F487199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 973 | 779 | 439 | 147 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2600255279|2601607992 |
| Length | 169 |
| Sequence | VDSIVSAASKPSAFHPGVAMSIPFPSAPADKEVLENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAEALSLTLETGIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFYRTVELSNGDAVTKITDDTRHFDPATTYSNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 22 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 23 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 24 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 25 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 26 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 27 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 28 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 29 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 30 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 31 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 32 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 33 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 34 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 35 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 36 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 37 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 38 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 39 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 40 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 41 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 42 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 43 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 44 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 45 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 46 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 47 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 48 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 49 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 50 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 51 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 52 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 53 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 54 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 55 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 56 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 57 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 58 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 59 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 60 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 61 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 62 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 63 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 64 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 65 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 66 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 67 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 68 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 69 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 70 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 71 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 72 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 73 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 74 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 75 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 76 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 77 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 78 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 79 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 80 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 81 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 82 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 83 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 84 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 85 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 86 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 87 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 88 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 89 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 90 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 91 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 92 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 93 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 94 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 95 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 96 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 97 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 98 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 99 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 100 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 101 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 102 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 103 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 104 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 105 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 106 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 107 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 108 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 109 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 110 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 111 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 112 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 113 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 114 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 115 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 116 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 117 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 118 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 119 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 120 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 121 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 122 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 123 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 124 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 125 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 126 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 127 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 128 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 129 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 130 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 131 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 132 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 133 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 134 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 135 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 136 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 137 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 138 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 139 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 140 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 141 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 142 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 143 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 144 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 145 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 146 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 147 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 148 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 149 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 150 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 151 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 152 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 153 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 154 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 155 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 156 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 157 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 158 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 159 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 160 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 161 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 162 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 163 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 164 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 165 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 166 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 167 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 168 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 169 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 170 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 171 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 172 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 173 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 174 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 175 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 176 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 177 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 178 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 179 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 180 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 181 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 182 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 183 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 184 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 185 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 186 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 187 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 188 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 189 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 190 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 191 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 192 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 193 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 194 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 195 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 196 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 197 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 198 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 199 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 200 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 201 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 202 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 203 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 204 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 205 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 206 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 207 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 208 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 209 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 210 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 211 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 212 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 213 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 214 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 215 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 216 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 217 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 218 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 219 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 220 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 221 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 222 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 223 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 224 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 225 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 226 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 227 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 228 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 229 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 230 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 231 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 232 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 233 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 234 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 235 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 236 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 237 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 238 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 239 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 240 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 241 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 242 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 243 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 244 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 245 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 246 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 247 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 248 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 249 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 250 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 251 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 252 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 253 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 254 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 255 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 256 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 257 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 258 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 259 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 260 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 261 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 262 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 263 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 264 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 265 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 266 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 267 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 268 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 269 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 270 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 271 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 272 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 273 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 274 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 275 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 276 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 277 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 278 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 279 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 280 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 281 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 282 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 283 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 284 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 285 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 286 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 287 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 288 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 289 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 290 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 291 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 292 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 293 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 294 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 295 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 296 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 297 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 298 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 299 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 