Ga0496124_0012897 3300048927 Bacteria 8204
339 Ga0496124_0036616 3300048927 Bacteria 4278
340 Ga0496124_0084961 3300048927 Bacteria 2594
341 Ga0496124_0088991 3300048927 Bacteria 2522
342 Ga0496124_0214638 3300048927 Bacteria 1453
343 Ga0496124_0428850 3300048927 Bacteria 908
344 Ga0496124_0608190 3300048927 Bacteria 709
345 Ga0496124_0637151 3300048927 Bacteria 687
346 Ga0496124_0759022 3300048927 Bacteria 606
347 Ga0496125_0000141 3300048928 Bacteria 158991
348 Ga0496125_0001650 3300048928 Bacteria 31436
349 Ga0496125_0021828 3300048928 Bacteria 5957
350 Ga0496125_0051706 3300048928 Bacteria 3386
351 Ga0496125_0338138 3300048928 Bacteria 905
352 Ga0496125_0342169 3300048928 Bacteria 897
353 Ga0496125_0438316 3300048928 Bacteria 752
354 Ga0496126_0001055 3300048929 Bacteria 46595
355 Ga0496126_0020807 3300048929 Bacteria 6421
356 Ga0496126_0068999 3300048929 Bacteria 3155
357 Ga0495678_029785 3300049459 Bacteria 2290
358 Ga0501031_0043880 3300049568 Bacteria 2917
359 Ga0501032_0040703 3300049569 Bacteria 3158
360 Ga0501032_0085344 3300049569 Bacteria 2099
361 Ga0501032_0252683 3300049569 Bacteria 1144
362 Ga0501033_0000118 3300049570 Bacteria 75690
363 Ga0501033_0028448 3300049570 Bacteria 4198
364 Ga0501033_0376166 3300049570 Bacteria 993
365 Ga0501034_0102139 3300049571 Bacteria 2860
366 Ga0501034_0167499 3300049571 Bacteria 2165
367 Ga0501036_0062044 3300049572 Bacteria 3166
368 Ga0501037_0215004 3300049573 Bacteria 1354
369 Ga0501038_0025657 3300049574 Bacteria 5250
370 Ga0501038_0375140 3300049574 Bacteria 1104
371 Ga0501039_0495514 3300049575 Bacteria 959
372 Ga0501043_0745639 3300049579 Bacteria 712
373 Ga0501043_0789076 3300049579 Bacteria 688
374 Ga0501047_0102950 3300049581 Bacteria 2735
375 Ga0501048_0508220 3300049582 Bacteria 864
376 Ga0501067_0197042 3300049583 Bacteria 1122
377 Ga0501068_0260229 3300049584 Bacteria 1107
378 Ga0501073_0036549 3300049589 Bacteria 3490
379 Ga0501080_0132818 3300049742 Bacteria 2304
380 Ga0501083_0052901 3300049744 Bacteria 2726
381 Ga0501083_0330634 3300049744 Bacteria 991
382 Ga0501280_002116 3300049776 Bacteria 3421
383 Ga0501280_038125 3300049776 Bacteria 771
384 Ga0501035_0002363 3300049822 Bacteria 18561
385 Ga0501035_0525970 3300049822 Bacteria 971
386 Ga0501035_0552929 3300049822 Bacteria 942
387 Ga0501035_0848203 3300049822 Bacteria 727
388 Ga0501035_1302068 3300049822 Bacteria 560
389 Ga0501044_0106883 3300049823 Bacteria 2810
390 Ga0501044_0142973 3300049823 Bacteria 2380
391 Ga0501045_0113532 3300049824 Bacteria 2009
392 nmdc:mga00v17_291_c1 3300050491 Bacteria 29216
393 nmdc:mga00v17_42712_c1 3300050491 Bacteria 2728
394 nmdc:mga0yw44_516265_c1 3300050492 Bacteria 811
395 nmdc:mga0k408_215936_c1 3300050493 Bacteria 1145
396 nmdc:mga0k408_451596_c1 3300050493 Bacteria 763
397 nmdc:mga06z11_293392_c1 3300050494 Bacteria 965
398 nmdc:mga0n895_430661_c1 3300050512 Bacteria 1333
399 nmdc:mga0rr50_583495_c1 3300050513 Bacteria 952
400 nmdc:mga0a205_596688_c1 3300050515 Bacteria 958
401 nmdc:mga0sz30_3070_c1 3300050516 Bacteria 4255
402 Ga0500578_0044842 3300053086 Bacteria 2837
403 Ga0500644_0005315 3300053088 Bacteria 3248
404 Ga0500646_0233981 3300053090 Bacteria 641
405 Ga0500654_103001 3300053099 Bacteria 1208
406 Ga0500556_0237166 3300053104 Bacteria 719
407 Ga0500572_116256 3300053111 Bacteria 864
408 Ga0500618_000125 3300053125 Bacteria 63168
409 Ga0500618_000289 3300053125 Bacteria 38453
410 Ga0500618_009145 3300053125 Bacteria 2720
411 Ga0500618_015691 3300053125 Bacteria 1909
412 Ga0500628_046983 3300053129 Bacteria 1010
413 Ga0500655_007893 3300053133 Bacteria 1917
414 Ga0500658_0000162 3300053134 Bacteria 32065
415 Ga0500658_0213842 3300053134 Bacteria 883
416 Ga0500559_0007060 3300053136 Bacteria 5009
417 Ga0500568_0000411 3300053139 Bacteria 32773
418 Ga0500568_0001577 3300053139 Bacteria 14417
419 Ga0500568_0057248 3300053139 Bacteria 1517
420 Ga0500573_0008408 3300053140 Bacteria 5684
421 Ga0500573_0013003 3300053140 Bacteria 4682
422 Ga0500577_0108487 3300053142 Bacteria 1143
423 Ga0500604_0003667 3300053151 Bacteria 4125
424 Ga0500604_0129644 3300053151 Bacteria 847
425 Ga0500616_0000661 3300053153 Bacteria 41050
426 Ga0500616_0001852 3300053153 Bacteria 19135
427 Ga0500616_0012405 3300053153 Bacteria 4987
428 Ga0500622_0000428 3300053156 Bacteria 39928
429 Ga0500622_0000956 3300053156 Bacteria 24552
430 Ga0500622_0068032 3300053156 Bacteria 1805
431 Ga0500627_0292184 3300053158 Bacteria 713
432 Ga0500645_066116 3300053730 Bacteria 1041
433 Ga0587073_0003572 3300059492 Bacteria 2146
434 Ga0587088_000751 3300059508 Bacteria 2957
435 Ga0587088_019463 3300059508 Bacteria 1116
436 Ga0587075_000934 3300059644 Bacteria 2634
437 Ga0587078_061485 3300059646 Bacteria 570
438 Ga0587079_037095 3300059647 Bacteria 967
439 Ga0501082_0044180 3300060353 Bacteria 3844

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027666 Ga0209282_1000095 Ga0209282_100009524 128
2 3300003322 rootL2_10141239 rootL2_101412392 135
3 3300005937 Ga0081455_10210237 Ga0081455_102102372 135
4 3300006871 Ga0075434_100106989 Ga0075434_1001069893 135
5 3300050512 nmdc:mga0n895_430661_c1 nmdc:mga0n895_430661_c1_27_452 135
6 3300050513 nmdc:mga0rr50_583495_c1 nmdc:mga0rr50_583495_c1_221_646 135
7 3300050515 nmdc:mga0a205_596688_c1 nmdc:mga0a205_596688_c1_419_844 135
8 3300002773 JGI25152J39213_1006003 JGI25152J39213_10060032 136
9 3300003215 JGI25153J46596_10004125 JGI25153J46596_1000412510 136
10 3300003316 rootH1_10058669 rootH1_100586693 136
11 3300003354 JGI25160J50197_1002563 JGI25160J50197_10025639 136
12 3300003374 JGI25161J50226_1000346 JGI25161J50226_10003467 136
13 3300003771 Ga0055526_1020769 Ga0055526_10207693 136
14 3300003792 Ga0055540_1001521 Ga0055540_100152112 136
15 3300003794 Ga0055531_10067209 Ga0055531_100672092 136
16 3300004625 Ga0055543_1000032 Ga0055543_100003234 136
17 3300005262 Ga0065165_1003840 Ga0065165_10038404 136
18 3300005337 Ga0070682_100207910 Ga0070682_1002079102 136
19 3300006353 Ga0075370_10815880 Ga0075370_108158802 136
20 3300025208 Ga0209436_100001 Ga0209436_10000155 136
21 3300025258 Ga0209129_1002592 Ga0209129_10025922 136
22 3300025273 Ga0209673_1001787 Ga0209673_10017873 136
23 3300025284 Ga0209130_1000004 Ga0209130_100000457 136
24 3300025295 Ga0209564_1000566 Ga0209564_100056644 136
25 3300025297 Ga0209758_1008178 Ga0209758_10081782 136
26 3300025299 Ga0209256_1002736 Ga0209256_10027367 136
27 3300025302 Ga0207426_1000003 Ga0207426_1000003671 136
28 3300025303 Ga0209051_1003671 Ga0209051_10036714 136
29 3300025304 Ga0209257_1057234 Ga0209257_10572342 136
30 3300025920 Ga0207649_10300260 Ga0207649_103002602 136
31 3300028794 Ga0307515_10258924 Ga0307515_102589241 136
32 3300048927 Ga0496124_0214638 Ga0496124_0214638_672_1124 136
33 3300059508 Ga0587088_019463 Ga0587088_019463_455_907 136
34 3300059647 Ga0587079_037095 Ga0587079_037095_503_955 136
35 iso_pu_bacteria 2765235802 2765466060 136
36 iso_pu_bacteria 2904578770 2904583334 136
37 iso_pu_bacteria 2919119836 2919121046 136
38 3300006038 Ga0075365_10027350 Ga0075365_100273505 137
39 3300006051 Ga0075364_11005233 Ga0075364_110052331 137
40 3300025294 Ga0209025_1027407 Ga0209025_10274073 137
41 3300050494 nmdc:mga06z11_293392_c1 nmdc:mga06z11_293392_c1_471_887 137