300 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 301 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 302 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 303 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 304 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 305 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 306 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 307 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 308 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 309 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 310 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 311 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 312 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 313 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 314 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 315 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 316 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 317 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 318 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 319 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 320 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 321 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 322 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 323 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 324 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 325 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 326 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 327 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 328 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 329 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 330 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 331 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 332 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 333 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 334 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 335 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 336 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 337 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 338 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 339 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 340 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 341 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 342 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 343 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 344 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 345 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 346 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 347 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 348 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 349 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 350 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 351 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 352 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 353 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 354 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 355 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 356 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 357 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 358 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 359 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 360 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 361 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 362 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 363 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 364 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 365 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 366 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 367 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 368 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 369 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 370 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 371 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 372 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 373 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 374 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 375 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 376 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 377 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 378 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 379 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 380 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 381 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 382 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 383 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 384 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 385 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 386 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 387 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 388 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 389 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 390 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 391 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 392 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 393 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 394 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 395 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 396 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 397 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 398 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 399 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 400 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 401 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 402 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 403 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 404 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 405 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 406 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 407 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 408 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 409 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 410 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 411 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 412 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 413 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 414 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 415 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 416 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 417 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 418 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 419 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 420 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 421 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 422 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 423 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 424 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 425 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 426 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 427 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 428 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 429 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 430 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 431 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 432 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 433 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 434 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 435 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 436 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 437 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 438 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 439 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 440 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 441 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 442 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 443 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 444 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 445 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 446 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 447 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 448 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 449 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 450 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 451 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 452 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 453 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 454 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 455 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 456 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 457 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 458 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 459 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 460 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 461 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 462 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 463 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 464 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 465 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 466 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 467 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 468 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 469 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 470 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 471 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 472 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 473 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 474 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 475 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 476 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 477 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 478 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 479 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 480 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 481 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 482 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 483 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 484 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 485 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 486 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 487 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 488 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 489 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 490 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 491 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 492 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 493 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 494 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 495 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 496 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 497 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 498 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 499 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 500 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 501 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 502 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 503 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 504 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 505 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 506 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 507 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 508 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 509 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 510 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 511 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 512 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 513 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 514 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 515 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 516 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 517 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 518 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 520 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 521 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 522 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 524 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 525 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 526 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 527 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 528 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 529 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 530 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 531 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 532 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 533 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 534 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 535 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 538 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 539 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 540 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 541 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 542 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 543 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 544 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 545 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 546 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 547 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 548 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 550 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 551 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 552 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 553 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 555 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 556 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 558 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 560 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 561 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 564 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 565 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 566 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 567 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 568 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 570 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 572 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 575 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 578 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 589 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 591 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 593 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 594 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 595 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 596 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 597 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 598 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 599 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 600 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 601 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 602 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 603 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 604 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 605 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 606 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 607 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 608 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 609 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 610 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 611 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 612 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 613 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 614 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 615 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 616 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 617 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 618 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 619 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 620 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 621 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 622 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 623 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 624 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 625 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 626 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 627 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 628 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 629 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 630 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 631 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 632 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 633 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 634 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 662 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 663 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 664 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 665 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 666 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 667 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 668 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 669 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 670 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 671 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 672 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 673 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 674 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 675 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 676 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 677 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 678 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 679 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 682 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 688 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 691 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 692 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 694 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 696 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 697 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 699 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 700 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 701 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 702 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 703 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 704 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 705 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 706 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 707 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 708 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 709 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 710 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 711 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 712 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 713 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 714 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 715 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 716 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 717 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 718 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 719 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 720 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 721 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 722 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 723 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 724 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 725 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 726 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 727 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 728 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 730 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 731 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 732 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 734 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 735 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 736 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 737 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 738 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 739 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 740 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 741 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 742 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 743 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 744 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 745 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 746 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 747 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 748 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 749 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 750 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 751 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 752 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 753 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 754 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 755 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 756 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 757 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 758 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 759 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 760 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 761 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 762 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 763 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 764 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 765 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 766 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 767 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 768 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 769 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 770 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 771 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 772 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 773 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 774 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 775 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 776 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 777 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 778 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 779 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.88 |
| Metatranscriptomes | 1.23 |
| Isolates | 54.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.51 |
| Bulb | 0 |
| Endosphere | 15.62 |
| Nodule | 41.42 |
| Rhizoplane | 2.06 |
| Rhizosphere | 21.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C9452 | 2010549000 | Bacteria | 1300 |
| 2 | JGI24740J21852_10000240 | 3300001979 | Bacteria | 23152 |
| 3 | JGI25155J39150_1000058 | 3300002704 | Bacteria | 72188 |
| 4 | JGI25156J39149_1000080 | 3300002705 | Bacteria | 72430 |
| 5 | JGI25162J39368_1000798 | 3300002737 | Bacteria | 21041 |
| 6 | JGI25162J39368_1000942 | 3300002737 | Bacteria | 18688 |
| 7 | JGI25162J39368_1002903 | 3300002737 | Bacteria | 5848 |
| 8 | JGI25162J39368_1003447 | 3300002737 | Bacteria | 4568 |
| 9 | JGI25154J39366_1000224 | 3300002738 | Bacteria | 38440 |
| 10 | JGI25157J39369_1000101 | 3300002741 | Bacteria | 72430 |
| 11 | JGI25152J39213_1006003 | 3300002773 | Bacteria | 3405 |
| 12 | JGI25152J39213_1027029 | 3300002773 | Bacteria | 928 |
| 13 | JGI25152J39213_1027068 | 3300002773 | Bacteria | 927 |
| 14 | JGI25150J39212_1011557 | 3300002774 | Bacteria | 1594 |
| 15 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 16 | JGI25151J46595_10010040 | 3300003187 | Bacteria | 4435 |
| 17 | JGI25151J46595_10037454 | 3300003187 | Bacteria | 1819 |
| 18 | JGI25151J46595_10045366 | 3300003187 | Bacteria | 1552 |
| 19 | JGI25165J46597_1000747 | 3300003214 | Bacteria | 25073 |
| 20 | JGI25165J46597_1001007 | 3300003214 | Bacteria | 18684 |
| 21 | JGI25165J46597_1008197 | 3300003214 | Bacteria | 1659 |
| 22 | JGI25153J46596_10004125 | 3300003215 | Bacteria | 7905 |
| 23 | JGI25153J46596_10068665 | 3300003215 | Bacteria | 928 |
| 24 | JGI25153J46596_10068750 | 3300003215 | Bacteria | 927 |
| 25 | rootH1_10058669 | 3300003316 | Bacteria | 2282 |
| 26 | rootH2_10006547 | 3300003320 | Bacteria | 2155 |
| 27 | rootL2_10001427 | 3300003322 | Bacteria | 10865 |
| 28 | rootL2_10141239 | 3300003322 | Bacteria | 2047 |
| 29 | rootH1_10087504 | 3300003323 | Bacteria | 1107 |
| 30 | rootH1_10140377 | 3300003323 | Bacteria | 2152 |
| 31 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 32 | JGI25160J50197_1002563 | 3300003354 | Bacteria | 8406 |
| 33 | JGI25161J50226_1000157 | 3300003374 | Bacteria | 47443 |
| 34 | JGI25161J50226_1000346 | 3300003374 | Bacteria | 24757 |
| 35 | Ga0055539_1006528 | 3300003752 | Bacteria | 1490 |
| 36 | Ga0055526_1006233 | 3300003771 | Bacteria | 6540 |
| 37 | Ga0055526_1008270 | 3300003771 | Bacteria | 5221 |
| 38 | Ga0055526_1020769 | 3300003771 | Bacteria | 2316 |
| 39 | Ga0055524_1001008 | 3300003775 | Bacteria | 17483 |
| 40 | Ga0055524_1001365 | 3300003775 | Bacteria | 14165 |
| 41 | Ga0055524_1024519 | 3300003775 | Bacteria | 1911 |
| 42 | Ga0055524_1032341 | 3300003775 | Bacteria | 1485 |
| 43 | Ga0055536_1000645 | 3300003781 | Bacteria | 23637 |
| 44 | Ga0055528_1000851 | 3300003790 | Bacteria | 20725 |
| 45 | Ga0055530_10004713 | 3300003791 | Bacteria | 6900 |
| 46 | Ga0055530_10065194 | 3300003791 | Bacteria | 800 |
| 47 | Ga0055540_1001322 | 3300003792 | Bacteria | 14966 |
| 48 | Ga0055540_1001521 | 3300003792 | Bacteria | 13669 |
| 49 | Ga0055540_1012369 | 3300003792 | Bacteria | 2683 |
| 50 | Ga0055531_10001888 | 3300003794 | Bacteria | 14671 |
| 51 | Ga0055531_10002873 | 3300003794 | Bacteria | 11229 |
| 52 | Ga0055531_10067209 | 3300003794 | Bacteria | 843 |
| 53 | Ga0055543_1000032 | 3300004625 | Bacteria | 130218 |
| 54 | Ga0055543_1000145 | 3300004625 | Bacteria | 58910 |
| 55 | Ga0058859_11670122 | 3300004798 | Bacteria | 1326 |
| 56 | Ga0065165_1000180 | 3300005262 | Bacteria | 111768 |
| 57 | Ga0065165_1003840 | 3300005262 | Bacteria | 10003 |
| 58 | Ga0070670_100000603 | 3300005331 | Bacteria | 28216 |
| 59 | Ga0070682_100207910 | 3300005337 | Bacteria | 1385 |
| 60 | Ga0070669_100597990 | 3300005353 | Bacteria | 924 |
| 61 | Ga0070671_100130749 | 3300005355 | Bacteria | 2114 |
| 62 | Ga0070665_100284105 | 3300005548 | Bacteria | 1657 |
| 63 | Ga0068854_100043013 | 3300005578 | Bacteria | 3200 |
| 64 | Ga0068856_100033811 | 3300005614 | Bacteria | 5007 |
| 65 | Ga0068856_100946695 | 3300005614 | Bacteria | 880 |
| 66 | Ga0068852_100041122 | 3300005616 | Bacteria | 3905 |
| 67 | Ga0081455_10210237 | 3300005937 | Bacteria | 1450 |
| 68 | Ga0075365_10027350 | 3300006038 | Bacteria | 3629 |
| 69 | Ga0075365_10505039 | 3300006038 | Bacteria | 855 |
| 70 | Ga0075364_10000170 | 3300006051 | Bacteria | 29008 |
| 71 | Ga0075364_10054934 | 3300006051 | Bacteria | 2605 |
| 72 | Ga0075364_11005233 | 3300006051 | Bacteria | 567 |
| 73 | Ga0075369_10018019 | 3300006186 | Bacteria | 2871 |
| 74 | Ga0075366_10224069 | 3300006195 | Bacteria | 1146 |
| 75 | Ga0075370_10011896 | 3300006353 | Bacteria | 4584 |
| 76 | Ga0075370_10319958 | 3300006353 | Bacteria | 924 |
| 77 | Ga0075370_10815880 | 3300006353 | Bacteria | 569 |
| 78 | Ga0075434_100106989 | 3300006871 | Bacteria | 2807 |
| 79 | Ga0079104_1011892 | 3300006946 | Bacteria | 2768 |
| 80 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 81 | Ga0105237_10001344 | 3300009545 | Bacteria | 32586 |
| 82 | Ga0105239_10003591 | 3300010375 | Bacteria | 18945 |
| 83 | Ga0105239_10329586 | 3300010375 | Bacteria | 1722 |
| 84 | Ga0157319_1002443 | 3300012497 | Bacteria | 1069 |
| 85 | Ga0157371_10012507 | 3300013102 | Bacteria | 6486 |
| 86 | Ga0157370_10000948 | 3300013104 | Bacteria | 36781 |
| 87 | Ga0157369_10096384 | 3300013105 | Bacteria | 3156 |
| 88 | Ga0157369_10158503 | 3300013105 | Bacteria | 2390 |
| 89 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 90 | Ga0157378_11306727 | 3300013297 | Bacteria | 767 |
| 91 | Ga0163162_10316912 | 3300013306 | Bacteria | 1692 |
| 92 | Ga0182008_10078580 | 3300014497 | Bacteria | 1623 |
| 93 | Ga0182007_10002187 | 3300015262 | Bacteria | 9922 |
| 94 | Ga0182005_1003334 | 3300015265 | Bacteria | 5475 |
| 95 | Ga0183363_1430 | 3300015690 | Bacteria | 3144 |
| 96 | Ga0163161_11422499 | 3300017792 | Bacteria | 606 |
| 97 | Ga0214544_1000265 | 3300021320 | Bacteria | 87060 |
| 98 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 99 | Ga0214542_1020378 | 3300021321 | Bacteria | 4884 |
| 100 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 101 | Ga0214543_1000032 | 3300021327 | Bacteria | 200766 |
| 102 | Ga0209435_100045 | 3300025206 | Bacteria | 96483 |
| 103 | Ga0209760_107039 | 3300025207 | Bacteria | 871 |
| 104 | Ga0209436_100001 | 3300025208 | Bacteria | 304543 |
| 105 | Ga0209436_100333 | 3300025208 | Bacteria | 21394 |
| 106 | Ga0209672_102875 | 3300025228 | Bacteria | 3868 |
| 107 | Ga0209672_117561 | 3300025228 | Bacteria | 753 |
| 108 | Ga0209563_103879 | 3300025230 | Bacteria | 2978 |
| 109 | Ga0207427_106592 | 3300025231 | Bacteria | 1452 |
| 110 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 111 | Ga0209437_100122 | 3300025233 | Bacteria | 201364 |
| 112 | Ga0207425_1002752 | 3300025245 | Bacteria | 5980 |
| 113 | Ga0207425_1045841 | 3300025245 | Bacteria | 816 |
| 114 | Ga0207425_1059235 | 3300025245 | Bacteria | 679 |
| 115 | Ga0209646_1000154 | 3300025246 | Bacteria | 96483 |
| 116 | Ga0209646_1003813 | 3300025246 | Bacteria | 2877 |
| 117 | Ga0209026_1000177 | 3300025250 | Bacteria | 96629 |
| 118 | Ga0209677_100440 | 3300025253 | Bacteria | 24115 |
| 119 | Ga0209759_1000274 | 3300025256 | Bacteria | 72593 |
| 120 | Ga0209759_1041180 | 3300025256 | Bacteria | 794 |
| 121 | Ga0209129_1002592 | 3300025258 | Bacteria | 8661 |
| 122 | Ga0209129_1003488 | 3300025258 | Bacteria | 6797 |
| 123 | Ga0209129_1003511 | 3300025258 | Bacteria | 6776 |
| 124 | Ga0209129_1005991 | 3300025258 | Bacteria | 4082 |
| 125 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 126 | Ga0209233_1000170 | 3300025261 | Bacteria | 147527 |
| 127 | Ga0209233_1001493 | 3300025261 | Bacteria | 9197 |
| 128 | Ga0209565_1070826 | 3300025263 | Bacteria | 588 |
| 129 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 130 | Ga0209673_1001787 | 3300025273 | Bacteria | 17792 |
| 131 | Ga0209673_1022246 | 3300025273 | Bacteria | 2192 |
| 132 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 133 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 134 | Ga0209130_1034287 | 3300025284 | Bacteria | 1023 |
| 135 | Ga0209676_1000399 | 3300025292 | Bacteria | 79312 |
| 136 | Ga0209676_1013109 | 3300025292 | Bacteria | 3206 |
| 137 | Ga0209025_1000787 | 3300025294 | Bacteria | 52060 |
| 138 | Ga0209025_1000870 | 3300025294 | Bacteria | 47707 |
| 139 | Ga0209025_1007264 | 3300025294 | Bacteria | 8325 |
| 140 | Ga0209025_1027407 | 3300025294 | Bacteria | 2826 |
| 141 | Ga0209025_1029520 | 3300025294 | Bacteria | 2650 |
| 142 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 143 | Ga0209564_1000566 | 3300025295 | Bacteria | 58647 |
| 144 | Ga0209564_1000906 | 3300025295 | Bacteria | 38845 |
| 145 | Ga0209758_1000977 | 3300025297 | Bacteria | 38489 |
| 146 | Ga0209758_1001265 | 3300025297 | Bacteria | 31307 |
| 147 | Ga0209758_1001420 | 3300025297 | Bacteria | 28346 |
| 148 | Ga0209758_1002711 | 3300025297 | Bacteria | 17455 |