42 iso_pu_bacteria 2758568016 2758641674 137
43 iso_pu_bacteria 2775506902 2776271677 137
44 iso_pu_bacteria 2775506904 2776279811 137
45 iso_pu_bacteria 2854911287 2854911960 137
46 3300049571 Ga0501034_0102139 Ga0501034_0102139_1285_1737 138
47 3300049572 Ga0501036_0062044 Ga0501036_0062044_522_974 138
48 3300049573 Ga0501037_0215004 Ga0501037_0215004_707_1159 138
49 3300049574 Ga0501038_0375140 Ga0501038_0375140_114_566 138
50 3300049575 Ga0501039_0495514 Ga0501039_0495514_114_566 138
51 3300049579 Ga0501043_0745639 Ga0501043_0745639_72_524 138
52 3300049582 Ga0501048_0508220 Ga0501048_0508220_244_696 138
53 3300049744 Ga0501083_0330634 Ga0501083_0330634_301_753 138
54 3300049822 Ga0501035_1302068 Ga0501035_1302068_12_464 138
55 3300049823 Ga0501044_0106883 Ga0501044_0106883_941_1393 138
56 3300002773 JGI25152J39213_1027029 JGI25152J39213_10270291 139
57 3300002773 JGI25152J39213_1027068 JGI25152J39213_10270681 139
58 3300002774 JGI25150J39212_1011557 JGI25150J39212_10115572 139
59 3300003187 JGI25151J46595_10045366 JGI25151J46595_100453662 139
60 3300003215 JGI25153J46596_10068665 JGI25153J46596_100686651 139
61 3300003215 JGI25153J46596_10068750 JGI25153J46596_100687501 139
62 3300003775 Ga0055524_1001365 Ga0055524_100136512 139
63 3300025245 Ga0207425_1002752 Ga0207425_10027522 139
64 3300025258 Ga0209129_1003488 Ga0209129_10034886 139
65 3300025258 Ga0209129_1003511 Ga0209129_10035116 139
66 3300025294 Ga0209025_1007264 Ga0209025_100726411 139
67 3300025294 Ga0209025_1029520 Ga0209025_10295203 139
68 3300025297 Ga0209758_1000977 Ga0209758_100097712 139
69 3300025297 Ga0209758_1001420 Ga0209758_100142014 139
70 3300041410 Ga0439461_0049033 Ga0439461_0049033_430_882 139
71 3300041413 Ga0439465_0094279 Ga0439465_0094279_374_826 139
72 3300041491 Ga0451833_1006218 Ga0451833_1006218_41_463 139
73 3300046660 Ga0495625_0285028 Ga0495625_0285028_62_484 139
74 3300048090 Ga0495615_0113248 Ga0495615_0113248_175_627 139
75 3300048926 Ga0496123_0359006 Ga0496123_0359006_65_517 139
76 3300049569 Ga0501032_0085344 Ga0501032_0085344_1122_1574 139
77 3300049570 Ga0501033_0376166 Ga0501033_0376166_525_977 139
78 3300049579 Ga0501043_0789076 Ga0501043_0789076_16_468 139
79 3300049581 Ga0501047_0102950 Ga0501047_0102950_642_1094 139
80 3300049583 Ga0501067_0197042 Ga0501067_0197042_329_781 139
81 3300049584 Ga0501068_0260229 Ga0501068_0260229_557_1009 139
82 3300049589 Ga0501073_0036549 Ga0501073_0036549_1011_1463 139
83 3300049744 Ga0501083_0052901 Ga0501083_0052901_1149_1601 139
84 3300050492 nmdc:mga0yw44_516265_c1 nmdc:mga0yw44_516265_c1_280_702 139
85 3300059492 Ga0587073_0003572 Ga0587073_0003572_82_531 139
86 3300059508 Ga0587088_000751 Ga0587088_000751_887_1336 139
87 3300059644 Ga0587075_000934 Ga0587075_000934_576_1025 139
88 3300060353 Ga0501082_0044180 Ga0501082_0044180_979_1431 139
89 iso_pu_bacteria 2840764183 2840770001 139
90 3300003320 rootH2_10006547 rootH2_100065472 141
91 3300003322 rootL2_10001427 rootL2_1000142712 141
92 3300003323 rootH1_10140377 rootH1_101403772 141
93 3300045976 Ga0466967_0389383 Ga0466967_0389383_440_889 141
94 3300025256 Ga0209759_1041180 Ga0209759_10411802 142
95 3300027312 Ga0209371_1011930 Ga0209371_10119302 142
96 3300030500 Ga0268256_1012987 Ga0268256_10129873 142
97 3300048925 Ga0496122_0007138 Ga0496122_0007138_897_1361 142
98 3300035112 Ga0373932_0422585 Ga0373932_0422585_11_442 143
99 3300048909 Ga0496106_0756981 Ga0496106_0756981_130_561 143
100 iso_pu_bacteria 2582581316 2585333739 143
101 iso_pu_bacteria 8005246636 8005250718 144
102 iso_pu_bacteria 2510461069 2510842691 145
103 iso_pu_bacteria 2510917022 2511134994 145
104 iso_pu_bacteria 2524023209 2524460534 145
105 iso_pu_bacteria 2582581307 2585270733 145
106 iso_pu_bacteria 2582581308 2585277081 145
107 iso_pu_bacteria 2582581315 2585323911 145
108 iso_pu_bacteria 2585427527 2585534181 145
109 iso_pu_bacteria 2585427530 2585551966 145
110 iso_pu_bacteria 2585427531 2585558456 145
111 iso_pu_bacteria 2585427608 2585897826 145
112 iso_pu_bacteria 2585427609 2585904574 145
113 iso_pu_bacteria 2585428125 2587980310 145
114 iso_pu_bacteria 2615840626 2616308457 145
115 iso_pu_bacteria 2615840698 2616556455 145
116 iso_pu_bacteria 2617270742 2617385101 145
117 iso_pu_bacteria 2643221653 2644300365 145
118 iso_pu_bacteria 2643221719 2644658589 145
119 iso_pu_bacteria 2667528174 2671116437 145
120 iso_pu_bacteria 2775507266 2778177798 145
121 iso_pu_bacteria 2818991272 2819242016 145
122 iso_pu_bacteria 2818991448 2819612868 145
123 iso_pu_bacteria 2818991453 2819638029 145
124 iso_pu_bacteria 2818991461 2819688612 145
125 iso_pu_bacteria 2838029111 2838030216 145
126 iso_pu_bacteria 2842298080 2842301714 145
127 iso_pu_bacteria 2842357229 2842357367 145
128 iso_pu_bacteria 2842475841 2842476499 145
129 iso_pu_bacteria 2842482326 2842488394 145
130 iso_pu_bacteria 2842502639 2842503744 145
131 iso_pu_bacteria 2842509118 2842510332 145
132 iso_pu_bacteria 2852387548 2852389771 145
133 iso_pu_bacteria 2855872281 2855873383 145
134 iso_pu_bacteria 2919408235 2919411811 145
135 iso_pu_bacteria 2989776772 2989778708 145
136 iso_pu_bacteria 3005416602 3005420224 145
137 iso_pu_bacteria 8005314921 8005317175 145
138 iso_pu_bacteria 8005484373 8005485025 145
139 iso_pu_bacteria 8005645114 8005648762 145
140 iso_pu_bacteria 8005658619 8005659269 145
141 iso_pu_bacteria 8005682033 8005683314 145
142 iso_pu_bacteria 8024486573 8024488735 145
143 iso_pu_bacteria 8046767195 8046769427 145
144 iso_pu_bacteria 8055431914 8055435063 145
145 iso_pu_bacteria 8057575449 8057578888 145
146 iso_pu_bacteria 2508501122 2509107915 146
147 iso_pu_bacteria 2509276019 2509375703 146
148 iso_pu_bacteria 2509276021 2509386809 146
149 iso_pu_bacteria 2509276033 2509442356 146
150 iso_pu_bacteria 2510065057 2510307010 146
151 iso_pu_bacteria 2510461076 2510894545 146
152 iso_pu_bacteria 2511231052 2511501327 146
153 iso_pu_bacteria 2512047086 2512532748 146
154 iso_pu_bacteria 2513237084 2513572225 146
155 iso_pu_bacteria 2513237085 2513579594 146
156 iso_pu_bacteria 2513237086 2513587081 146
157 iso_pu_bacteria 2513237091 2513617841 146
158 iso_pu_bacteria 2513237093 2513634366 146
159 iso_pu_bacteria 2513237103 2513708858 146
160 iso_pu_bacteria 2513237140 2513880726 146
161 iso_pu_bacteria 2513237143 2513906727 146
162 iso_pu_bacteria 2513237162 2514022802 146
163 iso_pu_bacteria 2515075009 2515112141 146
164 iso_pu_bacteria 2515154107 2515611533 146
165 iso_pu_bacteria 2515154113 2515635608 146
166 iso_pu_bacteria 2515154114 2515646192 146
167 iso_pu_bacteria 2515154116 2515657284 146
168 iso_pu_bacteria 2515154134 2515738711 146
169 iso_pu_bacteria 2516143018 2516209201 146
170 iso_pu_bacteria 2516653046 2516892606 146
171 iso_pu_bacteria 2516653085 2517076263 146
172 iso_pu_bacteria 2517287029 2517406653 146
173 iso_pu_bacteria 2519899620 2520379371 146
174 iso_pu_bacteria 2524023207 2524452834 146
175 iso_pu_bacteria 2529292951 2530645398 146
176 iso_pu_bacteria 2537561587 2537876560 146
177 iso_pu_bacteria 2551306084 2551682239 146
178 iso_pu_bacteria 2551306085 2551683770 146
179 iso_pu_bacteria 2551306086 2551695804 146
180 iso_pu_bacteria 2551306087 2551704803 146
181 iso_pu_bacteria 2551306089 2551709647 146
182 iso_pu_bacteria 2551306090 2551719589 146
183 iso_pu_bacteria 2551306091 2551728675 146
184 iso_pu_bacteria 2551306092 2551732135 146
185 iso_pu_bacteria 2551306093 2551744647 146
186 iso_pu_bacteria 2554235003 2554247824 146
187 iso_pu_bacteria 2558860100 2558863172 146
188 iso_pu_bacteria 2558860242 2559294954 146
189 iso_pu_bacteria 2582581283 2585168231 146
190 iso_pu_bacteria 2582581298 2585224223 146
191 iso_pu_bacteria 2582581306 2585268866 146
192 iso_pu_bacteria 2582581865 2585391413 146
193 iso_pu_bacteria 2585427526 2585529824 146
194 iso_pu_bacteria 2585427528 2585542326 146
195 iso_pu_bacteria 2585427529 2585546344 146
196 iso_pu_bacteria 2585427593 2585838817 146
197 iso_pu_bacteria 2599185156 2599333464 146
198 iso_pu_bacteria 2599185210 2599601349 146
199 iso_pu_bacteria 2599185352 2600192265 146
200 iso_pu_bacteria 2600255308 2601744767 146
201 iso_pu_bacteria 2615840624 2616292592 146
202 iso_pu_bacteria 2643221557 2643808346 146
203 iso_pu_bacteria 2643221582 2643919448 146
204 iso_pu_bacteria 2643221610 2644066560 146
205 iso_pu_bacteria 2643221618 2644109589 146
206 iso_pu_bacteria 2643221626 2644145273 146
207 iso_pu_bacteria 2643221637 2644207656 146
208 iso_pu_bacteria 2643221655 2644310978 146
209 iso_pu_bacteria 2643221659 2644332631 146
210 iso_pu_bacteria 2643221668 2644378149 146
211 iso_pu_bacteria 2643221675 2644415227 146
212 iso_pu_bacteria 2643221680 2644450372 146
213 iso_pu_bacteria 2643221688 2644494765 146
214 iso_pu_bacteria 2643221689 2644499154 146
215 iso_pu_bacteria 2643221693 2644522350 146
216 iso_pu_bacteria 2643221698 2644544376 146
217 iso_pu_bacteria 2643221712 2644613944 146
218 iso_pu_bacteria 2643221718 2644654537 146
219 iso_pu_bacteria 2643221723 2644677843 146
220 iso_pu_bacteria 2643221726 2644687924 146
221 iso_pu_bacteria 2657244999 2657683750 146
222 iso_pu_bacteria 2690316117 2692316480 146
223 iso_pu_bacteria 2718217882 2719181047 146
224 iso_pu_bacteria 2718217927 2719385660 146
225 iso_pu_bacteria 2718217997 2719665481 146
226 iso_pu_bacteria 2718218009 2719731796 146
227 iso_pu_bacteria 2718218199 2720491901 146
228 iso_pu_bacteria 2718218232 2720613168 146
229 iso_pu_bacteria 2718218233 2720620023 146
230 iso_pu_bacteria 2718218235 2720631448 146
231 iso_pu_bacteria 2718218269 2720775176 146
232 iso_pu_bacteria 2718218363 2721147141 146
233 iso_pu_bacteria 2718218365 2721158675 146
234 iso_pu_bacteria 2718218366 2721164059 146
235 iso_pu_bacteria 2718218423 2721399442 146
236 iso_pu_bacteria 2721755514 2722840229 146
237 iso_pu_bacteria 2721755556 2723026813 146
238 iso_pu_bacteria 2721755684 2723560430 146
239 iso_pu_bacteria 2721755685 2723566995 146
240 iso_pu_bacteria 2721755809 2724038255 146
241 iso_pu_bacteria 2721755810 2724044552 146
242 iso_pu_bacteria 2721755819 2724089783 146
243 iso_pu_bacteria 2721755822 2724104260 146
244 iso_pu_bacteria 2721755823 2724110074 146
245 iso_pu_bacteria 2724679232 2725951244 146
246 iso_pu_bacteria 2728369352 2730107749 146
247 iso_pu_bacteria 2728369365 2730164284 146
248 iso_pu_bacteria 2728369397 2730298307 146
249 iso_pu_bacteria 2738541333 2739038104 146
250 iso_pu_bacteria 2791355082 2792581242 146
251 iso_pu_bacteria 2791355094 2792642451 146
252 iso_pu_bacteria 2791355256 2793298161 146
253 iso_pu_bacteria 2791355259 2793313650 146
254 iso_pu_bacteria 2791355260 2793322162 146
255 iso_pu_bacteria 2791355261 2793326543 146
256 iso_pu_bacteria 2791355262 2793337214 146
257 iso_pu_bacteria 2791355263 2793341395 146
258 iso_pu_bacteria 2791355264 2793350481 146
259 iso_pu_bacteria 2791355265 2793352490 146
260 iso_pu_bacteria 2791355266 2793361298 146
261 iso_pu_bacteria 2791355267 2793369565 146
262 iso_pu_bacteria 2802429268 2804751813 146
263 iso_pu_bacteria 2802429605 2805931071 146
264 iso_pu_bacteria 2802429606 2805938086 146
265 iso_pu_bacteria 2802429633 2806047916 146
266 iso_pu_bacteria 2802429634 2806056333 146
267 iso_pu_bacteria 2802429635 2806061598 146
268 iso_pu_bacteria 2802429636 2806070127 146
269 iso_pu_bacteria 2802429637 2806072504 146
270 iso_pu_bacteria 2808606387 2808985275 146
271 iso_pu_bacteria 2818991439 2819559707 146
272 iso_pu_bacteria 2838016132 2838021042 146
273 iso_pu_bacteria 2838022645 2838027986 146
274 iso_pu_bacteria 2838042994 2838043297 146
275 iso_pu_bacteria 2838048938 2838052554 146
276 iso_pu_bacteria 2838061910 2838066080 146
277 iso_pu_bacteria 2838068647 2838071582 146
278 iso_pu_bacteria 2838074704 2838079276 146
279 iso_pu_bacteria 2838668709 2838673981 146
280 iso_pu_bacteria 2838675328 2838676114 146
281 iso_pu_bacteria 2838680041 2838682358 146
282 iso_pu_bacteria 2838686498 2838689354 146
283 iso_pu_bacteria 2838694306 2838696929 146
284 iso_pu_bacteria 2838701080 2838706381 146
285 iso_pu_bacteria 2838707686 2838709830 146
286 iso_pu_bacteria 2838714209 2838714996 146
287 iso_pu_bacteria 2838719591 2838721203 146
288 iso_pu_bacteria 2838724970 2838725756 146
289 iso_pu_bacteria 2838729681 2838730687 146
290 iso_pu_bacteria 2838742623 2838743628 146
291 iso_pu_bacteria 2841846520 2841848161 146
292 iso_pu_bacteria 2841851746 2841854696 146
293 iso_pu_bacteria 2841859092 2841859289 146
294 iso_pu_bacteria 2841864319 2841864691 146
295 iso_pu_bacteria 2842077413 2842078004 146
296 iso_pu_bacteria 2842118031 2842119488 146
297 iso_pu_bacteria 2842124991 2842125809 146
298 iso_pu_bacteria 2842130223 2842131009 146
299 iso_pu_bacteria 2842146304 2842148715 146
300 iso_pu_bacteria 2842152218 2842153821 146
301 iso_pu_bacteria 2842156927 2842157559 146
302 iso_pu_bacteria 2842163707 2842164751 146
303 iso_pu_bacteria 2842170452 2842171240 146
304 iso_pu_bacteria 2842175837 2842177441 146
305 iso_pu_bacteria 2842180545 2842180856 146
306 iso_pu_bacteria 2842187318 2842188105 146
307 iso_pu_bacteria 2842192696 2842196761 146
308 iso_pu_bacteria 2842198810 2842203880 146
309 iso_pu_bacteria 2842205361 2842206183 146
310 iso_pu_bacteria 2842211629 2842212416 146
311 iso_pu_bacteria 2842217011 2842217095 146
312 iso_pu_bacteria 2842224351 2842225965 146
313 iso_pu_bacteria 2842229732 2842231086 146
314 iso_pu_bacteria 2842237096 2842239243 146
315 iso_pu_bacteria 2842243621 2842244807 146
316 iso_pu_bacteria 2842250916 2842256099 146
317 iso_pu_bacteria 2842257432 2842258620 146
318 iso_pu_bacteria 2842264693 2842268145 146
319 iso_pu_bacteria 2842271015 2842273374 146
320 iso_pu_bacteria 2842278818 2842279640 146
321 iso_pu_bacteria 2842285085 2842286282 146
322 iso_pu_bacteria 2842291075 2842291667 146
323 iso_pu_bacteria 2842304105 2842304151 146
324 iso_pu_bacteria 2842311132 2842313782 146
325 iso_pu_bacteria 2842317721 2842318055 146
326 iso_pu_bacteria 2842341865 2842345969 146
327 iso_pu_bacteria 2842363717 2842364403 146
328 iso_pu_bacteria 2842370503 2842372924 146
329 iso_pu_bacteria 2842377471 2842378063 146
330 iso_pu_bacteria 2842384541 2842385996 146
331 iso_pu_bacteria 2842395702 2842397530 146
332 iso_pu_bacteria 2842402390 2842408023 146
333 iso_pu_bacteria 2842409023 2842414784 146
334 iso_pu_bacteria 2842415677 2842421333 146
335 iso_pu_bacteria 2842422224 2842424760 146
336 iso_pu_bacteria 2842428310 2842431620 146
337 iso_pu_bacteria 2842434925 2842438420 146
338 iso_pu_bacteria 2842441272 2842445050 146
339 iso_pu_bacteria 2842447887 2842452365 146