| 149 | Ga0209758_1008178 | 3300025297 | Bacteria | 6861 |
| 150 | Ga0209758_1055124 | 3300025297 | Bacteria | 1353 |
| 151 | Ga0209050_1000906 | 3300025298 | Bacteria | 39206 |
| 152 | Ga0209050_1001733 | 3300025298 | Bacteria | 21711 |
| 153 | Ga0209256_1000606 | 3300025299 | Bacteria | 49790 |
| 154 | Ga0209256_1000947 | 3300025299 | Bacteria | 35197 |
| 155 | Ga0209256_1001532 | 3300025299 | Bacteria | 23262 |
| 156 | Ga0209256_1002736 | 3300025299 | Bacteria | 13634 |
| 157 | Ga0209256_1010200 | 3300025299 | Bacteria | 3976 |
| 158 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 159 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 160 | Ga0209051_1001061 | 3300025303 | Bacteria | 25637 |
| 161 | Ga0209051_1002566 | 3300025303 | Bacteria | 12821 |
| 162 | Ga0209051_1003671 | 3300025303 | Bacteria | 9931 |
| 163 | Ga0209051_1045274 | 3300025303 | Bacteria | 1524 |
| 164 | Ga0209257_1001014 | 3300025304 | Bacteria | 37770 |
| 165 | Ga0209257_1001423 | 3300025304 | Bacteria | 28423 |
| 166 | Ga0209257_1057234 | 3300025304 | Bacteria | 1073 |
| 167 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 168 | Ga0207671_10000314 | 3300025914 | Bacteria | 71414 |
| 169 | Ga0207649_10300260 | 3300025920 | Bacteria | 1174 |
| 170 | Ga0207681_10513840 | 3300025923 | Bacteria | 982 |
| 171 | Ga0207650_10001911 | 3300025925 | Bacteria | 14671 |
| 172 | Ga0207644_10420203 | 3300025931 | Bacteria | 1095 |
| 173 | Ga0207712_10139481 | 3300025961 | Bacteria | 1859 |
| 174 | Ga0207640_10036793 | 3300025981 | Bacteria | 3076 |
| 175 | Ga0207702_10016488 | 3300026078 | Bacteria | 6114 |
| 176 | Ga0207702_10355219 | 3300026078 | Bacteria | 1403 |
| 177 | Ga0207698_10795544 | 3300026142 | Bacteria | 947 |
| 178 | Ga0209281_1000334 | 3300027111 | Bacteria | 81109 |
| 179 | Ga0209281_1000361 | 3300027111 | Bacteria | 74287 |
| 180 | Ga0209371_1011930 | 3300027312 | Bacteria | 2548 |
| 181 | Ga0209282_1000073 | 3300027666 | Bacteria | 81125 |
| 182 | Ga0209282_1000095 | 3300027666 | Bacteria | 60099 |
| 183 | Ga0268266_10202752 | 3300028379 | Bacteria | 1816 |
| 184 | Ga0307515_10001215 | 3300028794 | Bacteria | 58879 |
| 185 | Ga0307515_10001393 | 3300028794 | Bacteria | 54715 |
| 186 | Ga0307515_10038442 | 3300028794 | Bacteria | 7655 |
| 187 | Ga0307515_10258924 | 3300028794 | Bacteria | 1479 |
| 188 | Ga0268256_1012987 | 3300030500 | Bacteria | 2548 |
| 189 | Ga0307513_10046052 | 3300031456 | Bacteria | 4761 |
| 190 | Ga0307405_11246188 | 3300031731 | Bacteria | 645 |
| 191 | Ga0307412_10563049 | 3300031911 | Bacteria | 959 |
| 192 | Ga0307416_102118423 | 3300032002 | Bacteria | 664 |
| 193 | Ga0307414_12071045 | 3300032004 | Bacteria | 531 |
| 194 | Ga0315913_1000129 | 3300033430 | Bacteria | 48181 |
| 195 | Ga0373932_0422585 | 3300035112 | Bacteria | 519 |
| 196 | Ga0316574_0981343 | 3300035398 | Bacteria | 509 |
| 197 | Ga0316582_0250613 | 3300036647 | Bacteria | 1213 |
| 198 | Ga0395905_0000827 | 3300037471 | Bacteria | 40424 |
| 199 | Ga0395905_0006518 | 3300037471 | Bacteria | 11738 |
| 200 | Ga0395905_0609660 | 3300037471 | Bacteria | 993 |
| 201 | Ga0395905_1124358 | 3300037471 | Bacteria | 689 |
| 202 | Ga0395901_0447926 | 3300038443 | Bacteria | 1321 |
| 203 | Ga0439436_0112232 | 3300041404 | Bacteria | 761 |
| 204 | Ga0439438_070849 | 3300041405 | Bacteria | 863 |
| 205 | Ga0439461_0049033 | 3300041410 | Bacteria | 932 |
| 206 | Ga0439466_0114642 | 3300041411 | Bacteria | 834 |
| 207 | Ga0439465_0044118 | 3300041413 | Bacteria | 1448 |
| 208 | Ga0439465_0094279 | 3300041413 | Bacteria | 1027 |
| 209 | Ga0451793_1771588 | 3300041452 | Bacteria | 2505 |
| 210 | Ga0451833_1006218 | 3300041491 | Bacteria | 517 |
| 211 | Ga0451835_0689076 | 3300041492 | Bacteria | 2775 |
| 212 | Ga0451840_12231 | 3300041497 | Bacteria | 1258 |
| 213 | Ga0451841_0183806 | 3300041498 | Bacteria | 1424 |
| 214 | Ga0451846_02444 | 3300041502 | Bacteria | 1556 |
| 215 | Ga0451847_0483869 | 3300041503 | Bacteria | 603 |
| 216 | Ga0451847_0486657 | 3300041503 | Bacteria | 2072 |
| 217 | Ga0451848_08423 | 3300041504 | Bacteria | 784 |
| 218 | Ga0451849_0137763 | 3300041505 | Bacteria | 1088 |
| 219 | Ga0451850_51725 | 3300041506 | Bacteria | 1527 |
| 220 | Ga0451851_0203844 | 3300041507 | Bacteria | 774 |
| 221 | Ga0451854_17026 | 3300041510 | Bacteria | 1526 |
| 222 | Ga0451855_0606958 | 3300041511 | Bacteria | 985 |
| 223 | Ga0451853_3234756 | 3300041512 | Bacteria | 2743 |
| 224 | Ga0439449_0005864 | 3300042007 | Bacteria | 4695 |
| 225 | Ga0439457_017484 | 3300042014 | Bacteria | 1593 |
| 226 | Ga0466965_0188862 | 3300044683 | Bacteria | 1089 |
| 227 | Ga0466971_0319425 | 3300044719 | Bacteria | 748 |
| 228 | Ga0466968_0013912 | 3300044735 | Bacteria | 3172 |
| 229 | Ga0466970_0001159 | 3300044765 | Bacteria | 12775 |
| 230 | Ga0466957_0323890 | 3300044842 | Bacteria | 1040 |
| 231 | Ga0466959_0155850 | 3300045049 | Bacteria | 1607 |
| 232 | Ga0466958_0306419 | 3300045836 | Bacteria | 1020 |
| 233 | Ga0466967_0389383 | 3300045976 | Bacteria | 1355 |
| 234 | Ga0495638_0000597 | 3300046460 | Bacteria | 40647 |
| 235 | Ga0495638_0065247 | 3300046460 | Bacteria | 2241 |
| 236 | Ga0495650_0082159 | 3300046471 | Bacteria | 1240 |
| 237 | Ga0495585_0114385 | 3300046492 | Bacteria | 1432 |
| 238 | Ga0495596_0340851 | 3300046500 | Bacteria | 583 |
| 239 | Ga0495607_0014939 | 3300046501 | Bacteria | 5048 |
| 240 | Ga0495583_0047246 | 3300046506 | Bacteria | 1981 |
| 241 | Ga0495606_0005935 | 3300046507 | Bacteria | 11467 |
| 242 | Ga0495606_0031156 | 3300046507 | Bacteria | 3712 |
| 243 | Ga0495606_0065151 | 3300046507 | Bacteria | 2316 |
| 244 | Ga0495606_0377080 | 3300046507 | Bacteria | 745 |
| 245 | Ga0495610_0031394 | 3300046512 | Bacteria | 2772 |
| 246 | Ga0495610_0048705 | 3300046512 | Bacteria | 2079 |
| 247 | Ga0495616_0023559 | 3300046513 | Bacteria | 3310 |
| 248 | Ga0495616_0058559 | 3300046513 | Bacteria | 1897 |
| 249 | Ga0495620_0012510 | 3300046515 | Bacteria | 4378 |
| 250 | Ga0495631_0035705 | 3300046518 | Bacteria | 2222 |
| 251 | Ga0495632_0040920 | 3300046519 | Bacteria | 2331 |
| 252 | Ga0495632_0211342 | 3300046519 | Bacteria | 880 |
| 253 | Ga0495643_0036606 | 3300046522 | Bacteria | 2695 |
| 254 | Ga0495643_0083423 | 3300046522 | Bacteria | 1659 |
| 255 | Ga0495643_0142369 | 3300046522 | Bacteria | 1194 |
| 256 | Ga0495643_0316035 | 3300046522 | Bacteria | 707 |
| 257 | Ga0495654_0000641 | 3300046530 | Bacteria | 27579 |
| 258 | Ga0495654_0130829 | 3300046530 | Bacteria | 1127 |
| 259 | Ga0495597_0010628 | 3300046542 | Bacteria | 4490 |
| 260 | Ga0495597_0046866 | 3300046542 | Bacteria | 1915 |
| 261 | Ga0495668_0184666 | 3300046616 | Bacteria | 1142 |
| 262 | Ga0495625_0038160 | 3300046660 | Bacteria | 3518 |
| 263 | Ga0495625_0132496 | 3300046660 | Bacteria | 1687 |
| 264 | Ga0495625_0284198 | 3300046660 | Bacteria | 1063 |
| 265 | Ga0495625_0285028 | 3300046660 | Bacteria | 1062 |
| 266 | Ga0495625_0368167 | 3300046660 | Bacteria | 904 |
| 267 | Ga0495670_0118813 | 3300046691 | Bacteria | 1372 |
| 268 | Ga0495671_0060942 | 3300046692 | Bacteria | 1862 |
| 269 | Ga0495649_0060150 | 3300046694 | Bacteria | 2044 |
| 270 | Ga0495636_0141114 | 3300047318 | Bacteria | 1076 |
| 271 | Ga0495636_0330062 | 3300047318 | Bacteria | 717 |
| 272 | Ga0495672_0020846 | 3300047320 | Bacteria | 4287 |
| 273 | Ga0495687_203038 | 3300047443 | Bacteria | 628 |
| 274 | Ga0495679_072035 | 3300047446 | Bacteria | 994 |
| 275 | Ga0495681_0079294 | 3300047470 | Bacteria | 1469 |
| 276 | Ga0495686_0003870 | 3300047472 | Bacteria | 12635 |
| 277 | Ga0495686_0015546 | 3300047472 | Bacteria | 5190 |
| 278 | Ga0495686_0018766 | 3300047472 | Bacteria | 4633 |
| 279 | Ga0495686_0056345 | 3300047472 | Bacteria | 2456 |
| 280 | Ga0495686_0099843 | 3300047472 | Bacteria | 1752 |
| 281 | Ga0495686_0115104 | 3300047472 | Bacteria | 1609 |
| 282 | Ga0495615_0014893 | 3300048090 | Bacteria | 1652 |
| 283 | Ga0495615_0113248 | 3300048090 | Bacteria | 778 |
| 284 | Ga0496100_0607993 | 3300048903 | Bacteria | 849 |
| 285 | Ga0496102_0053430 | 3300048905 | Bacteria | 3682 |
| 286 | Ga0496103_0011652 | 3300048906 | Bacteria | 5215 |
| 287 | Ga0496106_0000801 | 3300048909 | Bacteria | 22763 |
| 288 | Ga0496106_0381654 | 3300048909 | Bacteria | 1132 |
| 289 | Ga0496106_0756981 | 3300048909 | Bacteria | 772 |
| 290 | Ga0496110_0061950 | 3300048913 | Bacteria | 3303 |
| 291 | Ga0496111_0018396 | 3300048914 | Bacteria | 4840 |
| 292 | Ga0496113_0136267 | 3300048916 | Bacteria | 1929 |
| 293 | Ga0496116_0050273 | 3300048919 | Bacteria | 2778 |
| 294 | Ga0496116_0110497 | 3300048919 | Bacteria | 1617 |
| 295 | Ga0496116_0260180 | 3300048919 | Bacteria | 856 |
| 296 | Ga0496117_0000641 | 3300048920 | Bacteria | 56335 |
| 297 | Ga0496117_0002492 | 3300048920 | Bacteria | 23104 |
| 298 | Ga0496117_0032556 | 3300048920 | Bacteria | 3959 |
| 299 | Ga0496117_0044740 | 3300048920 | Bacteria | 3204 |
| 300 | Ga0496117_0119160 | 3300048920 | Bacteria | 1626 |
| 301 | Ga0496118_0002255 | 3300048921 | Bacteria | 26416 |
| 302 | Ga0496118_0002788 | 3300048921 | Bacteria | 22874 |
| 303 | Ga0496118_0021378 | 3300048921 | Bacteria | 5697 |
| 304 | Ga0496118_0056313 | 3300048921 | Bacteria | 2957 |
| 305 | Ga0496118_0165800 | 3300048921 | Bacteria | 1358 |
| 306 | Ga0496118_0283407 | 3300048921 | Bacteria | 921 |
| 307 | Ga0496119_0032601 | 3300048922 | Bacteria | 3469 |
| 308 | Ga0496119_0033903 | 3300048922 | Bacteria | 3374 |
| 309 | Ga0496119_0058911 | 3300048922 | Bacteria | 2311 |
| 310 | Ga0496120_0011601 | 3300048923 | Bacteria | 6050 |
| 311 | Ga0496120_0030634 | 3300048923 | Bacteria | 3266 |
| 312 | Ga0496120_0045117 | 3300048923 | Bacteria | 2556 |
| 313 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 314 | Ga0496121_0000751 | 3300048924 | Bacteria | 59594 |
| 315 | Ga0496121_0003358 | 3300048924 | Bacteria | 22960 |
| 316 | Ga0496121_0015611 | 3300048924 | Bacteria | 7931 |
| 317 | Ga0496121_0031398 | 3300048924 | Bacteria | 4853 |
| 318 | Ga0496121_0091314 | 3300048924 | Bacteria | 2378 |
| 319 | Ga0496121_0189522 | 3300048924 | Bacteria | 1476 |
| 320 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 321 | Ga0496122_0000399 | 3300048925 | Bacteria | 92476 |
| 322 | Ga0496122_0003165 | 3300048925 | Bacteria | 21967 |
| 323 | Ga0496122_0007138 | 3300048925 | Bacteria | 12531 |
| 324 | Ga0496122_0008228 | 3300048925 | Bacteria | 11322 |
| 325 | Ga0496122_0016386 | 3300048925 | Bacteria | 7015 |
| 326 | Ga0496122_0074908 | 3300048925 | Bacteria | 2391 |
| 327 | Ga0496122_0122567 | 3300048925 | Bacteria | 1672 |
| 328 | Ga0496123_0000054 | 3300048926 | Bacteria | 234046 |
| 329 | Ga0496123_0002112 | 3300048926 | Bacteria | 25505 |
| 330 | Ga0496123_0010688 | 3300048926 | Bacteria | 8073 |
| 331 | Ga0496123_0018189 | 3300048926 | Bacteria | 5605 |
| 332 | Ga0496123_0049479 | 3300048926 | Bacteria | 2817 |
| 333 | Ga0496123_0065931 | 3300048926 | Bacteria | 2297 |
| 334 | Ga0496123_0129005 | 3300048926 | Bacteria | 1405 |
| 335 | Ga0496123_0359006 | 3300048926 | Bacteria | 675 |
| 336 | Ga0496124_0002648 | 3300048927 | Bacteria | 23011 |
| 337 | Ga0496124_0008646 | 3300048927 | Bacteria | 10606 |
| 338 | Ga0496124_0012897 | 3300048927 | Bacteria | 8204 |
| 339 | Ga0496124_0036616 | 3300048927 | Bacteria | 4278 |
| 340 | Ga0496124_0084961 | 3300048927 | Bacteria | 2594 |
| 341 | Ga0496124_0088991 | 3300048927 | Bacteria | 2522 |
| 342 | Ga0496124_0214638 | 3300048927 | Bacteria | 1453 |
| 343 | Ga0496124_0428850 | 3300048927 | Bacteria | 908 |
| 344 | Ga0496124_0608190 | 3300048927 | Bacteria | 709 |
| 345 | Ga0496124_0637151 | 3300048927 | Bacteria | 687 |
| 346 | Ga0496124_0759022 | 3300048927 | Bacteria | 606 |
| 347 | Ga0496125_0000141 | 3300048928 | Bacteria | 158991 |
| 348 | Ga0496125_0001650 | 3300048928 | Bacteria | 31436 |
| 349 | Ga0496125_0021828 | 3300048928 | Bacteria | 5957 |
| 350 | Ga0496125_0051706 | 3300048928 | Bacteria | 3386 |
| 351 | Ga0496125_0338138 | 3300048928 | Bacteria | 905 |
| 352 | Ga0496125_0342169 | 3300048928 | Bacteria | 897 |
| 353 | Ga0496125_0438316 | 3300048928 | Bacteria | 752 |
| 354 | Ga0496126_0001055 | 3300048929 | Bacteria | 46595 |
| 355 | Ga0496126_0020807 | 3300048929 | Bacteria | 6421 |
| 356 | Ga0496126_0068999 | 3300048929 | Bacteria | 3155 |
| 357 | Ga0495678_029785 | 3300049459 | Bacteria | 2290 |
| 358 | Ga0501031_0043880 | 3300049568 | Bacteria | 2917 |
| 359 | Ga0501032_0040703 | 3300049569 | Bacteria | 3158 |
| 360 | Ga0501032_0085344 | 3300049569 | Bacteria | 2099 |
| 361 | Ga0501032_0252683 | 3300049569 | Bacteria | 1144 |
| 362 | Ga0501033_0000118 | 3300049570 | Bacteria | 75690 |
| 363 | Ga0501033_0028448 | 3300049570 | Bacteria | 4198 |
| 364 | Ga0501033_0376166 | 3300049570 | Bacteria | 993 |
| 365 | Ga0501034_0102139 | 3300049571 | Bacteria | 2860 |
| 366 | Ga0501034_0167499 | 3300049571 | Bacteria | 2165 |
| 367 | Ga0501036_0062044 | 3300049572 | Bacteria | 3166 |
| 368 | Ga0501037_0215004 | 3300049573 | Bacteria | 1354 |
| 369 | Ga0501038_0025657 | 3300049574 | Bacteria | 5250 |
| 370 | Ga0501038_0375140 | 3300049574 | Bacteria | 1104 |
| 371 | Ga0501039_0495514 | 3300049575 | Bacteria | 959 |
| 372 | Ga0501043_0745639 | 3300049579 | Bacteria | 712 |
| 373 | Ga0501043_0789076 | 3300049579 | Bacteria | 688 |
| 374 | Ga0501047_0102950 | 3300049581 | Bacteria | 2735 |
| 375 | Ga0501048_0508220 | 3300049582 | Bacteria | 864 |
| 376 | Ga0501067_0197042 | 3300049583 | Bacteria | 1122 |
| 377 | Ga0501068_0260229 | 3300049584 | Bacteria | 1107 |
| 378 | Ga0501073_0036549 | 3300049589 | Bacteria | 3490 |
| 379 | Ga0501080_0132818 | 3300049742 | Bacteria | 2304 |
| 380 | Ga0501083_0052901 | 3300049744 | Bacteria | 2726 |
| 381 | Ga0501083_0330634 | 3300049744 | Bacteria | 991 |
| 382 | Ga0501280_002116 | 3300049776 | Bacteria | 3421 |
| 383 | Ga0501280_038125 | 3300049776 | Bacteria | 771 |
| 384 | Ga0501035_0002363 | 3300049822 | Bacteria | 18561 |
| 385 | Ga0501035_0525970 | 3300049822 | Bacteria | 971 |
| 386 | Ga0501035_0552929 | 3300049822 | Bacteria | 942 |
| 387 | Ga0501035_0848203 | 3300049822 | Bacteria | 727 |
| 388 | Ga0501035_1302068 | 3300049822 | Bacteria | 560 |
| 389 | Ga0501044_0106883 | 3300049823 | Bacteria | 2810 |
| 390 | Ga0501044_0142973 | 3300049823 | Bacteria | 2380 |
| 391 | Ga0501045_0113532 | 3300049824 | Bacteria | 2009 |
| 392 | nmdc:mga00v17_291_c1 | 3300050491 | Bacteria | 29216 |
| 393 | nmdc:mga00v17_42712_c1 | 3300050491 | Bacteria | 2728 |
| 394 | nmdc:mga0yw44_516265_c1 | 3300050492 | Bacteria | 811 |
| 395 | nmdc:mga0k408_215936_c1 | 3300050493 | Bacteria | 1145 |
| 396 | nmdc:mga0k408_451596_c1 | 3300050493 | Bacteria | 763 |
| 397 | nmdc:mga06z11_293392_c1 | 3300050494 | Bacteria | 965 |
| 398 | nmdc:mga0n895_430661_c1 | 3300050512 | Bacteria | 1333 |
| 399 | nmdc:mga0rr50_583495_c1 | 3300050513 | Bacteria | 952 |
| 400 | nmdc:mga0a205_596688_c1 | 3300050515 | Bacteria | 958 |
| 401 | nmdc:mga0sz30_3070_c1 | 3300050516 | Bacteria | 4255 |
| 402 | Ga0500578_0044842 | 3300053086 | Bacteria | 2837 |
| 403 | Ga0500644_0005315 | 3300053088 | Bacteria | 3248 |
| 404 | Ga0500646_0233981 | 3300053090 | Bacteria | 641 |
| 405 | Ga0500654_103001 | 3300053099 | Bacteria | 1208 |
| 406 | Ga0500556_0237166 | 3300053104 | Bacteria | 719 |
| 407 | Ga0500572_116256 | 3300053111 | Bacteria | 864 |
| 408 | Ga0500618_000125 | 3300053125 | Bacteria | 63168 |
| 409 | Ga0500618_000289 | 3300053125 | Bacteria | 38453 |
| 410 | Ga0500618_009145 | 3300053125 | Bacteria | 2720 |
| 411 | Ga0500618_015691 | 3300053125 | Bacteria | 1909 |
| 412 | Ga0500628_046983 | 3300053129 | Bacteria | 1010 |
| 413 | Ga0500655_007893 | 3300053133 | Bacteria | 1917 |
| 414 | Ga0500658_0000162 | 3300053134 | Bacteria | 32065 |
| 415 | Ga0500658_0213842 | 3300053134 | Bacteria | 883 |
| 416 | Ga0500559_0007060 | 3300053136 | Bacteria | 5009 |
| 417 | Ga0500568_0000411 | 3300053139 | Bacteria | 32773 |
| 418 | Ga0500568_0001577 | 3300053139 | Bacteria | 14417 |
| 419 | Ga0500568_0057248 | 3300053139 | Bacteria | 1517 |
| 420 | Ga0500573_0008408 | 3300053140 | Bacteria | 5684 |
| 421 | Ga0500573_0013003 | 3300053140 | Bacteria | 4682 |
| 422 | Ga0500577_0108487 | 3300053142 | Bacteria | 1143 |
| 423 | Ga0500604_0003667 | 3300053151 | Bacteria | 4125 |
| 424 | Ga0500604_0129644 | 3300053151 | Bacteria | 847 |
| 425 | Ga0500616_0000661 | 3300053153 | Bacteria | 41050 |
| 426 | Ga0500616_0001852 | 3300053153 | Bacteria | 19135 |