340 iso_pu_bacteria 2842462802 2842465992 146
341 iso_pu_bacteria 2842469257 2842473035 146
342 iso_pu_bacteria 2842489311 2842492980 146
343 iso_pu_bacteria 2842495871 2842496325 146
344 iso_pu_bacteria 2842515876 2842516073 146
345 iso_pu_bacteria 2842922631 2842925128 146
346 iso_pu_bacteria 2844163670 2844170467 146
347 iso_pu_bacteria 2844454524 2844459306 146
348 iso_pu_bacteria 2847417321 2847418454 146
349 iso_pu_bacteria 2848992105 2848993432 146
350 iso_pu_bacteria 2850079185 2850080755 146
351 iso_pu_bacteria 2855825444 2855831676 146
352 iso_pu_bacteria 2855839649 2855840795 146
353 iso_pu_bacteria 2858800743 2858801319 146
354 iso_pu_bacteria 2891373044 2891374376 146
355 iso_pu_bacteria 2896384573 2896386944 146
356 iso_pu_bacteria 2899792073 2899793932 146
357 iso_pu_bacteria 2899803654 2899808993 146
358 iso_pu_bacteria 2899845264 2899846465 146
359 iso_pu_bacteria 2913295892 2913300362 146
360 iso_pu_bacteria 2915986958 2915989044 146
361 iso_pu_bacteria 2915993759 2915997439 146
362 iso_pu_bacteria 2916000859 2916006407 146
363 iso_pu_bacteria 2916007675 2916012179 146
364 iso_pu_bacteria 2916014648 2916021005 146
365 iso_pu_bacteria 2916021584 2916025931 146
366 iso_pu_bacteria 2916028427 2916034721 146
367 iso_pu_bacteria 2916035215 2916041814 146
368 iso_pu_bacteria 2916041962 2916046258 146
369 iso_pu_bacteria 2916048683 2916051114 146
370 iso_pu_bacteria 2916055098 2916061078 146
371 iso_pu_bacteria 2916068649 2916072803 146
372 iso_pu_bacteria 2916076590 2916078288 146
373 iso_pu_bacteria 2919114240 2919115088 146
374 iso_pu_bacteria 2920760137 2920765531 146
375 iso_pu_bacteria 2920822456 2920824154 146
376 iso_pu_bacteria 2921201388 2921206713 146
377 iso_pu_bacteria 2921208531 2921209661 146
378 iso_pu_bacteria 2921237296 2921243481 146
379 iso_pu_bacteria 2921244191 2921249502 146
380 iso_pu_bacteria 2921250672 2921253084 146
381 iso_pu_bacteria 2921257292 2921262666 146
382 iso_pu_bacteria 2921263974 2921270311 146
383 iso_pu_bacteria 2921282425 2921288442 146
384 iso_pu_bacteria 2921289301 2921293539 146
385 iso_pu_bacteria 2921296804 2921304509 146
386 iso_pu_bacteria 2924144063 2924147548 146
387 iso_pu_bacteria 2924150972 2924157082 146
388 iso_pu_bacteria 2924158325 2924165101 146
389 iso_pu_bacteria 2924165586 2924171939 146
390 iso_pu_bacteria 2924172951 2924179260 146
391 iso_pu_bacteria 2924179722 2924183863 146
392 iso_pu_bacteria 2924186466 2924192587 146
393 iso_pu_bacteria 2924193448 2924197888 146
394 iso_pu_bacteria 2924200457 2924205890 146
395 iso_pu_bacteria 2924207177 2924211584 146
396 iso_pu_bacteria 2924214083 2924217531 146
397 iso_pu_bacteria 2924221636 2924228278 146
398 iso_pu_bacteria 2924228884 2924234239 146
399 iso_pu_bacteria 2926754445 2926756052 146
400 iso_pu_bacteria 2926760298 2926760366 146
401 iso_pu_bacteria 2933006813 2933008467 146
402 iso_pu_bacteria 2933011516 2933013282 146
403 iso_pu_bacteria 2933570622 2933571430 146
404 iso_pu_bacteria 2933599457 2933602381 146
405 iso_pu_bacteria 2935894831 2935897216 146
406 iso_pu_bacteria 2935901341 2935904602 146
407 iso_pu_bacteria 2936375103 2936376740 146
408 iso_pu_bacteria 2936381700 2936385110 146
409 iso_pu_bacteria 2936996657 2936997687 146
410 iso_pu_bacteria 2937002841 2937007302 146
411 iso_pu_bacteria 2937009748 2937012392 146
412 iso_pu_bacteria 2937016420 2937022003 146
413 iso_pu_bacteria 2937023124 2937028236 146
414 iso_pu_bacteria 2937042894 2937049401 146
415 iso_pu_bacteria 2937049772 2937056186 146
416 iso_pu_bacteria 2937056579 2937058521 146
417 iso_pu_bacteria 2937063883 2937064499 146
418 iso_pu_bacteria 2937071275 2937077496 146
419 iso_pu_bacteria 2937091812 2937097939 146
420 iso_pu_bacteria 2937098957 2937105118 146
421 iso_pu_bacteria 2937106411 2937107710 146
422 iso_pu_bacteria 2937113482 2937117234 146
423 iso_pu_bacteria 2937119839 2937124856 146
424 iso_pu_bacteria 2937126314 2937130427 146
425 iso_pu_bacteria 2941499720 2941499894 146
426 iso_pu_bacteria 2957382221 2957387629 146
427 iso_pu_bacteria 2957388812 2957393448 146
428 iso_pu_bacteria 2957395598 2957400954 146
429 iso_pu_bacteria 2957402308 2957408780 146
430 iso_pu_bacteria 2957408893 2957412609 146
431 iso_pu_bacteria 2957415311 2957416337 146
432 iso_pu_bacteria 2957422303 2957428828 146
433 iso_pu_bacteria 2957430029 2957436267 146
434 iso_pu_bacteria 2957443900 2957449290 146
435 iso_pu_bacteria 2957450854 2957456651 146
436 iso_pu_bacteria 2957457609 2957463793 146
437 iso_pu_bacteria 2957464669 2957469182 146
438 iso_pu_bacteria 2957471148 2957477010 146
439 iso_pu_bacteria 2957478035 2957484014 146
440 iso_pu_bacteria 2957484790 2957490604 146
441 iso_pu_bacteria 2957491536 2957495002 146
442 iso_pu_bacteria 2957498199 2957504291 146
443 iso_pu_bacteria 2957505466 2957512078 146
444 iso_pu_bacteria 2960584000 2960590564 146
445 iso_pu_bacteria 2960597568 2960601864 146
446 iso_pu_bacteria 2960603979 2960610071 146
447 iso_pu_bacteria 2960610863 2960615019 146
448 iso_pu_bacteria 2960617483 2960621925 146
449 iso_pu_bacteria 2960624210 2960628830 146
450 iso_pu_bacteria 2960637947 2960644355 146
451 iso_pu_bacteria 2960645483 2960647195 146
452 iso_pu_bacteria 2960652885 2960658956 146
453 iso_pu_bacteria 2960660292 2960665182 146
454 iso_pu_bacteria 2960667422 2960672652 146
455 iso_pu_bacteria 2960674078 2960679372 146
456 iso_pu_bacteria 2960687367 2960693225 146
457 iso_pu_bacteria 2964607997 2964609810 146
458 iso_pu_bacteria 2964615318 2964619495 146
459 iso_pu_bacteria 2964621998 2964622800 146
460 iso_pu_bacteria 2964628898 2964634440 146
461 iso_pu_bacteria 2964636051 2964637145 146
462 iso_pu_bacteria 2964643177 2964648608 146
463 iso_pu_bacteria 2964649959 2964654388 146
464 iso_pu_bacteria 2964656573 2964660253 146
465 iso_pu_bacteria 2964663802 2964666225 146
466 iso_pu_bacteria 2964670856 2964673670 146
467 iso_pu_bacteria 2964678106 2964684174 146
468 iso_pu_bacteria 2964685014 2964691077 146
469 iso_pu_bacteria 2964691889 2964696376 146
470 iso_pu_bacteria 2964698721 2964699531 146
471 iso_pu_bacteria 2964705432 2964711712 146
472 iso_pu_bacteria 2964712639 2964717891 146
473 iso_pu_bacteria 2964719344 2964725920 146
474 iso_pu_bacteria 2967664464 2967668595 146
475 iso_pu_bacteria 2967671571 2967677822 146
476 iso_pu_bacteria 2967678726 2967683698 146
477 iso_pu_bacteria 2967693043 2967698608 146
478 iso_pu_bacteria 2967699805 2967705500 146
479 iso_pu_bacteria 2967706974 2967713478 146
480 iso_pu_bacteria 2967714385 2967719061 146
481 iso_pu_bacteria 2967721400 2967726322 146
482 iso_pu_bacteria 2967735183 2967740318 146
483 iso_pu_bacteria 2967742019 2967743200 146
484 iso_pu_bacteria 2967748971 2967753420 146
485 iso_pu_bacteria 2967755722 2967761105 146
486 iso_pu_bacteria 2967762386 2967767412 146
487 iso_pu_bacteria 2967769361 2967772938 146
488 iso_pu_bacteria 2967775926 2967776504 146
489 iso_pu_bacteria 2970019648 2970024911 146
490 iso_pu_bacteria 2970033650 2970040377 146
491 iso_pu_bacteria 2970040964 2970045356 146
492 iso_pu_bacteria 2970047711 2970054151 146
493 iso_pu_bacteria 2970054988 2970059459 146
494 iso_pu_bacteria 2970061556 2970065584 146
495 iso_pu_bacteria 2970068827 2970075021 146
496 iso_pu_bacteria 2970076120 2970081447 146
497 iso_pu_bacteria 2970082768 2970087928 146
498 iso_pu_bacteria 2970088815 2970094592 146
499 iso_pu_bacteria 2970095765 2970096554 146
500 iso_pu_bacteria 2970102677 2970107235 146
501 iso_pu_bacteria 2970109326 2970112222 146
502 iso_pu_bacteria 2970116247 2970120399 146
503 iso_pu_bacteria 2970129317 2970133365 146
504 iso_pu_bacteria 2970136068 2970136707 146
505 iso_pu_bacteria 2970149975 2970155385 146
506 iso_pu_bacteria 2970156795 2970163194 146
507 iso_pu_bacteria 2970164137 2970168163 146
508 iso_pu_bacteria 2970170962 2970174787 146
509 iso_pu_bacteria 2970177841 2970181770 146
510 iso_pu_bacteria 2970184632 2970187985 146
511 iso_pu_bacteria 2970191845 2970197815 146
512 iso_pu_bacteria 2977516862 2977520682 146
513 iso_pu_bacteria 2977523885 2977529517 146
514 iso_pu_bacteria 2977537788 2977542174 146
515 iso_pu_bacteria 2977551784 2977557448 146
516 iso_pu_bacteria 2977558990 2977565003 146
517 iso_pu_bacteria 2977565890 2977570393 146
518 iso_pu_bacteria 2977572785 2977575490 146
519 iso_pu_bacteria 2977579622 2977584143 146
520 iso_pu_bacteria 2979089926 2979094356 146
521 iso_pu_bacteria 2979095461 2979098261 146
522 iso_pu_bacteria 2979100975 2979103597 146
523 iso_pu_bacteria 2984509177 2984511840 146
524 iso_pu_bacteria 2984518228 2984521800 146
525 iso_pu_bacteria 2984537506 2984541098 146
526 iso_pu_bacteria 2984601300 2984603378 146
527 iso_pu_bacteria 2989349275 2989353169 146
528 iso_pu_bacteria 2996893221 2996898277 146
529 iso_pu_bacteria 3005445848 3005447385 146
530 iso_pu_bacteria 639633055 639648408 146
531 iso_pu_bacteria 648276728 648740093 146
532 iso_pu_bacteria 650716007 650740212 146
533 iso_pu_bacteria 8003570095 8003571274 146
534 iso_pu_bacteria 8003992118 8003993294 146
535 iso_pu_bacteria 8005275841 8005280435 146
536 iso_pu_bacteria 8005282627 8005285656 146
537 iso_pu_bacteria 8005289223 8005290735 146
538 iso_pu_bacteria 8005301065 8005302287 146
539 iso_pu_bacteria 8005307578 8005314390 146
540 iso_pu_bacteria 8005382845 8005388199 146
541 iso_pu_bacteria 8005395548 8005397275 146
542 iso_pu_bacteria 8005430974 8005433630 146
543 iso_pu_bacteria 8005460587 8005462801 146
544 iso_pu_bacteria 8005497431 8005500202 146
545 iso_pu_bacteria 8005556819 8005557855 146
546 iso_pu_bacteria 8005563573 8005569028 146
547 iso_pu_bacteria 8005570704 8005572166 146
548 iso_pu_bacteria 8005619151 8005621494 146
549 iso_pu_bacteria 8005626139 8005631161 146
550 iso_pu_bacteria 8005668836 8005671618 146
551 iso_pu_bacteria 8005688590 8005689860 146
552 iso_pu_bacteria 8005695170 8005700162 146
553 iso_pu_bacteria 8018127388 8018129778 146
554 iso_pu_bacteria 8018163183 8018166940 146
555 iso_pu_bacteria 8023680758 8023685533 146
556 iso_pu_bacteria 8024479707 8024482158 146
557 iso_pu_bacteria 8024501048 8024506743 146
558 iso_pu_bacteria 8049293176 8049294347 146
559 iso_pu_bacteria 8056375014 8056377291 146
560 iso_pu_bacteria 8056382006 8056388228 146
561 3300050491 nmdc:mga00v17_291_c1 nmdc:mga00v17_291_c1_8632_9075 147
562 iso_pu_bacteria 2512875026 2512971924 147
563 iso_pu_bacteria 2513237089 2513606325 147
564 iso_pu_bacteria 2513237156 2513986532 147
565 iso_pu_bacteria 2513237160 2514005474 147
566 iso_pu_bacteria 2513237305 2514418537 147
567 iso_pu_bacteria 2517487022 2517569416 147
568 iso_pu_bacteria 2802428858 2802718919 147
569 iso_pu_bacteria 2802428859 2802726529 147
570 iso_pu_bacteria 2802428860 2802733822 147
571 iso_pu_bacteria 2802428861 2802738428 147
572 iso_pu_bacteria 2802428862 2802744761 147
573 iso_pu_bacteria 2802428863 2802751033 147
574 iso_pu_bacteria 2915980308 2915985159 147
575 iso_pu_bacteria 2916061851 2916066176 147
576 iso_pu_bacteria 2929138655 2929140545 147
577 iso_pu_bacteria 2937029754 2937031134 147
578 iso_pu_bacteria 2937036028 2937040476 147
579 iso_pu_bacteria 2937078374 2937079929 147
580 iso_pu_bacteria 2937084907 2937091039 147
581 iso_pu_bacteria 2957375807 2957379741 147
582 iso_pu_bacteria 2957437181 2957438152 147
583 iso_pu_bacteria 2960591022 2960596094 147
584 iso_pu_bacteria 2960631154 2960634676 147
585 iso_pu_bacteria 2960680706 2960685124 147
586 iso_pu_bacteria 2960693952 2960698528 147
587 iso_pu_bacteria 2967686174 2967688800 147
588 iso_pu_bacteria 2967728569 2967733041 147
589 iso_pu_bacteria 2970026789 2970031562 147
590 iso_pu_bacteria 2970122695 2970128574 147
591 iso_pu_bacteria 2970143518 2970147773 147
592 iso_pu_bacteria 2977530762 2977533792 147
593 iso_pu_bacteria 2977544691 2977547276 147
594 iso_pu_bacteria 3003930520 3003933354 147
595 iso_pu_bacteria 8003999396 8004000547 147
596 3300005331 Ga0070670_100000603 Ga0070670_10000060315 148
597 3300025925 Ga0207650_10001911 Ga0207650_100019116 148
598 3300049776 Ga0501280_002116 Ga0501280_002116_59_511 148
599 3300049776 Ga0501280_038125 Ga0501280_038125_34_486 148
600 3300053140 Ga0500573_0013003 Ga0500573_0013003_3071_3517 148
601 iso_pu_bacteria 2558860983 2561466317 148
602 iso_pu_bacteria 2582581294 2585200043 148
603 iso_pu_bacteria 2775507049 2776913288 148
604 iso_pu_bacteria 643692032 643825461 148
605 iso_pu_bacteria 8018150411 8018155506 148
606 iso_pu_bacteria 8054460903 8054462792 148
607 iso_pu_bacteria 8054558443 8054559696 148
608 3300001979 JGI24740J21852_10000240 JGI24740J21852_1000024031 149
609 3300002704 JGI25155J39150_1000058 JGI25155J39150_100005829 149
610 3300002705 JGI25156J39149_1000080 JGI25156J39149_100008029 149
611 3300002737 JGI25162J39368_1000798 JGI25162J39368_100079829 149
612 3300002737 JGI25162J39368_1000942 JGI25162J39368_10009423 149
613 3300002737 JGI25162J39368_1002903 JGI25162J39368_10029032 149
614 3300002737 JGI25162J39368_1003447 JGI25162J39368_10034471 149
615 3300002738 JGI25154J39366_1000224 JGI25154J39366_100022418 149
616 3300002741 JGI25157J39369_1000101 JGI25157J39369_100010152 149
617 3300003214 JGI25165J46597_1000747 JGI25165J46597_10007478 149
618 3300003214 JGI25165J46597_1001007 JGI25165J46597_100100725 149
619 3300003214 JGI25165J46597_1008197 JGI25165J46597_10081973 149
620 3300003752 Ga0055539_1006528 Ga0055539_10065283 149
621 3300003771 Ga0055526_1006233 Ga0055526_10062337 149
622 3300003775 Ga0055524_1024519 Ga0055524_10245192 149
623 3300003790 Ga0055528_1000851 Ga0055528_10008519 149
624 3300005353 Ga0070669_100597990 Ga0070669_1005979902 149
625 3300005548 Ga0070665_100284105 Ga0070665_1002841052 149
626 3300005578 Ga0068854_100043013 Ga0068854_1000430132 149
627 3300005614 Ga0068856_100033811 Ga0068856_1000338116 149
628 3300005614 Ga0068856_100946695 Ga0068856_1009466951 149
629 3300005616 Ga0068852_100041122 Ga0068852_1000411225 149
630 3300006051 Ga0075364_10000170 Ga0075364_1000017013 149
631 3300006186 Ga0075369_10018019 Ga0075369_100180192 149
632 3300006195 Ga0075366_10224069 Ga0075366_102240692 149
633 3300006353 Ga0075370_10011896 Ga0075370_100118965 149
634 3300009093 Ga0105240_10000005 Ga0105240_10000005472 149
635 3300009545 Ga0105237_10001344 Ga0105237_1000134424 149
636 3300010375 Ga0105239_10003591 Ga0105239_1000359113 149
637 3300010375 Ga0105239_10329586 Ga0105239_103295862 149
638 3300012497 Ga0157319_1002443 Ga0157319_10024432 149
639 3300013104 Ga0157370_10000948 Ga0157370_1000094812 149
640 3300013105 Ga0157369_10158503 Ga0157369_101585033 149