| 427 | Ga0500616_0012405 | 3300053153 | Bacteria | 4987 |
| 428 | Ga0500622_0000428 | 3300053156 | Bacteria | 39928 |
| 429 | Ga0500622_0000956 | 3300053156 | Bacteria | 24552 |
| 430 | Ga0500622_0068032 | 3300053156 | Bacteria | 1805 |
| 431 | Ga0500627_0292184 | 3300053158 | Bacteria | 713 |
| 432 | Ga0500645_066116 | 3300053730 | Bacteria | 1041 |
| 433 | Ga0587073_0003572 | 3300059492 | Bacteria | 2146 |
| 434 | Ga0587088_000751 | 3300059508 | Bacteria | 2957 |
| 435 | Ga0587088_019463 | 3300059508 | Bacteria | 1116 |
| 436 | Ga0587075_000934 | 3300059644 | Bacteria | 2634 |
| 437 | Ga0587078_061485 | 3300059646 | Bacteria | 570 |
| 438 | Ga0587079_037095 | 3300059647 | Bacteria | 967 |
| 439 | Ga0501082_0044180 | 3300060353 | Bacteria | 3844 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027666 | Ga0209282_1000095 | Ga0209282_100009524 | 128 |
| 2 | 3300003322 | rootL2_10141239 | rootL2_101412392 | 135 |
| 3 | 3300005937 | Ga0081455_10210237 | Ga0081455_102102372 | 135 |
| 4 | 3300006871 | Ga0075434_100106989 | Ga0075434_1001069893 | 135 |
| 5 | 3300050512 | nmdc:mga0n895_430661_c1 | nmdc:mga0n895_430661_c1_27_452 | 135 |
| 6 | 3300050513 | nmdc:mga0rr50_583495_c1 | nmdc:mga0rr50_583495_c1_221_646 | 135 |
| 7 | 3300050515 | nmdc:mga0a205_596688_c1 | nmdc:mga0a205_596688_c1_419_844 | 135 |
| 8 | 3300002773 | JGI25152J39213_1006003 | JGI25152J39213_10060032 | 136 |
| 9 | 3300003215 | JGI25153J46596_10004125 | JGI25153J46596_1000412510 | 136 |
| 10 | 3300003316 | rootH1_10058669 | rootH1_100586693 | 136 |
| 11 | 3300003354 | JGI25160J50197_1002563 | JGI25160J50197_10025639 | 136 |
| 12 | 3300003374 | JGI25161J50226_1000346 | JGI25161J50226_10003467 | 136 |
| 13 | 3300003771 | Ga0055526_1020769 | Ga0055526_10207693 | 136 |
| 14 | 3300003792 | Ga0055540_1001521 | Ga0055540_100152112 | 136 |
| 15 | 3300003794 | Ga0055531_10067209 | Ga0055531_100672092 | 136 |
| 16 | 3300004625 | Ga0055543_1000032 | Ga0055543_100003234 | 136 |
| 17 | 3300005262 | Ga0065165_1003840 | Ga0065165_10038404 | 136 |
| 18 | 3300005337 | Ga0070682_100207910 | Ga0070682_1002079102 | 136 |
| 19 | 3300006353 | Ga0075370_10815880 | Ga0075370_108158802 | 136 |
| 20 | 3300025208 | Ga0209436_100001 | Ga0209436_10000155 | 136 |
| 21 | 3300025258 | Ga0209129_1002592 | Ga0209129_10025922 | 136 |
| 22 | 3300025273 | Ga0209673_1001787 | Ga0209673_10017873 | 136 |
| 23 | 3300025284 | Ga0209130_1000004 | Ga0209130_100000457 | 136 |
| 24 | 3300025295 | Ga0209564_1000566 | Ga0209564_100056644 | 136 |
| 25 | 3300025297 | Ga0209758_1008178 | Ga0209758_10081782 | 136 |
| 26 | 3300025299 | Ga0209256_1002736 | Ga0209256_10027367 | 136 |
| 27 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003671 | 136 |
| 28 | 3300025303 | Ga0209051_1003671 | Ga0209051_10036714 | 136 |
| 29 | 3300025304 | Ga0209257_1057234 | Ga0209257_10572342 | 136 |
| 30 | 3300025920 | Ga0207649_10300260 | Ga0207649_103002602 | 136 |
| 31 | 3300028794 | Ga0307515_10258924 | Ga0307515_102589241 | 136 |
| 32 | 3300048927 | Ga0496124_0214638 | Ga0496124_0214638_672_1124 | 136 |
| 33 | 3300059508 | Ga0587088_019463 | Ga0587088_019463_455_907 | 136 |
| 34 | 3300059647 | Ga0587079_037095 | Ga0587079_037095_503_955 | 136 |
| 35 | iso_pu_bacteria | 2765235802 | 2765466060 | 136 |
| 36 | iso_pu_bacteria | 2904578770 | 2904583334 | 136 |
| 37 | iso_pu_bacteria | 2919119836 | 2919121046 | 136 |
| 38 | 3300006038 | Ga0075365_10027350 | Ga0075365_100273505 | 137 |
| 39 | 3300006051 | Ga0075364_11005233 | Ga0075364_110052331 | 137 |
| 40 | 3300025294 | Ga0209025_1027407 | Ga0209025_10274073 | 137 |
| 41 | 3300050494 | nmdc:mga06z11_293392_c1 | nmdc:mga06z11_293392_c1_471_887 | 137 |
| 42 | iso_pu_bacteria | 2758568016 | 2758641674 | 137 |
| 43 | iso_pu_bacteria | 2775506902 | 2776271677 | 137 |
| 44 | iso_pu_bacteria | 2775506904 | 2776279811 | 137 |
| 45 | iso_pu_bacteria | 2854911287 | 2854911960 | 137 |
| 46 | 3300049571 | Ga0501034_0102139 | Ga0501034_0102139_1285_1737 | 138 |
| 47 | 3300049572 | Ga0501036_0062044 | Ga0501036_0062044_522_974 | 138 |
| 48 | 3300049573 | Ga0501037_0215004 | Ga0501037_0215004_707_1159 | 138 |
| 49 | 3300049574 | Ga0501038_0375140 | Ga0501038_0375140_114_566 | 138 |
| 50 | 3300049575 | Ga0501039_0495514 | Ga0501039_0495514_114_566 | 138 |
| 51 | 3300049579 | Ga0501043_0745639 | Ga0501043_0745639_72_524 | 138 |
| 52 | 3300049582 | Ga0501048_0508220 | Ga0501048_0508220_244_696 | 138 |
| 53 | 3300049744 | Ga0501083_0330634 | Ga0501083_0330634_301_753 | 138 |
| 54 | 3300049822 | Ga0501035_1302068 | Ga0501035_1302068_12_464 | 138 |
| 55 | 3300049823 | Ga0501044_0106883 | Ga0501044_0106883_941_1393 | 138 |
| 56 | 3300002773 | JGI25152J39213_1027029 | JGI25152J39213_10270291 | 139 |
| 57 | 3300002773 | JGI25152J39213_1027068 | JGI25152J39213_10270681 | 139 |
| 58 | 3300002774 | JGI25150J39212_1011557 | JGI25150J39212_10115572 | 139 |
| 59 | 3300003187 | JGI25151J46595_10045366 | JGI25151J46595_100453662 | 139 |
| 60 | 3300003215 | JGI25153J46596_10068665 | JGI25153J46596_100686651 | 139 |
| 61 | 3300003215 | JGI25153J46596_10068750 | JGI25153J46596_100687501 | 139 |
| 62 | 3300003775 | Ga0055524_1001365 | Ga0055524_100136512 | 139 |
| 63 | 3300025245 | Ga0207425_1002752 | Ga0207425_10027522 | 139 |
| 64 | 3300025258 | Ga0209129_1003488 | Ga0209129_10034886 | 139 |
| 65 | 3300025258 | Ga0209129_1003511 | Ga0209129_10035116 | 139 |
| 66 | 3300025294 | Ga0209025_1007264 | Ga0209025_100726411 | 139 |
| 67 | 3300025294 | Ga0209025_1029520 | Ga0209025_10295203 | 139 |
| 68 | 3300025297 | Ga0209758_1000977 | Ga0209758_100097712 | 139 |
| 69 | 3300025297 | Ga0209758_1001420 | Ga0209758_100142014 | 139 |
| 70 | 3300041410 | Ga0439461_0049033 | Ga0439461_0049033_430_882 | 139 |
| 71 | 3300041413 | Ga0439465_0094279 | Ga0439465_0094279_374_826 | 139 |
| 72 | 3300041491 | Ga0451833_1006218 | Ga0451833_1006218_41_463 | 139 |
| 73 | 3300046660 | Ga0495625_0285028 | Ga0495625_0285028_62_484 | 139 |
| 74 | 3300048090 | Ga0495615_0113248 | Ga0495615_0113248_175_627 | 139 |
| 75 | 3300048926 | Ga0496123_0359006 | Ga0496123_0359006_65_517 | 139 |
| 76 | 3300049569 | Ga0501032_0085344 | Ga0501032_0085344_1122_1574 | 139 |
| 77 | 3300049570 | Ga0501033_0376166 | Ga0501033_0376166_525_977 | 139 |
| 78 | 3300049579 | Ga0501043_0789076 | Ga0501043_0789076_16_468 | 139 |
| 79 | 3300049581 | Ga0501047_0102950 | Ga0501047_0102950_642_1094 | 139 |
| 80 | 3300049583 | Ga0501067_0197042 | Ga0501067_0197042_329_781 | 139 |
| 81 | 3300049584 | Ga0501068_0260229 | Ga0501068_0260229_557_1009 | 139 |
| 82 | 3300049589 | Ga0501073_0036549 | Ga0501073_0036549_1011_1463 | 139 |
| 83 | 3300049744 | Ga0501083_0052901 | Ga0501083_0052901_1149_1601 | 139 |
| 84 | 3300050492 | nmdc:mga0yw44_516265_c1 | nmdc:mga0yw44_516265_c1_280_702 | 139 |
| 85 | 3300059492 | Ga0587073_0003572 | Ga0587073_0003572_82_531 | 139 |
| 86 | 3300059508 | Ga0587088_000751 | Ga0587088_000751_887_1336 | 139 |
| 87 | 3300059644 | Ga0587075_000934 | Ga0587075_000934_576_1025 | 139 |
| 88 | 3300060353 | Ga0501082_0044180 | Ga0501082_0044180_979_1431 | 139 |
| 89 | iso_pu_bacteria | 2840764183 | 2840770001 | 139 |
| 90 | 3300003320 | rootH2_10006547 | rootH2_100065472 | 141 |
| 91 | 3300003322 | rootL2_10001427 | rootL2_1000142712 | 141 |
| 92 | 3300003323 | rootH1_10140377 | rootH1_101403772 | 141 |
| 93 | 3300045976 | Ga0466967_0389383 | Ga0466967_0389383_440_889 | 141 |
| 94 | 3300025256 | Ga0209759_1041180 | Ga0209759_10411802 | 142 |
| 95 | 3300027312 | Ga0209371_1011930 | Ga0209371_10119302 | 142 |
| 96 | 3300030500 | Ga0268256_1012987 | Ga0268256_10129873 | 142 |
| 97 | 3300048925 | Ga0496122_0007138 | Ga0496122_0007138_897_1361 | 142 |
| 98 | 3300035112 | Ga0373932_0422585 | Ga0373932_0422585_11_442 | 143 |
| 99 | 3300048909 | Ga0496106_0756981 | Ga0496106_0756981_130_561 | 143 |
| 100 | iso_pu_bacteria | 2582581316 | 2585333739 | 143 |
| 101 | iso_pu_bacteria | 8005246636 | 8005250718 | 144 |
| 102 | iso_pu_bacteria | 2510461069 | 2510842691 | 145 |
| 103 | iso_pu_bacteria | 2510917022 | 2511134994 | 145 |
| 104 | iso_pu_bacteria | 2524023209 | 2524460534 | 145 |
| 105 | iso_pu_bacteria | 2582581307 | 2585270733 | 145 |
| 106 | iso_pu_bacteria | 2582581308 | 2585277081 | 145 |
| 107 | iso_pu_bacteria | 2582581315 | 2585323911 | 145 |
| 108 | iso_pu_bacteria | 2585427527 | 2585534181 | 145 |
| 109 | iso_pu_bacteria | 2585427530 | 2585551966 | 145 |
| 110 | iso_pu_bacteria | 2585427531 | 2585558456 | 145 |
| 111 | iso_pu_bacteria | 2585427608 | 2585897826 | 145 |
| 112 | iso_pu_bacteria | 2585427609 | 2585904574 | 145 |
| 113 | iso_pu_bacteria | 2585428125 | 2587980310 | 145 |
| 114 | iso_pu_bacteria | 2615840626 | 2616308457 | 145 |
| 115 | iso_pu_bacteria | 2615840698 | 2616556455 | 145 |
| 116 | iso_pu_bacteria | 2617270742 | 2617385101 | 145 |
| 117 | iso_pu_bacteria | 2643221653 | 2644300365 | 145 |
| 118 | iso_pu_bacteria | 2643221719 | 2644658589 | 145 |
| 119 | iso_pu_bacteria | 2667528174 | 2671116437 | 145 |
| 120 | iso_pu_bacteria | 2775507266 | 2778177798 | 145 |
| 121 | iso_pu_bacteria | 2818991272 | 2819242016 | 145 |
| 122 | iso_pu_bacteria | 2818991448 | 2819612868 | 145 |
| 123 | iso_pu_bacteria | 2818991453 | 2819638029 | 145 |
| 124 | iso_pu_bacteria | 2818991461 | 2819688612 | 145 |
| 125 | iso_pu_bacteria | 2838029111 | 2838030216 | 145 |
| 126 | iso_pu_bacteria | 2842298080 | 2842301714 | 145 |
| 127 | iso_pu_bacteria | 2842357229 | 2842357367 | 145 |
| 128 | iso_pu_bacteria | 2842475841 | 2842476499 | 145 |
| 129 | iso_pu_bacteria | 2842482326 | 2842488394 | 145 |
| 130 | iso_pu_bacteria | 2842502639 | 2842503744 | 145 |
| 131 | iso_pu_bacteria | 2842509118 | 2842510332 | 145 |
| 132 | iso_pu_bacteria | 2852387548 | 2852389771 | 145 |
| 133 | iso_pu_bacteria | 2855872281 | 2855873383 | 145 |
| 134 | iso_pu_bacteria | 2919408235 | 2919411811 | 145 |
| 135 | iso_pu_bacteria | 2989776772 | 2989778708 | 145 |
| 136 | iso_pu_bacteria | 3005416602 | 3005420224 | 145 |
| 137 | iso_pu_bacteria | 8005314921 | 8005317175 | 145 |
| 138 | iso_pu_bacteria | 8005484373 | 8005485025 | 145 |
| 139 | iso_pu_bacteria | 8005645114 | 8005648762 | 145 |
| 140 | iso_pu_bacteria | 8005658619 | 8005659269 | 145 |
| 141 | iso_pu_bacteria | 8005682033 | 8005683314 | 145 |
| 142 | iso_pu_bacteria | 8024486573 | 8024488735 | 145 |
| 143 | iso_pu_bacteria | 8046767195 | 8046769427 | 145 |
| 144 | iso_pu_bacteria | 8055431914 | 8055435063 | 145 |
| 145 | iso_pu_bacteria | 8057575449 | 8057578888 | 145 |
| 146 | iso_pu_bacteria | 2508501122 | 2509107915 | 146 |
| 147 | iso_pu_bacteria | 2509276019 | 2509375703 | 146 |
| 148 | iso_pu_bacteria | 2509276021 | 2509386809 | 146 |
| 149 | iso_pu_bacteria | 2509276033 | 2509442356 | 146 |
| 150 | iso_pu_bacteria | 2510065057 | 2510307010 | 146 |
| 151 | iso_pu_bacteria | 2510461076 | 2510894545 | 146 |
| 152 | iso_pu_bacteria | 2511231052 | 2511501327 | 146 |
| 153 | iso_pu_bacteria | 2512047086 | 2512532748 | 146 |
| 154 | iso_pu_bacteria | 2513237084 | 2513572225 | 146 |
| 155 | iso_pu_bacteria | 2513237085 | 2513579594 | 146 |
| 156 | iso_pu_bacteria | 2513237086 | 2513587081 | 146 |
| 157 | iso_pu_bacteria | 2513237091 | 2513617841 | 146 |
| 158 | iso_pu_bacteria | 2513237093 | 2513634366 | 146 |
| 159 | iso_pu_bacteria | 2513237103 | 2513708858 | 146 |
| 160 | iso_pu_bacteria | 2513237140 | 2513880726 | 146 |
| 161 | iso_pu_bacteria | 2513237143 | 2513906727 | 146 |
| 162 | iso_pu_bacteria | 2513237162 | 2514022802 | 146 |
| 163 | iso_pu_bacteria | 2515075009 | 2515112141 | 146 |
| 164 | iso_pu_bacteria | 2515154107 | 2515611533 | 146 |
| 165 | iso_pu_bacteria | 2515154113 | 2515635608 | 146 |
| 166 | iso_pu_bacteria | 2515154114 | 2515646192 | 146 |
| 167 | iso_pu_bacteria | 2515154116 | 2515657284 | 146 |
| 168 | iso_pu_bacteria | 2515154134 | 2515738711 | 146 |
| 169 | iso_pu_bacteria | 2516143018 | 2516209201 | 146 |
| 170 | iso_pu_bacteria | 2516653046 | 2516892606 | 146 |
| 171 | iso_pu_bacteria | 2516653085 | 2517076263 | 146 |
| 172 | iso_pu_bacteria | 2517287029 | 2517406653 | 146 |
| 173 | iso_pu_bacteria | 2519899620 | 2520379371 | 146 |
| 174 | iso_pu_bacteria | 2524023207 | 2524452834 | 146 |
| 175 | iso_pu_bacteria | 2529292951 | 2530645398 | 146 |
| 176 | iso_pu_bacteria | 2537561587 | 2537876560 | 146 |
| 177 | iso_pu_bacteria | 2551306084 | 2551682239 | 146 |
| 178 | iso_pu_bacteria | 2551306085 | 2551683770 | 146 |
| 179 | iso_pu_bacteria | 2551306086 | 2551695804 | 146 |
| 180 | iso_pu_bacteria | 2551306087 | 2551704803 | 146 |
| 181 | iso_pu_bacteria | 2551306089 | 2551709647 | 146 |
| 182 | iso_pu_bacteria | 2551306090 | 2551719589 | 146 |
| 183 | iso_pu_bacteria | 2551306091 | 2551728675 | 146 |
| 184 | iso_pu_bacteria | 2551306092 | 2551732135 | 146 |
| 185 | iso_pu_bacteria | 2551306093 | 2551744647 | 146 |
| 186 | iso_pu_bacteria | 2554235003 | 2554247824 | 146 |
| 187 | iso_pu_bacteria | 2558860100 | 2558863172 | 146 |
| 188 | iso_pu_bacteria | 2558860242 | 2559294954 | 146 |
| 189 | iso_pu_bacteria | 2582581283 | 2585168231 | 146 |
| 190 | iso_pu_bacteria | 2582581298 | 2585224223 | 146 |
| 191 | iso_pu_bacteria | 2582581306 | 2585268866 | 146 |
| 192 | iso_pu_bacteria | 2582581865 | 2585391413 | 146 |
| 193 | iso_pu_bacteria | 2585427526 | 2585529824 | 146 |
| 194 | iso_pu_bacteria | 2585427528 | 2585542326 | 146 |
| 195 | iso_pu_bacteria | 2585427529 | 2585546344 | 146 |
| 196 | iso_pu_bacteria | 2585427593 | 2585838817 | 146 |
| 197 | iso_pu_bacteria | 2599185156 | 2599333464 | 146 |
| 198 | iso_pu_bacteria | 2599185210 | 2599601349 | 146 |
| 199 | iso_pu_bacteria | 2599185352 | 2600192265 | 146 |
| 200 | iso_pu_bacteria | 2600255308 | 2601744767 | 146 |
| 201 | iso_pu_bacteria | 2615840624 | 2616292592 | 146 |
| 202 | iso_pu_bacteria | 2643221557 | 2643808346 | 146 |
| 203 | iso_pu_bacteria | 2643221582 | 2643919448 | 146 |
| 204 | iso_pu_bacteria | 2643221610 | 2644066560 | 146 |
| 205 | iso_pu_bacteria | 2643221618 | 2644109589 | 146 |
| 206 | iso_pu_bacteria | 2643221626 | 2644145273 | 146 |
| 207 | iso_pu_bacteria | 2643221637 | 2644207656 | 146 |
| 208 | iso_pu_bacteria | 2643221655 | 2644310978 | 146 |
| 209 | iso_pu_bacteria | 2643221659 | 2644332631 | 146 |
| 210 | iso_pu_bacteria | 2643221668 | 2644378149 | 146 |
| 211 | iso_pu_bacteria | 2643221675 | 2644415227 | 146 |
| 212 | iso_pu_bacteria | 2643221680 | 2644450372 | 146 |
| 213 | iso_pu_bacteria | 2643221688 | 2644494765 | 146 |
| 214 | iso_pu_bacteria | 2643221689 | 2644499154 | 146 |
| 215 | iso_pu_bacteria | 2643221693 | 2644522350 | 146 |
| 216 | iso_pu_bacteria | 2643221698 | 2644544376 | 146 |
| 217 | iso_pu_bacteria | 2643221712 | 2644613944 | 146 |
| 218 | iso_pu_bacteria | 2643221718 | 2644654537 | 146 |
| 219 | iso_pu_bacteria | 2643221723 | 2644677843 | 146 |
| 220 | iso_pu_bacteria | 2643221726 | 2644687924 | 146 |
| 221 | iso_pu_bacteria | 2657244999 | 2657683750 | 146 |
| 222 | iso_pu_bacteria | 2690316117 | 2692316480 | 146 |
| 223 | iso_pu_bacteria | 2718217882 | 2719181047 | 146 |
| 224 | iso_pu_bacteria | 2718217927 | 2719385660 | 146 |
| 225 | iso_pu_bacteria | 2718217997 | 2719665481 | 146 |
| 226 | iso_pu_bacteria | 2718218009 | 2719731796 | 146 |
| 227 | iso_pu_bacteria | 2718218199 | 2720491901 | 146 |
| 228 | iso_pu_bacteria | 2718218232 | 2720613168 | 146 |
| 229 | iso_pu_bacteria | 2718218233 | 2720620023 | 146 |
| 230 | iso_pu_bacteria | 2718218235 | 2720631448 | 146 |
| 231 | iso_pu_bacteria | 2718218269 | 2720775176 | 146 |
| 232 | iso_pu_bacteria | 2718218363 | 2721147141 | 146 |
| 233 | iso_pu_bacteria | 2718218365 | 2721158675 | 146 |
| 234 | iso_pu_bacteria | 2718218366 | 2721164059 | 146 |
| 235 | iso_pu_bacteria | 2718218423 | 2721399442 | 146 |
| 236 | iso_pu_bacteria | 2721755514 | 2722840229 | 146 |
| 237 | iso_pu_bacteria | 2721755556 | 2723026813 | 146 |
| 238 | iso_pu_bacteria | 2721755684 | 2723560430 | 146 |
| 239 | iso_pu_bacteria | 2721755685 | 2723566995 | 146 |
| 240 | iso_pu_bacteria | 2721755809 | 2724038255 | 146 |
| 241 | iso_pu_bacteria | 2721755810 | 2724044552 | 146 |
| 242 | iso_pu_bacteria | 2721755819 | 2724089783 | 146 |
| 243 | iso_pu_bacteria | 2721755822 | 2724104260 | 146 |
| 244 | iso_pu_bacteria | 2721755823 | 2724110074 | 146 |
| 245 | iso_pu_bacteria | 2724679232 | 2725951244 | 146 |
| 246 | iso_pu_bacteria | 2728369352 | 2730107749 | 146 |
| 247 | iso_pu_bacteria | 2728369365 | 2730164284 | 146 |
| 248 | iso_pu_bacteria | 2728369397 | 2730298307 | 146 |