641 3300013297 Ga0157378_11306727 Ga0157378_113067271 149
642 3300013306 Ga0163162_10316912 Ga0163162_103169123 149
643 3300014497 Ga0182008_10078580 Ga0182008_100785801 149
644 3300015262 Ga0182007_10002187 Ga0182007_100021874 149
645 3300015265 Ga0182005_1003334 Ga0182005_10033345 149
646 3300025206 Ga0209435_100045 Ga0209435_10004553 149
647 3300025207 Ga0209760_107039 Ga0209760_1070392 149
648 3300025228 Ga0209672_102875 Ga0209672_1028752 149
649 3300025228 Ga0209672_117561 Ga0209672_1175611 149
650 3300025231 Ga0207427_106592 Ga0207427_1065922 149
651 3300025233 Ga0209437_100047 Ga0209437_100047346 149
652 3300025233 Ga0209437_100122 Ga0209437_10012230 149
653 3300025246 Ga0209646_1000154 Ga0209646_100015453 149
654 3300025246 Ga0209646_1003813 Ga0209646_10038132 149
655 3300025250 Ga0209026_1000177 Ga0209026_100017753 149
656 3300025253 Ga0209677_100440 Ga0209677_10044023 149
657 3300025256 Ga0209759_1000274 Ga0209759_100027427 149
658 3300025261 Ga0209233_1000048 Ga0209233_100004857 149
659 3300025261 Ga0209233_1000170 Ga0209233_100017030 149
660 3300025261 Ga0209233_1001493 Ga0209233_10014937 149
661 3300025273 Ga0209673_1000013 Ga0209673_1000013569 149
662 3300025273 Ga0209673_1022246 Ga0209673_10222463 149
663 3300025284 Ga0209130_1034287 Ga0209130_10342872 149
664 3300025295 Ga0209564_1000906 Ga0209564_100090620 149
665 3300025297 Ga0209758_1002711 Ga0209758_100271112 149
666 3300025299 Ga0209256_1000947 Ga0209256_100094719 149
667 3300025299 Ga0209256_1010200 Ga0209256_10102002 149
668 3300025303 Ga0209051_1045274 Ga0209051_10452742 149
669 3300025913 Ga0207695_10000011 Ga0207695_10000011445 149
670 3300025914 Ga0207671_10000314 Ga0207671_100003143 149
671 3300025923 Ga0207681_10513840 Ga0207681_105138402 149
672 3300025981 Ga0207640_10036793 Ga0207640_100367935 149
673 3300026078 Ga0207702_10016488 Ga0207702_100164886 149
674 3300026078 Ga0207702_10355219 Ga0207702_103552192 149
675 3300026142 Ga0207698_10795544 Ga0207698_107955442 149
676 3300028379 Ga0268266_10202752 Ga0268266_102027522 149
677 3300028794 Ga0307515_10001215 Ga0307515_1000121516 149
678 3300028794 Ga0307515_10038442 Ga0307515_100384428 149
679 3300031911 Ga0307412_10563049 Ga0307412_105630492 149
680 3300037471 Ga0395905_0000827 Ga0395905_0000827_1378_1830 149
681 3300037471 Ga0395905_0006518 Ga0395905_0006518_8554_9003 149
682 3300037471 Ga0395905_0609660 Ga0395905_0609660_424_873 149
683 3300037471 Ga0395905_1124358 Ga0395905_1124358_28_477 149
684 3300038443 Ga0395901_0447926 Ga0395901_0447926_423_872 149
685 3300041452 Ga0451793_1771588 Ga0451793_1771588_548_1000 149
686 3300041492 Ga0451835_0689076 Ga0451835_0689076_2161_2613 149
687 3300041497 Ga0451840_12231 Ga0451840_12231_267_719 149
688 3300041498 Ga0451841_0183806 Ga0451841_0183806_83_535 149
689 3300041502 Ga0451846_02444 Ga0451846_02444_522_974 149
690 3300041503 Ga0451847_0483869 Ga0451847_0483869_83_535 149
691 3300041503 Ga0451847_0486657 Ga0451847_0486657_1552_2004 149
692 3300041504 Ga0451848_08423 Ga0451848_08423_138_590 149
693 3300041505 Ga0451849_0137763 Ga0451849_0137763_611_1063 149
694 3300041506 Ga0451850_51725 Ga0451850_51725_530_982 149
695 3300041507 Ga0451851_0203844 Ga0451851_0203844_254_706 149
696 3300041510 Ga0451854_17026 Ga0451854_17026_262_714 149
697 3300041511 Ga0451855_0606958 Ga0451855_0606958_166_618 149
698 3300041512 Ga0451853_3234756 Ga0451853_3234756_547_999 149
699 3300044719 Ga0466971_0319425 Ga0466971_0319425_164_628 149
700 3300044765 Ga0466970_0001159 Ga0466970_0001159_9026_9490 149
701 3300044842 Ga0466957_0323890 Ga0466957_0323890_388_852 149
702 3300045049 Ga0466959_0155850 Ga0466959_0155850_347_811 149
703 3300045836 Ga0466958_0306419 Ga0466958_0306419_338_802 149
704 3300046460 Ga0495638_0000597 Ga0495638_0000597_23468_23917 149
705 3300046460 Ga0495638_0065247 Ga0495638_0065247_205_654 149
706 3300046471 Ga0495650_0082159 Ga0495650_0082159_366_815 149
707 3300046492 Ga0495585_0114385 Ga0495585_0114385_36_488 149
708 3300046500 Ga0495596_0340851 Ga0495596_0340851_18_470 149
709 3300046501 Ga0495607_0014939 Ga0495607_0014939_2115_2567 149
710 3300046506 Ga0495583_0047246 Ga0495583_0047246_1350_1802 149
711 3300046507 Ga0495606_0005935 Ga0495606_0005935_4313_4762 149
712 3300046507 Ga0495606_0031156 Ga0495606_0031156_2109_2561 149
713 3300046507 Ga0495606_0065151 Ga0495606_0065151_149_598 149
714 3300046507 Ga0495606_0377080 Ga0495606_0377080_37_489 149
715 3300046512 Ga0495610_0031394 Ga0495610_0031394_433_885 149
716 3300046512 Ga0495610_0048705 Ga0495610_0048705_1271_1723 149
717 3300046513 Ga0495616_0023559 Ga0495616_0023559_866_1315 149
718 3300046513 Ga0495616_0058559 Ga0495616_0058559_1223_1675 149
719 3300046515 Ga0495620_0012510 Ga0495620_0012510_2537_2989 149
720 3300046518 Ga0495631_0035705 Ga0495631_0035705_256_708 149
721 3300046519 Ga0495632_0040920 Ga0495632_0040920_1039_1497 149
722 3300046519 Ga0495632_0211342 Ga0495632_0211342_54_506 149
723 3300046522 Ga0495643_0036606 Ga0495643_0036606_57_509 149
724 3300046522 Ga0495643_0083423 Ga0495643_0083423_146_595 149
725 3300046522 Ga0495643_0142369 Ga0495643_0142369_105_557 149
726 3300046522 Ga0495643_0316035 Ga0495643_0316035_28_486 149
727 3300046530 Ga0495654_0130829 Ga0495654_0130829_620_1072 149
728 3300046542 Ga0495597_0010628 Ga0495597_0010628_3597_4049 149
729 3300046542 Ga0495597_0046866 Ga0495597_0046866_168_617 149
730 3300046616 Ga0495668_0184666 Ga0495668_0184666_476_928 149
731 3300046660 Ga0495625_0132496 Ga0495625_0132496_748_1200 149
732 3300046660 Ga0495625_0284198 Ga0495625_0284198_218_670 149
733 3300046660 Ga0495625_0368167 Ga0495625_0368167_70_519 149
734 3300046691 Ga0495670_0118813 Ga0495670_0118813_541_993 149
735 3300046692 Ga0495671_0060942 Ga0495671_0060942_1320_1772 149
736 3300046694 Ga0495649_0060150 Ga0495649_0060150_115_567 149
737 3300047318 Ga0495636_0141114 Ga0495636_0141114_318_770 149
738 3300047318 Ga0495636_0330062 Ga0495636_0330062_159_608 149
739 3300047320 Ga0495672_0020846 Ga0495672_0020846_2727_3176 149
740 3300047443 Ga0495687_203038 Ga0495687_203038_54_506 149
741 3300047446 Ga0495679_072035 Ga0495679_072035_43_495 149
742 3300047470 Ga0495681_0079294 Ga0495681_0079294_484_936 149
743 3300047472 Ga0495686_0003870 Ga0495686_0003870_8704_9153 149
744 3300047472 Ga0495686_0015546 Ga0495686_0015546_2538_2990 149
745 3300047472 Ga0495686_0099843 Ga0495686_0099843_1006_1455 149
746 3300047472 Ga0495686_0115104 Ga0495686_0115104_342_791 149
747 3300048090 Ga0495615_0014893 Ga0495615_0014893_22_474 149
748 3300048903 Ga0496100_0607993 Ga0496100_0607993_247_696 149
749 3300048905 Ga0496102_0053430 Ga0496102_0053430_684_1133 149
750 3300048906 Ga0496103_0011652 Ga0496103_0011652_2886_3335 149
751 3300048909 Ga0496106_0000801 Ga0496106_0000801_18389_18841 149
752 3300048909 Ga0496106_0381654 Ga0496106_0381654_268_717 149
753 3300048916 Ga0496113_0136267 Ga0496113_0136267_1133_1582 149
754 3300048919 Ga0496116_0050273 Ga0496116_0050273_924_1373 149
755 3300048919 Ga0496116_0110497 Ga0496116_0110497_44_496 149
756 3300048919 Ga0496116_0260180 Ga0496116_0260180_306_758 149
757 3300048920 Ga0496117_0000641 Ga0496117_0000641_43439_43888 149
758 3300048920 Ga0496117_0044740 Ga0496117_0044740_1002_1454 149