| 249 | iso_pu_bacteria | 2738541333 | 2739038104 | 146 |
| 250 | iso_pu_bacteria | 2791355082 | 2792581242 | 146 |
| 251 | iso_pu_bacteria | 2791355094 | 2792642451 | 146 |
| 252 | iso_pu_bacteria | 2791355256 | 2793298161 | 146 |
| 253 | iso_pu_bacteria | 2791355259 | 2793313650 | 146 |
| 254 | iso_pu_bacteria | 2791355260 | 2793322162 | 146 |
| 255 | iso_pu_bacteria | 2791355261 | 2793326543 | 146 |
| 256 | iso_pu_bacteria | 2791355262 | 2793337214 | 146 |
| 257 | iso_pu_bacteria | 2791355263 | 2793341395 | 146 |
| 258 | iso_pu_bacteria | 2791355264 | 2793350481 | 146 |
| 259 | iso_pu_bacteria | 2791355265 | 2793352490 | 146 |
| 260 | iso_pu_bacteria | 2791355266 | 2793361298 | 146 |
| 261 | iso_pu_bacteria | 2791355267 | 2793369565 | 146 |
| 262 | iso_pu_bacteria | 2802429268 | 2804751813 | 146 |
| 263 | iso_pu_bacteria | 2802429605 | 2805931071 | 146 |
| 264 | iso_pu_bacteria | 2802429606 | 2805938086 | 146 |
| 265 | iso_pu_bacteria | 2802429633 | 2806047916 | 146 |
| 266 | iso_pu_bacteria | 2802429634 | 2806056333 | 146 |
| 267 | iso_pu_bacteria | 2802429635 | 2806061598 | 146 |
| 268 | iso_pu_bacteria | 2802429636 | 2806070127 | 146 |
| 269 | iso_pu_bacteria | 2802429637 | 2806072504 | 146 |
| 270 | iso_pu_bacteria | 2808606387 | 2808985275 | 146 |
| 271 | iso_pu_bacteria | 2818991439 | 2819559707 | 146 |
| 272 | iso_pu_bacteria | 2838016132 | 2838021042 | 146 |
| 273 | iso_pu_bacteria | 2838022645 | 2838027986 | 146 |
| 274 | iso_pu_bacteria | 2838042994 | 2838043297 | 146 |
| 275 | iso_pu_bacteria | 2838048938 | 2838052554 | 146 |
| 276 | iso_pu_bacteria | 2838061910 | 2838066080 | 146 |
| 277 | iso_pu_bacteria | 2838068647 | 2838071582 | 146 |
| 278 | iso_pu_bacteria | 2838074704 | 2838079276 | 146 |
| 279 | iso_pu_bacteria | 2838668709 | 2838673981 | 146 |
| 280 | iso_pu_bacteria | 2838675328 | 2838676114 | 146 |
| 281 | iso_pu_bacteria | 2838680041 | 2838682358 | 146 |
| 282 | iso_pu_bacteria | 2838686498 | 2838689354 | 146 |
| 283 | iso_pu_bacteria | 2838694306 | 2838696929 | 146 |
| 284 | iso_pu_bacteria | 2838701080 | 2838706381 | 146 |
| 285 | iso_pu_bacteria | 2838707686 | 2838709830 | 146 |
| 286 | iso_pu_bacteria | 2838714209 | 2838714996 | 146 |
| 287 | iso_pu_bacteria | 2838719591 | 2838721203 | 146 |
| 288 | iso_pu_bacteria | 2838724970 | 2838725756 | 146 |
| 289 | iso_pu_bacteria | 2838729681 | 2838730687 | 146 |
| 290 | iso_pu_bacteria | 2838742623 | 2838743628 | 146 |
| 291 | iso_pu_bacteria | 2841846520 | 2841848161 | 146 |
| 292 | iso_pu_bacteria | 2841851746 | 2841854696 | 146 |
| 293 | iso_pu_bacteria | 2841859092 | 2841859289 | 146 |
| 294 | iso_pu_bacteria | 2841864319 | 2841864691 | 146 |
| 295 | iso_pu_bacteria | 2842077413 | 2842078004 | 146 |
| 296 | iso_pu_bacteria | 2842118031 | 2842119488 | 146 |
| 297 | iso_pu_bacteria | 2842124991 | 2842125809 | 146 |
| 298 | iso_pu_bacteria | 2842130223 | 2842131009 | 146 |
| 299 | iso_pu_bacteria | 2842146304 | 2842148715 | 146 |
| 300 | iso_pu_bacteria | 2842152218 | 2842153821 | 146 |
| 301 | iso_pu_bacteria | 2842156927 | 2842157559 | 146 |
| 302 | iso_pu_bacteria | 2842163707 | 2842164751 | 146 |
| 303 | iso_pu_bacteria | 2842170452 | 2842171240 | 146 |
| 304 | iso_pu_bacteria | 2842175837 | 2842177441 | 146 |
| 305 | iso_pu_bacteria | 2842180545 | 2842180856 | 146 |
| 306 | iso_pu_bacteria | 2842187318 | 2842188105 | 146 |
| 307 | iso_pu_bacteria | 2842192696 | 2842196761 | 146 |
| 308 | iso_pu_bacteria | 2842198810 | 2842203880 | 146 |
| 309 | iso_pu_bacteria | 2842205361 | 2842206183 | 146 |
| 310 | iso_pu_bacteria | 2842211629 | 2842212416 | 146 |
| 311 | iso_pu_bacteria | 2842217011 | 2842217095 | 146 |
| 312 | iso_pu_bacteria | 2842224351 | 2842225965 | 146 |
| 313 | iso_pu_bacteria | 2842229732 | 2842231086 | 146 |
| 314 | iso_pu_bacteria | 2842237096 | 2842239243 | 146 |
| 315 | iso_pu_bacteria | 2842243621 | 2842244807 | 146 |
| 316 | iso_pu_bacteria | 2842250916 | 2842256099 | 146 |
| 317 | iso_pu_bacteria | 2842257432 | 2842258620 | 146 |
| 318 | iso_pu_bacteria | 2842264693 | 2842268145 | 146 |
| 319 | iso_pu_bacteria | 2842271015 | 2842273374 | 146 |
| 320 | iso_pu_bacteria | 2842278818 | 2842279640 | 146 |
| 321 | iso_pu_bacteria | 2842285085 | 2842286282 | 146 |
| 322 | iso_pu_bacteria | 2842291075 | 2842291667 | 146 |
| 323 | iso_pu_bacteria | 2842304105 | 2842304151 | 146 |
| 324 | iso_pu_bacteria | 2842311132 | 2842313782 | 146 |
| 325 | iso_pu_bacteria | 2842317721 | 2842318055 | 146 |
| 326 | iso_pu_bacteria | 2842341865 | 2842345969 | 146 |
| 327 | iso_pu_bacteria | 2842363717 | 2842364403 | 146 |
| 328 | iso_pu_bacteria | 2842370503 | 2842372924 | 146 |
| 329 | iso_pu_bacteria | 2842377471 | 2842378063 | 146 |
| 330 | iso_pu_bacteria | 2842384541 | 2842385996 | 146 |
| 331 | iso_pu_bacteria | 2842395702 | 2842397530 | 146 |
| 332 | iso_pu_bacteria | 2842402390 | 2842408023 | 146 |
| 333 | iso_pu_bacteria | 2842409023 | 2842414784 | 146 |
| 334 | iso_pu_bacteria | 2842415677 | 2842421333 | 146 |
| 335 | iso_pu_bacteria | 2842422224 | 2842424760 | 146 |
| 336 | iso_pu_bacteria | 2842428310 | 2842431620 | 146 |
| 337 | iso_pu_bacteria | 2842434925 | 2842438420 | 146 |
| 338 | iso_pu_bacteria | 2842441272 | 2842445050 | 146 |
| 339 | iso_pu_bacteria | 2842447887 | 2842452365 | 146 |
| 340 | iso_pu_bacteria | 2842462802 | 2842465992 | 146 |
| 341 | iso_pu_bacteria | 2842469257 | 2842473035 | 146 |
| 342 | iso_pu_bacteria | 2842489311 | 2842492980 | 146 |
| 343 | iso_pu_bacteria | 2842495871 | 2842496325 | 146 |
| 344 | iso_pu_bacteria | 2842515876 | 2842516073 | 146 |
| 345 | iso_pu_bacteria | 2842922631 | 2842925128 | 146 |
| 346 | iso_pu_bacteria | 2844163670 | 2844170467 | 146 |
| 347 | iso_pu_bacteria | 2844454524 | 2844459306 | 146 |
| 348 | iso_pu_bacteria | 2847417321 | 2847418454 | 146 |
| 349 | iso_pu_bacteria | 2848992105 | 2848993432 | 146 |
| 350 | iso_pu_bacteria | 2850079185 | 2850080755 | 146 |
| 351 | iso_pu_bacteria | 2855825444 | 2855831676 | 146 |
| 352 | iso_pu_bacteria | 2855839649 | 2855840795 | 146 |
| 353 | iso_pu_bacteria | 2858800743 | 2858801319 | 146 |
| 354 | iso_pu_bacteria | 2891373044 | 2891374376 | 146 |
| 355 | iso_pu_bacteria | 2896384573 | 2896386944 | 146 |
| 356 | iso_pu_bacteria | 2899792073 | 2899793932 | 146 |
| 357 | iso_pu_bacteria | 2899803654 | 2899808993 | 146 |
| 358 | iso_pu_bacteria | 2899845264 | 2899846465 | 146 |
| 359 | iso_pu_bacteria | 2913295892 | 2913300362 | 146 |
| 360 | iso_pu_bacteria | 2915986958 | 2915989044 | 146 |
| 361 | iso_pu_bacteria | 2915993759 | 2915997439 | 146 |
| 362 | iso_pu_bacteria | 2916000859 | 2916006407 | 146 |
| 363 | iso_pu_bacteria | 2916007675 | 2916012179 | 146 |
| 364 | iso_pu_bacteria | 2916014648 | 2916021005 | 146 |
| 365 | iso_pu_bacteria | 2916021584 | 2916025931 | 146 |
| 366 | iso_pu_bacteria | 2916028427 | 2916034721 | 146 |
| 367 | iso_pu_bacteria | 2916035215 | 2916041814 | 146 |
| 368 | iso_pu_bacteria | 2916041962 | 2916046258 | 146 |
| 369 | iso_pu_bacteria | 2916048683 | 2916051114 | 146 |
| 370 | iso_pu_bacteria | 2916055098 | 2916061078 | 146 |
| 371 | iso_pu_bacteria | 2916068649 | 2916072803 | 146 |
| 372 | iso_pu_bacteria | 2916076590 | 2916078288 | 146 |
| 373 | iso_pu_bacteria | 2919114240 | 2919115088 | 146 |
| 374 | iso_pu_bacteria | 2920760137 | 2920765531 | 146 |
| 375 | iso_pu_bacteria | 2920822456 | 2920824154 | 146 |
| 376 | iso_pu_bacteria | 2921201388 | 2921206713 | 146 |
| 377 | iso_pu_bacteria | 2921208531 | 2921209661 | 146 |
| 378 | iso_pu_bacteria | 2921237296 | 2921243481 | 146 |
| 379 | iso_pu_bacteria | 2921244191 | 2921249502 | 146 |
| 380 | iso_pu_bacteria | 2921250672 | 2921253084 | 146 |
| 381 | iso_pu_bacteria | 2921257292 | 2921262666 | 146 |
| 382 | iso_pu_bacteria | 2921263974 | 2921270311 | 146 |
| 383 | iso_pu_bacteria | 2921282425 | 2921288442 | 146 |
| 384 | iso_pu_bacteria | 2921289301 | 2921293539 | 146 |
| 385 | iso_pu_bacteria | 2921296804 | 2921304509 | 146 |
| 386 | iso_pu_bacteria | 2924144063 | 2924147548 | 146 |
| 387 | iso_pu_bacteria | 2924150972 | 2924157082 | 146 |
| 388 | iso_pu_bacteria | 2924158325 | 2924165101 | 146 |
| 389 | iso_pu_bacteria | 2924165586 | 2924171939 | 146 |
| 390 | iso_pu_bacteria | 2924172951 | 2924179260 | 146 |
| 391 | iso_pu_bacteria | 2924179722 | 2924183863 | 146 |
| 392 | iso_pu_bacteria | 2924186466 | 2924192587 | 146 |
| 393 | iso_pu_bacteria | 2924193448 | 2924197888 | 146 |
| 394 | iso_pu_bacteria | 2924200457 | 2924205890 | 146 |
| 395 | iso_pu_bacteria | 2924207177 | 2924211584 | 146 |
| 396 | iso_pu_bacteria | 2924214083 | 2924217531 | 146 |
| 397 | iso_pu_bacteria | 2924221636 | 2924228278 | 146 |
| 398 | iso_pu_bacteria | 2924228884 | 2924234239 | 146 |
| 399 | iso_pu_bacteria | 2926754445 | 2926756052 | 146 |
| 400 | iso_pu_bacteria | 2926760298 | 2926760366 | 146 |
| 401 | iso_pu_bacteria | 2933006813 | 2933008467 | 146 |
| 402 | iso_pu_bacteria | 2933011516 | 2933013282 | 146 |
| 403 | iso_pu_bacteria | 2933570622 | 2933571430 | 146 |
| 404 | iso_pu_bacteria | 2933599457 | 2933602381 | 146 |
| 405 | iso_pu_bacteria | 2935894831 | 2935897216 | 146 |
| 406 | iso_pu_bacteria | 2935901341 | 2935904602 | 146 |
| 407 | iso_pu_bacteria | 2936375103 | 2936376740 | 146 |
| 408 | iso_pu_bacteria | 2936381700 | 2936385110 | 146 |
| 409 | iso_pu_bacteria | 2936996657 | 2936997687 | 146 |
| 410 | iso_pu_bacteria | 2937002841 | 2937007302 | 146 |
| 411 | iso_pu_bacteria | 2937009748 | 2937012392 | 146 |
| 412 | iso_pu_bacteria | 2937016420 | 2937022003 | 146 |
| 413 | iso_pu_bacteria | 2937023124 | 2937028236 | 146 |
| 414 | iso_pu_bacteria | 2937042894 | 2937049401 | 146 |
| 415 | iso_pu_bacteria | 2937049772 | 2937056186 | 146 |
| 416 | iso_pu_bacteria | 2937056579 | 2937058521 | 146 |
| 417 | iso_pu_bacteria | 2937063883 | 2937064499 | 146 |
| 418 | iso_pu_bacteria | 2937071275 | 2937077496 | 146 |
| 419 | iso_pu_bacteria | 2937091812 | 2937097939 | 146 |
| 420 | iso_pu_bacteria | 2937098957 | 2937105118 | 146 |
| 421 | iso_pu_bacteria | 2937106411 | 2937107710 | 146 |
| 422 | iso_pu_bacteria | 2937113482 | 2937117234 | 146 |
| 423 | iso_pu_bacteria | 2937119839 | 2937124856 | 146 |
| 424 | iso_pu_bacteria | 2937126314 | 2937130427 | 146 |
| 425 | iso_pu_bacteria | 2941499720 | 2941499894 | 146 |
| 426 | iso_pu_bacteria | 2957382221 | 2957387629 | 146 |
| 427 | iso_pu_bacteria | 2957388812 | 2957393448 | 146 |
| 428 | iso_pu_bacteria | 2957395598 | 2957400954 | 146 |
| 429 | iso_pu_bacteria | 2957402308 | 2957408780 | 146 |
| 430 | iso_pu_bacteria | 2957408893 | 2957412609 | 146 |
| 431 | iso_pu_bacteria | 2957415311 | 2957416337 | 146 |
| 432 | iso_pu_bacteria | 2957422303 | 2957428828 | 146 |
| 433 | iso_pu_bacteria | 2957430029 | 2957436267 | 146 |
| 434 | iso_pu_bacteria | 2957443900 | 2957449290 | 146 |
| 435 | iso_pu_bacteria | 2957450854 | 2957456651 | 146 |
| 436 | iso_pu_bacteria | 2957457609 | 2957463793 | 146 |
| 437 | iso_pu_bacteria | 2957464669 | 2957469182 | 146 |
| 438 | iso_pu_bacteria | 2957471148 | 2957477010 | 146 |
| 439 | iso_pu_bacteria | 2957478035 | 2957484014 | 146 |
| 440 | iso_pu_bacteria | 2957484790 | 2957490604 | 146 |
| 441 | iso_pu_bacteria | 2957491536 | 2957495002 | 146 |
| 442 | iso_pu_bacteria | 2957498199 | 2957504291 | 146 |
| 443 | iso_pu_bacteria | 2957505466 | 2957512078 | 146 |
| 444 | iso_pu_bacteria | 2960584000 | 2960590564 | 146 |
| 445 | iso_pu_bacteria | 2960597568 | 2960601864 | 146 |
| 446 | iso_pu_bacteria | 2960603979 | 2960610071 | 146 |
| 447 | iso_pu_bacteria | 2960610863 | 2960615019 | 146 |
| 448 | iso_pu_bacteria | 2960617483 | 2960621925 | 146 |
| 449 | iso_pu_bacteria | 2960624210 | 2960628830 | 146 |
| 450 | iso_pu_bacteria | 2960637947 | 2960644355 | 146 |
| 451 | iso_pu_bacteria | 2960645483 | 2960647195 | 146 |
| 452 | iso_pu_bacteria | 2960652885 | 2960658956 | 146 |
| 453 | iso_pu_bacteria | 2960660292 | 2960665182 | 146 |
| 454 | iso_pu_bacteria | 2960667422 | 2960672652 | 146 |
| 455 | iso_pu_bacteria | 2960674078 | 2960679372 | 146 |
| 456 | iso_pu_bacteria | 2960687367 | 2960693225 | 146 |
| 457 | iso_pu_bacteria | 2964607997 | 2964609810 | 146 |
| 458 | iso_pu_bacteria | 2964615318 | 2964619495 | 146 |
| 459 | iso_pu_bacteria | 2964621998 | 2964622800 | 146 |
| 460 | iso_pu_bacteria | 2964628898 | 2964634440 | 146 |
| 461 | iso_pu_bacteria | 2964636051 | 2964637145 | 146 |
| 462 | iso_pu_bacteria | 2964643177 | 2964648608 | 146 |
| 463 | iso_pu_bacteria | 2964649959 | 2964654388 | 146 |
| 464 | iso_pu_bacteria | 2964656573 | 2964660253 | 146 |
| 465 | iso_pu_bacteria | 2964663802 | 2964666225 | 146 |
| 466 | iso_pu_bacteria | 2964670856 | 2964673670 | 146 |
| 467 | iso_pu_bacteria | 2964678106 | 2964684174 | 146 |
| 468 | iso_pu_bacteria | 2964685014 | 2964691077 | 146 |
| 469 | iso_pu_bacteria | 2964691889 | 2964696376 | 146 |
| 470 | iso_pu_bacteria | 2964698721 | 2964699531 | 146 |
| 471 | iso_pu_bacteria | 2964705432 | 2964711712 | 146 |
| 472 | iso_pu_bacteria | 2964712639 | 2964717891 | 146 |
| 473 | iso_pu_bacteria | 2964719344 | 2964725920 | 146 |
| 474 | iso_pu_bacteria | 2967664464 | 2967668595 | 146 |
| 475 | iso_pu_bacteria | 2967671571 | 2967677822 | 146 |
| 476 | iso_pu_bacteria | 2967678726 | 2967683698 | 146 |
| 477 | iso_pu_bacteria | 2967693043 | 2967698608 | 146 |
| 478 | iso_pu_bacteria | 2967699805 | 2967705500 | 146 |
| 479 | iso_pu_bacteria | 2967706974 | 2967713478 | 146 |
| 480 | iso_pu_bacteria | 2967714385 | 2967719061 | 146 |
| 481 | iso_pu_bacteria | 2967721400 | 2967726322 | 146 |
| 482 | iso_pu_bacteria | 2967735183 | 2967740318 | 146 |
| 483 | iso_pu_bacteria | 2967742019 | 2967743200 | 146 |
| 484 | iso_pu_bacteria | 2967748971 | 2967753420 | 146 |
| 485 | iso_pu_bacteria | 2967755722 | 2967761105 | 146 |
| 486 | iso_pu_bacteria | 2967762386 | 2967767412 | 146 |
| 487 | iso_pu_bacteria | 2967769361 | 2967772938 | 146 |
| 488 | iso_pu_bacteria | 2967775926 | 2967776504 | 146 |
| 489 | iso_pu_bacteria | 2970019648 | 2970024911 | 146 |
| 490 | iso_pu_bacteria | 2970033650 | 2970040377 | 146 |
| 491 | iso_pu_bacteria | 2970040964 | 2970045356 | 146 |
| 492 | iso_pu_bacteria | 2970047711 | 2970054151 | 146 |
| 493 | iso_pu_bacteria | 2970054988 | 2970059459 | 146 |
| 494 | iso_pu_bacteria | 2970061556 | 2970065584 | 146 |
| 495 | iso_pu_bacteria | 2970068827 | 2970075021 | 146 |
| 496 | iso_pu_bacteria | 2970076120 | 2970081447 | 146 |
| 497 | iso_pu_bacteria | 2970082768 | 2970087928 | 146 |
| 498 | iso_pu_bacteria | 2970088815 | 2970094592 | 146 |
| 499 | iso_pu_bacteria | 2970095765 | 2970096554 | 146 |
| 500 | iso_pu_bacteria | 2970102677 | 2970107235 | 146 |
| 501 | iso_pu_bacteria | 2970109326 | 2970112222 | 146 |
| 502 | iso_pu_bacteria | 2970116247 | 2970120399 | 146 |
| 503 | iso_pu_bacteria | 2970129317 | 2970133365 | 146 |
| 504 | iso_pu_bacteria | 2970136068 | 2970136707 | 146 |
| 505 | iso_pu_bacteria | 2970149975 | 2970155385 | 146 |
| 506 | iso_pu_bacteria | 2970156795 | 2970163194 | 146 |
| 507 | iso_pu_bacteria | 2970164137 | 2970168163 | 146 |
| 508 | iso_pu_bacteria | 2970170962 | 2970174787 | 146 |
| 509 | iso_pu_bacteria | 2970177841 | 2970181770 | 146 |
| 510 | iso_pu_bacteria | 2970184632 | 2970187985 | 146 |
| 511 | iso_pu_bacteria | 2970191845 | 2970197815 | 146 |
| 512 | iso_pu_bacteria | 2977516862 | 2977520682 | 146 |
| 513 | iso_pu_bacteria | 2977523885 | 2977529517 | 146 |
| 514 | iso_pu_bacteria | 2977537788 | 2977542174 | 146 |
| 515 | iso_pu_bacteria | 2977551784 | 2977557448 | 146 |
| 516 | iso_pu_bacteria | 2977558990 | 2977565003 | 146 |
| 517 | iso_pu_bacteria | 2977565890 | 2977570393 | 146 |
| 518 | iso_pu_bacteria | 2977572785 | 2977575490 | 146 |
| 519 | iso_pu_bacteria | 2977579622 | 2977584143 | 146 |
| 520 | iso_pu_bacteria | 2979089926 | 2979094356 | 146 |
| 521 | iso_pu_bacteria | 2979095461 | 2979098261 | 146 |
| 522 | iso_pu_bacteria | 2979100975 | 2979103597 | 146 |
| 523 | iso_pu_bacteria | 2984509177 | 2984511840 | 146 |
| 524 | iso_pu_bacteria | 2984518228 | 2984521800 | 146 |
| 525 | iso_pu_bacteria | 2984537506 | 2984541098 | 146 |
| 526 | iso_pu_bacteria | 2984601300 | 2984603378 | 146 |
| 527 | iso_pu_bacteria | 2989349275 | 2989353169 | 146 |
| 528 | iso_pu_bacteria | 2996893221 | 2996898277 | 146 |
| 529 | iso_pu_bacteria | 3005445848 | 3005447385 | 146 |
| 530 | iso_pu_bacteria | 639633055 | 639648408 | 146 |
| 531 | iso_pu_bacteria | 648276728 | 648740093 | 146 |
| 532 | iso_pu_bacteria | 650716007 | 650740212 | 146 |
| 533 | iso_pu_bacteria | 8003570095 | 8003571274 | 146 |
| 534 | iso_pu_bacteria | 8003992118 | 8003993294 | 146 |
| 535 | iso_pu_bacteria | 8005275841 | 8005280435 | 146 |
| 536 | iso_pu_bacteria | 8005282627 | 8005285656 | 146 |
| 537 | iso_pu_bacteria | 8005289223 | 8005290735 | 146 |
| 538 | iso_pu_bacteria | 8005301065 | 8005302287 | 146 |
| 539 | iso_pu_bacteria | 8005307578 | 8005314390 | 146 |
| 540 | iso_pu_bacteria | 8005382845 | 8005388199 | 146 |
| 541 | iso_pu_bacteria | 8005395548 | 8005397275 | 146 |
| 542 | iso_pu_bacteria | 8005430974 | 8005433630 | 146 |
| 543 | iso_pu_bacteria | 8005460587 | 8005462801 | 146 |
| 544 | iso_pu_bacteria | 8005497431 | 8005500202 | 146 |
| 545 | iso_pu_bacteria | 8005556819 | 8005557855 | 146 |
| 546 | iso_pu_bacteria | 8005563573 | 8005569028 | 146 |
| 547 | iso_pu_bacteria | 8005570704 | 8005572166 | 146 |
| 548 | iso_pu_bacteria | 8005619151 | 8005621494 | 146 |
| 549 | iso_pu_bacteria | 8005626139 | 8005631161 | 146 |
| 550 | iso_pu_bacteria | 8005668836 | 8005671618 | 146 |
| 551 | iso_pu_bacteria | 8005688590 | 8005689860 | 146 |
| 552 | iso_pu_bacteria | 8005695170 | 8005700162 | 146 |
| 553 | iso_pu_bacteria | 8018127388 | 8018129778 | 146 |
| 554 | iso_pu_bacteria | 8018163183 | 8018166940 | 146 |
| 555 | iso_pu_bacteria | 8023680758 | 8023685533 | 146 |
| 556 | iso_pu_bacteria | 8024479707 | 8024482158 | 146 |
| 557 | iso_pu_bacteria | 8024501048 | 8024506743 | 146 |
| 558 | iso_pu_bacteria | 8049293176 | 8049294347 | 146 |
| 559 | iso_pu_bacteria | 8056375014 | 8056377291 | 146 |
| 560 | iso_pu_bacteria | 8056382006 | 8056388228 | 146 |
| 561 | 3300050491 | nmdc:mga00v17_291_c1 | nmdc:mga00v17_291_c1_8632_9075 | 147 |
| 562 | iso_pu_bacteria | 2512875026 | 2512971924 | 147 |
| 563 | iso_pu_bacteria | 2513237089 | 2513606325 | 147 |
| 564 | iso_pu_bacteria | 2513237156 | 2513986532 | 147 |
| 565 | iso_pu_bacteria | 2513237160 | 2514005474 | 147 |
| 566 | iso_pu_bacteria | 2513237305 | 2514418537 | 147 |
| 567 | iso_pu_bacteria | 2517487022 | 2517569416 | 147 |
| 568 | iso_pu_bacteria | 2802428858 | 2802718919 | 147 |
| 569 | iso_pu_bacteria | 2802428859 | 2802726529 | 147 |
| 570 | iso_pu_bacteria | 2802428860 | 2802733822 | 147 |
| 571 | iso_pu_bacteria | 2802428861 | 2802738428 | 147 |
| 572 | iso_pu_bacteria | 2802428862 | 2802744761 | 147 |
| 573 | iso_pu_bacteria | 2802428863 | 2802751033 | 147 |
| 574 | iso_pu_bacteria | 2915980308 | 2915985159 | 147 |
| 575 | iso_pu_bacteria | 2916061851 | 2916066176 | 147 |
| 576 | iso_pu_bacteria | 2929138655 | 2929140545 | 147 |
| 577 | iso_pu_bacteria | 2937029754 | 2937031134 | 147 |
| 578 | iso_pu_bacteria | 2937036028 | 2937040476 | 147 |
| 579 | iso_pu_bacteria | 2937078374 | 2937079929 | 147 |
| 580 | iso_pu_bacteria | 2937084907 | 2937091039 | 147 |
| 581 | iso_pu_bacteria | 2957375807 | 2957379741 | 147 |
| 582 | iso_pu_bacteria | 2957437181 | 2957438152 | 147 |
| 583 | iso_pu_bacteria | 2960591022 | 2960596094 | 147 |
| 584 | iso_pu_bacteria | 2960631154 | 2960634676 | 147 |
| 585 | iso_pu_bacteria | 2960680706 | 2960685124 | 147 |
| 586 | iso_pu_bacteria | 2960693952 | 2960698528 | 147 |
| 587 | iso_pu_bacteria | 2967686174 | 2967688800 | 147 |
| 588 | iso_pu_bacteria | 2967728569 | 2967733041 | 147 |
| 589 | iso_pu_bacteria | 2970026789 | 2970031562 | 147 |
| 590 | iso_pu_bacteria | 2970122695 | 2970128574 | 147 |
| 591 | iso_pu_bacteria | 2970143518 | 2970147773 | 147 |
| 592 | iso_pu_bacteria | 2977530762 | 2977533792 | 147 |
| 593 | iso_pu_bacteria | 2977544691 | 2977547276 | 147 |
| 594 | iso_pu_bacteria | 3003930520 | 3003933354 | 147 |
| 595 | iso_pu_bacteria | 8003999396 | 8004000547 | 147 |
| 596 | 3300005331 | Ga0070670_100000603 | Ga0070670_10000060315 | 148 |
| 597 | 3300025925 | Ga0207650_10001911 | Ga0207650_100019116 | 148 |
| 598 | 3300049776 | Ga0501280_002116 | Ga0501280_002116_59_511 | 148 |
| 599 | 3300049776 | Ga0501280_038125 | Ga0501280_038125_34_486 | 148 |
| 600 | 3300053140 | Ga0500573_0013003 | Ga0500573_0013003_3071_3517 | 148 |
| 601 | iso_pu_bacteria | 2558860983 | 2561466317 | 148 |
| 602 | iso_pu_bacteria | 2582581294 | 2585200043 | 148 |
| 603 | iso_pu_bacteria | 2775507049 | 2776913288 | 148 |
| 604 | iso_pu_bacteria | 643692032 | 643825461 | 148 |
| 605 | iso_pu_bacteria | 8018150411 | 8018155506 | 148 |
| 606 | iso_pu_bacteria | 8054460903 | 8054462792 | 148 |
| 607 | iso_pu_bacteria | 8054558443 | 8054559696 | 148 |
| 608 | 3300001979 | JGI24740J21852_10000240 | JGI24740J21852_1000024031 | 149 |
| 609 | 3300002704 | JGI25155J39150_1000058 | JGI25155J39150_100005829 | 149 |
| 610 | 3300002705 | JGI25156J39149_1000080 | JGI25156J39149_100008029 | 149 |
| 611 | 3300002737 | JGI25162J39368_1000798 | JGI25162J39368_100079829 | 149 |
| 612 | 3300002737 | JGI25162J39368_1000942 | JGI25162J39368_10009423 | 149 |
| 613 | 3300002737 | JGI25162J39368_1002903 | JGI25162J39368_10029032 | 149 |
| 614 | 3300002737 | JGI25162J39368_1003447 | JGI25162J39368_10034471 | 149 |
| 615 | 3300002738 | JGI25154J39366_1000224 | JGI25154J39366_100022418 | 149 |
| 616 | 3300002741 | JGI25157J39369_1000101 | JGI25157J39369_100010152 | 149 |
| 617 | 3300003214 | JGI25165J46597_1000747 | JGI25165J46597_10007478 | 149 |
| 618 | 3300003214 | JGI25165J46597_1001007 | JGI25165J46597_100100725 | 149 |
| 619 | 3300003214 | JGI25165J46597_1008197 | JGI25165J46597_10081973 | 149 |
| 620 | 3300003752 | Ga0055539_1006528 | Ga0055539_10065283 | 149 |
| 621 | 3300003771 | Ga0055526_1006233 | Ga0055526_10062337 | 149 |
| 622 | 3300003775 | Ga0055524_1024519 | Ga0055524_10245192 | 149 |
| 623 | 3300003790 | Ga0055528_1000851 | Ga0055528_10008519 | 149 |
| 624 | 3300005353 | Ga0070669_100597990 | Ga0070669_1005979902 | 149 |
| 625 | 3300005548 | Ga0070665_100284105 | Ga0070665_1002841052 | 149 |
| 626 | 3300005578 | Ga0068854_100043013 | Ga0068854_1000430132 | 149 |
| 627 | 3300005614 | Ga0068856_100033811 | Ga0068856_1000338116 | 149 |
| 628 | 3300005614 | Ga0068856_100946695 | Ga0068856_1009466951 | 149 |
| 629 | 3300005616 | Ga0068852_100041122 | Ga0068852_1000411225 | 149 |
| 630 | 3300006051 | Ga0075364_10000170 | Ga0075364_1000017013 | 149 |
| 631 | 3300006186 | Ga0075369_10018019 | Ga0075369_100180192 | 149 |
| 632 | 3300006195 | Ga0075366_10224069 | Ga0075366_102240692 | 149 |
| 633 | 3300006353 | Ga0075370_10011896 | Ga0075370_100118965 | 149 |
| 634 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005472 | 149 |
| 635 | 3300009545 | Ga0105237_10001344 | Ga0105237_1000134424 | 149 |
| 636 | 3300010375 | Ga0105239_10003591 | Ga0105239_1000359113 | 149 |
| 637 | 3300010375 | Ga0105239_10329586 | Ga0105239_103295862 | 149 |
| 638 | 3300012497 | Ga0157319_1002443 | Ga0157319_10024432 | 149 |
| 639 | 3300013104 | Ga0157370_10000948 | Ga0157370_1000094812 | 149 |
| 640 | 3300013105 | Ga0157369_10158503 | Ga0157369_101585033 | 149 |
| 641 | 3300013297 | Ga0157378_11306727 | Ga0157378_113067271 | 149 |
| 642 | 3300013306 | Ga0163162_10316912 | Ga0163162_103169123 | 149 |
| 643 | 3300014497 | Ga0182008_10078580 | Ga0182008_100785801 | 149 |
| 644 | 3300015262 | Ga0182007_10002187 | Ga0182007_100021874 | 149 |
| 645 | 3300015265 | Ga0182005_1003334 | Ga0182005_10033345 | 149 |
| 646 | 3300025206 | Ga0209435_100045 | Ga0209435_10004553 | 149 |
| 647 | 3300025207 | Ga0209760_107039 | Ga0209760_1070392 | 149 |
| 648 | 3300025228 | Ga0209672_102875 | Ga0209672_1028752 | 149 |
| 649 | 3300025228 | Ga0209672_117561 | Ga0209672_1175611 | 149 |
| 650 | 3300025231 | Ga0207427_106592 | Ga0207427_1065922 | 149 |
| 651 | 3300025233 | Ga0209437_100047 | Ga0209437_100047346 | 149 |
| 652 | 3300025233 | Ga0209437_100122 | Ga0209437_10012230 | 149 |
| 653 | 3300025246 | Ga0209646_1000154 | Ga0209646_100015453 | 149 |
| 654 | 3300025246 | Ga0209646_1003813 | Ga0209646_10038132 | 149 |
| 655 | 3300025250 | Ga0209026_1000177 | Ga0209026_100017753 | 149 |
| 656 | 3300025253 | Ga0209677_100440 | Ga0209677_10044023 | 149 |
| 657 | 3300025256 | Ga0209759_1000274 | Ga0209759_100027427 | 149 |
| 658 | 3300025261 | Ga0209233_1000048 | Ga0209233_100004857 | 149 |
| 659 | 3300025261 | Ga0209233_1000170 | Ga0209233_100017030 | 149 |
| 660 | 3300025261 | Ga0209233_1001493 | Ga0209233_10014937 | 149 |
| 661 | 3300025273 | Ga0209673_1000013 | Ga0209673_1000013569 | 149 |
| 662 | 3300025273 | Ga0209673_1022246 | Ga0209673_10222463 | 149 |
| 663 | 3300025284 | Ga0209130_1034287 | Ga0209130_10342872 | 149 |
| 664 | 3300025295 | Ga0209564_1000906 | Ga0209564_100090620 | 149 |
| 665 | 3300025297 | Ga0209758_1002711 | Ga0209758_100271112 | 149 |
| 666 | 3300025299 | Ga0209256_1000947 | Ga0209256_100094719 | 149 |
| 667 | 3300025299 | Ga0209256_1010200 | Ga0209256_10102002 | 149 |
| 668 | 3300025303 | Ga0209051_1045274 | Ga0209051_10452742 | 149 |
| 669 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011445 | 149 |
| 670 | 3300025914 | Ga0207671_10000314 | Ga0207671_100003143 | 149 |
| 671 | 3300025923 | Ga0207681_10513840 | Ga0207681_105138402 | 149 |
| 672 | 3300025981 | Ga0207640_10036793 | Ga0207640_100367935 | 149 |
| 673 | 3300026078 | Ga0207702_10016488 | Ga0207702_100164886 | 149 |
| 674 | 3300026078 | Ga0207702_10355219 | Ga0207702_103552192 | 149 |
| 675 | 3300026142 | Ga0207698_10795544 | Ga0207698_107955442 | 149 |
| 676 | 3300028379 | Ga0268266_10202752 | Ga0268266_102027522 | 149 |
| 677 | 3300028794 | Ga0307515_10001215 | Ga0307515_1000121516 | 149 |
| 678 | 3300028794 | Ga0307515_10038442 | Ga0307515_100384428 | 149 |
| 679 | 3300031911 | Ga0307412_10563049 | Ga0307412_105630492 | 149 |
| 680 | 3300037471 | Ga0395905_0000827 | Ga0395905_0000827_1378_1830 | 149 |
| 681 | 3300037471 | Ga0395905_0006518 | Ga0395905_0006518_8554_9003 | 149 |
| 682 | 3300037471 | Ga0395905_0609660 | Ga0395905_0609660_424_873 | 149 |
| 683 | 3300037471 | Ga0395905_1124358 | Ga0395905_1124358_28_477 | 149 |
| 684 | 3300038443 | Ga0395901_0447926 | Ga0395901_0447926_423_872 | 149 |
| 685 | 3300041452 | Ga0451793_1771588 | Ga0451793_1771588_548_1000 | 149 |
| 686 | 3300041492 | Ga0451835_0689076 | Ga0451835_0689076_2161_2613 | 149 |
| 687 | 3300041497 | Ga0451840_12231 | Ga0451840_12231_267_719 | 149 |
| 688 | 3300041498 | Ga0451841_0183806 | Ga0451841_0183806_83_535 | 149 |
| 689 | 3300041502 | Ga0451846_02444 | Ga0451846_02444_522_974 | 149 |
| 690 | 3300041503 | Ga0451847_0483869 | Ga0451847_0483869_83_535 | 149 |
| 691 | 3300041503 | Ga0451847_0486657 | Ga0451847_0486657_1552_2004 | 149 |
| 692 | 3300041504 | Ga0451848_08423 | Ga0451848_08423_138_590 | 149 |
| 693 | 3300041505 | Ga0451849_0137763 | Ga0451849_0137763_611_1063 | 149 |
| 694 | 3300041506 | Ga0451850_51725 | Ga0451850_51725_530_982 | 149 |
| 695 | 3300041507 | Ga0451851_0203844 | Ga0451851_0203844_254_706 | 149 |
| 696 | 3300041510 | Ga0451854_17026 | Ga0451854_17026_262_714 | 149 |
| 697 | 3300041511 | Ga0451855_0606958 | Ga0451855_0606958_166_618 | 149 |
| 698 | 3300041512 | Ga0451853_3234756 | Ga0451853_3234756_547_999 | 149 |
| 699 | 3300044719 | Ga0466971_0319425 | Ga0466971_0319425_164_628 | 149 |
| 700 | 3300044765 | Ga0466970_0001159 | Ga0466970_0001159_9026_9490 | 149 |
| 701 | 3300044842 | Ga0466957_0323890 | Ga0466957_0323890_388_852 | 149 |
| 702 | 3300045049 | Ga0466959_0155850 | Ga0466959_0155850_347_811 | 149 |
| 703 | 3300045836 | Ga0466958_0306419 | Ga0466958_0306419_338_802 | 149 |
| 704 | 3300046460 | Ga0495638_0000597 | Ga0495638_0000597_23468_23917 | 149 |
| 705 | 3300046460 | Ga0495638_0065247 | Ga0495638_0065247_205_654 | 149 |
| 706 | 3300046471 | Ga0495650_0082159 | Ga0495650_0082159_366_815 | 149 |
| 707 | 3300046492 | Ga0495585_0114385 | Ga0495585_0114385_36_488 | 149 |
| 708 | 3300046500 | Ga0495596_0340851 | Ga0495596_0340851_18_470 | 149 |
| 709 | 3300046501 | Ga0495607_0014939 | Ga0495607_0014939_2115_2567 | 149 |
| 710 | 3300046506 | Ga0495583_0047246 | Ga0495583_0047246_1350_1802 | 149 |
| 711 | 3300046507 | Ga0495606_0005935 | Ga0495606_0005935_4313_4762 | 149 |
| 712 | 3300046507 | Ga0495606_0031156 | Ga0495606_0031156_2109_2561 | 149 |
| 713 | 3300046507 | Ga0495606_0065151 | Ga0495606_0065151_149_598 | 149 |
| 714 | 3300046507 | Ga0495606_0377080 | Ga0495606_0377080_37_489 | 149 |
| 715 | 3300046512 | Ga0495610_0031394 | Ga0495610_0031394_433_885 | 149 |
| 716 | 3300046512 | Ga0495610_0048705 | Ga0495610_0048705_1271_1723 | 149 |
| 717 | 3300046513 | Ga0495616_0023559 | Ga0495616_0023559_866_1315 | 149 |
| 718 | 3300046513 | Ga0495616_0058559 | Ga0495616_0058559_1223_1675 | 149 |
| 719 | 3300046515 | Ga0495620_0012510 | Ga0495620_0012510_2537_2989 | 149 |
| 720 | 3300046518 | Ga0495631_0035705 | Ga0495631_0035705_256_708 | 149 |
| 721 | 3300046519 | Ga0495632_0040920 | Ga0495632_0040920_1039_1497 | 149 |
| 722 | 3300046519 | Ga0495632_0211342 | Ga0495632_0211342_54_506 | 149 |
| 723 | 3300046522 | Ga0495643_0036606 | Ga0495643_0036606_57_509 | 149 |
| 724 | 3300046522 | Ga0495643_0083423 | Ga0495643_0083423_146_595 | 149 |
| 725 | 3300046522 | Ga0495643_0142369 | Ga0495643_0142369_105_557 | 149 |
| 726 | 3300046522 | Ga0495643_0316035 | Ga0495643_0316035_28_486 | 149 |
| 727 | 3300046530 | Ga0495654_0130829 | Ga0495654_0130829_620_1072 | 149 |
| 728 | 3300046542 | Ga0495597_0010628 | Ga0495597_0010628_3597_4049 | 149 |
| 729 | 3300046542 | Ga0495597_0046866 | Ga0495597_0046866_168_617 | 149 |
| 730 | 3300046616 | Ga0495668_0184666 | Ga0495668_0184666_476_928 | 149 |
| 731 | 3300046660 | Ga0495625_0132496 | Ga0495625_0132496_748_1200 | 149 |
| 732 | 3300046660 | Ga0495625_0284198 | Ga0495625_0284198_218_670 | 149 |
| 733 | 3300046660 | Ga0495625_0368167 | Ga0495625_0368167_70_519 | 149 |
| 734 | 3300046691 | Ga0495670_0118813 | Ga0495670_0118813_541_993 | 149 |
| 735 | 3300046692 | Ga0495671_0060942 | Ga0495671_0060942_1320_1772 | 149 |
| 736 | 3300046694 | Ga0495649_0060150 | Ga0495649_0060150_115_567 | 149 |
| 737 | 3300047318 | Ga0495636_0141114 | Ga0495636_0141114_318_770 | 149 |
| 738 | 3300047318 | Ga0495636_0330062 | Ga0495636_0330062_159_608 | 149 |
| 739 | 3300047320 | Ga0495672_0020846 | Ga0495672_0020846_2727_3176 | 149 |
| 740 | 3300047443 | Ga0495687_203038 | Ga0495687_203038_54_506 | 149 |
| 741 | 3300047446 | Ga0495679_072035 | Ga0495679_072035_43_495 | 149 |
| 742 | 3300047470 | Ga0495681_0079294 | Ga0495681_0079294_484_936 | 149 |
| 743 | 3300047472 | Ga0495686_0003870 | Ga0495686_0003870_8704_9153 | 149 |
| 744 | 3300047472 | Ga0495686_0015546 | Ga0495686_0015546_2538_2990 | 149 |
| 745 | 3300047472 | Ga0495686_0099843 | Ga0495686_0099843_1006_1455 | 149 |
| 746 | 3300047472 | Ga0495686_0115104 | Ga0495686_0115104_342_791 | 149 |
| 747 | 3300048090 | Ga0495615_0014893 | Ga0495615_0014893_22_474 | 149 |
| 748 | 3300048903 | Ga0496100_0607993 | Ga0496100_0607993_247_696 | 149 |
| 749 | 3300048905 | Ga0496102_0053430 | Ga0496102_0053430_684_1133 | 149 |
| 750 | 3300048906 | Ga0496103_0011652 | Ga0496103_0011652_2886_3335 | 149 |
| 751 | 3300048909 | Ga0496106_0000801 | Ga0496106_0000801_18389_18841 | 149 |
| 752 | 3300048909 | Ga0496106_0381654 | Ga0496106_0381654_268_717 | 149 |
| 753 | 3300048916 | Ga0496113_0136267 | Ga0496113_0136267_1133_1582 | 149 |
| 754 | 3300048919 | Ga0496116_0050273 | Ga0496116_0050273_924_1373 | 149 |
| 755 | 3300048919 | Ga0496116_0110497 | Ga0496116_0110497_44_496 | 149 |
| 756 | 3300048919 | Ga0496116_0260180 | Ga0496116_0260180_306_758 | 149 |
| 757 | 3300048920 | Ga0496117_0000641 | Ga0496117_0000641_43439_43888 | 149 |
| 758 | 3300048920 | Ga0496117_0044740 | Ga0496117_0044740_1002_1454 | 149 |
| 759 | 3300048920 | Ga0496117_0119160 | Ga0496117_0119160_846_1298 | 149 |
| 760 | 3300048921 | Ga0496118_0002255 | Ga0496118_0002255_18674_19126 | 149 |
| 761 | 3300048921 | Ga0496118_0002788 | Ga0496118_0002788_9978_10427 | 149 |
| 762 | 3300048921 | Ga0496118_0021378 | Ga0496118_0021378_945_1397 | 149 |
| 763 | 3300048921 | Ga0496118_0283407 | Ga0496118_0283407_286_735 | 149 |
| 764 | 3300048922 | Ga0496119_0033903 | Ga0496119_0033903_2160_2609 | 149 |
| 765 | 3300048923 | Ga0496120_0030634 | Ga0496120_0030634_1741_2190 | 149 |
| 766 | 3300048923 | Ga0496120_0045117 | Ga0496120_0045117_667_1116 | 149 |
| 767 | 3300048924 | Ga0496121_0000751 | Ga0496121_0000751_34944_35393 | 149 |
| 768 | 3300048924 | Ga0496121_0003358 | Ga0496121_0003358_14425_14874 | 149 |
| 769 | 3300048924 | Ga0496121_0015611 | Ga0496121_0015611_156_605 | 149 |
| 770 | 3300048924 | Ga0496121_0031398 | Ga0496121_0031398_1650_2102 | 149 |