759 3300048920 Ga0496117_0119160 Ga0496117_0119160_846_1298 149
760 3300048921 Ga0496118_0002255 Ga0496118_0002255_18674_19126 149
761 3300048921 Ga0496118_0002788 Ga0496118_0002788_9978_10427 149
762 3300048921 Ga0496118_0021378 Ga0496118_0021378_945_1397 149
763 3300048921 Ga0496118_0283407 Ga0496118_0283407_286_735 149
764 3300048922 Ga0496119_0033903 Ga0496119_0033903_2160_2609 149
765 3300048923 Ga0496120_0030634 Ga0496120_0030634_1741_2190 149
766 3300048923 Ga0496120_0045117 Ga0496120_0045117_667_1116 149
767 3300048924 Ga0496121_0000751 Ga0496121_0000751_34944_35393 149
768 3300048924 Ga0496121_0003358 Ga0496121_0003358_14425_14874 149
769 3300048924 Ga0496121_0015611 Ga0496121_0015611_156_605 149
770 3300048924 Ga0496121_0031398 Ga0496121_0031398_1650_2102 149
771 3300048924 Ga0496121_0091314 Ga0496121_0091314_346_798 149
772 3300048924 Ga0496121_0189522 Ga0496121_0189522_718_1170 149
773 3300048925 Ga0496122_0003165 Ga0496122_0003165_8859_9308 149
774 3300048925 Ga0496122_0016386 Ga0496122_0016386_3985_4437 149
775 3300048925 Ga0496122_0122567 Ga0496122_0122567_835_1284 149
776 3300048926 Ga0496123_0010688 Ga0496123_0010688_3634_4083 149
777 3300048926 Ga0496123_0018189 Ga0496123_0018189_1470_1922 149
778 3300048926 Ga0496123_0065931 Ga0496123_0065931_1014_1463 149
779 3300048927 Ga0496124_0008646 Ga0496124_0008646_548_997 149
780 3300048927 Ga0496124_0012897 Ga0496124_0012897_4025_4474 149
781 3300048927 Ga0496124_0036616 Ga0496124_0036616_3395_3847 149
782 3300048927 Ga0496124_0637151 Ga0496124_0637151_175_624 149
783 3300048928 Ga0496125_0021828 Ga0496125_0021828_1759_2211 149
784 3300048928 Ga0496125_0051706 Ga0496125_0051706_292_741 149
785 3300048928 Ga0496125_0338138 Ga0496125_0338138_356_805 149
786 3300048928 Ga0496125_0342169 Ga0496125_0342169_352_801 149
787 3300048929 Ga0496126_0020807 Ga0496126_0020807_5794_6243 149
788 3300049459 Ga0495678_029785 Ga0495678_029785_771_1223 149
789 3300049742 Ga0501080_0132818 Ga0501080_0132818_95_547 149
790 3300049822 Ga0501035_0525970 Ga0501035_0525970_181_630 149
791 3300049822 Ga0501035_0848203 Ga0501035_0848203_124_573 149
792 3300049823 Ga0501044_0142973 Ga0501044_0142973_588_1037 149
793 3300050493 nmdc:mga0k408_215936_c1 nmdc:mga0k408_215936_c1_285_734 149
794 3300050493 nmdc:mga0k408_451596_c1 nmdc:mga0k408_451596_c1_223_672 149
795 3300050516 nmdc:mga0sz30_3070_c1 nmdc:mga0sz30_3070_c1_1684_2136 149
796 3300053086 Ga0500578_0044842 Ga0500578_0044842_57_509 149
797 3300053088 Ga0500644_0005315 Ga0500644_0005315_439_888 149
798 3300053090 Ga0500646_0233981 Ga0500646_0233981_58_507 149
799 3300053104 Ga0500556_0237166 Ga0500556_0237166_126_575 149
800 3300053111 Ga0500572_116256 Ga0500572_116256_235_684 149
801 3300053125 Ga0500618_009145 Ga0500618_009145_276_734 149
802 3300053125 Ga0500618_015691 Ga0500618_015691_172_621 149
803 3300053129 Ga0500628_046983 Ga0500628_046983_56_508 149
804 3300053133 Ga0500655_007893 Ga0500655_007893_1310_1768 149
805 3300053134 Ga0500658_0000162 Ga0500658_0000162_28756_29208 149
806 3300053134 Ga0500658_0213842 Ga0500658_0213842_299_751 149
807 3300053136 Ga0500559_0007060 Ga0500559_0007060_951_1400 149
808 3300053139 Ga0500568_0000411 Ga0500568_0000411_28317_28766 149
809 3300053139 Ga0500568_0001577 Ga0500568_0001577_10201_10653 149
810 3300053139 Ga0500568_0057248 Ga0500568_0057248_546_998 149
811 3300053142 Ga0500577_0108487 Ga0500577_0108487_308_757 149
812 3300053151 Ga0500604_0003667 Ga0500604_0003667_2272_2724 149
813 3300053153 Ga0500616_0001852 Ga0500616_0001852_11836_12285 149
814 3300053153 Ga0500616_0012405 Ga0500616_0012405_807_1259 149
815 3300053156 Ga0500622_0000428 Ga0500622_0000428_3924_4376 149
816 3300053156 Ga0500622_0000956 Ga0500622_0000956_11663_12112 149
817 3300053730 Ga0500645_066116 Ga0500645_066116_261_710 149
818 iso_pu_bacteria 2510917026 2511171591 149
819 iso_pu_bacteria 2585427633 2585995923 149
820 iso_pu_bacteria 2585427634 2586000491 149
821 iso_pu_bacteria 2600254933 2600375764 149
822 iso_pu_bacteria 2643221558 2643811963 149
823 iso_pu_bacteria 2643221568 2643855540 149
824 iso_pu_bacteria 2854896431 2854899294 149
825 iso_pu_bacteria 2854916844 2854919251 149
826 iso_pu_bacteria 2919166419 2919167696 149
827 iso_pu_bacteria 2919171160 2919175039 149
828 iso_pu_bacteria 2978969890 2978974154 149
829 iso_pu_bacteria 2984587000 2984589481 149
830 iso_pu_bacteria 2989771324 2989773663 149
831 3300002987 JGI25159J45721_1000006 JGI25159J45721_100000624 150
832 3300003187 JGI25151J46595_10010040 JGI25151J46595_100100406 150
833 3300003187 JGI25151J46595_10037454 JGI25151J46595_100374542 150
834 3300003354 JGI25160J50197_1000019 JGI25160J50197_100001929 150
835 3300003374 JGI25161J50226_1000157 JGI25161J50226_100015732 150
836 3300003771 Ga0055526_1008270 Ga0055526_10082701 150
837 3300003775 Ga0055524_1001008 Ga0055524_100100813 150
838 3300003775 Ga0055524_1032341 Ga0055524_10323412 150
839 3300003781 Ga0055536_1000645 Ga0055536_10006457 150
840 3300003791 Ga0055530_10004713 Ga0055530_100047135 150
841 3300003792 Ga0055540_1012369 Ga0055540_10123694 150
842 3300003794 Ga0055531_10002873 Ga0055531_1000287310 150
843 3300004625 Ga0055543_1000145 Ga0055543_100014523 150
844 3300005262 Ga0065165_1000180 Ga0065165_100018029 150
845 3300006051 Ga0075364_10054934 Ga0075364_100549342 150
846 3300006353 Ga0075370_10319958 Ga0075370_103199582 150
847 3300006946 Ga0079104_1011892 Ga0079104_10118922 150
848 3300013249 Ga0171463_1011 Ga0171463_101188 150
849 3300015690 Ga0183363_1430 Ga0183363_14302 150
850 3300021320 Ga0214544_1000265 Ga0214544_100026565 150
851 3300021321 Ga0214542_1000015 Ga0214542_1000015226 150
852 3300021321 Ga0214542_1020378 Ga0214542_10203783 150
853 3300021327 Ga0214543_1000011 Ga0214543_1000011198 150
854 3300021327 Ga0214543_1000032 Ga0214543_1000032116 150
855 3300025208 Ga0209436_100333 Ga0209436_10033324 150
856 3300025230 Ga0209563_103879 Ga0209563_1038792 150
857 3300025245 Ga0207425_1059235 Ga0207425_10592351 150
858 3300025263 Ga0209565_1070826 Ga0209565_10708261 150
859 3300025284 Ga0209130_1000007 Ga0209130_1000007385 150
860 3300025292 Ga0209676_1000399 Ga0209676_100039967 150
861 3300025294 Ga0209025_1000787 Ga0209025_100078749 150
862 3300025294 Ga0209025_1000870 Ga0209025_100087027 150
863 3300025295 Ga0209564_1000140 Ga0209564_1000140113 150
864 3300025297 Ga0209758_1055124 Ga0209758_10551242 150
865 3300025298 Ga0209050_1000906 Ga0209050_100090624 150
866 3300025299 Ga0209256_1000606 Ga0209256_100060630 150
867 3300025299 Ga0209256_1001532 Ga0209256_10015322 150
868 3300025302 Ga0207426_1000111 Ga0207426_100011126 150
869 3300025303 Ga0209051_1002566 Ga0209051_10025666 150
870 3300025304 Ga0209257_1001423 Ga0209257_10014239 150
871 3300027111 Ga0209281_1000334 Ga0209281_100033427 150
872 3300027111 Ga0209281_1000361 Ga0209281_100036129 150
873 3300027666 Ga0209282_1000073 Ga0209282_100007327 150
874 3300028794 Ga0307515_10001393 Ga0307515_100013936 150
875 3300031456 Ga0307513_10046052 Ga0307513_100460524 150
876 3300031731 Ga0307405_11246188 Ga0307405_112461881 150
877 3300032002 Ga0307416_102118423 Ga0307416_1021184232 150
878 3300032004 Ga0307414_12071045 Ga0307414_120710451 150
879 3300033430 Ga0315913_1000129 Ga0315913_100012928 150
880 3300041404 Ga0439436_0112232 Ga0439436_0112232_42_494 150
881 3300041405 Ga0439438_070849 Ga0439438_070849_149_601 150
882 3300041411 Ga0439466_0114642 Ga0439466_0114642_345_797 150
883 3300041413 Ga0439465_0044118 Ga0439465_0044118_940_1392 150
884 3300042007 Ga0439449_0005864 Ga0439449_0005864_1679_2131 150
885 3300042014 Ga0439457_017484 Ga0439457_017484_302_754 150
886 3300044683 Ga0466965_0188862 Ga0466965_0188862_443_904 150
887 3300044735 Ga0466968_0013912 Ga0466968_0013912_2096_2557 150
888 3300046660 Ga0495625_0038160 Ga0495625_0038160_1174_1626 150
889 3300048920 Ga0496117_0002492 Ga0496117_0002492_13826_14278 150
890 3300048920 Ga0496117_0032556 Ga0496117_0032556_1294_1749 150
891 3300048921 Ga0496118_0056313 Ga0496118_0056313_306_761 150
892 3300048921 Ga0496118_0165800 Ga0496118_0165800_384_836 150
893 3300048922 Ga0496119_0032601 Ga0496119_0032601_2368_2823 150
894 3300048923 Ga0496120_0011601 Ga0496120_0011601_816_1271 150
895 3300048924 Ga0496121_0000003 Ga0496121_0000003_80623_81078 150
896 3300048925 Ga0496122_0000025 Ga0496122_0000025_39977_40438 150
897 3300048925 Ga0496122_0000399 Ga0496122_0000399_52912_53364 150
898 3300048925 Ga0496122_0074908 Ga0496122_0074908_1453_1908 150
899 3300048926 Ga0496123_0000054 Ga0496123_0000054_194966_195427 150
900 3300048926 Ga0496123_0002112 Ga0496123_0002112_14790_15242 150
901 3300048926 Ga0496123_0049479 Ga0496123_0049479_1560_2015 150
902 3300048927 Ga0496124_0002648 Ga0496124_0002648_13873_14325 150
903 3300048927 Ga0496124_0088991 Ga0496124_0088991_1336_1797 150
904 3300048927 Ga0496124_0428850 Ga0496124_0428850_413_868 150
905 3300048927 Ga0496124_0608190 Ga0496124_0608190_111_566 150
906 3300048927 Ga0496124_0759022 Ga0496124_0759022_111_566 150
907 3300048928 Ga0496125_0000141 Ga0496125_0000141_1959_2414 150
908 3300048928 Ga0496125_0001650 Ga0496125_0001650_24582_25034 150
909 3300048929 Ga0496126_0001055 Ga0496126_0001055_16635_17087 150
910 3300048929 Ga0496126_0068999 Ga0496126_0068999_2557_3012 150
911 3300049568 Ga0501031_0043880 Ga0501031_0043880_893_1345 150
912 3300049569 Ga0501032_0040703 Ga0501032_0040703_1441_1893 150
913 3300049569 Ga0501032_0252683 Ga0501032_0252683_491_943 150
914 3300049570 Ga0501033_0000118 Ga0501033_0000118_10632_11084 150
915 3300049570 Ga0501033_0028448 Ga0501033_0028448_3159_3611 150
916 3300049571 Ga0501034_0167499 Ga0501034_0167499_1397_1849 150
917 3300049574 Ga0501038_0025657 Ga0501038_0025657_296_748 150
918 3300049822 Ga0501035_0002363 Ga0501035_0002363_14276_14728 150
919 3300049822 Ga0501035_0552929 Ga0501035_0552929_329_781 150
920 3300049824 Ga0501045_0113532 Ga0501045_0113532_570_1022 150
921 3300050491 nmdc:mga00v17_42712_c1 nmdc:mga00v17_42712_c1_1343_1798 150
922 3300053099 Ga0500654_103001 Ga0500654_103001_401_853 150
923 3300053140 Ga0500573_0008408 Ga0500573_0008408_2874_3332 150
924 3300053151 Ga0500604_0129644 Ga0500604_0129644_341_793 150
925 iso_pu_bacteria 2599185236 2599720905 150
926 iso_pu_bacteria 2600255279 2601607992 150
927 iso_pu_bacteria 2738541317 2738945448 150
928 iso_pu_bacteria 2821123053 2821127779 150
929 iso_pu_bacteria 2838736955 2838738203 150
930 iso_pu_bacteria 2841840854 2841841427 150
931 iso_pu_bacteria 2842140634 2842141205 150
932 iso_pu_bacteria 2857531043 2857534480 150
933 iso_pu_bacteria 2913308742 2913310154 150
934 iso_pu_bacteria 2933594066 2933597971 150
935 iso_pu_bacteria 8056875544 8056877700 150
936 3300004798 Ga0058859_11670122 Ga0058859_116701222 151
937 3300005355 Ga0070671_100130749 Ga0070671_1001307492 151
938 3300006038 Ga0075365_10505039 Ga0075365_105050392 151
939 3300013105 Ga0157369_10096384 Ga0157369_100963842 151
940 3300025245 Ga0207425_1045841 Ga0207425_10458412 151
941 3300025258 Ga0209129_1005991 Ga0209129_10059915 151
942 3300025931 Ga0207644_10420203 Ga0207644_104202032 151
943 3300025961 Ga0207712_10139481 Ga0207712_101394813 151
944 3300047472 Ga0495686_0018766 Ga0495686_0018766_3643_4098 151
945 3300048928 Ga0496125_0438316 Ga0496125_0438316_31_486 151
946 3300059646 Ga0587078_061485 Ga0587078_061485_22_480 151
947 3300035398 Ga0316574_0981343 Ga0316574_0981343_15_485 152
948 3300036647 Ga0316582_0250613 Ga0316582_0250613_479_949 152
949 3300053125 Ga0500618_000125 Ga0500618_000125_54985_55446 152
950 3300003323 rootH1_10087504 rootH1_100875042 153
951 3300003791 Ga0055530_10065194 Ga0055530_100651942 153
952 3300003792 Ga0055540_1001322 Ga0055540_10013222 153
953 3300003794 Ga0055531_10001888 Ga0055531_1000188813 153
954 3300013102 Ga0157371_10012507 Ga0157371_100125074 153
955 3300017792 Ga0163161_11422499 Ga0163161_114224991 153
956 3300025292 Ga0209676_1013109 Ga0209676_10131092 153
957 3300025297 Ga0209758_1001265 Ga0209758_100126524 153
958 3300025298 Ga0209050_1001733 Ga0209050_100173315 153
959 3300025303 Ga0209051_1001061 Ga0209051_10010616 153
960 3300025304 Ga0209257_1001014 Ga0209257_100101422 153
961 3300047472 Ga0495686_0056345 Ga0495686_0056345_132_596 153
962 3300048913 Ga0496110_0061950 Ga0496110_0061950_19_483 153
963 3300048914 Ga0496111_0018396 Ga0496111_0018396_2527_2991 153
964 3300048922 Ga0496119_0058911 Ga0496119_0058911_591_1052 153
965 3300048925 Ga0496122_0008228 Ga0496122_0008228_5346_5810 153
966 3300048926 Ga0496123_0129005 Ga0496123_0129005_383_847 153
967 3300048927 Ga0496124_0084961 Ga0496124_0084961_2076_2540 153
968 3300053125 Ga0500618_000289 Ga0500618_000289_34457_34921 153
969 3300053153 Ga0500616_0000661 Ga0500616_0000661_36627_37088 153
970 3300053156 Ga0500622_0068032 Ga0500622_0068032_157_618 153
971 3300046530 Ga0495654_0000641 Ga0495654_0000641_5184_5654 155
972 3300053158 Ga0500627_0292184 Ga0500627_0292184_93_563 155
973 2010549000 RicEn_C9452 RicEn_165770 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

64

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9369 28 105
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.8876 30 111
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8732 28 110
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8644 23 114
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8639 25 110
ID Description Score Start End Superfamily
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9523 23 105 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9522 30 105 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9067 24 105 3.10.20.810
af_O59667_194_289_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8853 23 105 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8843 23 108 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A1S6IYE0-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.965 23 104 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A2H6G3I7-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9647 23 105 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7J5BUA8-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9646 23 104 GO:0000105
GO:0004635
AF-A0A425W566-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.9645 23 105 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A7C6XYQ9-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9642 25 105 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270

Feature Viewer

pLDDT pTM Quality
70.22 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map