| 771 | 3300048924 | Ga0496121_0091314 | Ga0496121_0091314_346_798 | 149 |
| 772 | 3300048924 | Ga0496121_0189522 | Ga0496121_0189522_718_1170 | 149 |
| 773 | 3300048925 | Ga0496122_0003165 | Ga0496122_0003165_8859_9308 | 149 |
| 774 | 3300048925 | Ga0496122_0016386 | Ga0496122_0016386_3985_4437 | 149 |
| 775 | 3300048925 | Ga0496122_0122567 | Ga0496122_0122567_835_1284 | 149 |
| 776 | 3300048926 | Ga0496123_0010688 | Ga0496123_0010688_3634_4083 | 149 |
| 777 | 3300048926 | Ga0496123_0018189 | Ga0496123_0018189_1470_1922 | 149 |
| 778 | 3300048926 | Ga0496123_0065931 | Ga0496123_0065931_1014_1463 | 149 |
| 779 | 3300048927 | Ga0496124_0008646 | Ga0496124_0008646_548_997 | 149 |
| 780 | 3300048927 | Ga0496124_0012897 | Ga0496124_0012897_4025_4474 | 149 |
| 781 | 3300048927 | Ga0496124_0036616 | Ga0496124_0036616_3395_3847 | 149 |
| 782 | 3300048927 | Ga0496124_0637151 | Ga0496124_0637151_175_624 | 149 |
| 783 | 3300048928 | Ga0496125_0021828 | Ga0496125_0021828_1759_2211 | 149 |
| 784 | 3300048928 | Ga0496125_0051706 | Ga0496125_0051706_292_741 | 149 |
| 785 | 3300048928 | Ga0496125_0338138 | Ga0496125_0338138_356_805 | 149 |
| 786 | 3300048928 | Ga0496125_0342169 | Ga0496125_0342169_352_801 | 149 |
| 787 | 3300048929 | Ga0496126_0020807 | Ga0496126_0020807_5794_6243 | 149 |
| 788 | 3300049459 | Ga0495678_029785 | Ga0495678_029785_771_1223 | 149 |
| 789 | 3300049742 | Ga0501080_0132818 | Ga0501080_0132818_95_547 | 149 |
| 790 | 3300049822 | Ga0501035_0525970 | Ga0501035_0525970_181_630 | 149 |
| 791 | 3300049822 | Ga0501035_0848203 | Ga0501035_0848203_124_573 | 149 |
| 792 | 3300049823 | Ga0501044_0142973 | Ga0501044_0142973_588_1037 | 149 |
| 793 | 3300050493 | nmdc:mga0k408_215936_c1 | nmdc:mga0k408_215936_c1_285_734 | 149 |
| 794 | 3300050493 | nmdc:mga0k408_451596_c1 | nmdc:mga0k408_451596_c1_223_672 | 149 |
| 795 | 3300050516 | nmdc:mga0sz30_3070_c1 | nmdc:mga0sz30_3070_c1_1684_2136 | 149 |
| 796 | 3300053086 | Ga0500578_0044842 | Ga0500578_0044842_57_509 | 149 |
| 797 | 3300053088 | Ga0500644_0005315 | Ga0500644_0005315_439_888 | 149 |
| 798 | 3300053090 | Ga0500646_0233981 | Ga0500646_0233981_58_507 | 149 |
| 799 | 3300053104 | Ga0500556_0237166 | Ga0500556_0237166_126_575 | 149 |
| 800 | 3300053111 | Ga0500572_116256 | Ga0500572_116256_235_684 | 149 |
| 801 | 3300053125 | Ga0500618_009145 | Ga0500618_009145_276_734 | 149 |
| 802 | 3300053125 | Ga0500618_015691 | Ga0500618_015691_172_621 | 149 |
| 803 | 3300053129 | Ga0500628_046983 | Ga0500628_046983_56_508 | 149 |
| 804 | 3300053133 | Ga0500655_007893 | Ga0500655_007893_1310_1768 | 149 |
| 805 | 3300053134 | Ga0500658_0000162 | Ga0500658_0000162_28756_29208 | 149 |
| 806 | 3300053134 | Ga0500658_0213842 | Ga0500658_0213842_299_751 | 149 |
| 807 | 3300053136 | Ga0500559_0007060 | Ga0500559_0007060_951_1400 | 149 |
| 808 | 3300053139 | Ga0500568_0000411 | Ga0500568_0000411_28317_28766 | 149 |
| 809 | 3300053139 | Ga0500568_0001577 | Ga0500568_0001577_10201_10653 | 149 |
| 810 | 3300053139 | Ga0500568_0057248 | Ga0500568_0057248_546_998 | 149 |
| 811 | 3300053142 | Ga0500577_0108487 | Ga0500577_0108487_308_757 | 149 |
| 812 | 3300053151 | Ga0500604_0003667 | Ga0500604_0003667_2272_2724 | 149 |
| 813 | 3300053153 | Ga0500616_0001852 | Ga0500616_0001852_11836_12285 | 149 |
| 814 | 3300053153 | Ga0500616_0012405 | Ga0500616_0012405_807_1259 | 149 |
| 815 | 3300053156 | Ga0500622_0000428 | Ga0500622_0000428_3924_4376 | 149 |
| 816 | 3300053156 | Ga0500622_0000956 | Ga0500622_0000956_11663_12112 | 149 |
| 817 | 3300053730 | Ga0500645_066116 | Ga0500645_066116_261_710 | 149 |
| 818 | iso_pu_bacteria | 2510917026 | 2511171591 | 149 |
| 819 | iso_pu_bacteria | 2585427633 | 2585995923 | 149 |
| 820 | iso_pu_bacteria | 2585427634 | 2586000491 | 149 |
| 821 | iso_pu_bacteria | 2600254933 | 2600375764 | 149 |
| 822 | iso_pu_bacteria | 2643221558 | 2643811963 | 149 |
| 823 | iso_pu_bacteria | 2643221568 | 2643855540 | 149 |
| 824 | iso_pu_bacteria | 2854896431 | 2854899294 | 149 |
| 825 | iso_pu_bacteria | 2854916844 | 2854919251 | 149 |
| 826 | iso_pu_bacteria | 2919166419 | 2919167696 | 149 |
| 827 | iso_pu_bacteria | 2919171160 | 2919175039 | 149 |
| 828 | iso_pu_bacteria | 2978969890 | 2978974154 | 149 |
| 829 | iso_pu_bacteria | 2984587000 | 2984589481 | 149 |
| 830 | iso_pu_bacteria | 2989771324 | 2989773663 | 149 |
| 831 | 3300002987 | JGI25159J45721_1000006 | JGI25159J45721_100000624 | 150 |
| 832 | 3300003187 | JGI25151J46595_10010040 | JGI25151J46595_100100406 | 150 |
| 833 | 3300003187 | JGI25151J46595_10037454 | JGI25151J46595_100374542 | 150 |
| 834 | 3300003354 | JGI25160J50197_1000019 | JGI25160J50197_100001929 | 150 |
| 835 | 3300003374 | JGI25161J50226_1000157 | JGI25161J50226_100015732 | 150 |
| 836 | 3300003771 | Ga0055526_1008270 | Ga0055526_10082701 | 150 |
| 837 | 3300003775 | Ga0055524_1001008 | Ga0055524_100100813 | 150 |
| 838 | 3300003775 | Ga0055524_1032341 | Ga0055524_10323412 | 150 |
| 839 | 3300003781 | Ga0055536_1000645 | Ga0055536_10006457 | 150 |
| 840 | 3300003791 | Ga0055530_10004713 | Ga0055530_100047135 | 150 |
| 841 | 3300003792 | Ga0055540_1012369 | Ga0055540_10123694 | 150 |
| 842 | 3300003794 | Ga0055531_10002873 | Ga0055531_1000287310 | 150 |
| 843 | 3300004625 | Ga0055543_1000145 | Ga0055543_100014523 | 150 |
| 844 | 3300005262 | Ga0065165_1000180 | Ga0065165_100018029 | 150 |
| 845 | 3300006051 | Ga0075364_10054934 | Ga0075364_100549342 | 150 |
| 846 | 3300006353 | Ga0075370_10319958 | Ga0075370_103199582 | 150 |
| 847 | 3300006946 | Ga0079104_1011892 | Ga0079104_10118922 | 150 |
| 848 | 3300013249 | Ga0171463_1011 | Ga0171463_101188 | 150 |
| 849 | 3300015690 | Ga0183363_1430 | Ga0183363_14302 | 150 |
| 850 | 3300021320 | Ga0214544_1000265 | Ga0214544_100026565 | 150 |
| 851 | 3300021321 | Ga0214542_1000015 | Ga0214542_1000015226 | 150 |
| 852 | 3300021321 | Ga0214542_1020378 | Ga0214542_10203783 | 150 |
| 853 | 3300021327 | Ga0214543_1000011 | Ga0214543_1000011198 | 150 |
| 854 | 3300021327 | Ga0214543_1000032 | Ga0214543_1000032116 | 150 |
| 855 | 3300025208 | Ga0209436_100333 | Ga0209436_10033324 | 150 |
| 856 | 3300025230 | Ga0209563_103879 | Ga0209563_1038792 | 150 |
| 857 | 3300025245 | Ga0207425_1059235 | Ga0207425_10592351 | 150 |
| 858 | 3300025263 | Ga0209565_1070826 | Ga0209565_10708261 | 150 |
| 859 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007385 | 150 |
| 860 | 3300025292 | Ga0209676_1000399 | Ga0209676_100039967 | 150 |
| 861 | 3300025294 | Ga0209025_1000787 | Ga0209025_100078749 | 150 |
| 862 | 3300025294 | Ga0209025_1000870 | Ga0209025_100087027 | 150 |
| 863 | 3300025295 | Ga0209564_1000140 | Ga0209564_1000140113 | 150 |
| 864 | 3300025297 | Ga0209758_1055124 | Ga0209758_10551242 | 150 |
| 865 | 3300025298 | Ga0209050_1000906 | Ga0209050_100090624 | 150 |
| 866 | 3300025299 | Ga0209256_1000606 | Ga0209256_100060630 | 150 |
| 867 | 3300025299 | Ga0209256_1001532 | Ga0209256_10015322 | 150 |
| 868 | 3300025302 | Ga0207426_1000111 | Ga0207426_100011126 | 150 |
| 869 | 3300025303 | Ga0209051_1002566 | Ga0209051_10025666 | 150 |
| 870 | 3300025304 | Ga0209257_1001423 | Ga0209257_10014239 | 150 |
| 871 | 3300027111 | Ga0209281_1000334 | Ga0209281_100033427 | 150 |
| 872 | 3300027111 | Ga0209281_1000361 | Ga0209281_100036129 | 150 |
| 873 | 3300027666 | Ga0209282_1000073 | Ga0209282_100007327 | 150 |
| 874 | 3300028794 | Ga0307515_10001393 | Ga0307515_100013936 | 150 |
| 875 | 3300031456 | Ga0307513_10046052 | Ga0307513_100460524 | 150 |
| 876 | 3300031731 | Ga0307405_11246188 | Ga0307405_112461881 | 150 |
| 877 | 3300032002 | Ga0307416_102118423 | Ga0307416_1021184232 | 150 |
| 878 | 3300032004 | Ga0307414_12071045 | Ga0307414_120710451 | 150 |
| 879 | 3300033430 | Ga0315913_1000129 | Ga0315913_100012928 | 150 |
| 880 | 3300041404 | Ga0439436_0112232 | Ga0439436_0112232_42_494 | 150 |
| 881 | 3300041405 | Ga0439438_070849 | Ga0439438_070849_149_601 | 150 |
| 882 | 3300041411 | Ga0439466_0114642 | Ga0439466_0114642_345_797 | 150 |
| 883 | 3300041413 | Ga0439465_0044118 | Ga0439465_0044118_940_1392 | 150 |
| 884 | 3300042007 | Ga0439449_0005864 | Ga0439449_0005864_1679_2131 | 150 |
| 885 | 3300042014 | Ga0439457_017484 | Ga0439457_017484_302_754 | 150 |
| 886 | 3300044683 | Ga0466965_0188862 | Ga0466965_0188862_443_904 | 150 |
| 887 | 3300044735 | Ga0466968_0013912 | Ga0466968_0013912_2096_2557 | 150 |
| 888 | 3300046660 | Ga0495625_0038160 | Ga0495625_0038160_1174_1626 | 150 |
| 889 | 3300048920 | Ga0496117_0002492 | Ga0496117_0002492_13826_14278 | 150 |
| 890 | 3300048920 | Ga0496117_0032556 | Ga0496117_0032556_1294_1749 | 150 |
| 891 | 3300048921 | Ga0496118_0056313 | Ga0496118_0056313_306_761 | 150 |
| 892 | 3300048921 | Ga0496118_0165800 | Ga0496118_0165800_384_836 | 150 |
| 893 | 3300048922 | Ga0496119_0032601 | Ga0496119_0032601_2368_2823 | 150 |
| 894 | 3300048923 | Ga0496120_0011601 | Ga0496120_0011601_816_1271 | 150 |
| 895 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_80623_81078 | 150 |
| 896 | 3300048925 | Ga0496122_0000025 | Ga0496122_0000025_39977_40438 | 150 |
| 897 | 3300048925 | Ga0496122_0000399 | Ga0496122_0000399_52912_53364 | 150 |
| 898 | 3300048925 | Ga0496122_0074908 | Ga0496122_0074908_1453_1908 | 150 |
| 899 | 3300048926 | Ga0496123_0000054 | Ga0496123_0000054_194966_195427 | 150 |
| 900 | 3300048926 | Ga0496123_0002112 | Ga0496123_0002112_14790_15242 | 150 |
| 901 | 3300048926 | Ga0496123_0049479 | Ga0496123_0049479_1560_2015 | 150 |
| 902 | 3300048927 | Ga0496124_0002648 | Ga0496124_0002648_13873_14325 | 150 |
| 903 | 3300048927 | Ga0496124_0088991 | Ga0496124_0088991_1336_1797 | 150 |
| 904 | 3300048927 | Ga0496124_0428850 | Ga0496124_0428850_413_868 | 150 |
| 905 | 3300048927 | Ga0496124_0608190 | Ga0496124_0608190_111_566 | 150 |
| 906 | 3300048927 | Ga0496124_0759022 | Ga0496124_0759022_111_566 | 150 |
| 907 | 3300048928 | Ga0496125_0000141 | Ga0496125_0000141_1959_2414 | 150 |
| 908 | 3300048928 | Ga0496125_0001650 | Ga0496125_0001650_24582_25034 | 150 |
| 909 | 3300048929 | Ga0496126_0001055 | Ga0496126_0001055_16635_17087 | 150 |
| 910 | 3300048929 | Ga0496126_0068999 | Ga0496126_0068999_2557_3012 | 150 |
| 911 | 3300049568 | Ga0501031_0043880 | Ga0501031_0043880_893_1345 | 150 |
| 912 | 3300049569 | Ga0501032_0040703 | Ga0501032_0040703_1441_1893 | 150 |
| 913 | 3300049569 | Ga0501032_0252683 | Ga0501032_0252683_491_943 | 150 |
| 914 | 3300049570 | Ga0501033_0000118 | Ga0501033_0000118_10632_11084 | 150 |
| 915 | 3300049570 | Ga0501033_0028448 | Ga0501033_0028448_3159_3611 | 150 |
| 916 | 3300049571 | Ga0501034_0167499 | Ga0501034_0167499_1397_1849 | 150 |
| 917 | 3300049574 | Ga0501038_0025657 | Ga0501038_0025657_296_748 | 150 |
| 918 | 3300049822 | Ga0501035_0002363 | Ga0501035_0002363_14276_14728 | 150 |
| 919 | 3300049822 | Ga0501035_0552929 | Ga0501035_0552929_329_781 | 150 |
| 920 | 3300049824 | Ga0501045_0113532 | Ga0501045_0113532_570_1022 | 150 |
| 921 | 3300050491 | nmdc:mga00v17_42712_c1 | nmdc:mga00v17_42712_c1_1343_1798 | 150 |
| 922 | 3300053099 | Ga0500654_103001 | Ga0500654_103001_401_853 | 150 |
| 923 | 3300053140 | Ga0500573_0008408 | Ga0500573_0008408_2874_3332 | 150 |
| 924 | 3300053151 | Ga0500604_0129644 | Ga0500604_0129644_341_793 | 150 |
| 925 | iso_pu_bacteria | 2599185236 | 2599720905 | 150 |
| 926 | iso_pu_bacteria | 2600255279 | 2601607992 | 150 |
| 927 | iso_pu_bacteria | 2738541317 | 2738945448 | 150 |
| 928 | iso_pu_bacteria | 2821123053 | 2821127779 | 150 |
| 929 | iso_pu_bacteria | 2838736955 | 2838738203 | 150 |
| 930 | iso_pu_bacteria | 2841840854 | 2841841427 | 150 |
| 931 | iso_pu_bacteria | 2842140634 | 2842141205 | 150 |
| 932 | iso_pu_bacteria | 2857531043 | 2857534480 | 150 |
| 933 | iso_pu_bacteria | 2913308742 | 2913310154 | 150 |
| 934 | iso_pu_bacteria | 2933594066 | 2933597971 | 150 |
| 935 | iso_pu_bacteria | 8056875544 | 8056877700 | 150 |
| 936 | 3300004798 | Ga0058859_11670122 | Ga0058859_116701222 | 151 |
| 937 | 3300005355 | Ga0070671_100130749 | Ga0070671_1001307492 | 151 |
| 938 | 3300006038 | Ga0075365_10505039 | Ga0075365_105050392 | 151 |
| 939 | 3300013105 | Ga0157369_10096384 | Ga0157369_100963842 | 151 |
| 940 | 3300025245 | Ga0207425_1045841 | Ga0207425_10458412 | 151 |
| 941 | 3300025258 | Ga0209129_1005991 | Ga0209129_10059915 | 151 |
| 942 | 3300025931 | Ga0207644_10420203 | Ga0207644_104202032 | 151 |
| 943 | 3300025961 | Ga0207712_10139481 | Ga0207712_101394813 | 151 |
| 944 | 3300047472 | Ga0495686_0018766 | Ga0495686_0018766_3643_4098 | 151 |
| 945 | 3300048928 | Ga0496125_0438316 | Ga0496125_0438316_31_486 | 151 |
| 946 | 3300059646 | Ga0587078_061485 | Ga0587078_061485_22_480 | 151 |
| 947 | 3300035398 | Ga0316574_0981343 | Ga0316574_0981343_15_485 | 152 |
| 948 | 3300036647 | Ga0316582_0250613 | Ga0316582_0250613_479_949 | 152 |
| 949 | 3300053125 | Ga0500618_000125 | Ga0500618_000125_54985_55446 | 152 |
| 950 | 3300003323 | rootH1_10087504 | rootH1_100875042 | 153 |
| 951 | 3300003791 | Ga0055530_10065194 | Ga0055530_100651942 | 153 |
| 952 | 3300003792 | Ga0055540_1001322 | Ga0055540_10013222 | 153 |
| 953 | 3300003794 | Ga0055531_10001888 | Ga0055531_1000188813 | 153 |
| 954 | 3300013102 | Ga0157371_10012507 | Ga0157371_100125074 | 153 |
| 955 | 3300017792 | Ga0163161_11422499 | Ga0163161_114224991 | 153 |
| 956 | 3300025292 | Ga0209676_1013109 | Ga0209676_10131092 | 153 |
| 957 | 3300025297 | Ga0209758_1001265 | Ga0209758_100126524 | 153 |
| 958 | 3300025298 | Ga0209050_1001733 | Ga0209050_100173315 | 153 |
| 959 | 3300025303 | Ga0209051_1001061 | Ga0209051_10010616 | 153 |
| 960 | 3300025304 | Ga0209257_1001014 | Ga0209257_100101422 | 153 |
| 961 | 3300047472 | Ga0495686_0056345 | Ga0495686_0056345_132_596 | 153 |
| 962 | 3300048913 | Ga0496110_0061950 | Ga0496110_0061950_19_483 | 153 |
| 963 | 3300048914 | Ga0496111_0018396 | Ga0496111_0018396_2527_2991 | 153 |
| 964 | 3300048922 | Ga0496119_0058911 | Ga0496119_0058911_591_1052 | 153 |
| 965 | 3300048925 | Ga0496122_0008228 | Ga0496122_0008228_5346_5810 | 153 |
| 966 | 3300048926 | Ga0496123_0129005 | Ga0496123_0129005_383_847 | 153 |
| 967 | 3300048927 | Ga0496124_0084961 | Ga0496124_0084961_2076_2540 | 153 |
| 968 | 3300053125 | Ga0500618_000289 | Ga0500618_000289_34457_34921 | 153 |
| 969 | 3300053153 | Ga0500616_0000661 | Ga0500616_0000661_36627_37088 | 153 |
| 970 | 3300053156 | Ga0500622_0068032 | Ga0500622_0068032_157_618 | 153 |
| 971 | 3300046530 | Ga0495654_0000641 | Ga0495654_0000641_5184_5654 | 155 |
| 972 | 3300053158 | Ga0500627_0292184 | Ga0500627_0292184_93_563 | 155 |
| 973 | 2010549000 | RicEn_C9452 | RicEn_165770 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j22-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.9369 | 28 | 105 |
| 1zps-assembly1.cif.gz_A | crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi | 0.8876 | 30 | 111 |
| 6j22-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.8732 | 28 | 110 |
| 7bgn-assembly2.cif.gz_D | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.8644 | 23 | 114 |
| 6j2l-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.8639 | 25 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9523 | 23 | 105 | 3.10.20.810 |
| 1zpsA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9522 | 30 | 105 | 3.10.20.810 |
| af_Q2FUU3_250_343_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9067 | 24 | 105 | 3.10.20.810 |
| af_O59667_194_289_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.8853 | 23 | 105 | 3.10.20.810 |
| af_A0A1D8PKY7_169_272_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.8843 | 23 | 108 | 3.10.20.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S6IYE0-F1-model_v4 | Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] | 0.965 | 23 | 104 |
GO:0000105
GO:0004635 GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A2H6G3I7-F1-model_v4 | Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) | 0.9647 | 23 | 105 |
GO:0000105
GO:0000287 GO:0004635 GO:0005737 GO:0008270 |
| AF-A0A7J5BUA8-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9646 | 23 | 104 |
GO:0000105
GO:0004635 |
| AF-A0A425W566-F1-model_v4 | Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] | 0.9645 | 23 | 105 |
GO:0000105
GO:0004635 GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A7C6XYQ9-F1-model_v4 | Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) | 0.9642 | 25 | 105 |
GO:0000105
GO:0000287 GO:0004635 GO:0005737 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar