F487198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 973 | 649 | 656 | 321 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501025501|2501075382 |
| Length | 358 |
| Sequence | AYARNVPQEYDMKSILPRHGVAASPTQPAQGAQPARSVAVDGHRQRMKSLVRTAGMLPVLVLLCIGFGLLNDGFFTLENLSIVTQQASINIVLAAGMTFVILTGGIDLSVGSVLAAAAMAAMIGSNIAGWGWLGVPMALAVGLGFGLVNGALISLLRLPPFIVTLGSLTAVRGIARLMGHDTTIFNPQLPFAFIGNGTVLGVPWLVIIALVVVAGSWFVLRRTVLGLRIYSVGGNPEAARLSGIKVWGIEMFVYAVSGLLAGLGAVMSAARLYAANGLQLGQSYELDAIAAVILGGTSFVGGVGSIIGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGLVIVGAVALDRYRQRGSART |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 4 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 7 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 8 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 9 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 10 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 11 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 12 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 13 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 14 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 15 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 16 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 17 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 18 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 19 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 20 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 21 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 22 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 23 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 24 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 25 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 26 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 27 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 28 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 29 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 30 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 31 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 32 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 33 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 34 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 35 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 36 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 37 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 38 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 39 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 40 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 41 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 42 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 43 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 44 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 45 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 46 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 47 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 48 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 49 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 50 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 51 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 52 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 53 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 54 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 55 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 56 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 57 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 58 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 59 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 60 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 61 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 62 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 63 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 64 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 65 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 66 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 67 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 68 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 69 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 70 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 71 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 72 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 73 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 74 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 75 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 76 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 77 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 78 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 79 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 80 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 81 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 82 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 83 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 84 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 85 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 86 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 87 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 88 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 89 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 90 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 91 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 92 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 93 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 94 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 95 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 96 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 97 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 98 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 99 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 100 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 101 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 102 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 103 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 104 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 105 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 106 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 107 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 108 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 109 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 110 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 111 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 112 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 113 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 114 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 115 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 116 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 117 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 118 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 119 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 120 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 121 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 122 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 123 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 124 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 125 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 126 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 127 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 128 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 129 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 130 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 131 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 132 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 133 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 134 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 135 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 136 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 137 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 138 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 139 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 140 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 141 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 142 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 143 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 144 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 145 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 146 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 147 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 148 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 149 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 150 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 151 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 152 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 153 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 154 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 155 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 156 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 157 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 158 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 159 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 160 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 161 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 162 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 163 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 164 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 165 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 166 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 167 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 168 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 169 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 170 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 171 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 172 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 173 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 174 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 175 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 176 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 177 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 178 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 179 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 180 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 181 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 182 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 183 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 184 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 185 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 186 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 187 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 188 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 189 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 190 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 191 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 192 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 193 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 194 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 195 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 196 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 197 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 198 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 199 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 200 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 201 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 202 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 203 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 204 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 205 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 206 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 207 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 208 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 209 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 210 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 211 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 212 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 213 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 214 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 215 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 216 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 217 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 218 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 219 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 220 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 221 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 222 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 223 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 224 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 225 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 226 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 227 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 228 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 229 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 230 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 231 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 232 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 233 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 234 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 235 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 236 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 237 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 238 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 239 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 240 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 241 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 242 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 243 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 244 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 245 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 246 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 247 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 248 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 249 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 250 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 251 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 252 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 253 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 254 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 255 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 256 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 257 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 258 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 259 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 260 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 261 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 262 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 263 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 264 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 265 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 266 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 267 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 268 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 269 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 270 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 271 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 272 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 273 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 274 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 275 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 276 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 277 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 278 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 279 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 280 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 281 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 282 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 283 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 284 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 285 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 286 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 287 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 288 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 289 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 290 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 291 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 292 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 293 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 294 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 295 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 296 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 297 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 298 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 299 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 300 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 301 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 302 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 303 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 304 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 305 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 306 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 307 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 308 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 309 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 310 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 312 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 317 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 321 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 322 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 323 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 324 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 326 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 327 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 328 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 330 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 331 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 332 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 333 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 334 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 335 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 344 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 353 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 354 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 355 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 356 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 357 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 369 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 370 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 373 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 374 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 377 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 379 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 411 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 412 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 413 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 414 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 416 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 417 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 418 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 419 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 420 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 421 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 422 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 423 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 424 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 425 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 426 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 427 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 428 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 429 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 430 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 431 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 432 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 433 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 434 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 435 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 436 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 437 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 438 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 439 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 440 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 441 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 442 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 443 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 444 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 445 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 446 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 447 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 448 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 449 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 450 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 451 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 452 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 453 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 454 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 455 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 456 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 457 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 458 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 459 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 460 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 461 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 462 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 463 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 464 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 465 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 466 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 467 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 468 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 469 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 470 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 471 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 472 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 473 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 474 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 475 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 476 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 563 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 564 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 565 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 566 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 567 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 568 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 569 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 570 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 571 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 572 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 573 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 574 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 575 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 576 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 577 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 578 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 579 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 580 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 581 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 582 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 583 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 584 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 585 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 586 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 587 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 596 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 601 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 606 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 607 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 608 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 611 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 612 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 613 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 614 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 615 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 616 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 617 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 619 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 620 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 621 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 622 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 623 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 624 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 625 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 626 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 627 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 628 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 629 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 630 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 631 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 632 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 633 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 634 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 635 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 636 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 637 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 638 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 639 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 640 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 641 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 642 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 643 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 644 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 645 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 646 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 647 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 648 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 649 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.01 |
| Metatranscriptomes | 0.41 |
| Isolates | 32.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.15 |
| Nodule | 17.99 |
| Rhizoplane | 3.91 |
| Rhizosphere | 55.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_79 | 2124908027 | Bacteria | 37018 |
| 2 | MBSR1b_contig_478279 | 2162886012 | Bacteria | 2110 |
| 3 | JGI24741J21665_1001854 | 3300001915 | Bacteria | 5763 |
| 4 | JGI24740J21852_10000029 | 3300001979 | Bacteria | 48171 |
| 5 | JGI24740J21852_10001316 | 3300001979 | Bacteria | 11288 |
| 6 | JGI24739J22299_10007978 | 3300001989 | Bacteria | 3962 |
| 7 | JGI24739J22299_10016441 | 3300001989 | Bacteria | 2677 |
| 8 | JGI24739J22299_10046749 | 3300001989 | Bacteria | 1416 |
| 9 | JGI24735J21928_10000362 | 3300002067 | Bacteria | 15787 |
| 10 | JGI25156J39149_1003309 | 3300002705 | Bacteria | 5333 |
| 11 | JGI25156J39149_1003693 | 3300002705 | Bacteria | 4906 |
| 12 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 13 | JGI25154J39366_1000402 | 3300002738 | Bacteria | 23561 |
| 14 | JGI25163J39215_1001653 | 3300002771 | Bacteria | 3286 |
| 15 | Ga0006778J45830_1018533 | 3300003162 | Bacteria | 2347 |
| 16 | JGI25151J46595_10001875 | 3300003187 | Bacteria | 13420 |
| 17 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 18 | Ga0007410J51695_1003197 | 3300003574 | Bacteria | 4992 |
| 19 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 20 | Ga0055538_1000534 | 3300003751 | Bacteria | 13427 |
| 21 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 22 | Ga0055539_1000073 | 3300003752 | Bacteria | 131094 |
| 23 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 24 | Ga0055533_1000561 | 3300003756 | Bacteria | 13045 |
| 25 | Ga0055533_1003352 | 3300003756 | Bacteria | 3250 |
| 26 | Ga0055532_1000564 | 3300003758 | Bacteria | 15555 |
| 27 | Ga0055532_1004378 | 3300003758 | Bacteria | 2149 |
| 28 | Ga0055532_1004404 | 3300003758 | Bacteria | 2138 |
| 29 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 30 | Ga0055525_1000383 | 3300003759 | Bacteria | 28771 |
| 31 | Ga0055527_1000549 | 3300003760 | Bacteria | 12495 |
| 32 | Ga0055535_1007205 | 3300003761 | Bacteria | 2149 |
| 33 | Ga0055535_1007260 | 3300003761 | Bacteria | 2138 |
| 34 | Ga0055542_1000928 | 3300003762 | Bacteria | 19416 |
| 35 | Ga0055542_1007757 | 3300003762 | Bacteria | 2149 |
| 36 | Ga0055542_1007805 | 3300003762 | Bacteria | 2138 |
| 37 | Ga0055529_1000447 | 3300003763 | Bacteria | 41032 |
| 38 | Ga0055529_1006454 | 3300003763 | Bacteria | 1639 |
| 39 | Ga0055528_1002503 | 3300003790 | Bacteria | 9808 |
| 40 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 41 | Ga0055541_1000351 | 3300003841 | Bacteria | 14348 |
| 42 | Ga0055541_1000473 | 3300003841 | Bacteria | 11535 |
| 43 | Ga0065714_10000437 | 3300005288 | Bacteria | 4674 |
| 44 | Ga0065714_10064853 | 3300005288 | Bacteria | 16996 |
| 45 | Ga0065714_10093650 | 3300005288 | Bacteria | 1840 |
| 46 | Ga0065712_10000438 | 3300005290 | Bacteria | 32737 |
| 47 | Ga0065712_10072822 | 3300005290 | Bacteria | 4605 |
| 48 | Ga0070658_10073348 | 3300005327 | Bacteria | 2806 |
| 49 | Ga0070670_100000079 | 3300005331 | Bacteria | 92916 |
| 50 | Ga0070666_10013971 | 3300005335 | Bacteria | 5105 |
| 51 | Ga0070660_100000087 | 3300005339 | Bacteria | 55894 |
| 52 | Ga0070660_100030766 | 3300005339 | Bacteria | 4028 |
| 53 | Ga0070661_100000141 | 3300005344 | Bacteria | 58825 |
| 54 | Ga0070661_100001004 | 3300005344 | Bacteria | 20032 |
| 55 | Ga0070668_100099598 | 3300005347 | Bacteria | 2301 |
| 56 | Ga0070669_100007493 | 3300005353 | Bacteria | 7815 |
| 57 | Ga0070659_100000211 | 3300005366 | Bacteria | 45357 |
| 58 | Ga0070659_100201703 | 3300005366 | Bacteria | 1638 |
| 59 | Ga0070667_100049430 | 3300005367 | Bacteria | 3542 |
| 60 | Ga0070663_100000034 | 3300005455 | Bacteria | 68516 |
| 61 | Ga0070663_100002551 | 3300005455 | Bacteria | 10283 |
| 62 | Ga0070662_100008560 | 3300005457 | Bacteria | 6672 |
| 63 | Ga0070706_100093931 | 3300005467 | Bacteria | 2783 |
| 64 | Ga0070698_100064473 | 3300005471 | Bacteria | 3691 |
| 65 | Ga0070665_100274804 | 3300005548 | Bacteria | 1686 |
| 66 | Ga0070665_100528649 | 3300005548 | Bacteria | 1191 |
| 67 | Ga0070664_100000057 | 3300005564 | Bacteria | 68516 |
| 68 | Ga0070664_100001292 | 3300005564 | Bacteria | 20032 |
| 69 | Ga0068856_100001920 | 3300005614 | Bacteria | 21668 |
| 70 | Ga0068852_100017539 | 3300005616 | Bacteria | 5620 |
| 71 | Ga0081539_10109005 | 3300005985 | Bacteria | 1398 |
| 72 | Ga0070717_10403811 | 3300006028 | Bacteria | 1228 |
| 73 | Ga0075365_10037339 | 3300006038 | Bacteria | 3153 |
| 74 | Ga0075432_10000758 | 3300006058 | Bacteria | 10034 |
| 75 | Ga0075432_10022684 | 3300006058 | Bacteria | 2147 |
| 76 | Ga0075432_10036132 | 3300006058 | Bacteria | 1717 |
| 77 | Ga0075366_10096513 | 3300006195 | Bacteria | 1772 |
| 78 | Ga0075370_10001724 | 3300006353 | Bacteria | 9729 |
| 79 | Ga0075370_10144737 | 3300006353 | Bacteria | 1391 |
| 80 | Ga0099824_1019296 | 3300006942 | Bacteria | 5355 |
| 81 | Ga0099822_1004906 | 3300006943 | Bacteria | 17459 |
| 82 | Ga0105251_10000357 | 3300009011 | Bacteria | 45041 |
| 83 | Ga0105251_10002252 | 3300009011 | Bacteria | 15333 |
| 84 | Ga0105251_10004723 | 3300009011 | Bacteria | 9135 |
| 85 | Ga0105251_10014955 | 3300009011 | Bacteria | 4261 |
| 86 | Ga0105244_10001369 | 3300009036 | Bacteria | 19810 |
| 87 | Ga0105244_10001610 | 3300009036 | Bacteria | 17926 |
| 88 | Ga0105244_10007778 | 3300009036 | Bacteria | 6773 |
| 89 | Ga0105244_10100418 | 3300009036 | Bacteria | 1416 |
| 90 | Ga0105250_10000015 | 3300009092 | Bacteria | 262683 |
| 91 | Ga0105250_10039918 | 3300009092 | Bacteria | 1882 |
| 92 | Ga0105240_10001380 | 3300009093 | Bacteria | 41739 |
| 93 | Ga0105240_10019894 | 3300009093 | Bacteria | 8965 |
| 94 | Ga0105240_10114973 | 3300009093 | Bacteria | 3249 |
| 95 | Ga0105240_10170911 | 3300009093 | Bacteria | 2575 |
| 96 | Ga0105242_10001326 | 3300009176 | Bacteria | 19534 |
| 97 | Ga0105237_10000937 | 3300009545 | Bacteria | 39281 |
| 98 | Ga0105237_10214218 | 3300009545 | Bacteria | 1926 |
| 99 | Ga0105238_10006248 | 3300009551 | Bacteria | 11837 |
| 100 | Ga0105239_10011798 | 3300010375 | Bacteria | 9752 |
| 101 | Ga0105239_10203686 | 3300010375 | Bacteria | 2217 |
| 102 | Ga0105246_10024013 | 3300011119 | Bacteria | 3953 |
| 103 | Ga0157373_10000409 | 3300013100 | Bacteria | 34480 |
| 104 | Ga0157373_10000598 | 3300013100 | Bacteria | 28031 |
| 105 | Ga0157373_10001522 | 3300013100 | Bacteria | 17681 |
| 106 | Ga0157373_10002881 | 3300013100 | Bacteria | 13009 |
| 107 | Ga0157373_10013153 | 3300013100 | Bacteria | 6075 |
| 108 | Ga0157373_10014396 | 3300013100 | Bacteria | 5798 |
| 109 | Ga0157373_10135579 | 3300013100 | Bacteria | 1731 |
| 110 | Ga0157371_10000323 | 3300013102 | Bacteria | 61980 |
| 111 | Ga0157371_10053913 | 3300013102 | Bacteria | 2855 |
| 112 | Ga0157370_10000038 | 3300013104 | Bacteria | 135182 |
| 113 | Ga0157370_10003190 | 3300013104 | Bacteria | 19390 |
| 114 | Ga0157370_10135089 | 3300013104 | Bacteria | 2299 |
| 115 | Ga0157369_10002773 | 3300013105 | Bacteria | 20919 |
| 116 | Ga0157369_10003376 | 3300013105 | Bacteria | 18972 |
| 117 | Ga0157369_10128831 | 3300013105 | Bacteria | 2682 |
| 118 | Ga0157369_10285749 | 3300013105 | Bacteria | 1718 |
| 119 | Ga0157374_10092263 | 3300013296 | Bacteria | 2889 |
| 120 | Ga0163162_10360388 | 3300013306 | Bacteria | 1587 |
| 121 | Ga0163162_10519859 | 3300013306 | Bacteria | 1320 |
| 122 | Ga0163162_10718549 | 3300013306 | Bacteria | 1120 |
| 123 | Ga0157372_10013616 | 3300013307 | Bacteria | 8694 |
| 124 | Ga0157375_10000100 | 3300013308 | Bacteria | 87522 |
| 125 | Ga0157375_10002189 | 3300013308 | Bacteria | 16893 |
| 126 | Ga0157375_10038747 | 3300013308 | Bacteria | 4579 |
| 127 | Ga0157375_10363670 | 3300013308 | Bacteria | 1613 |
| 128 | Ga0182008_10001638 | 3300014497 | Bacteria | 14811 |
| 129 | Ga0182008_10038132 | 3300014497 | Bacteria | 2404 |
| 130 | Ga0182006_1000099 | 3300015261 | Bacteria | 98453 |
| 131 | Ga0182007_10000379 | 3300015262 | Bacteria | 28020 |
| 132 | Ga0182005_1001696 | 3300015265 | Bacteria | 8522 |
| 133 | Ga0182005_1002583 | 3300015265 | Bacteria | 6410 |
| 134 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 135 | Ga0163161_10018945 | 3300017792 | Bacteria | 4825 |
| 136 | Ga0163161_10161357 | 3300017792 | Bacteria | 1709 |
| 137 | Ga0209760_100730 | 3300025207 | Bacteria | 4865 |
| 138 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 139 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 140 | Ga0209784_100303 | 3300025224 | Bacteria | 26446 |
| 141 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 142 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 143 | Ga0209566_100129 | 3300025225 | Bacteria | 92878 |
| 144 | Ga0209566_100665 | 3300025225 | Bacteria | 20581 |
| 145 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 146 | Ga0209674_100097 | 3300025226 | Bacteria | 167285 |
| 147 | Ga0209674_100195 | 3300025226 | Bacteria | 64986 |
| 148 | Ga0209672_100037 | 3300025228 | Bacteria | 287776 |
| 149 | Ga0209672_100102 | 3300025228 | Bacteria | 104385 |
| 150 | Ga0209147_100049 | 3300025229 | Bacteria | 274980 |
| 151 | Ga0209147_100071 | 3300025229 | Bacteria | 215861 |
| 152 | Ga0209147_100284 | 3300025229 | Bacteria | 43233 |
| 153 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 154 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 155 | Ga0209563_102007 | 3300025230 | Bacteria | 4868 |
| 156 | Ga0207427_100206 | 3300025231 | Bacteria | 53709 |
| 157 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 158 | Ga0209258_100066 | 3300025242 | Bacteria | 287776 |
| 159 | Ga0209258_100082 | 3300025242 | Bacteria | 247739 |
| 160 | Ga0209646_1000063 | 3300025246 | Bacteria | 248065 |
| 161 | Ga0209026_1003385 | 3300025250 | Bacteria | 5268 |
| 162 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 163 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 164 | Ga0209677_101172 | 3300025253 | Bacteria | 12051 |
| 165 | Ga0209677_104837 | 3300025253 | Bacteria | 3716 |
| 166 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 167 | Ga0209148_1000168 | 3300025254 | Bacteria | 133952 |
| 168 | Ga0209148_1001176 | 3300025254 | Bacteria | 15061 |
| 169 | Ga0209148_1003323 | 3300025254 | Bacteria | 4531 |
| 170 | Ga0209759_1000819 | 3300025256 | Bacteria | 24663 |
| 171 | Ga0209759_1002792 | 3300025256 | Bacteria | 7381 |
| 172 | Ga0209759_1007655 | 3300025256 | Bacteria | 3447 |
| 173 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 174 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 175 | Ga0209455_1000141 | 3300025272 | Bacteria | 138212 |
| 176 | Ga0209455_1000161 | 3300025272 | Bacteria | 117353 |
| 177 | Ga0209455_1001584 | 3300025272 | Bacteria | 10019 |
| 178 | Ga0209455_1003534 | 3300025272 | Bacteria | 5485 |
| 179 | Ga0209455_1022539 | 3300025272 | Bacteria | 1197 |
| 180 | Ga0209673_1000184 | 3300025273 | Bacteria | 126036 |
| 181 | Ga0209025_1000338 | 3300025294 | Bacteria | 103479 |
| 182 | Ga0209564_1013075 | 3300025295 | Bacteria | 3555 |
| 183 | Ga0209758_1000048 | 3300025297 | Bacteria | 358400 |
| 184 | Ga0209758_1003308 | 3300025297 | Bacteria | 14918 |
| 185 | Ga0209758_1025482 | 3300025297 | Bacteria | 2594 |
| 186 | Ga0209050_1005781 | 3300025298 | Bacteria | 7612 |
| 187 | Ga0209257_1000334 | 3300025304 | Bacteria | 98054 |
| 188 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 189 | Ga0207696_1021938 | 3300025711 | Bacteria | 2037 |
| 190 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 191 | Ga0207655_1004310 | 3300025728 | Bacteria | 10166 |
| 192 | Ga0207655_1009973 | 3300025728 | Bacteria | 5824 |
| 193 | Ga0207713_1000058 | 3300025735 | Bacteria | 216911 |
| 194 | Ga0207713_1000774 | 3300025735 | Bacteria | 29524 |
| 195 | Ga0207713_1002317 | 3300025735 | Bacteria | 13989 |
| 196 | Ga0207713_1007264 | 3300025735 | Bacteria | 6572 |
| 197 | Ga0207713_1014153 | 3300025735 | Bacteria | 4161 |
| 198 | Ga0207680_10084344 | 3300025903 | Bacteria | 2004 |
| 199 | Ga0207647_10003229 | 3300025904 | Bacteria | 12230 |
| 200 | Ga0207647_10007459 | 3300025904 | Bacteria | 7900 |
| 201 | Ga0207705_10067526 | 3300025909 | Bacteria | 2588 |
| 202 | Ga0207684_10005922 | 3300025910 | Bacteria | 11192 |
| 203 | Ga0207695_10001136 | 3300025913 | Bacteria | 46129 |
| 204 | Ga0207695_10001137 | 3300025913 | Bacteria | 46108 |
| 205 | Ga0207695_10065674 | 3300025913 | Bacteria | 3730 |
| 206 | Ga0207695_10239111 | 3300025913 | Bacteria | 1718 |
| 207 | Ga0207695_10314452 | 3300025913 | Bacteria | 1456 |
| 208 | Ga0207671_10001472 | 3300025914 | Bacteria | 27195 |
| 209 | Ga0207657_10000078 | 3300025919 | Bacteria | 92019 |
| 210 | Ga0207649_10000111 | 3300025920 | Bacteria | 68568 |
| 211 | Ga0207649_10004380 | 3300025920 | Bacteria | 7662 |
| 212 | Ga0207681_10015979 | 3300025923 | Bacteria | 4689 |
| 213 | Ga0207681_10192931 | 3300025923 | Bacteria | 1560 |
| 214 | Ga0207681_10254015 | 3300025923 | Bacteria | 1374 |
| 215 | Ga0207694_10018442 | 3300025924 | Bacteria | 5274 |
| 216 | Ga0207650_10001079 | 3300025925 | Bacteria | 20203 |
| 217 | Ga0207690_10000026 | 3300025932 | Bacteria | 175904 |
| 218 | Ga0207706_10013625 | 3300025933 | Bacteria | 7385 |
| 219 | Ga0207686_10046851 | 3300025934 | Bacteria | 2669 |
| 220 | Ga0207691_10069105 | 3300025940 | Bacteria | 3191 |
| 221 | Ga0207711_10085423 | 3300025941 | Bacteria | 2765 |
| 222 | Ga0207679_10000105 | 3300025945 | Bacteria | 68561 |
| 223 | Ga0207679_10000818 | 3300025945 | Bacteria | 20047 |
| 224 | Ga0207658_10036205 | 3300025986 | Bacteria | 3538 |
| 225 | Ga0207639_10048044 | 3300026041 | Bacteria | 3228 |
| 226 | Ga0207639_10115535 | 3300026041 | Bacteria | 2195 |
| 227 | Ga0207678_10000106 | 3300026067 | Bacteria | 68474 |
| 228 | Ga0207678_10006717 | 3300026067 | Bacteria | 10203 |
| 229 | Ga0207678_10070213 | 3300026067 | Bacteria | 3003 |
| 230 | Ga0207702_10000135 | 3300026078 | Bacteria | 88092 |
| 231 | Ga0207702_10169762 | 3300026078 | Bacteria | 1999 |
| 232 | Ga0207674_10242360 | 3300026116 | Bacteria | 1750 |
| 233 | Ga0207683_10121325 | 3300026121 | Bacteria | 2347 |
| 234 | Ga0207698_10044384 | 3300026142 | Bacteria | 3339 |
| 235 | Ga0209371_1000488 | 3300027312 | Bacteria | 38733 |
| 236 | Ga0209589_1000042 | 3300027357 | Bacteria | 122436 |
| 237 | Ga0209489_100095 | 3300027361 | Bacteria | 122436 |
| 238 | Ga0209700_100095 | 3300027363 | Bacteria | 122436 |
| 239 | Ga0207428_10014760 | 3300027907 | Bacteria | 6767 |
| 240 | Ga0207428_10015644 | 3300027907 | Bacteria | 6555 |
| 241 | Ga0207428_10018964 | 3300027907 | Bacteria | 5867 |
| 242 | Ga0207428_10224554 | 3300027907 | Bacteria | 1407 |
| 243 | Ga0268265_10018107 | 3300028380 | Bacteria | 4876 |
| 244 | Ga0307515_10066283 | 3300028794 | Bacteria | 5005 |
| 245 | Ga0265338_10000037 | 3300028800 | Bacteria | 237244 |
| 246 | Ga0310981_1009967 | 3300029285 | Bacteria | 1409 |
| 247 | Ga0268256_1003581 | 3300030500 | Bacteria | 6933 |
| 248 | Ga0265340_10014726 | 3300031247 | Bacteria | 4079 |
| 249 | Ga0265316_10232510 | 3300031344 | Bacteria | 1357 |
| 250 | Ga0307513_10041773 | 3300031456 | Bacteria | 5057 |
| 251 | Ga0307408_100191534 | 3300031548 | Bacteria | 1648 |
| 252 | Ga0307508_10125162 | 3300031616 | Bacteria | 2173 |
| 253 | Ga0307405_10000479 | 3300031731 | Bacteria | 15021 |
| 254 | Ga0307410_10302880 | 3300031852 | Bacteria | 1262 |
| 255 | Ga0307411_10065341 | 3300032005 | Bacteria | 2440 |
| 256 | Ga0307510_10151481 | 3300033180 | Bacteria | 1937 |
| 257 | Ga0373923_0101801 | 3300035111 | Bacteria | 1267 |
| 258 | Ga0373937_0047181 | 3300036401 | Bacteria | 3940 |
| 259 | Ga0395899_0029919 | 3300037312 | Bacteria | 4098 |
| 260 | Ga0395899_0115027 | 3300037312 | Bacteria | 1931 |
| 261 | Ga0395900_0083216 | 3300037418 | Bacteria | 3288 |
| 262 | Ga0395905_0026325 | 3300037471 | Bacteria | 5485 |
| 263 | Ga0436364_0738766 | 3300037853 | Bacteria | 4033 |
| 264 | Ga0237819_04710 | 3300038705 | Bacteria | 2215 |
| 265 | Ga0436365_1255399 | 3300039437 | Bacteria | 3124 |
| 266 | Ga0436361_0734299 | 3300039447 | Bacteria | 2461 |
| 267 | Ga0436362_0478089 | 3300039453 | Bacteria | 1530 |
| 268 | Ga0439438_001304 | 3300041405 | Bacteria | 11047 |
| 269 | Ga0439438_010381 | 3300041405 | Bacteria | 2945 |
| 270 | Ga0439439_0001544 | 3300041406 | Bacteria | 4624 |
| 271 | Ga0439447_001045 | 3300041407 | Bacteria | 10069 |
| 272 | Ga0439447_018421 | 3300041407 | Bacteria | 1882 |
| 273 | Ga0439447_034028 | 3300041407 | Bacteria | 1268 |
| 274 | Ga0439466_0007138 | 3300041411 | Bacteria | 4229 |
| 275 | Ga0439466_0013904 | 3300041411 | Bacteria | 2939 |
| 276 | Ga0439466_0019824 | 3300041411 | Bacteria | 2403 |
| 277 | Ga0439465_0006173 | 3300041413 | Bacteria | 3811 |
| 278 | Ga0439431_0021573 | 3300041997 | Bacteria | 1546 |
| 279 | Ga0439445_0007986 | 3300042004 | Bacteria | 2468 |
| 280 | Ga0439432_000292 | 3300042006 | Bacteria | 18051 |
| 281 | Ga0439432_005525 | 3300042006 | Bacteria | 4548 |
| 282 | Ga0439432_019836 | 3300042006 | Bacteria | 2237 |
| 283 | Ga0439432_028798 | 3300042006 | Bacteria | 1807 |
| 284 | Ga0439449_0001069 | 3300042007 | Bacteria | 10763 |
| 285 | Ga0439449_0029879 | 3300042007 | Bacteria | 2030 |
| 286 | Ga0439451_000584 | 3300042009 | Bacteria | 6925 |
| 287 | Ga0439451_015658 | 3300042009 | Bacteria | 1529 |
| 288 | Ga0439452_000134 | 3300042010 | Bacteria | 55915 |
| 289 | Ga0439452_002617 | 3300042010 | Bacteria | 6578 |
| 290 | Ga0439452_015506 | 3300042010 | Bacteria | 2089 |
| 291 | Ga0439456_010692 | 3300042013 | Bacteria | 1897 |
| 292 | Ga0439463_000532 | 3300042016 | Bacteria | 10687 |
| 293 | Ga0439463_000642 | 3300042016 | Bacteria | 9676 |
| 294 | Ga0450911_000827 | 3300042115 | Bacteria | 8468 |
| 295 | Ga0450890_001166 | 3300042127 | Bacteria | 3805 |
| 296 | Ga0450902_001559 | 3300042137 | Bacteria | 3136 |
| 297 | Ga0450903_002672 | 3300042138 | Bacteria | 3141 |
| 298 | Ga0450906_000568 | 3300042145 | Bacteria | 7814 |
| 299 | Ga0450906_004068 | 3300042145 | Bacteria | 3094 |
| 300 | Ga0450907_002608 | 3300042146 | Bacteria | 3376 |
| 301 | Ga0450908_004697 | 3300042184 | Bacteria | 2632 |
| 302 | Ga0450908_017573 | 3300042184 | Bacteria | 1268 |
| 303 | Ga0439434_0005521 | 3300042435 | Bacteria | 3695 |
| 304 | Ga0439464_0007775 | 3300042439 | Bacteria | 2805 |
| 305 | Ga0439460_0013610 | 3300042461 | Bacteria | 2130 |
| 306 | Ga0439440_0000266 | 3300042993 | Bacteria | 8442 |
| 307 | Ga0466969_0001891 | 3300044656 | Bacteria | 11192 |
| 308 | Ga0466969_0011954 | 3300044656 | Bacteria | 4590 |
| 309 | Ga0466969_0098019 | 3300044656 | Bacteria | 1382 |
| 310 | Ga0466972_0021255 | 3300044658 | Bacteria | 3237 |
| 311 | Ga0466972_0035450 | 3300044658 | Bacteria | 2442 |
| 312 | Ga0466965_0020425 | 3300044683 | Bacteria | 3183 |
| 313 | Ga0466965_0078061 | 3300044683 | Bacteria | 1672 |
| 314 | Ga0466966_0000017 | 3300044684 | Bacteria | 123642 |
| 315 | Ga0466966_0008059 | 3300044684 | Bacteria | 6982 |
| 316 | Ga0466966_0054990 | 3300044684 | Bacteria | 2521 |
| 317 | Ga0466961_0000433 | 3300044693 | Bacteria | 26669 |
| 318 | Ga0466961_0008995 | 3300044693 | Bacteria | 6371 |
| 319 | Ga0466961_0039226 | 3300044693 | Bacteria | 3036 |
| 320 | Ga0466963_0000944 | 3300044694 | Bacteria | 14881 |
| 321 | Ga0466963_0103578 | 3300044694 | Bacteria | 1950 |
| 322 | Ga0466964_0003050 | 3300044706 | Bacteria | 6079 |
| 323 | Ga0466971_0007795 | 3300044719 | Bacteria | 4666 |
| 324 | Ga0466971_0037703 | 3300044719 | Bacteria | 2167 |
| 325 | Ga0466968_0009107 | 3300044735 | Bacteria | 3816 |
| 326 | Ga0466968_0057733 | 3300044735 | Bacteria | 1669 |
| 327 | Ga0466970_0004294 | 3300044765 | Bacteria | 7013 |
| 328 | Ga0466957_0008225 | 3300044842 | Bacteria | 5926 |
| 329 | Ga0466957_0140688 | 3300044842 | Bacteria | 1554 |
| 330 | Ga0466957_0145319 | 3300044842 | Bacteria | 1530 |
| 331 | Ga0466960_0004840 | 3300044901 | Bacteria | 5292 |
| 332 | Ga0466959_0015380 | 3300045049 | Bacteria | 5572 |
| 333 | Ga0466959_0018197 | 3300045049 | Bacteria | 5157 |
| 334 | Ga0466958_0003813 | 3300045836 | Bacteria | 7875 |
| 335 | Ga0466958_0004066 | 3300045836 | Bacteria | 7674 |
| 336 | Ga0466958_0014521 | 3300045836 | Bacteria | 4495 |
| 337 | Ga0495617_000278 | 3300046452 | Bacteria | 29586 |
| 338 | Ga0495627_000263 | 3300046453 | Bacteria | 53912 |
| 339 | Ga0495627_020422 | 3300046453 | Bacteria | 2207 |
| 340 | Ga0495592_0034404 | 3300046454 | Bacteria | 3819 |
| 341 | Ga0495603_0000631 | 3300046455 | Bacteria | 19774 |
| 342 | Ga0495603_0000708 | 3300046455 | Bacteria | 18905 |
| 343 | Ga0495590_0035811 | 3300046457 | Bacteria | 1732 |
| 344 | Ga0495591_000130 | 3300046458 | Bacteria | 82467 |
| 345 | Ga0495591_000208 | 3300046458 | Bacteria | 59856 |
| 346 | Ga0495591_001119 | 3300046458 | Bacteria | 17719 |
| 347 | Ga0495591_002961 | 3300046458 | Bacteria | 9068 |
| 348 | Ga0495591_018643 | 3300046458 | Bacteria | 2348 |
| 349 | Ga0495591_034846 | 3300046458 | Bacteria | 1478 |
| 350 | Ga0495629_0000203 | 3300046459 | Bacteria | 52930 |
| 351 | Ga0495629_0252329 | 3300046459 | Bacteria | 1214 |
| 352 | Ga0495638_0002449 | 3300046460 | Bacteria | 15148 |
| 353 | Ga0495638_0016207 | 3300046460 | Bacteria | 4995 |
| 354 | Ga0495638_0070018 | 3300046460 | Bacteria | 2149 |
| 355 | Ga0495638_0105132 | 3300046460 | Bacteria | 1683 |
| 356 | Ga0495651_0096623 | 3300046462 | Bacteria | 2207 |
| 357 | Ga0495651_0118815 | 3300046462 | Bacteria | 1945 |
| 358 | Ga0495651_0137227 | 3300046462 | Bacteria | 1778 |
| 359 | Ga0495653_0000400 | 3300046463 | Bacteria | 34828 |
| 360 | Ga0495653_0038718 | 3300046463 | Bacteria | 3741 |
| 361 | Ga0495653_0184809 | 3300046463 | Bacteria | 1427 |
| 362 | Ga0495653_0261490 | 3300046463 | Bacteria | 1144 |
| 363 | Ga0495650_0000617 | 3300046471 | Bacteria | 48235 |
| 364 | Ga0495650_0000977 | 3300046471 | Bacteria | 32622 |
| 365 | Ga0495650_0047282 | 3300046471 | Bacteria | 1800 |
| 366 | Ga0495650_0047801 | 3300046471 | Bacteria | 1787 |
| 367 | Ga0495650_0061071 | 3300046471 | Bacteria | 1511 |
| 368 | Ga0495580_0011535 | 3300046472 | Bacteria | 6836 |
| 369 | Ga0495605_0000060 | 3300046474 | Bacteria | 145530 |
| 370 | Ga0495605_0000066 | 3300046474 | Bacteria | 139260 |
| 371 | Ga0495605_0000129 | 3300046474 | Bacteria | 99505 |
| 372 | Ga0495605_0000310 | 3300046474 | Bacteria | 51402 |
| 373 | Ga0495605_0001183 | 3300046474 | Bacteria | 17357 |
| 374 | Ga0495605_0002052 | 3300046474 | Bacteria | 12704 |
| 375 | Ga0495662_0111691 | 3300046476 | Bacteria | 1340 |
| 376 | Ga0495664_0004705 | 3300046477 | Bacteria | 7467 |
| 377 | Ga0495664_0164551 | 3300046477 | Bacteria | 1346 |
| 378 | Ga0495584_0027613 | 3300046491 | Bacteria | 2875 |
| 379 | Ga0495584_0111672 | 3300046491 | Bacteria | 1383 |
| 380 | Ga0495585_0001822 | 3300046492 | Bacteria | 16137 |
| 381 | Ga0495585_0047975 | 3300046492 | Bacteria | 2376 |
| 382 | Ga0495594_0001716 | 3300046499 | Bacteria | 11359 |
| 383 | Ga0495596_0054830 | 3300046500 | Bacteria | 1558 |
| 384 | Ga0495607_0000858 | 3300046501 | Bacteria | 28651 |
| 385 | Ga0495607_0003325 | 3300046501 | Bacteria | 12347 |
| 386 | Ga0495607_0006938 | 3300046501 | Bacteria | 7895 |
| 387 | Ga0495607_0012819 | 3300046501 | Bacteria | 5513 |
| 388 | Ga0495607_0015236 | 3300046501 | Bacteria | 4985 |
| 389 | Ga0495607_0048743 | 3300046501 | Bacteria | 2475 |
| 390 | Ga0495607_0068773 | 3300046501 | Bacteria | 1984 |
| 391 | Ga0495583_0000086 | 3300046506 | Bacteria | 165176 |
| 392 | Ga0495583_0000282 | 3300046506 | Bacteria | 82063 |
| 393 | Ga0495583_0000312 | 3300046506 | Bacteria | 76605 |
| 394 | Ga0495583_0000694 | 3300046506 | Bacteria | 43511 |
| 395 | Ga0495583_0001046 | 3300046506 | Bacteria | 31212 |
| 396 | Ga0495583_0001170 | 3300046506 | Bacteria | 28380 |
| 397 | Ga0495583_0006932 | 3300046506 | Bacteria | 7275 |
| 398 | Ga0495583_0082906 | 3300046506 | Bacteria | 1391 |
| 399 | Ga0495606_0000274 | 3300046507 | Bacteria | 90529 |
| 400 | Ga0495606_0005395 | 3300046507 | Bacteria | 12259 |
| 401 | Ga0495606_0022702 | 3300046507 | Bacteria | 4561 |
| 402 | Ga0495606_0026807 | 3300046507 | Bacteria | 4099 |
| 403 | Ga0495606_0050412 | 3300046507 | Bacteria | 2723 |
| 404 | Ga0495608_0004835 | 3300046511 | Bacteria | 9629 |
| 405 | Ga0495610_0052406 | 3300046512 | Bacteria | 1980 |
| 406 | Ga0495610_0080705 | 3300046512 | Bacteria | 1494 |
| 407 | Ga0495616_0097822 | 3300046513 | Bacteria | 1380 |
| 408 | Ga0495618_0037393 | 3300046514 | Bacteria | 3048 |
| 409 | Ga0495620_0000061 | 3300046515 | Bacteria | 94469 |
| 410 | Ga0495620_0000962 | 3300046515 | Bacteria | 17723 |
| 411 | Ga0495620_0021769 | 3300046515 | Bacteria | 3105 |
| 412 | Ga0495628_0000614 | 3300046516 | Bacteria | 32697 |
| 413 | Ga0495628_0001445 | 3300046516 | Bacteria | 21790 |
| 414 | Ga0495628_0001650 | 3300046516 | Bacteria | 20411 |
| 415 | Ga0495628_0007899 | 3300046516 | Bacteria | 9169 |
| 416 | Ga0495630_0001326 | 3300046517 | Bacteria | 17013 |
| 417 | Ga0495630_0015418 | 3300046517 | Bacteria | 5581 |
| 418 | Ga0495631_0002774 | 3300046518 | Bacteria | 9712 |
| 419 | Ga0495631_0026707 | 3300046518 | Bacteria | 2648 |
| 420 | Ga0495632_0002787 | 3300046519 | Bacteria | 12963 |
| 421 | Ga0495632_0002802 | 3300046519 | Bacteria | 12909 |
| 422 | Ga0495632_0003043 | 3300046519 | Bacteria | 12204 |
| 423 | Ga0495637_0000043 | 3300046520 | Bacteria | 112526 |
| 424 | Ga0495637_0000661 | 3300046520 | Bacteria | 24026 |
| 425 | Ga0495637_0050732 | 3300046520 | Bacteria | 1739 |
| 426 | Ga0495643_0020381 | 3300046522 | Bacteria | 3822 |
| 427 | Ga0495643_0032144 | 3300046522 | Bacteria | 2915 |
| 428 | Ga0495644_0002549 | 3300046523 | Bacteria | 7250 |
| 429 | Ga0495644_0019462 | 3300046523 | Bacteria | 2592 |
| 430 | Ga0495644_0036401 | 3300046523 | Bacteria | 1857 |
| 431 | Ga0495648_0000218 | 3300046524 | Bacteria | 65786 |
| 432 | Ga0495648_0002103 | 3300046524 | Bacteria | 18775 |
| 433 | Ga0495648_0005363 | 3300046524 | Bacteria | 10673 |
| 434 | Ga0495648_0077514 | 3300046524 | Bacteria | 1904 |
| 435 | Ga0495666_0009100 | 3300046526 | Bacteria | 4968 |
| 436 | Ga0495642_0007735 | 3300046528 | Bacteria | 4118 |
| 437 | Ga0495642_0032826 | 3300046528 | Bacteria | 2084 |
| 438 | Ga0495652_0003089 | 3300046529 | Bacteria | 16662 |
| 439 | Ga0495652_0034716 | 3300046529 | Bacteria | 4394 |
| 440 | Ga0495654_0000244 | 3300046530 | Bacteria | 50838 |
| 441 | Ga0495654_0000770 | 3300046530 | Bacteria | 24726 |
| 442 | Ga0495654_0008768 | 3300046530 | Bacteria | 5565 |
| 443 | Ga0495654_0022451 | 3300046530 | Bacteria | 3276 |
| 444 | Ga0495654_0033179 | 3300046530 | Bacteria | 2614 |
| 445 | Ga0495665_0000050 | 3300046531 | Bacteria | 47033 |
| 446 | Ga0495665_0009851 | 3300046531 | Bacteria | 5172 |
| 447 | Ga0495609_0000045 | 3300046538 | Bacteria | 159595 |
| 448 | Ga0495609_0000125 | 3300046538 | Bacteria | 83190 |
| 449 | Ga0495609_0000144 | 3300046538 | Bacteria | 74360 |
| 450 | Ga0495609_0005126 | 3300046538 | Bacteria | 6977 |
| 451 | Ga0495621_0031343 | 3300046539 | Bacteria | 1823 |
| 452 | Ga0495597_0038052 | 3300046542 | Bacteria | 2158 |
| 453 | Ga0495645_0003414 | 3300046543 | Bacteria | 10766 |
| 454 | Ga0495645_0038879 | 3300046543 | Bacteria | 3470 |
| 455 | Ga0495622_0000667 | 3300046557 | Bacteria | 19434 |
| 456 | Ga0495633_0000139 | 3300046558 | Bacteria | 96799 |
| 457 | Ga0495667_0018909 | 3300046559 | Bacteria | 4653 |
| 458 | Ga0495667_0088426 | 3300046559 | Bacteria | 2008 |
| 459 | Ga0495656_0000060 | 3300046615 | Bacteria | 52471 |
| 460 | Ga0495656_0008750 | 3300046615 | Bacteria | 3624 |
| 461 | Ga0495668_0007195 | 3300046616 | Bacteria | 7155 |
| 462 | Ga0495668_0026059 | 3300046616 | Bacteria | 3319 |
| 463 | Ga0495668_0033949 | 3300046616 | Bacteria | 2865 |
| 464 | Ga0495668_0090047 | 3300046616 | Bacteria | 1681 |
| 465 | Ga0495634_0054589 | 3300046642 | Bacteria | 2674 |
| 466 | Ga0495611_0001065 | 3300046648 | Bacteria | 14497 |
| 467 | Ga0495611_0014154 | 3300046648 | Bacteria | 3404 |
| 468 | Ga0495611_0093651 | 3300046648 | Bacteria | 1390 |
| 469 | Ga0495625_0000070 | 3300046660 | Bacteria | 167336 |
| 470 | Ga0495625_0050474 | 3300046660 | Bacteria | 2985 |
| 471 | Ga0495625_0183694 | 3300046660 | Bacteria | 1389 |
| 472 | Ga0495635_0068701 | 3300046663 | Bacteria | 2430 |
| 473 | Ga0495635_0123188 | 3300046663 | Bacteria | 1768 |
| 474 | Ga0495661_0000042 | 3300046665 | Bacteria | 150599 |
| 475 | Ga0495661_0000043 | 3300046665 | Bacteria | 149067 |
| 476 | Ga0495661_0000155 | 3300046665 | Bacteria | 80777 |
| 477 | Ga0495661_0001686 | 3300046665 | Bacteria | 17933 |
| 478 | Ga0495661_0164211 | 3300046665 | Bacteria | 1189 |
| 479 | Ga0495588_0034818 | 3300046674 | Bacteria | 2549 |
| 480 | Ga0495599_0053403 | 3300046678 | Bacteria | 2531 |
| 481 | Ga0495623_0000473 | 3300046679 | Bacteria | 26592 |
| 482 | Ga0495623_0001311 | 3300046679 | Bacteria | 16923 |
| 483 | Ga0495623_0009070 | 3300046679 | Bacteria | 6452 |
| 484 | Ga0495646_0001063 | 3300046680 | Bacteria | 15918 |
| 485 | Ga0495646_0002170 | 3300046680 | Bacteria | 11954 |
| 486 | Ga0495646_0006353 | 3300046680 | Bacteria | 7494 |
| 487 | Ga0495646_0102622 | 3300046680 | Bacteria | 1638 |
| 488 | Ga0495669_0002291 | 3300046684 | Bacteria | 7854 |
| 489 | Ga0495669_0044164 | 3300046684 | Bacteria | 1985 |
| 490 | Ga0495613_0121396 | 3300046689 | Bacteria | 1876 |
| 491 | Ga0495624_0001912 | 3300046690 | Bacteria | 15847 |
| 492 | Ga0495624_0026074 | 3300046690 | Bacteria | 3832 |
| 493 | Ga0495624_0040213 | 3300046690 | Bacteria | 2996 |
| 494 | Ga0495624_0068383 | 3300046690 | Bacteria | 2214 |
| 495 | Ga0495670_0036289 | 3300046691 | Bacteria | 2456 |
| 496 | Ga0495671_0001615 | 3300046692 | Bacteria | 14823 |
| 497 | Ga0495671_0032256 | 3300046692 | Bacteria | 2674 |
| 498 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 499 | Ga0495649_0061928 | 3300046694 | Bacteria | 2011 |
| 500 | Ga0495649_0065551 | 3300046694 | Bacteria | 1949 |
| 501 | Ga0495589_0015683 | 3300046794 | Bacteria | 3895 |
| 502 | Ga0495589_0034570 | 3300046794 | Bacteria | 2536 |
| 503 | Ga0495600_0005356 | 3300046809 | Bacteria | 7732 |
| 504 | Ga0495600_0101608 | 3300046809 | Bacteria | 1874 |
| 505 | Ga0495660_0025466 | 3300046810 | Bacteria | 3359 |
| 506 | Ga0495660_0034832 | 3300046810 | Bacteria | 2815 |
| 507 | Ga0495660_0070045 | 3300046810 | Bacteria | 1862 |
| 508 | Ga0495660_0070683 | 3300046810 | Bacteria | 1852 |
| 509 | Ga0495581_0026107 | 3300047315 | Bacteria | 3389 |
| 510 | Ga0495604_0000557 | 3300047317 | Bacteria | 32763 |
| 511 | Ga0495604_0007691 | 3300047317 | Bacteria | 8537 |
| 512 | Ga0495604_0020189 | 3300047317 | Bacteria | 5324 |
| 513 | Ga0495674_0000364 | 3300047319 | Bacteria | 40183 |
| 514 | Ga0495674_0000942 | 3300047319 | Bacteria | 27786 |
| 515 | Ga0495674_0073734 | 3300047319 | Bacteria | 2941 |
| 516 | Ga0495674_0145902 | 3300047319 | Bacteria | 1987 |
| 517 | Ga0495672_0000313 | 3300047320 | Bacteria | 64731 |
| 518 | Ga0495672_0001604 | 3300047320 | Bacteria | 22065 |
| 519 | Ga0495672_0006864 | 3300047320 | Bacteria | 8691 |
| 520 | Ga0495672_0053461 | 3300047320 | Bacteria | 2366 |
| 521 | Ga0495672_0090183 | 3300047320 | Bacteria | 1685 |
| 522 | Ga0495676_0000019 | 3300047321 | Bacteria | 167261 |
| 523 | Ga0495680_0007331 | 3300047322 | Bacteria | 10144 |
| 524 | Ga0495683_0000020 | 3300047323 | Bacteria | 181773 |
| 525 | Ga0495683_0002228 | 3300047323 | Bacteria | 11855 |
| 526 | Ga0495683_0041174 | 3300047323 | Bacteria | 2332 |
| 527 | Ga0495683_0064584 | 3300047323 | Bacteria | 1807 |
| 528 | Ga0495687_000020 | 3300047443 | Bacteria | 337717 |
| 529 | Ga0495687_003689 | 3300047443 | Bacteria | 10892 |
| 530 | Ga0495687_076483 | 3300047443 | Bacteria | 1325 |
| 531 | Ga0495687_080791 | 3300047443 | Bacteria | 1274 |
| 532 | Ga0495675_0005135 | 3300047444 | Bacteria | 7963 |
| 533 | Ga0495675_0022533 | 3300047444 | Bacteria | 4015 |
| 534 | Ga0495675_0049658 | 3300047444 | Bacteria | 2666 |
| 535 | Ga0495675_0092267 | 3300047444 | Bacteria | 1900 |
| 536 | Ga0495677_0000311 | 3300047445 | Bacteria | 21147 |
| 537 | Ga0495679_000800 | 3300047446 | Bacteria | 19965 |
| 538 | Ga0495679_001430 | 3300047446 | Bacteria | 13572 |
| 539 | Ga0495673_0003719 | 3300047469 | Bacteria | 9915 |
| 540 | Ga0495673_0023486 | 3300047469 | Bacteria | 2998 |
| 541 | Ga0495673_0063403 | 3300047469 | Bacteria | 1575 |
| 542 | Ga0495673_0095829 | 3300047469 | Bacteria | 1206 |
| 543 | Ga0495681_0002002 | 3300047470 | Bacteria | 14888 |
| 544 | Ga0495681_0043095 | 3300047470 | Bacteria | 2179 |
| 545 | Ga0495684_0073107 | 3300047471 | Bacteria | 2605 |
| 546 | Ga0495686_0073388 | 3300047472 | Bacteria | 2102 |
| 547 | Ga0495593_0011379 | 3300047673 | Bacteria | 5111 |
| 548 | Ga0495602_0000269 | 3300048088 | Bacteria | 47834 |
| 549 | Ga0495602_0012534 | 3300048088 | Bacteria | 8705 |
| 550 | Ga0495602_0018465 | 3300048088 | Bacteria | 6963 |
| 551 | Ga0495602_0087373 | 3300048088 | Bacteria | 2599 |
| 552 | Ga0495615_0020377 | 3300048090 | Bacteria | 1485 |
| 553 | Ga0495626_0000378 | 3300048091 | Bacteria | 46400 |
| 554 | Ga0495626_0018729 | 3300048091 | Bacteria | 3469 |
| 555 | Ga0495626_0050015 | 3300048091 | Bacteria | 1933 |
| 556 | Ga0496100_0125745 | 3300048903 | Bacteria | 1799 |
| 557 | Ga0496100_0165232 | 3300048903 | Bacteria | 1589 |
| 558 | Ga0496101_0145847 | 3300048904 | Bacteria | 1807 |
| 559 | Ga0496102_0005456 | 3300048905 | Bacteria | 10785 |
| 560 | Ga0496102_0010607 | 3300048905 | Bacteria | 7937 |
| 561 | Ga0496103_0002801 | 3300048906 | Bacteria | 10850 |
| 562 | Ga0496103_0237289 | 3300048906 | Bacteria | 1173 |
| 563 | Ga0496104_0054958 | 3300048907 | Bacteria | 3764 |
| 564 | Ga0496104_0135025 | 3300048907 | Bacteria | 2370 |
| 565 | Ga0496104_0192865 | 3300048907 | Bacteria | 1949 |
| 566 | Ga0496105_0091100 | 3300048908 | Bacteria | 2518 |
| 567 | Ga0496105_0189862 | 3300048908 | Bacteria | 1680 |
| 568 | Ga0496105_0200256 | 3300048908 | Bacteria | 1630 |
| 569 | Ga0496106_0008681 | 3300048909 | Bacteria | 7521 |
| 570 | Ga0496106_0027797 | 3300048909 | Bacteria | 4212 |
| 571 | Ga0496108_0326904 | 3300048911 | Bacteria | 1337 |
| 572 | Ga0496110_0001089 | 3300048913 | Bacteria | 19134 |
| 573 | Ga0496110_0005839 | 3300048913 | Bacteria | 9675 |
| 574 | Ga0496110_0372092 | 3300048913 | Bacteria | 1302 |
| 575 | Ga0496111_0039594 | 3300048914 | Bacteria | 3380 |
| 576 | Ga0496112_0022401 | 3300048915 | Bacteria | 6021 |
| 577 | Ga0496112_0149002 | 3300048915 | Bacteria | 2307 |
| 578 | Ga0496113_0027996 | 3300048916 | Bacteria | 4047 |
| 579 | Ga0496114_0000165 | 3300048917 | Bacteria | 47058 |
| 580 | Ga0496115_0150435 | 3300048918 | Bacteria | 1922 |
| 581 | Ga0496116_0002414 | 3300048919 | Bacteria | 19679 |
| 582 | Ga0496116_0129401 | 3300048919 | Bacteria | 1442 |
| 583 | Ga0496117_0000205 | 3300048920 | Bacteria | 116761 |
| 584 | Ga0496117_0040175 | 3300048920 | Bacteria | 3445 |
| 585 | Ga0496117_0073826 | 3300048920 | Bacteria | 2274 |
| 586 | Ga0496117_0119710 | 3300048920 | Bacteria | 1620 |
| 587 | Ga0496118_0012794 | 3300048921 | Bacteria | 8008 |
| 588 | Ga0496118_0024517 | 3300048921 | Bacteria | 5202 |
| 589 | Ga0496118_0085589 | 3300048921 | Bacteria | 2194 |
| 590 | Ga0496119_0000198 | 3300048922 | Bacteria | 84746 |
| 591 | Ga0496120_0010682 | 3300048923 | Bacteria | 6374 |
| 592 | Ga0496120_0109994 | 3300048923 | Bacteria | 1441 |
| 593 | Ga0496121_0003265 | 3300048924 | Bacteria | 23309 |
| 594 | Ga0496121_0030122 | 3300048924 | Bacteria | 4992 |
| 595 | Ga0496121_0036718 | 3300048924 | Bacteria | 4362 |
| 596 | Ga0496121_0089764 | 3300048924 | Bacteria | 2404 |
| 597 | Ga0496121_0123765 | 3300048924 | Bacteria | 1948 |
| 598 | Ga0496122_0000156 | 3300048925 | Bacteria | 160178 |
| 599 | Ga0496122_0022808 | 3300048925 | Bacteria | 5549 |
| 600 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 601 | Ga0496123_0036720 | 3300048926 | Bacteria | 3469 |
| 602 | Ga0496123_0148870 | 3300048926 | Bacteria | 1266 |
| 603 | Ga0496124_0000118 | 3300048927 | Bacteria | 164259 |
| 604 | Ga0496124_0002944 | 3300048927 | Bacteria | 21404 |
| 605 | Ga0496124_0006644 | 3300048927 | Bacteria | 12547 |
| 606 | Ga0496124_0124236 | 3300048927 | Bacteria | 2058 |
| 607 | Ga0496124_0129726 | 3300048927 | Bacteria | 2004 |
| 608 | Ga0496124_0179283 | 3300048927 | Bacteria | 1632 |
| 609 | Ga0496125_0003318 | 3300048928 | Bacteria | 19669 |
| 610 | Ga0496125_0003880 | 3300048928 | Bacteria | 17674 |
| 611 | Ga0496125_0004583 | 3300048928 | Bacteria | 15809 |
| 612 | Ga0496125_0075694 | 3300048928 | Bacteria | 2603 |
| 613 | Ga0496126_0328336 | 3300048929 | Bacteria | 1256 |
| 614 | Ga0495678_000077 | 3300049459 | Bacteria | 125025 |
| 615 | Ga0495678_000137 | 3300049459 | Bacteria | 87580 |
| 616 | Ga0495678_006070 | 3300049459 | Bacteria | 6506 |
| 617 | Ga0495678_075695 | 3300049459 | Bacteria | 1221 |
| 618 | Ga0495682_0000040 | 3300049460 | Bacteria | 119566 |
| 619 | Ga0495682_0000051 | 3300049460 | Bacteria | 109996 |
| 620 | Ga0495682_0024099 | 3300049460 | Bacteria | 2270 |
| 621 | Ga0495682_0035493 | 3300049460 | Bacteria | 1837 |
| 622 | Ga0501032_0048223 | 3300049569 | Bacteria | 2876 |
| 623 | Ga0501034_0001273 | 3300049571 | Bacteria | 34174 |
| 624 | Ga0501036_0177742 | 3300049572 | Bacteria | 1792 |
| 625 | Ga0501046_0035863 | 3300049580 | Bacteria | 3994 |
| 626 | Ga0501047_0004562 | 3300049581 | Bacteria | 13024 |
| 627 | Ga0501047_0007211 | 3300049581 | Bacteria | 10452 |
| 628 | Ga0501067_0018338 | 3300049583 | Bacteria | 3877 |
| 629 | Ga0501069_0036326 | 3300049585 | Bacteria | 2717 |
| 630 | Ga0501070_0122613 | 3300049586 | Bacteria | 2148 |
| 631 | Ga0501070_0181510 | 3300049586 | Bacteria | 1732 |
| 632 | Ga0501073_0007640 | 3300049589 | Bacteria | 8024 |
| 633 | Ga0501074_0095163 | 3300049590 | Bacteria | 2133 |
| 634 | Ga0501076_0109472 | 3300049592 | Bacteria | 2233 |
| 635 | Ga0501076_0110343 | 3300049592 | Bacteria | 2224 |
| 636 | Ga0501257_009654 | 3300049686 | Bacteria | 2181 |
| 637 | Ga0501079_0192956 | 3300049741 | Bacteria | 1590 |
| 638 | Ga0501080_0018053 | 3300049742 | Bacteria | 6530 |
| 639 | Ga0501083_0104666 | 3300049744 | Bacteria | 1864 |
| 640 | Ga0501035_0144614 | 3300049822 | Bacteria | 2066 |
| 641 | nmdc:mga00v17_301546_c1 | 3300050491 | Bacteria | 1041 |
| 642 | nmdc:mga0k408_114327_c1 | 3300050493 | Bacteria | 1596 |
| 643 | nmdc:mga07m45_105967_c1 | 3300050496 | Bacteria | 1617 |
| 644 | nmdc:mga07m45_89663_c1 | 3300050496 | Bacteria | 1761 |
| 645 | nmdc:mga07m45_966_c1 | 3300050496 | Bacteria | 4412 |
| 646 | Ga0495601_0006243 | 3300053077 | Bacteria | 6958 |
| 647 | Ga0495619_0046835 | 3300053085 | Bacteria | 2845 |
| 648 | Ga0500651_0009119 | 3300053093 | Bacteria | 5877 |
| 649 | Ga0500595_005009 | 3300053119 | Bacteria | 5836 |
| 650 | Ga0500642_0005236 | 3300053130 | Bacteria | 4168 |
| 651 | Ga0500588_0098574 | 3300053146 | Bacteria | 1004 |
| 652 | Ga0500611_023523 | 3300053727 | Bacteria | 1201 |
| 653 | Ga0500609_001135 | 3300053731 | Bacteria | 3962 |
| 654 | Ga0501084_0030279 | 3300054114 | Bacteria | 4527 |
| 655 | Ga0587072_000271 | 3300059643 | Bacteria | 4793 |
| 656 | Ga0501082_0012918 | 3300060353 | Bacteria | 7179 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10254015 | Ga0207681_102540153 | 242 |
| 2 | 3300046519 | Ga0495632_0002802 | Ga0495632_0002802_12031_12897 | 244 |
| 3 | 3300048091 | Ga0495626_0018729 | Ga0495626_0018729_2591_3457 | 244 |
| 4 | 3300049459 | Ga0495678_075695 | Ga0495678_075695_343_1209 | 244 |
| 5 | 3300049590 | Ga0501074_0095163 | Ga0501074_0095163_1126_2112 | 244 |
| 6 | iso_pu_bacteria | 8019659431 | 8019660913 | 245 |
| 7 | 3300025272 | Ga0209455_1022539 | Ga0209455_10225391 | 246 |
| 8 | 3300048921 | Ga0496118_0012794 | Ga0496118_0012794_5730_6731 | 246 |
| 9 | 3300048924 | Ga0496121_0089764 | Ga0496121_0089764_1257_2258 | 246 |
| 10 | 3300003752 | Ga0055539_1000073 | Ga0055539_100007391 | 247 |
| 11 | 3300003759 | Ga0055525_1000383 | Ga0055525_10003839 | 247 |
| 12 | 3300009093 | Ga0105240_10170911 | Ga0105240_101709112 | 249 |
| 13 | iso_pu_bacteria | 2922178524 | 2922178567 | 249 |
| 14 | iso_pu_bacteria | 2924754689 | 2924755883 | 249 |
| 15 | 3300025272 | Ga0209455_1003534 | Ga0209455_10035343 | 250 |
| 16 | 3300048908 | Ga0496105_0200256 | Ga0496105_0200256_29_1069 | 253 |
| 17 | 3300031852 | Ga0307410_10302880 | Ga0307410_103028802 | 254 |
| 18 | 3300049581 | Ga0501047_0007211 | Ga0501047_0007211_68_1090 | 256 |
| 19 | 3300049822 | Ga0501035_0144614 | Ga0501035_0144614_688_1710 | 256 |
| 20 | 3300003762 | Ga0055542_1000928 | Ga0055542_10009286 | 257 |
| 21 | 3300005327 | Ga0070658_10073348 | Ga0070658_100733482 | 257 |
| 22 | 3300005339 | Ga0070660_100030766 | Ga0070660_1000307662 | 257 |
| 23 | 3300005366 | Ga0070659_100201703 | Ga0070659_1002017032 | 257 |
| 24 | 3300005548 | Ga0070665_100274804 | Ga0070665_1002748042 | 257 |
| 25 | 3300006038 | Ga0075365_10037339 | Ga0075365_100373393 | 257 |
| 26 | 3300025254 | Ga0209148_1001176 | Ga0209148_10011762 | 257 |
| 27 | 3300025272 | Ga0209455_1000161 | Ga0209455_100016199 | 257 |
| 28 | 3300025909 | Ga0207705_10067526 | Ga0207705_100675262 | 257 |
| 29 | 3300025913 | Ga0207695_10314452 | Ga0207695_103144522 | 257 |
| 30 | 3300026041 | Ga0207639_10115535 | Ga0207639_101155352 | 257 |
| 31 | 3300026067 | Ga0207678_10070213 | Ga0207678_100702132 | 257 |
| 32 | 3300048923 | Ga0496120_0109994 | Ga0496120_0109994_206_1198 | 257 |
| 33 | 3300048927 | Ga0496124_0179283 | Ga0496124_0179283_393_1385 | 257 |
| 34 | 3300050496 | nmdc:mga07m45_105967_c1 | nmdc:mga07m45_105967_c1_118_1110 | 257 |
| 35 | iso_pu_bacteria | 2965110997 | 2965118234 | 257 |
| 36 | 3300006942 | Ga0099824_1019296 | Ga0099824_10192962 | 258 |
| 37 | 3300006943 | Ga0099822_1004906 | Ga0099822_100490617 | 258 |
| 38 | 3300027357 | Ga0209589_1000042 | Ga0209589_100004251 | 258 |
| 39 | 3300027361 | Ga0209489_100095 | Ga0209489_10009551 | 258 |
| 40 | 3300027363 | Ga0209700_100095 | Ga0209700_10009551 | 258 |
| 41 | 3300042013 | Ga0439456_010692 | Ga0439456_010692_16_924 | 258 |
| 42 | 3300001989 | JGI24739J22299_10007978 | JGI24739J22299_100079782 | 259 |
| 43 | 3300010375 | Ga0105239_10203686 | Ga0105239_102036862 | 259 |
| 44 | 3300013105 | Ga0157369_10128831 | Ga0157369_101288312 | 259 |
| 45 | 3300025297 | Ga0209758_1025482 | Ga0209758_10254822 | 259 |
| 46 | 3300025904 | Ga0207647_10007459 | Ga0207647_100074593 | 259 |
| 47 | 3300026078 | Ga0207702_10169762 | Ga0207702_101697622 | 259 |
| 48 | 3300026116 | Ga0207674_10242360 | Ga0207674_102423602 | 259 |
| 49 | 3300039447 | Ga0436361_0734299 | Ga0436361_0734299_454_1467 | 259 |
| 50 | 3300044658 | Ga0466972_0021255 | Ga0466972_0021255_1599_2597 | 259 |
| 51 | 3300044901 | Ga0466960_0004840 | Ga0466960_0004840_2497_3495 | 259 |
| 52 | 3300046460 | Ga0495638_0105132 | Ga0495638_0105132_194_1222 | 259 |
| 53 | 3300046616 | Ga0495668_0033949 | Ga0495668_0033949_1010_2008 | 259 |
| 54 | 3300053146 | Ga0500588_0098574 | Ga0500588_0098574_16_978 | 259 |
| 55 | 3300025253 | Ga0209677_101172 | Ga0209677_1011725 | 260 |
| 56 | 3300025297 | Ga0209758_1003308 | Ga0209758_10033087 | 260 |
| 57 | 3300031548 | Ga0307408_100191534 | Ga0307408_1001915342 | 260 |
| 58 | 3300048913 | Ga0496110_0372092 | Ga0496110_0372092_326_1285 | 260 |
| 59 | 3300014497 | Ga0182008_10038132 | Ga0182008_100381322 | 262 |
| 60 | 3300049586 | Ga0501070_0122613 | Ga0501070_0122613_931_1950 | 262 |
| 61 | 3300049592 | Ga0501076_0109472 | Ga0501076_0109472_831_1850 | 262 |
| 62 | 3300049741 | Ga0501079_0192956 | Ga0501079_0192956_366_1394 | 262 |
| 63 | 3300046501 | Ga0495607_0012819 | Ga0495607_0012819_1799_2791 | 265 |
| 64 | 3300046506 | Ga0495583_0001046 | Ga0495583_0001046_14350_15342 | 265 |
| 65 | 3300046518 | Ga0495631_0026707 | Ga0495631_0026707_549_1541 | 265 |
| 66 | 3300046519 | Ga0495632_0003043 | Ga0495632_0003043_2393_3385 | 265 |
| 67 | 3300046524 | Ga0495648_0000218 | Ga0495648_0000218_51379_52371 | 265 |
| 68 | 3300046530 | Ga0495654_0022451 | Ga0495654_0022451_39_1031 | 265 |
| 69 | 3300046616 | Ga0495668_0026059 | Ga0495668_0026059_1896_2888 | 265 |
| 70 | 3300046665 | Ga0495661_0001686 | Ga0495661_0001686_15847_16839 | 265 |
| 71 | 3300046692 | Ga0495671_0001615 | Ga0495671_0001615_9492_10484 | 265 |
| 72 | 3300047320 | Ga0495672_0001604 | Ga0495672_0001604_14591_15583 | 265 |
| 73 | 3300047472 | Ga0495686_0073388 | Ga0495686_0073388_633_1625 | 265 |
| 74 | 3300049459 | Ga0495678_006070 | Ga0495678_006070_974_1966 | 265 |
| 75 | 3300046462 | Ga0495651_0118815 | Ga0495651_0118815_776_1753 | 266 |
| 76 | 3300046477 | Ga0495664_0164551 | Ga0495664_0164551_368_1306 | 266 |
| 77 | 3300047319 | Ga0495674_0073734 | Ga0495674_0073734_1542_2480 | 266 |
| 78 | 3300047444 | Ga0495675_0092267 | Ga0495675_0092267_797_1774 | 266 |
| 79 | 3300048906 | Ga0496103_0237289 | Ga0496103_0237289_110_1048 | 266 |
| 80 | 3300050491 | nmdc:mga00v17_301546_c1 | nmdc:mga00v17_301546_c1_58_993 | 266 |
| 81 | 3300053085 | Ga0495619_0046835 | Ga0495619_0046835_1556_2533 | 266 |
| 82 | 3300013306 | Ga0163162_10360388 | Ga0163162_103603882 | 267 |
| 83 | 3300013308 | Ga0157375_10002189 | Ga0157375_1000218914 | 267 |
| 84 | 3300014497 | Ga0182008_10001638 | Ga0182008_1000163816 | 267 |
| 85 | 3300042006 | Ga0439432_028798 | Ga0439432_028798_688_1656 | 267 |
| 86 | 3300046453 | Ga0495627_000263 | Ga0495627_000263_9477_10445 | 267 |
| 87 | 3300046458 | Ga0495591_000208 | Ga0495591_000208_56615_57583 | 267 |
| 88 | 3300046463 | Ga0495653_0261490 | Ga0495653_0261490_151_1089 | 267 |
| 89 | 3300046507 | Ga0495606_0005395 | Ga0495606_0005395_7638_8606 | 267 |
| 90 | 3300046519 | Ga0495632_0002787 | Ga0495632_0002787_9812_10780 | 267 |
| 91 | 3300046520 | Ga0495637_0000661 | Ga0495637_0000661_20287_21279 | 267 |
| 92 | 3300046522 | Ga0495643_0032144 | Ga0495643_0032144_72_1007 | 267 |
| 93 | 3300046665 | Ga0495661_0000043 | Ga0495661_0000043_9103_10071 | 267 |
| 94 | 3300048920 | Ga0496117_0000205 | Ga0496117_0000205_110434_111402 | 267 |
| 95 | 3300048921 | Ga0496118_0085589 | Ga0496118_0085589_367_1335 | 267 |
| 96 | 3300048923 | Ga0496120_0010682 | Ga0496120_0010682_5305_6273 | 267 |
| 97 | 3300048927 | Ga0496124_0006644 | Ga0496124_0006644_3610_4578 | 267 |
| 98 | 3300048928 | Ga0496125_0004583 | Ga0496125_0004583_5302_6270 | 267 |
| 99 | 3300049459 | Ga0495678_000137 | Ga0495678_000137_67606_68598 | 267 |
| 100 | 3300049460 | Ga0495682_0035493 | Ga0495682_0035493_52_987 | 267 |
| 101 | 3300028794 | Ga0307515_10066283 | Ga0307515_100662833 | 268 |
| 102 | 3300053731 | Ga0500609_001135 | Ga0500609_001135_637_1665 | 268 |
| 103 | 3300005985 | Ga0081539_10109005 | Ga0081539_101090052 | 269 |
| 104 | 3300031616 | Ga0307508_10125162 | Ga0307508_101251622 | 269 |
| 105 | 3300046665 | Ga0495661_0000155 | Ga0495661_0000155_11847_12866 | 269 |
| 106 | 3300048919 | Ga0496116_0129401 | Ga0496116_0129401_66_1016 | 269 |
| 107 | 3300001979 | JGI24740J21852_10000029 | JGI24740J21852_100000293 | 270 |
| 108 | 3300002705 | JGI25156J39149_1003309 | JGI25156J39149_10033093 | 270 |
| 109 | 3300002738 | JGI25154J39366_1000402 | JGI25154J39366_100040210 | 270 |
| 110 | 3300003756 | Ga0055533_1003352 | Ga0055533_10033523 | 270 |
| 111 | 3300003841 | Ga0055541_1000473 | Ga0055541_100047310 | 270 |
| 112 | 3300005288 | Ga0065714_10064853 | Ga0065714_1006485316 | 270 |
| 113 | 3300005288 | Ga0065714_10093650 | Ga0065714_100936502 | 270 |
| 114 | 3300005290 | Ga0065712_10072822 | Ga0065712_100728224 | 270 |
| 115 | 3300005331 | Ga0070670_100000079 | Ga0070670_10000007930 | 270 |
| 116 | 3300005353 | Ga0070669_100007493 | Ga0070669_1000074937 | 270 |
| 117 | 3300005457 | Ga0070662_100008560 | Ga0070662_1000085606 | 270 |
| 118 | 3300009011 | Ga0105251_10014955 | Ga0105251_100149552 | 270 |
| 119 | 3300009092 | Ga0105250_10000015 | Ga0105250_1000001576 | 270 |
| 120 | 3300013100 | Ga0157373_10000409 | Ga0157373_1000040931 | 270 |
| 121 | 3300013100 | Ga0157373_10000598 | Ga0157373_1000059824 | 270 |
| 122 | 3300013100 | Ga0157373_10014396 | Ga0157373_100143962 | 270 |
| 123 | 3300013102 | Ga0157371_10053913 | Ga0157371_100539132 | 270 |
| 124 | 3300013104 | Ga0157370_10135089 | Ga0157370_101350892 | 270 |
| 125 | 3300013105 | Ga0157369_10002773 | Ga0157369_100027738 | 270 |
| 126 | 3300013105 | Ga0157369_10285749 | Ga0157369_102857492 | 270 |
| 127 | 3300013306 | Ga0163162_10519859 | Ga0163162_105198591 | 270 |
| 128 | 3300013306 | Ga0163162_10718549 | Ga0163162_107185491 | 270 |
| 129 | 3300015262 | Ga0182007_10000379 | Ga0182007_100003797 | 270 |
| 130 | 3300017792 | Ga0163161_10018945 | Ga0163161_100189455 | 270 |
| 131 | 3300017792 | Ga0163161_10161357 | Ga0163161_101613572 | 270 |
| 132 | 3300025224 | Ga0209784_100303 | Ga0209784_10030324 | 270 |
| 133 | 3300025225 | Ga0209566_100129 | Ga0209566_10012974 | 270 |
| 134 | 3300025226 | Ga0209674_100195 | Ga0209674_10019538 | 270 |
| 135 | 3300025230 | Ga0209563_102007 | Ga0209563_1020073 | 270 |
| 136 | 3300025246 | Ga0209646_1000063 | Ga0209646_1000063101 | 270 |
| 137 | 3300025250 | Ga0209026_1003385 | Ga0209026_10033855 | 270 |
| 138 | 3300025253 | Ga0209677_104837 | Ga0209677_1048374 | 270 |
| 139 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019552 | 270 |
| 140 | 3300025256 | Ga0209759_1007655 | Ga0209759_10076553 | 270 |
| 141 | 3300025711 | Ga0207696_1000017 | Ga0207696_100001738 | 270 |
| 142 | 3300025735 | Ga0207713_1000774 | Ga0207713_100077424 | 270 |
| 143 | 3300025735 | Ga0207713_1014153 | Ga0207713_10141532 | 270 |
| 144 | 3300025923 | Ga0207681_10015979 | Ga0207681_100159792 | 270 |
| 145 | 3300025925 | Ga0207650_10001079 | Ga0207650_1000107912 | 270 |
| 146 | 3300025933 | Ga0207706_10013625 | Ga0207706_100136256 | 270 |
| 147 | 3300026041 | Ga0207639_10048044 | Ga0207639_100480443 | 270 |
| 148 | 3300031731 | Ga0307405_10000479 | Ga0307405_100004792 | 270 |
| 149 | 3300046506 | Ga0495583_0000086 | Ga0495583_0000086_43498_44475 | 270 |
| 150 | 3300046530 | Ga0495654_0000244 | Ga0495654_0000244_41323_42300 | 270 |
| 151 | 3300049569 | Ga0501032_0048223 | Ga0501032_0048223_938_1966 | 270 |
| 152 | 3300049572 | Ga0501036_0177742 | Ga0501036_0177742_492_1520 | 270 |
| 153 | 3300049580 | Ga0501046_0035863 | Ga0501046_0035863_2656_3684 | 270 |
| 154 | 3300049581 | Ga0501047_0004562 | Ga0501047_0004562_7540_8568 | 270 |
| 155 | 3300049583 | Ga0501067_0018338 | Ga0501067_0018338_1857_2885 | 270 |
| 156 | 3300049585 | Ga0501069_0036326 | Ga0501069_0036326_349_1377 | 270 |
| 157 | 3300049586 | Ga0501070_0181510 | Ga0501070_0181510_369_1397 | 270 |
| 158 | 3300049589 | Ga0501073_0007640 | Ga0501073_0007640_4359_5387 | 270 |
| 159 | 3300049592 | Ga0501076_0110343 | Ga0501076_0110343_328_1356 | 270 |
| 160 | 3300049742 | Ga0501080_0018053 | Ga0501080_0018053_2832_3860 | 270 |
| 161 | 3300049744 | Ga0501083_0104666 | Ga0501083_0104666_492_1520 | 270 |
| 162 | 3300054114 | Ga0501084_0030279 | Ga0501084_0030279_2457_3485 | 270 |
| 163 | 3300060353 | Ga0501082_0012918 | Ga0501082_0012918_2834_3862 | 270 |
| 164 | 3300048928 | Ga0496125_0003318 | Ga0496125_0003318_1006_1986 | 271 |
| 165 | 3300048929 | Ga0496126_0328336 | Ga0496126_0328336_45_1043 | 271 |
| 166 | 3300001915 | JGI24741J21665_1001854 | JGI24741J21665_10018544 | 272 |
| 167 | 3300001979 | JGI24740J21852_10001316 | JGI24740J21852_100013168 | 272 |
| 168 | 3300002705 | JGI25156J39149_1003693 | JGI25156J39149_10036933 | 272 |
| 169 | 3300003751 | Ga0055538_1000534 | Ga0055538_10005348 | 272 |
| 170 | 3300003756 | Ga0055533_1000561 | Ga0055533_10005617 | 272 |
| 171 | 3300003841 | Ga0055541_1000351 | Ga0055541_100035110 | 272 |
| 172 | 3300005344 | Ga0070661_100000141 | Ga0070661_10000014150 | 272 |
| 173 | 3300005455 | Ga0070663_100000034 | Ga0070663_10000003411 | 272 |
| 174 | 3300005548 | Ga0070665_100528649 | Ga0070665_1005286491 | 272 |
| 175 | 3300005564 | Ga0070664_100000057 | Ga0070664_10000005712 | 272 |
| 176 | 3300005614 | Ga0068856_100001920 | Ga0068856_10000192010 | 272 |
| 177 | 3300005616 | Ga0068852_100017539 | Ga0068852_1000175393 | 272 |
| 178 | 3300013100 | Ga0157373_10002881 | Ga0157373_100028813 | 272 |
| 179 | 3300013102 | Ga0157371_10000323 | Ga0157371_100003234 | 272 |
| 180 | 3300013104 | Ga0157370_10000038 | Ga0157370_100000383 | 272 |
| 181 | 3300013307 | Ga0157372_10013616 | Ga0157372_100136164 | 272 |
| 182 | 3300025224 | Ga0209784_100006 | Ga0209784_100006151 | 272 |
| 183 | 3300025225 | Ga0209566_100002 | Ga0209566_100002151 | 272 |
| 184 | 3300025226 | Ga0209674_100097 | Ga0209674_100097151 | 272 |
| 185 | 3300025230 | Ga0209563_100041 | Ga0209563_100041321 | 272 |
| 186 | 3300025253 | Ga0209677_100007 | Ga0209677_100007151 | 272 |
| 187 | 3300025256 | Ga0209759_1000819 | Ga0209759_100081922 | 272 |
| 188 | 3300025920 | Ga0207649_10000111 | Ga0207649_1000011111 | 272 |
| 189 | 3300025945 | Ga0207679_10000105 | Ga0207679_1000010555 | 272 |
| 190 | 3300026067 | Ga0207678_10000106 | Ga0207678_1000010611 | 272 |
| 191 | 3300026078 | Ga0207702_10000135 | Ga0207702_1000013533 | 272 |
| 192 | 3300037312 | Ga0395899_0115027 | Ga0395899_0115027_175_1209 | 272 |
| 193 | 3300046515 | Ga0495620_0000061 | Ga0495620_0000061_19543_20544 | 272 |
| 194 | 3300046538 | Ga0495609_0000144 | Ga0495609_0000144_66980_67981 | 272 |
| 195 | 3300048928 | Ga0496125_0003880 | Ga0496125_0003880_15129_16163 | 272 |
| 196 | 3300059643 | Ga0587072_000271 | Ga0587072_000271_2973_4007 | 272 |
| 197 | iso_pu_bacteria | 2838029111 | 2838032913 | 272 |
| 198 | iso_pu_bacteria | 2842475841 | 2842479646 | 272 |
| 199 | iso_pu_bacteria | 2842502639 | 2842506689 | 272 |
| 200 | 3300039453 | Ga0436362_0478089 | Ga0436362_0478089_72_1082 | 273 |
| 201 | 3300041407 | Ga0439447_018421 | Ga0439447_018421_817_1827 | 273 |
| 202 | iso_pu_bacteria | 2643221689 | 2644500963 | 273 |
| 203 | 3300005344 | Ga0070661_100001004 | Ga0070661_10000100417 | 274 |
| 204 | 3300005564 | Ga0070664_100001292 | Ga0070664_1000012925 | 274 |
| 205 | 3300009036 | Ga0105244_10001369 | Ga0105244_100013695 | 274 |
| 206 | 3300009176 | Ga0105242_10001326 | Ga0105242_100013264 | 274 |
| 207 | 3300009545 | Ga0105237_10000937 | Ga0105237_1000093717 | 274 |
| 208 | 3300011119 | Ga0105246_10024013 | Ga0105246_100240134 | 274 |
| 209 | 3300013100 | Ga0157373_10013153 | Ga0157373_100131532 | 274 |
| 210 | 3300013105 | Ga0157369_10003376 | Ga0157369_1000337617 | 274 |
| 211 | 3300015261 | Ga0182006_1000099 | Ga0182006_100009934 | 274 |
| 212 | 3300025728 | Ga0207655_1000070 | Ga0207655_1000070158 | 274 |
| 213 | 3300025914 | Ga0207671_10001472 | Ga0207671_100014724 | 274 |
| 214 | 3300025920 | Ga0207649_10004380 | Ga0207649_100043805 | 274 |
| 215 | 3300025934 | Ga0207686_10046851 | Ga0207686_100468512 | 274 |
| 216 | 3300025945 | Ga0207679_10000818 | Ga0207679_100008185 | 274 |
| 217 | 3300031344 | Ga0265316_10232510 | Ga0265316_102325102 | 274 |
| 218 | iso_pu_bacteria | 2945961074 | 2945963498 | 274 |
| 219 | 3300033180 | Ga0307510_10151481 | Ga0307510_101514812 | 275 |
| 220 | 3300042016 | Ga0439463_000532 | Ga0439463_000532_1836_2828 | 275 |
| 221 | 3300046458 | Ga0495591_000130 | Ga0495591_000130_42643_43635 | 275 |
| 222 | 3300046471 | Ga0495650_0000617 | Ga0495650_0000617_7826_8818 | 275 |
| 223 | 3300046474 | Ga0495605_0000066 | Ga0495605_0000066_132119_133111 | 275 |
| 224 | 3300046474 | Ga0495605_0000310 | Ga0495605_0000310_9236_10228 | 275 |
| 225 | 3300046474 | Ga0495605_0002052 | Ga0495605_0002052_9304_10296 | 275 |
| 226 | 3300046501 | Ga0495607_0000858 | Ga0495607_0000858_17220_18212 | 275 |
| 227 | 3300046501 | Ga0495607_0003325 | Ga0495607_0003325_11245_12237 | 275 |
| 228 | 3300046501 | Ga0495607_0006938 | Ga0495607_0006938_1479_2471 | 275 |
| 229 | 3300046501 | Ga0495607_0068773 | Ga0495607_0068773_554_1546 | 275 |
| 230 | 3300046506 | Ga0495583_0000312 | Ga0495583_0000312_56596_57588 | 275 |
| 231 | 3300046506 | Ga0495583_0001170 | Ga0495583_0001170_16725_17717 | 275 |
| 232 | 3300046506 | Ga0495583_0006932 | Ga0495583_0006932_117_1109 | 275 |
| 233 | 3300046507 | Ga0495606_0000274 | Ga0495606_0000274_25667_26659 | 275 |
| 234 | 3300046507 | Ga0495606_0022702 | Ga0495606_0022702_402_1394 | 275 |
| 235 | 3300046515 | Ga0495620_0000962 | Ga0495620_0000962_83_1075 | 275 |
| 236 | 3300046515 | Ga0495620_0021769 | Ga0495620_0021769_470_1462 | 275 |
| 237 | 3300046520 | Ga0495637_0000043 | Ga0495637_0000043_18174_19166 | 275 |
| 238 | 3300046522 | Ga0495643_0020381 | Ga0495643_0020381_1382_2374 | 275 |
| 239 | 3300046523 | Ga0495644_0019462 | Ga0495644_0019462_313_1305 | 275 |
| 240 | 3300046538 | Ga0495609_0000045 | Ga0495609_0000045_117115_118107 | 275 |
| 241 | 3300046538 | Ga0495609_0000125 | Ga0495609_0000125_51374_52366 | 275 |
| 242 | 3300046648 | Ga0495611_0001065 | Ga0495611_0001065_1477_2562 | 275 |
| 243 | 3300046660 | Ga0495625_0000070 | Ga0495625_0000070_99947_100939 | 275 |
| 244 | 3300046665 | Ga0495661_0000042 | Ga0495661_0000042_56984_57976 | 275 |
| 245 | 3300046694 | Ga0495649_0061928 | Ga0495649_0061928_706_1698 | 275 |
| 246 | 3300046810 | Ga0495660_0025466 | Ga0495660_0025466_1530_2522 | 275 |
| 247 | 3300047320 | Ga0495672_0090183 | Ga0495672_0090183_408_1400 | 275 |
| 248 | 3300047321 | Ga0495676_0000019 | Ga0495676_0000019_93261_94253 | 275 |
| 249 | 3300047446 | Ga0495679_001430 | Ga0495679_001430_3557_4549 | 275 |
| 250 | 3300047469 | Ga0495673_0003719 | Ga0495673_0003719_4106_5098 | 275 |
| 251 | 3300047469 | Ga0495673_0023486 | Ga0495673_0023486_1131_2123 | 275 |
| 252 | 3300047469 | Ga0495673_0095829 | Ga0495673_0095829_120_1112 | 275 |
| 253 | 3300047470 | Ga0495681_0002002 | Ga0495681_0002002_10134_11126 | 275 |
| 254 | 3300048091 | Ga0495626_0000378 | Ga0495626_0000378_4065_5057 | 275 |
| 255 | 3300048920 | Ga0496117_0073826 | Ga0496117_0073826_218_1210 | 275 |
| 256 | 3300048924 | Ga0496121_0030122 | Ga0496121_0030122_122_1114 | 275 |
| 257 | 3300048926 | Ga0496123_0148870 | Ga0496123_0148870_97_1089 | 275 |
| 258 | 3300048927 | Ga0496124_0000118 | Ga0496124_0000118_122908_123900 | 275 |
| 259 | 3300048927 | Ga0496124_0002944 | Ga0496124_0002944_3869_4861 | 275 |
| 260 | 3300048927 | Ga0496124_0124236 | Ga0496124_0124236_110_1102 | 275 |
| 261 | 3300049460 | Ga0495682_0000051 | Ga0495682_0000051_97174_98166 | 275 |
| 262 | iso_pu_bacteria | 2582581294 | 2585203268 | 275 |
| 263 | iso_pu_bacteria | 2643221634 | 2644192501 | 275 |
| 264 | iso_pu_bacteria | 2738541293 | 2738801680 | 275 |
| 265 | iso_pu_bacteria | 2891048133 | 2891048514 | 275 |
| 266 | iso_pu_bacteria | 2919100787 | 2919104817 | 275 |
| 267 | iso_pu_bacteria | 2923556063 | 2923561874 | 275 |
| 268 | iso_pu_bacteria | 2928521798 | 2928526044 | 275 |
| 269 | iso_pu_bacteria | 2954011201 | 2954011863 | 275 |
| 270 | iso_pu_bacteria | 2989771324 | 2989775554 | 275 |
| 271 | iso_pu_bacteria | 2995392953 | 2995396759 | 275 |
| 272 | iso_pu_bacteria | 3000405567 | 3000407059 | 275 |
| 273 | iso_pu_bacteria | 3003930520 | 3003935401 | 275 |
| 274 | iso_pu_bacteria | 3005409236 | 3005410051 | 275 |
| 275 | iso_pu_bacteria | 3005452660 | 3005457439 | 275 |
| 276 | 3300005339 | Ga0070660_100000087 | Ga0070660_10000008744 | 276 |
| 277 | 3300005366 | Ga0070659_100000211 | Ga0070659_10000021137 | 276 |
| 278 | 3300005455 | Ga0070663_100002551 | Ga0070663_1000025514 | 276 |
| 279 | 3300009092 | Ga0105250_10039918 | Ga0105250_100399182 | 276 |
| 280 | 3300009093 | Ga0105240_10019894 | Ga0105240_100198943 | 276 |
| 281 | 3300009551 | Ga0105238_10006248 | Ga0105238_1000624810 | 276 |
| 282 | 3300010375 | Ga0105239_10011798 | Ga0105239_100117986 | 276 |
| 283 | 3300013100 | Ga0157373_10135579 | Ga0157373_101355792 | 276 |
| 284 | 3300015265 | Ga0182005_1002583 | Ga0182005_10025834 | 276 |
| 285 | 3300025297 | Ga0209758_1000048 | Ga0209758_1000048117 | 276 |
| 286 | 3300025711 | Ga0207696_1021938 | Ga0207696_10219382 | 276 |
| 287 | 3300025904 | Ga0207647_10003229 | Ga0207647_100032298 | 276 |
| 288 | 3300025913 | Ga0207695_10239111 | Ga0207695_102391112 | 276 |
| 289 | 3300025919 | Ga0207657_10000078 | Ga0207657_100000784 | 276 |
| 290 | 3300025924 | Ga0207694_10018442 | Ga0207694_100184423 | 276 |
| 291 | 3300025932 | Ga0207690_10000026 | Ga0207690_100000268 | 276 |
| 292 | 3300026067 | Ga0207678_10006717 | Ga0207678_100067174 | 276 |
| 293 | 3300026142 | Ga0207698_10044384 | Ga0207698_100443842 | 276 |
| 294 | 3300028380 | Ga0268265_10018107 | Ga0268265_100181074 | 276 |
| 295 | 3300038705 | Ga0237819_04710 | Ga0237819_04710_413_1408 | 276 |
| 296 | 3300048920 | Ga0496117_0119710 | Ga0496117_0119710_403_1440 | 276 |
| 297 | 3300048924 | Ga0496121_0123765 | Ga0496121_0123765_587_1624 | 276 |
| 298 | 3300050493 | nmdc:mga0k408_114327_c1 | nmdc:mga0k408_114327_c1_152_1222 | 276 |
| 299 | 3300053093 | Ga0500651_0009119 | Ga0500651_0009119_3612_4640 | 276 |
| 300 | 3300053119 | Ga0500595_005009 | Ga0500595_005009_1144_2172 | 276 |
| 301 | 3300053130 | Ga0500642_0005236 | Ga0500642_0005236_1475_2503 | 276 |
| 302 | 3300053727 | Ga0500611_023523 | Ga0500611_023523_76_1104 | 276 |
| 303 | 3300003162 | Ga0006778J45830_1018533 | Ga0006778J45830_10185332 | 277 |
| 304 | 3300003574 | Ga0007410J51695_1003197 | Ga0007410J51695_10031973 | 277 |
| 305 | 3300006195 | Ga0075366_10096513 | Ga0075366_100965132 | 277 |
| 306 | 3300006353 | Ga0075370_10001724 | Ga0075370_100017242 | 277 |
| 307 | 3300025298 | Ga0209050_1005781 | Ga0209050_10057812 | 277 |
| 308 | 3300025304 | Ga0209257_1000334 | Ga0209257_100033475 | 277 |
| 309 | 3300029285 | Ga0310981_1009967 | Ga0310981_10099672 | 277 |
| 310 | 3300031456 | Ga0307513_10041773 | Ga0307513_100417732 | 277 |
| 311 | 3300041407 | Ga0439447_034028 | Ga0439447_034028_103_1152 | 277 |
| 312 | 3300050496 | nmdc:mga07m45_966_c1 | nmdc:mga07m45_966_c1_2657_3727 | 277 |
| 313 | iso_pu_bacteria | 2599185167 | 2599398301 | 277 |
| 314 | iso_pu_bacteria | 2599185179 | 2599450313 | 277 |
| 315 | iso_pu_bacteria | 2599185190 | 2599512805 | 277 |
| 316 | iso_pu_bacteria | 2599185191 | 2599521259 | 277 |
| 317 | iso_pu_bacteria | 2599185288 | 2599881384 | 277 |
| 318 | iso_pu_bacteria | 2599185290 | 2599891481 | 277 |
| 319 | iso_pu_bacteria | 2599185303 | 2599946586 | 277 |
| 320 | iso_pu_bacteria | 2675903420 | 2677896628 | 277 |
| 321 | iso_pu_bacteria | 2738541294 | 2738806900 | 277 |
| 322 | iso_pu_bacteria | 2738541309 | 2738894260 | 277 |
| 323 | iso_pu_bacteria | 2808606385 | 2808979723 | 277 |
| 324 | iso_pu_bacteria | 2808606388 | 2808995443 | 277 |
| 325 | iso_pu_bacteria | 2821443989 | 2821444556 | 277 |
| 326 | iso_pu_bacteria | 2831426010 | 2831429726 | 277 |
| 327 | iso_pu_bacteria | 2834028612 | 2834029883 | 277 |
| 328 | iso_pu_bacteria | 2848694841 | 2848697770 | 277 |
| 329 | iso_pu_bacteria | 2849660919 | 2849667308 | 277 |
| 330 | iso_pu_bacteria | 2852612431 | 2852614510 | 277 |
| 331 | iso_pu_bacteria | 2852667396 | 2852667752 | 277 |
| 332 | iso_pu_bacteria | 2886627955 | 2886632907 | 277 |
| 333 | iso_pu_bacteria | 2909042592 | 2909044838 | 277 |
| 334 | iso_pu_bacteria | 2931390751 | 2931394033 | 277 |
| 335 | iso_pu_bacteria | 2945928738 | 2945933431 | 277 |
| 336 | iso_pu_bacteria | 2946006987 | 2946009820 | 277 |
| 337 | iso_pu_bacteria | 8054002106 | 8054006643 | 277 |
| 338 | iso_pu_bacteria | 8054285046 | 8054291251 | 277 |
| 339 | iso_pu_bacteria | 8054503363 | 8054506325 | 277 |
| 340 | iso_pu_bacteria | 8055817908 | 8055821059 | 277 |
| 341 | iso_pu_bacteria | 8056161164 | 8056166041 | 277 |
| 342 | 3300001989 | JGI24739J22299_10046749 | JGI24739J22299_100467491 | 278 |
| 343 | 3300003758 | Ga0055532_1000564 | Ga0055532_10005644 | 278 |
| 344 | 3300003758 | Ga0055532_1004378 | Ga0055532_10043782 | 278 |
| 345 | 3300003758 | Ga0055532_1004404 | Ga0055532_10044042 | 278 |
| 346 | 3300003760 | Ga0055527_1000549 | Ga0055527_100054912 | 278 |
| 347 | 3300003761 | Ga0055535_1007205 | Ga0055535_10072052 | 278 |
| 348 | 3300003761 | Ga0055535_1007260 | Ga0055535_10072602 | 278 |
| 349 | 3300003762 | Ga0055542_1007757 | Ga0055542_10077572 | 278 |
| 350 | 3300003762 | Ga0055542_1007805 | Ga0055542_10078052 | 278 |
| 351 | 3300003763 | Ga0055529_1000447 | Ga0055529_100044737 | 278 |
| 352 | 3300003763 | Ga0055529_1006454 | Ga0055529_10064542 | 278 |
| 353 | 3300003790 | Ga0055528_1002503 | Ga0055528_10025037 | 278 |
| 354 | 3300006028 | Ga0070717_10403811 | Ga0070717_104038112 | 278 |
| 355 | 3300009011 | Ga0105251_10004723 | Ga0105251_100047238 | 278 |
| 356 | 3300009093 | Ga0105240_10001380 | Ga0105240_1000138034 | 278 |
| 357 | 3300025225 | Ga0209566_100665 | Ga0209566_10066511 | 278 |
| 358 | 3300025228 | Ga0209672_100037 | Ga0209672_10003784 | 278 |
| 359 | 3300025228 | Ga0209672_100102 | Ga0209672_10010264 | 278 |
| 360 | 3300025229 | Ga0209147_100049 | Ga0209147_10004969 | 278 |
| 361 | 3300025229 | Ga0209147_100071 | Ga0209147_10007137 | 278 |
| 362 | 3300025229 | Ga0209147_100284 | Ga0209147_10028434 | 278 |
| 363 | 3300025242 | Ga0209258_100066 | Ga0209258_10006684 | 278 |
| 364 | 3300025242 | Ga0209258_100082 | Ga0209258_100082171 | 278 |
| 365 | 3300025254 | Ga0209148_1000168 | Ga0209148_100016877 | 278 |
| 366 | 3300025254 | Ga0209148_1003323 | Ga0209148_10033232 | 278 |
| 367 | 3300025256 | Ga0209759_1002792 | Ga0209759_10027923 | 278 |
| 368 | 3300025272 | Ga0209455_1000141 | Ga0209455_100014177 | 278 |
| 369 | 3300025272 | Ga0209455_1001584 | Ga0209455_10015849 | 278 |
| 370 | 3300025273 | Ga0209673_1000184 | Ga0209673_100018450 | 278 |
| 371 | 3300025295 | Ga0209564_1013075 | Ga0209564_10130753 | 278 |
| 372 | 3300025913 | Ga0207695_10001136 | Ga0207695_1000113634 | 278 |
| 373 | 3300025913 | Ga0207695_10001137 | Ga0207695_1000113734 | 278 |
| 374 | 3300027312 | Ga0209371_1000488 | Ga0209371_100048849 | 278 |
| 375 | 3300030500 | Ga0268256_1003581 | Ga0268256_10035812 | 278 |
| 376 | 3300035111 | Ga0373923_0101801 | Ga0373923_0101801_30_1028 | 278 |
| 377 | 3300036401 | Ga0373937_0047181 | Ga0373937_0047181_1226_2224 | 278 |
| 378 | 3300039437 | Ga0436365_1255399 | Ga0436365_1255399_1074_2111 | 278 |
| 379 | 3300042007 | Ga0439449_0001069 | Ga0439449_0001069_7125_8132 | 278 |
| 380 | 3300044683 | Ga0466965_0078061 | Ga0466965_0078061_295_1332 | 278 |
| 381 | 3300044842 | Ga0466957_0140688 | Ga0466957_0140688_330_1367 | 278 |
| 382 | 3300046453 | Ga0495627_020422 | Ga0495627_020422_39_1058 | 278 |
| 383 | 3300046458 | Ga0495591_018643 | Ga0495591_018643_233_1252 | 278 |
| 384 | 3300046474 | Ga0495605_0000060 | Ga0495605_0000060_14010_15029 | 278 |
| 385 | 3300046506 | Ga0495583_0000282 | Ga0495583_0000282_67030_68049 | 278 |
| 386 | 3300046512 | Ga0495610_0052406 | Ga0495610_0052406_117_1136 | 278 |
| 387 | 3300046524 | Ga0495648_0005363 | Ga0495648_0005363_4245_5264 | 278 |
| 388 | 3300046530 | Ga0495654_0008768 | Ga0495654_0008768_616_1635 | 278 |
| 389 | 3300046558 | Ga0495633_0000139 | Ga0495633_0000139_21874_22893 | 278 |
| 390 | 3300046810 | Ga0495660_0034832 | Ga0495660_0034832_84_1103 | 278 |
| 391 | 3300047323 | Ga0495683_0000020 | Ga0495683_0000020_130776_131795 | 278 |
| 392 | 3300047446 | Ga0495679_000800 | Ga0495679_000800_14015_15034 | 278 |
| 393 | 3300048926 | Ga0496123_0036720 | Ga0496123_0036720_1630_2628 | 278 |
| 394 | 3300049459 | Ga0495678_000077 | Ga0495678_000077_104504_105523 | 278 |
| 395 | iso_pu_bacteria | 2512875016 | 2512933056 | 278 |
| 396 | iso_pu_bacteria | 2588253730 | 2588519103 | 278 |
| 397 | iso_pu_bacteria | 2617270889 | 2617916026 | 278 |
| 398 | iso_pu_bacteria | 2818991436 | 2819542614 | 278 |
| 399 | iso_pu_bacteria | 2876363079 | 2876364696 | 278 |
| 400 | iso_pu_bacteria | 2885312484 | 2885313144 | 278 |
| 401 | iso_pu_bacteria | 2903448605 | 2903449315 | 278 |
| 402 | iso_pu_bacteria | 2903521522 | 2903522568 | 278 |
| 403 | iso_pu_bacteria | 2903528002 | 2903528947 | 278 |
| 404 | iso_pu_bacteria | 2913844669 | 2913850212 | 278 |
| 405 | iso_pu_bacteria | 2913912277 | 2913914680 | 278 |
| 406 | iso_pu_bacteria | 2913939268 | 2913944116 | 278 |
| 407 | iso_pu_bacteria | 2937848649 | 2937855489 | 278 |
| 408 | iso_pu_bacteria | 2963644680 | 2963646152 | 278 |
| 409 | iso_pu_bacteria | 2968083720 | 2968085378 | 278 |
| 410 | iso_pu_bacteria | 2977922695 | 2977928804 | 278 |
| 411 | iso_pu_bacteria | 2977986579 | 2977987639 | 278 |
| 412 | iso_pu_bacteria | 3004211236 | 3004211448 | 278 |
| 413 | iso_pu_bacteria | 3004218560 | 3004225003 | 278 |
| 414 | iso_pu_bacteria | 3004334049 | 3004336260 | 278 |
| 415 | iso_pu_bacteria | 637000159 | 637076135 | 278 |
| 416 | iso_pu_bacteria | 641228493 | 641336578 | 278 |
| 417 | iso_pu_bacteria | 642555144 | 642604259 | 278 |
| 418 | iso_pu_bacteria | 643348555 | 643390371 | 278 |
| 419 | 3300005347 | Ga0070668_100099598 | Ga0070668_1000995982 | 279 |
| 420 | 3300005467 | Ga0070706_100093931 | Ga0070706_1000939312 | 279 |
| 421 | 3300005471 | Ga0070698_100064473 | Ga0070698_1000644732 | 279 |
| 422 | 3300025910 | Ga0207684_10005922 | Ga0207684_100059228 | 279 |
| 423 | iso_pu_bacteria | 2508501128 | 2509151679 | 279 |
| 424 | iso_pu_bacteria | 2643221637 | 2644210769 | 279 |
| 425 | iso_pu_bacteria | 2643221718 | 2644654303 | 279 |
| 426 | iso_pu_bacteria | 2860867994 | 2860870559 | 279 |
| 427 | iso_pu_bacteria | 2885192300 | 2885196253 | 279 |
| 428 | iso_pu_bacteria | 2932401849 | 2932405632 | 279 |
| 429 | iso_pu_bacteria | 2946027586 | 2946030982 | 279 |
| 430 | 3300003187 | JGI25151J46595_10001875 | JGI25151J46595_1000187511 | 280 |
| 431 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016150 | 280 |
| 432 | 3300025294 | Ga0209025_1000338 | Ga0209025_100033837 | 280 |
| 433 | 3300032005 | Ga0307411_10065341 | Ga0307411_100653412 | 280 |
| 434 | 3300041405 | Ga0439438_010381 | Ga0439438_010381_455_1465 | 280 |
| 435 | 3300041406 | Ga0439439_0001544 | Ga0439439_0001544_1128_2138 | 280 |
| 436 | 3300042006 | Ga0439432_019836 | Ga0439432_019836_828_1838 | 280 |
| 437 | 3300042145 | Ga0450906_004068 | Ga0450906_004068_1647_2657 | 280 |
| 438 | 3300042184 | Ga0450908_004697 | Ga0450908_004697_63_1073 | 280 |
| 439 | 3300042435 | Ga0439434_0005521 | Ga0439434_0005521_707_1717 | 280 |
| 440 | 3300049686 | Ga0501257_009654 | Ga0501257_009654_857_1861 | 280 |
| 441 | iso_pu_bacteria | 2508501123 | 2509115263 | 280 |
| 442 | iso_pu_bacteria | 2508501127 | 2509142482 | 280 |
| 443 | iso_pu_bacteria | 2509276018 | 2509370995 | 280 |
| 444 | iso_pu_bacteria | 2512875024 | 2512961101 | 280 |
| 445 | iso_pu_bacteria | 2597489875 | 2597811098 | 280 |
| 446 | iso_pu_bacteria | 2643221595 | 2643988153 | 280 |
| 447 | iso_pu_bacteria | 2643221627 | 2644155111 | 280 |
| 448 | iso_pu_bacteria | 2687453392 | 2688596803 | 280 |
| 449 | iso_pu_bacteria | 2756170246 | 2756677334 | 280 |
| 450 | iso_pu_bacteria | 2791355197 | 2793072869 | 280 |
| 451 | iso_pu_bacteria | 2841734538 | 2841737450 | 280 |
| 452 | iso_pu_bacteria | 2844002411 | 2844009242 | 280 |
| 453 | iso_pu_bacteria | 2844009547 | 2844012062 | 280 |
| 454 | iso_pu_bacteria | 2847670302 | 2847673122 | 280 |
| 455 | iso_pu_bacteria | 2856314179 | 2856319845 | 280 |
| 456 | iso_pu_bacteria | 2856320880 | 2856322632 | 280 |
| 457 | iso_pu_bacteria | 2856328259 | 2856328897 | 280 |
| 458 | iso_pu_bacteria | 2856334872 | 2856340449 | 280 |
| 459 | iso_pu_bacteria | 2856342000 | 2856342347 | 280 |
| 460 | iso_pu_bacteria | 2857367948 | 2857370511 | 280 |
| 461 | iso_pu_bacteria | 2869169390 | 2869171635 | 280 |
| 462 | iso_pu_bacteria | 2869234852 | 2869239540 | 280 |
| 463 | iso_pu_bacteria | 2869242130 | 2869244710 | 280 |
| 464 | iso_pu_bacteria | 2869249662 | 2869252308 | 280 |
| 465 | iso_pu_bacteria | 2869256925 | 2869258988 | 280 |
| 466 | iso_pu_bacteria | 2869264136 | 2869268618 | 280 |
| 467 | iso_pu_bacteria | 2869271264 | 2869275555 | 280 |
| 468 | iso_pu_bacteria | 2869278585 | 2869285851 | 280 |
| 469 | iso_pu_bacteria | 2871435913 | 2871441810 | 280 |
| 470 | iso_pu_bacteria | 2871451962 | 2871452647 | 280 |
| 471 | iso_pu_bacteria | 2871459585 | 2871465807 | 280 |
| 472 | iso_pu_bacteria | 2871466892 | 2871473945 | 280 |
| 473 | iso_pu_bacteria | 2871474448 | 2871474453 | 280 |
| 474 | iso_pu_bacteria | 2874109183 | 2874110684 | 280 |
| 475 | iso_pu_bacteria | 2874116593 | 2874118048 | 280 |
| 476 | iso_pu_bacteria | 2874131515 | 2874134504 | 280 |
| 477 | iso_pu_bacteria | 2874139085 | 2874141837 | 280 |
| 478 | iso_pu_bacteria | 2874162495 | 2874167557 | 280 |
| 479 | iso_pu_bacteria | 2876386047 | 2876389678 | 280 |
| 480 | iso_pu_bacteria | 2876399893 | 2876401317 | 280 |
| 481 | iso_pu_bacteria | 2876406927 | 2876407712 | 280 |
| 482 | iso_pu_bacteria | 2878035449 | 2878035726 | 280 |
| 483 | iso_pu_bacteria | 2878730984 | 2878732273 | 280 |
| 484 | iso_pu_bacteria | 2878738818 | 2878739425 | 280 |
| 485 | iso_pu_bacteria | 2878774303 | 2878775949 | 280 |
| 486 | iso_pu_bacteria | 2878781027 | 2878788715 | 280 |
| 487 | iso_pu_bacteria | 2881147464 | 2881147847 | 280 |
| 488 | iso_pu_bacteria | 2885374607 | 2885382887 | 280 |
| 489 | iso_pu_bacteria | 2888337043 | 2888337916 | 280 |
| 490 | iso_pu_bacteria | 2888343758 | 2888345364 | 280 |
| 491 | iso_pu_bacteria | 2888350351 | 2888352729 | 280 |
| 492 | iso_pu_bacteria | 2889010040 | 2889014500 | 280 |
| 493 | iso_pu_bacteria | 2889016732 | 2889020514 | 280 |
| 494 | iso_pu_bacteria | 2903513507 | 2903519178 | 280 |
| 495 | iso_pu_bacteria | 2906354277 | 2906359637 | 280 |
| 496 | iso_pu_bacteria | 2906363423 | 2906364976 | 280 |
| 497 | iso_pu_bacteria | 2906370794 | 2906372959 | 280 |
| 498 | iso_pu_bacteria | 2906378014 | 2906383254 | 280 |
| 499 | iso_pu_bacteria | 2906386501 | 2906393476 | 280 |
| 500 | iso_pu_bacteria | 2906393657 | 2906394656 | 280 |
| 501 | iso_pu_bacteria | 2906401398 | 2906405609 | 280 |
| 502 | iso_pu_bacteria | 2906408224 | 2906413509 | 280 |
| 503 | iso_pu_bacteria | 2906414383 | 2906420621 | 280 |
| 504 | iso_pu_bacteria | 2906427513 | 2906433338 | 280 |
| 505 | iso_pu_bacteria | 2908739725 | 2908745883 | 280 |
| 506 | iso_pu_bacteria | 2922130491 | 2922137542 | 280 |
| 507 | iso_pu_bacteria | 2922151315 | 2922157552 | 280 |
| 508 | iso_pu_bacteria | 2922172374 | 2922177661 | 280 |
| 509 | iso_pu_bacteria | 2922185730 | 2922186457 | 280 |
| 510 | iso_pu_bacteria | 2924718760 | 2924722030 | 280 |
| 511 | iso_pu_bacteria | 2924733363 | 2924736309 | 280 |
| 512 | iso_pu_bacteria | 2924741084 | 2924744495 | 280 |
| 513 | iso_pu_bacteria | 2924748358 | 2924750326 | 280 |
| 514 | iso_pu_bacteria | 2924776078 | 2924776946 | 280 |
| 515 | iso_pu_bacteria | 2935630451 | 2935630624 | 280 |
| 516 | iso_pu_bacteria | 2937836603 | 2937840320 | 280 |
| 517 | iso_pu_bacteria | 2937861824 | 2937868670 | 280 |
| 518 | iso_pu_bacteria | 2937868953 | 2937873351 | 280 |
| 519 | iso_pu_bacteria | 2937877337 | 2937883454 | 280 |
| 520 | iso_pu_bacteria | 2937972304 | 2937973566 | 280 |
| 521 | iso_pu_bacteria | 2937980651 | 2937986759 | 280 |
| 522 | iso_pu_bacteria | 2941507105 | 2941507276 | 280 |
| 523 | iso_pu_bacteria | 2941515067 | 2941515703 | 280 |
| 524 | iso_pu_bacteria | 2941523033 | 2941523589 | 280 |
| 525 | iso_pu_bacteria | 2958034702 | 2958041867 | 280 |
| 526 | iso_pu_bacteria | 2958041894 | 2958050398 | 280 |
| 527 | iso_pu_bacteria | 2958071322 | 2958071529 | 280 |
| 528 | iso_pu_bacteria | 2958084443 | 2958090621 | 280 |
| 529 | iso_pu_bacteria | 2958122699 | 2958128200 | 280 |
| 530 | iso_pu_bacteria | 2958137437 | 2958141130 | 280 |
| 531 | iso_pu_bacteria | 2958144490 | 2958147081 | 280 |
| 532 | iso_pu_bacteria | 2958158011 | 2958159457 | 280 |
| 533 | iso_pu_bacteria | 2958172287 | 2958177423 | 280 |
| 534 | iso_pu_bacteria | 2961136820 | 2961140208 | 280 |
| 535 | iso_pu_bacteria | 2965025482 | 2965025629 | 280 |
| 536 | iso_pu_bacteria | 2965032056 | 2965032502 | 280 |
| 537 | iso_pu_bacteria | 2965040258 | 2965044021 | 280 |
| 538 | iso_pu_bacteria | 2965047637 | 2965055215 | 280 |
| 539 | iso_pu_bacteria | 2965089291 | 2965092043 | 280 |
| 540 | iso_pu_bacteria | 2965102966 | 2965104727 | 280 |
| 541 | iso_pu_bacteria | 2965119406 | 2965121593 | 280 |
| 542 | iso_pu_bacteria | 2968016561 | 2968016635 | 280 |
| 543 | iso_pu_bacteria | 2970469710 | 2970469977 | 280 |
| 544 | iso_pu_bacteria | 2970489779 | 2970492658 | 280 |
| 545 | iso_pu_bacteria | 2970510686 | 2970517346 | 280 |
| 546 | iso_pu_bacteria | 2970524798 | 2970527079 | 280 |
| 547 | iso_pu_bacteria | 2970532167 | 2970532937 | 280 |
| 548 | iso_pu_bacteria | 2970540015 | 2970546535 | 280 |
| 549 | iso_pu_bacteria | 2970547951 | 2970552964 | 280 |
| 550 | iso_pu_bacteria | 2970593180 | 2970600468 | 280 |
| 551 | iso_pu_bacteria | 2970619444 | 2970622851 | 280 |
| 552 | iso_pu_bacteria | 2970627176 | 2970633379 | 280 |
| 553 | iso_pu_bacteria | 2977851361 | 2977854080 | 280 |
| 554 | iso_pu_bacteria | 2977872689 | 2977873335 | 280 |
| 555 | iso_pu_bacteria | 2977898635 | 2977903090 | 280 |
| 556 | iso_pu_bacteria | 2977907340 | 2977909373 | 280 |
| 557 | iso_pu_bacteria | 2977915119 | 2977921330 | 280 |
| 558 | iso_pu_bacteria | 2977935797 | 2977935969 | 280 |
| 559 | iso_pu_bacteria | 2977950692 | 2977952193 | 280 |
| 560 | iso_pu_bacteria | 2977971508 | 2977976966 | 280 |
| 561 | iso_pu_bacteria | 2979710463 | 2979717203 | 280 |
| 562 | iso_pu_bacteria | 2979764755 | 2979771026 | 280 |
| 563 | iso_pu_bacteria | 2979772303 | 2979777071 | 280 |
| 564 | iso_pu_bacteria | 2979793036 | 2979796062 | 280 |
| 565 | iso_pu_bacteria | 2987645492 | 2987650049 | 280 |
| 566 | iso_pu_bacteria | 2987652177 | 2987659195 | 280 |
| 567 | iso_pu_bacteria | 2987673487 | 2987675599 | 280 |
| 568 | iso_pu_bacteria | 2996348954 | 2996353092 | 280 |
| 569 | iso_pu_bacteria | 2996386984 | 2996389711 | 280 |
| 570 | iso_pu_bacteria | 3004167301 | 3004174191 | 280 |
| 571 | iso_pu_bacteria | 3004195979 | 3004202087 | 280 |
| 572 | iso_pu_bacteria | 3004239961 | 3004240491 | 280 |
| 573 | iso_pu_bacteria | 3004268573 | 3004270627 | 280 |
| 574 | iso_pu_bacteria | 3004275668 | 3004279774 | 280 |
| 575 | iso_pu_bacteria | 3004289098 | 3004293475 | 280 |
| 576 | iso_pu_bacteria | 649633066 | 649871357 | 280 |
| 577 | iso_pu_bacteria | 8004300914 | 8004302084 | 280 |
| 578 | iso_pu_bacteria | 8004312739 | 8004316346 | 280 |
| 579 | iso_pu_bacteria | 8004361976 | 8004363734 | 280 |
| 580 | iso_pu_bacteria | 8004395343 | 8004403501 | 280 |
| 581 | iso_pu_bacteria | 8004633249 | 8004639471 | 280 |
| 582 | iso_pu_bacteria | 8004640170 | 8004644328 | 280 |
| 583 | iso_pu_bacteria | 8004695233 | 8004701784 | 280 |
| 584 | iso_pu_bacteria | 8055617313 | 8055619168 | 280 |
| 585 | iso_pu_bacteria | 8056131705 | 8056134765 | 280 |
| 586 | 3300006353 | Ga0075370_10144737 | Ga0075370_101447371 | 281 |
| 587 | 3300009036 | Ga0105244_10001610 | Ga0105244_100016107 | 281 |
| 588 | 3300013308 | Ga0157375_10000100 | Ga0157375_1000010013 | 281 |
| 589 | 3300025940 | Ga0207691_10069105 | Ga0207691_100691052 | 281 |
| 590 | 3300041997 | Ga0439431_0021573 | Ga0439431_0021573_420_1433 | 281 |
| 591 | 3300042004 | Ga0439445_0007986 | Ga0439445_0007986_391_1404 | 281 |
| 592 | 3300042006 | Ga0439432_005525 | Ga0439432_005525_369_1382 | 281 |
| 593 | 3300042007 | Ga0439449_0029879 | Ga0439449_0029879_932_1945 | 281 |
| 594 | 3300042010 | Ga0439452_002617 | Ga0439452_002617_1006_2019 | 281 |
| 595 | 3300046539 | Ga0495621_0031343 | Ga0495621_0031343_758_1771 | 281 |
| 596 | 3300046615 | Ga0495656_0000060 | Ga0495656_0000060_34706_35719 | 281 |
| 597 | 3300046691 | Ga0495670_0036289 | Ga0495670_0036289_579_1592 | 281 |
| 598 | 3300048090 | Ga0495615_0020377 | Ga0495615_0020377_330_1343 | 281 |
| 599 | 3300048907 | Ga0496104_0054958 | Ga0496104_0054958_1161_2141 | 281 |
| 600 | 3300048915 | Ga0496112_0022401 | Ga0496112_0022401_3734_4771 | 281 |
| 601 | 3300048916 | Ga0496113_0027996 | Ga0496113_0027996_2277_3314 | 281 |
| 602 | 3300048922 | Ga0496119_0000198 | Ga0496119_0000198_55811_56848 | 281 |
| 603 | 3300050496 | nmdc:mga07m45_89663_c1 | nmdc:mga07m45_89663_c1_245_1288 | 281 |
| 604 | iso_pu_bacteria | 2508501125 | 2509128588 | 281 |
| 605 | iso_pu_bacteria | 2619619299 | 2621299653 | 281 |
| 606 | iso_pu_bacteria | 2738541265 | 2738669653 | 281 |
| 607 | iso_pu_bacteria | 2738541282 | 2738748046 | 281 |
| 608 | iso_pu_bacteria | 2738541303 | 2738857088 | 281 |
| 609 | iso_pu_bacteria | 2808606384 | 2808968009 | 281 |
| 610 | iso_pu_bacteria | 2808606390 | 2809002840 | 281 |
| 611 | iso_pu_bacteria | 2808606391 | 2809010118 | 281 |
| 612 | iso_pu_bacteria | 2816332298 | 2817491005 | 281 |
| 613 | iso_pu_bacteria | 2842333319 | 2842337354 | 281 |
| 614 | iso_pu_bacteria | 2869162929 | 2869168209 | 281 |
| 615 | iso_pu_bacteria | 2874123672 | 2874127115 | 281 |
| 616 | iso_pu_bacteria | 2876369609 | 2876374700 | 281 |
| 617 | 3300002737 | JGI25162J39368_1000036 | JGI25162J39368_100003628 | 282 |
| 618 | 3300002771 | JGI25163J39215_1001653 | JGI25163J39215_10016532 | 282 |
| 619 | 3300003214 | JGI25165J46597_1000022 | JGI25165J46597_1000022330 | 282 |
| 620 | 3300003751 | Ga0055538_1000011 | Ga0055538_100001127 | 282 |
| 621 | 3300003752 | Ga0055539_1000016 | Ga0055539_1000016330 | 282 |
| 622 | 3300003756 | Ga0055533_1000019 | Ga0055533_1000019330 | 282 |
| 623 | 3300003759 | Ga0055525_1000042 | Ga0055525_100004228 | 282 |
| 624 | 3300003841 | Ga0055541_1000017 | Ga0055541_1000017265 | 282 |
| 625 | 3300015265 | Ga0182005_1001696 | Ga0182005_10016964 | 282 |
| 626 | 3300015683 | Ga0183362_10001 | Ga0183362_100011974 | 282 |
| 627 | 3300025207 | Ga0209760_100730 | Ga0209760_1007303 | 282 |
| 628 | 3300025224 | Ga0209784_100019 | Ga0209784_100019407 | 282 |
| 629 | 3300025225 | Ga0209566_100017 | Ga0209566_100017407 | 282 |
| 630 | 3300025226 | Ga0209674_100031 | Ga0209674_100031407 | 282 |
| 631 | 3300025230 | Ga0209563_100035 | Ga0209563_100035407 | 282 |
| 632 | 3300025231 | Ga0207427_100206 | Ga0207427_10020638 | 282 |
| 633 | 3300025233 | Ga0209437_100038 | Ga0209437_100038407 | 282 |
| 634 | 3300025253 | Ga0209677_100020 | Ga0209677_100020407 | 282 |
| 635 | 3300025261 | Ga0209233_1000049 | Ga0209233_1000049407 | 282 |
| 636 | 3300046454 | Ga0495592_0034404 | Ga0495592_0034404_1633_2649 | 282 |
| 637 | 3300046463 | Ga0495653_0038718 | Ga0495653_0038718_1016_2032 | 282 |
| 638 | 3300046463 | Ga0495653_0184809 | Ga0495653_0184809_244_1260 | 282 |
| 639 | 3300046511 | Ga0495608_0004835 | Ga0495608_0004835_621_1637 | 282 |
| 640 | 3300046514 | Ga0495618_0037393 | Ga0495618_0037393_1285_2271 | 282 |
| 641 | 3300046516 | Ga0495628_0001650 | Ga0495628_0001650_4673_5689 | 282 |
| 642 | 3300046516 | Ga0495628_0007899 | Ga0495628_0007899_7345_8361 | 282 |
| 643 | 3300046529 | Ga0495652_0003089 | Ga0495652_0003089_2134_3150 | 282 |
| 644 | 3300046559 | Ga0495667_0088426 | Ga0495667_0088426_551_1573 | 282 |
| 645 | 3300046663 | Ga0495635_0068701 | Ga0495635_0068701_585_1601 | 282 |
| 646 | 3300046663 | Ga0495635_0123188 | Ga0495635_0123188_554_1576 | 282 |
| 647 | 3300046679 | Ga0495623_0001311 | Ga0495623_0001311_2298_3314 | 282 |
| 648 | 3300046680 | Ga0495646_0006353 | Ga0495646_0006353_714_1730 | 282 |
| 649 | 3300046690 | Ga0495624_0068383 | Ga0495624_0068383_631_1647 | 282 |
| 650 | 3300046809 | Ga0495600_0005356 | Ga0495600_0005356_5749_6765 | 282 |
| 651 | 3300047317 | Ga0495604_0020189 | Ga0495604_0020189_1828_2844 | 282 |
| 652 | 3300047319 | Ga0495674_0145902 | Ga0495674_0145902_579_1601 | 282 |
| 653 | 3300047471 | Ga0495684_0073107 | Ga0495684_0073107_128_1150 | 282 |
| 654 | 3300048088 | Ga0495602_0012534 | Ga0495602_0012534_1063_2079 | 282 |
| 655 | 3300048088 | Ga0495602_0087373 | Ga0495602_0087373_54_1076 | 282 |
| 656 | 3300053077 | Ga0495601_0006243 | Ga0495601_0006243_591_1607 | 282 |
| 657 | iso_pu_bacteria | 2599185307 | 2599971255 | 282 |
| 658 | iso_pu_bacteria | 2600255283 | 2601624826 | 282 |
| 659 | iso_pu_bacteria | 2738541271 | 2738691170 | 282 |
| 660 | iso_pu_bacteria | 2738543016 | 2739266944 | 282 |
| 661 | iso_pu_bacteria | 2738543031 | 2739351981 | 282 |
| 662 | iso_pu_bacteria | 2908446538 | 2908449670 | 282 |
| 663 | 3300046512 | Ga0495610_0080705 | Ga0495610_0080705_238_1233 | 283 |
| 664 | iso_pu_bacteria | 2738543031 | 2739349961 | 283 |
| 665 | 3300025923 | Ga0207681_10192931 | Ga0207681_101929312 | 284 |
| 666 | 3300028800 | Ga0265338_10000037 | Ga0265338_1000003781 | 284 |
| 667 | 3300031247 | Ga0265340_10014726 | Ga0265340_100147262 | 284 |
| 668 | 3300046462 | Ga0495651_0096623 | Ga0495651_0096623_196_1233 | 284 |
| 669 | 3300046679 | Ga0495623_0000473 | Ga0495623_0000473_9498_10535 | 284 |
| 670 | 3300047317 | Ga0495604_0000557 | Ga0495604_0000557_10414_11451 | 284 |
| 671 | 3300047322 | Ga0495680_0007331 | Ga0495680_0007331_6810_7847 | 284 |
| 672 | 3300047444 | Ga0495675_0005135 | Ga0495675_0005135_3575_4612 | 284 |
| 673 | 3300048088 | Ga0495602_0018465 | Ga0495602_0018465_1930_2967 | 284 |
| 674 | 3300049571 | Ga0501034_0001273 | Ga0501034_0001273_18128_19159 | 284 |
| 675 | iso_pu_bacteria | 2501025502 | 2501079719 | 284 |
| 676 | iso_pu_bacteria | 2510917013 | 2511094059 | 284 |
| 677 | iso_pu_bacteria | 2513237082 | 2513555432 | 284 |
| 678 | iso_pu_bacteria | 2513237083 | 2513562707 | 284 |
| 679 | iso_pu_bacteria | 2671180139 | 2671692637 | 284 |
| 680 | iso_pu_bacteria | 2917554339 | 2917557335 | 284 |
| 681 | iso_pu_bacteria | 2935769743 | 2935771289 | 284 |
| 682 | iso_pu_bacteria | 8003955200 | 8003959894 | 284 |
| 683 | 3300046680 | Ga0495646_0001063 | Ga0495646_0001063_3634_4632 | 285 |
| 684 | 3300046690 | Ga0495624_0040213 | Ga0495624_0040213_824_1822 | 285 |
| 685 | 3300047443 | Ga0495687_076483 | Ga0495687_076483_198_1235 | 285 |
| 686 | iso_pu_bacteria | 2773857925 | 2774872969 | 285 |
| 687 | iso_pu_bacteria | 2775506901 | 2776260054 | 285 |
| 688 | iso_pu_bacteria | 2835312727 | 2835319240 | 285 |
| 689 | iso_pu_bacteria | 2882456835 | 2882460780 | 285 |
| 690 | iso_pu_bacteria | 2894232714 | 2894234075 | 285 |
| 691 | 3300009011 | Ga0105251_10000357 | Ga0105251_1000035716 | 286 |
| 692 | 3300025735 | Ga0207713_1000058 | Ga0207713_1000058174 | 286 |
| 693 | 3300037853 | Ga0436364_0738766 | Ga0436364_0738766_2428_3462 | 286 |
| 694 | 3300046458 | Ga0495591_001119 | Ga0495591_001119_9154_10146 | 286 |
| 695 | 3300048924 | Ga0496121_0003265 | Ga0496121_0003265_22198_23190 | 286 |
| 696 | 3300048925 | Ga0496122_0000156 | Ga0496122_0000156_25634_26626 | 286 |
| 697 | 3300048926 | Ga0496123_0000087 | Ga0496123_0000087_156167_157159 | 286 |
| 698 | 3300046462 | Ga0495651_0137227 | Ga0495651_0137227_395_1417 | 287 |
| 699 | 3300046476 | Ga0495662_0111691 | Ga0495662_0111691_288_1310 | 287 |
| 700 | 3300046680 | Ga0495646_0102622 | Ga0495646_0102622_188_1210 | 287 |
| 701 | 3300047323 | Ga0495683_0064584 | Ga0495683_0064584_536_1570 | 287 |
| 702 | iso_pu_bacteria | 2510917013 | 2511092217 | 287 |
| 703 | iso_pu_bacteria | 2856287931 | 2856291497 | 287 |
| 704 | iso_pu_bacteria | 2857357740 | 2857363893 | 287 |
| 705 | 3300005335 | Ga0070666_10013971 | Ga0070666_100139712 | 288 |
| 706 | 3300005367 | Ga0070667_100049430 | Ga0070667_1000494302 | 288 |
| 707 | 3300013308 | Ga0157375_10038747 | Ga0157375_100387473 | 288 |
| 708 | 3300025903 | Ga0207680_10084344 | Ga0207680_100843442 | 288 |
| 709 | 3300025941 | Ga0207711_10085423 | Ga0207711_100854233 | 288 |
| 710 | 3300025986 | Ga0207658_10036205 | Ga0207658_100362052 | 288 |
| 711 | 3300026121 | Ga0207683_10121325 | Ga0207683_101213252 | 288 |
| 712 | 3300046460 | Ga0495638_0002449 | Ga0495638_0002449_6922_7956 | 288 |
| 713 | 3300046471 | Ga0495650_0061071 | Ga0495650_0061071_356_1390 | 288 |
| 714 | 3300046474 | Ga0495605_0001183 | Ga0495605_0001183_1425_2459 | 288 |
| 715 | 3300046492 | Ga0495585_0047975 | Ga0495585_0047975_1010_2044 | 288 |
| 716 | 3300046501 | Ga0495607_0048743 | Ga0495607_0048743_296_1330 | 288 |
| 717 | 3300046506 | Ga0495583_0082906 | Ga0495583_0082906_138_1172 | 288 |
| 718 | 3300046523 | Ga0495644_0036401 | Ga0495644_0036401_288_1322 | 288 |
| 719 | 3300046542 | Ga0495597_0038052 | Ga0495597_0038052_308_1342 | 288 |
| 720 | 3300046616 | Ga0495668_0090047 | Ga0495668_0090047_364_1398 | 288 |
| 721 | 3300046648 | Ga0495611_0014154 | Ga0495611_0014154_2178_3176 | 288 |
| 722 | 3300046648 | Ga0495611_0093651 | Ga0495611_0093651_131_1165 | 288 |
| 723 | 3300046660 | Ga0495625_0183694 | Ga0495625_0183694_309_1343 | 288 |
| 724 | 3300046684 | Ga0495669_0044164 | Ga0495669_0044164_248_1282 | 288 |
| 725 | 3300046794 | Ga0495589_0015683 | Ga0495589_0015683_1055_2089 | 288 |
| 726 | 3300047443 | Ga0495687_000020 | Ga0495687_000020_331314_332336 | 288 |
| 727 | 3300048091 | Ga0495626_0050015 | Ga0495626_0050015_499_1533 | 288 |
| 728 | 3300048903 | Ga0496100_0165232 | Ga0496100_0165232_429_1463 | 288 |
| 729 | 3300048905 | Ga0496102_0010607 | Ga0496102_0010607_5250_6284 | 288 |
| 730 | 3300048907 | Ga0496104_0135025 | Ga0496104_0135025_615_1649 | 288 |
| 731 | 3300048908 | Ga0496105_0189862 | Ga0496105_0189862_330_1364 | 288 |
| 732 | 3300048909 | Ga0496106_0027797 | Ga0496106_0027797_2809_3843 | 288 |
| 733 | 3300048918 | Ga0496115_0150435 | Ga0496115_0150435_653_1687 | 288 |
| 734 | iso_pu_bacteria | 2513237165 | 2514041978 | 288 |
| 735 | iso_pu_bacteria | 2904434214 | 2904435666 | 288 |
| 736 | 3300037312 | Ga0395899_0029919 | Ga0395899_0029919_882_1946 | 289 |
| 737 | 3300037418 | Ga0395900_0083216 | Ga0395900_0083216_182_1246 | 289 |
| 738 | 3300042137 | Ga0450902_001559 | Ga0450902_001559_1558_2580 | 289 |
| 739 | 3300046459 | Ga0495629_0252329 | Ga0495629_0252329_139_1128 | 289 |
| 740 | iso_pu_bacteria | 2512047030 | 2512351828 | 289 |
| 741 | iso_pu_bacteria | 2515154123 | 2515689981 | 289 |
| 742 | iso_pu_bacteria | 2519103095 | 2519458635 | 289 |
| 743 | iso_pu_bacteria | 2582581311 | 2585294973 | 289 |
| 744 | iso_pu_bacteria | 2599185239 | 2599737314 | 289 |
| 745 | iso_pu_bacteria | 2599185240 | 2599746955 | 289 |
| 746 | iso_pu_bacteria | 2599185355 | 2600208890 | 289 |
| 747 | iso_pu_bacteria | 2675903129 | 2676744518 | 289 |
| 748 | iso_pu_bacteria | 2744054900 | 2746091193 | 289 |
| 749 | iso_pu_bacteria | 2744054901 | 2746097626 | 289 |
| 750 | iso_pu_bacteria | 2816332253 | 2817260856 | 289 |
| 751 | iso_pu_bacteria | 2816332256 | 2817278490 | 289 |
| 752 | iso_pu_bacteria | 2816332286 | 2817454959 | 289 |
| 753 | iso_pu_bacteria | 2818991452 | 2819634974 | 289 |
| 754 | iso_pu_bacteria | 2863421361 | 2863424460 | 289 |
| 755 | iso_pu_bacteria | 2870068957 | 2870071619 | 289 |
| 756 | iso_pu_bacteria | 2904564687 | 2904568763 | 289 |
| 757 | iso_pu_bacteria | 2904571731 | 2904575805 | 289 |
| 758 | iso_pu_bacteria | 2928157003 | 2928160552 | 289 |
| 759 | iso_pu_bacteria | 2928163908 | 2928164908 | 289 |
| 760 | iso_pu_bacteria | 2928170801 | 2928172849 | 289 |
| 761 | iso_pu_bacteria | 2928536128 | 2928540822 | 289 |
| 762 | iso_pu_bacteria | 2981990288 | 2981996477 | 289 |
| 763 | iso_pu_bacteria | 641736154 | 642415734 | 289 |
| 764 | iso_pu_bacteria | 8018845410 | 8018853231 | 289 |
| 765 | iso_pu_bacteria | 8020807995 | 8020813128 | 289 |
| 766 | iso_pu_bacteria | 8020938398 | 8020944238 | 289 |
| 767 | iso_pu_bacteria | 8020945358 | 8020949406 | 289 |
| 768 | iso_pu_bacteria | 8020953355 | 8020958033 | 289 |
| 769 | iso_pu_bacteria | 8021120328 | 8021124255 | 289 |
| 770 | iso_pu_bacteria | 8039098773 | 8039101152 | 289 |
| 771 | iso_pu_bacteria | 8040167225 | 8040172237 | 289 |
| 772 | iso_pu_bacteria | 8040173305 | 8040177915 | 289 |
| 773 | iso_pu_bacteria | 2501025504 | 2501409248 | 290 |
| 774 | iso_pu_bacteria | 2510917013 | 2511090886 | 290 |
| 775 | iso_pu_bacteria | 2510917014 | 2511098809 | 290 |
| 776 | iso_pu_bacteria | 2510917015 | 2511109097 | 290 |
| 777 | iso_pu_bacteria | 2515154189 | 2516020860 | 290 |
| 778 | iso_pu_bacteria | 2883087390 | 2883092339 | 290 |
| 779 | iso_pu_bacteria | 2885270888 | 2885271685 | 290 |
| 780 | iso_pu_bacteria | 2904615490 | 2904622860 | 290 |
| 781 | 3300037471 | Ga0395905_0026325 | Ga0395905_0026325_1157_2188 | 291 |
| 782 | 3300044656 | Ga0466969_0001891 | Ga0466969_0001891_6247_7305 | 291 |
| 783 | 3300044658 | Ga0466972_0035450 | Ga0466972_0035450_754_1812 | 291 |
| 784 | 3300044683 | Ga0466965_0020425 | Ga0466965_0020425_983_2041 | 291 |
| 785 | 3300044684 | Ga0466966_0054990 | Ga0466966_0054990_1138_2196 | 291 |
| 786 | 3300044693 | Ga0466961_0008995 | Ga0466961_0008995_5321_6355 | 291 |
| 787 | 3300044694 | Ga0466963_0000944 | Ga0466963_0000944_5131_6189 | 291 |
| 788 | 3300044719 | Ga0466971_0007795 | Ga0466971_0007795_2268_3326 | 291 |
| 789 | 3300044735 | Ga0466968_0057733 | Ga0466968_0057733_197_1255 | 291 |
| 790 | 3300044842 | Ga0466957_0008225 | Ga0466957_0008225_3164_4222 | 291 |
| 791 | 3300045836 | Ga0466958_0004066 | Ga0466958_0004066_5276_6334 | 291 |
| 792 | 3300046455 | Ga0495603_0000708 | Ga0495603_0000708_7579_8613 | 291 |
| 793 | 3300046458 | Ga0495591_034846 | Ga0495591_034846_303_1337 | 291 |
| 794 | 3300046459 | Ga0495629_0000203 | Ga0495629_0000203_15360_16394 | 291 |
| 795 | 3300046471 | Ga0495650_0000977 | Ga0495650_0000977_10476_11510 | 291 |
| 796 | 3300046471 | Ga0495650_0047801 | Ga0495650_0047801_241_1275 | 291 |
| 797 | 3300046507 | Ga0495606_0050412 | Ga0495606_0050412_678_1712 | 291 |
| 798 | 3300046513 | Ga0495616_0097822 | Ga0495616_0097822_13_1047 | 291 |
| 799 | 3300046530 | Ga0495654_0033179 | Ga0495654_0033179_1007_2041 | 291 |
| 800 | 3300046543 | Ga0495645_0003414 | Ga0495645_0003414_4395_5429 | 291 |
| 801 | 3300046559 | Ga0495667_0018909 | Ga0495667_0018909_727_1761 | 291 |
| 802 | 3300046674 | Ga0495588_0034818 | Ga0495588_0034818_1001_2035 | 291 |
| 803 | 3300046689 | Ga0495613_0121396 | Ga0495613_0121396_291_1325 | 291 |
| 804 | 3300046694 | Ga0495649_0065551 | Ga0495649_0065551_585_1619 | 291 |
| 805 | 3300046809 | Ga0495600_0101608 | Ga0495600_0101608_481_1515 | 291 |
| 806 | 3300047315 | Ga0495581_0026107 | Ga0495581_0026107_382_1416 | 291 |
| 807 | 3300047323 | Ga0495683_0041174 | Ga0495683_0041174_956_1990 | 291 |
| 808 | 3300047444 | Ga0495675_0022533 | Ga0495675_0022533_2149_3183 | 291 |
| 809 | 3300048903 | Ga0496100_0125745 | Ga0496100_0125745_410_1444 | 291 |
| 810 | 3300048908 | Ga0496105_0091100 | Ga0496105_0091100_468_1502 | 291 |
| 811 | 3300048917 | Ga0496114_0000165 | Ga0496114_0000165_40570_41604 | 291 |
| 812 | 3300001989 | JGI24739J22299_10016441 | JGI24739J22299_100164412 | 292 |
| 813 | 3300002067 | JGI24735J21928_10000362 | JGI24735J21928_1000036214 | 292 |
| 814 | 3300009011 | Ga0105251_10002252 | Ga0105251_100022523 | 292 |
| 815 | 3300009036 | Ga0105244_10100418 | Ga0105244_101004182 | 292 |
| 816 | 3300009093 | Ga0105240_10114973 | Ga0105240_101149733 | 292 |
| 817 | 3300009545 | Ga0105237_10214218 | Ga0105237_102142182 | 292 |
| 818 | 3300013296 | Ga0157374_10092263 | Ga0157374_100922632 | 292 |
| 819 | 3300025735 | Ga0207713_1007264 | Ga0207713_10072645 | 292 |
| 820 | 3300025913 | Ga0207695_10065674 | Ga0207695_100656742 | 292 |
| 821 | 3300044656 | Ga0466969_0011954 | Ga0466969_0011954_2220_3281 | 292 |
| 822 | 3300044684 | Ga0466966_0008059 | Ga0466966_0008059_956_2017 | 292 |
| 823 | 3300044693 | Ga0466961_0039226 | Ga0466961_0039226_1156_2217 | 292 |
| 824 | 3300044694 | Ga0466963_0103578 | Ga0466963_0103578_693_1754 | 292 |
| 825 | 3300044706 | Ga0466964_0003050 | Ga0466964_0003050_4460_5521 | 292 |
| 826 | 3300044735 | Ga0466968_0009107 | Ga0466968_0009107_1089_2150 | 292 |
| 827 | 3300044765 | Ga0466970_0004294 | Ga0466970_0004294_5469_6530 | 292 |
| 828 | 3300044842 | Ga0466957_0145319 | Ga0466957_0145319_131_1192 | 292 |
| 829 | 3300045049 | Ga0466959_0015380 | Ga0466959_0015380_2440_3501 | 292 |
| 830 | 3300045836 | Ga0466958_0003813 | Ga0466958_0003813_608_1669 | 292 |
| 831 | 3300046463 | Ga0495653_0000400 | Ga0495653_0000400_9402_10439 | 292 |
| 832 | 3300046491 | Ga0495584_0111672 | Ga0495584_0111672_45_1082 | 292 |
| 833 | 3300046500 | Ga0495596_0054830 | Ga0495596_0054830_97_1134 | 292 |
| 834 | 3300046507 | Ga0495606_0026807 | Ga0495606_0026807_1147_2184 | 292 |
| 835 | 3300046516 | Ga0495628_0001445 | Ga0495628_0001445_10508_11545 | 292 |
| 836 | 3300046517 | Ga0495630_0001326 | Ga0495630_0001326_6030_7067 | 292 |
| 837 | 3300046529 | Ga0495652_0034716 | Ga0495652_0034716_440_1477 | 292 |
| 838 | 3300046531 | Ga0495665_0000050 | Ga0495665_0000050_28511_29548 | 292 |
| 839 | 3300046543 | Ga0495645_0038879 | Ga0495645_0038879_1636_2673 | 292 |
| 840 | 3300046642 | Ga0495634_0054589 | Ga0495634_0054589_787_1824 | 292 |
| 841 | 3300046678 | Ga0495599_0053403 | Ga0495599_0053403_985_2022 | 292 |
| 842 | 3300046679 | Ga0495623_0009070 | Ga0495623_0009070_2547_3584 | 292 |
| 843 | 3300046690 | Ga0495624_0026074 | Ga0495624_0026074_1022_2059 | 292 |
| 844 | 3300047317 | Ga0495604_0007691 | Ga0495604_0007691_7033_8070 | 292 |
| 845 | 3300047319 | Ga0495674_0000364 | Ga0495674_0000364_1897_2934 | 292 |
| 846 | 3300047323 | Ga0495683_0002228 | Ga0495683_0002228_8021_9058 | 292 |
| 847 | 3300047443 | Ga0495687_080791 | Ga0495687_080791_87_1124 | 292 |
| 848 | 3300047444 | Ga0495675_0049658 | Ga0495675_0049658_472_1509 | 292 |
| 849 | 3300047673 | Ga0495593_0011379 | Ga0495593_0011379_1303_2340 | 292 |
| 850 | 3300048088 | Ga0495602_0000269 | Ga0495602_0000269_16904_17941 | 292 |
| 851 | 3300048904 | Ga0496101_0145847 | Ga0496101_0145847_424_1461 | 292 |
| 852 | 3300048905 | Ga0496102_0005456 | Ga0496102_0005456_6800_7837 | 292 |
| 853 | 3300048906 | Ga0496103_0002801 | Ga0496103_0002801_5444_6481 | 292 |
| 854 | 3300048907 | Ga0496104_0192865 | Ga0496104_0192865_644_1681 | 292 |
| 855 | 3300048909 | Ga0496106_0008681 | Ga0496106_0008681_716_1753 | 292 |
| 856 | 3300048911 | Ga0496108_0326904 | Ga0496108_0326904_195_1232 | 292 |
| 857 | 3300048913 | Ga0496110_0001089 | Ga0496110_0001089_6799_7836 | 292 |
| 858 | 3300048915 | Ga0496112_0149002 | Ga0496112_0149002_539_1576 | 292 |
| 859 | 3300048919 | Ga0496116_0002414 | Ga0496116_0002414_7364_8401 | 292 |
| 860 | 3300048920 | Ga0496117_0040175 | Ga0496117_0040175_1498_2535 | 292 |
| 861 | 3300048921 | Ga0496118_0024517 | Ga0496118_0024517_2050_3087 | 292 |
| 862 | 3300048924 | Ga0496121_0036718 | Ga0496121_0036718_1833_2870 | 292 |
| 863 | 3300048925 | Ga0496122_0022808 | Ga0496122_0022808_3055_4092 | 292 |
| 864 | 3300048928 | Ga0496125_0075694 | Ga0496125_0075694_685_1722 | 292 |
| 865 | iso_pu_bacteria | 2511231016 | 2511324356 | 292 |
| 866 | iso_pu_bacteria | 2511231017 | 2511329879 | 292 |
| 867 | iso_pu_bacteria | 2511231022 | 2511364514 | 292 |
| 868 | iso_pu_bacteria | 2643221633 | 2644185122 | 292 |
| 869 | iso_pu_bacteria | 2738543004 | 2739201672 | 292 |
| 870 | iso_pu_bacteria | 2738543015 | 2739262466 | 292 |
| 871 | iso_pu_bacteria | 2773857670 | 2774119947 | 292 |
| 872 | iso_pu_bacteria | 2784132072 | 2784312122 | 292 |
| 873 | 3300044656 | Ga0466969_0098019 | Ga0466969_0098019_159_1223 | 293 |
| 874 | 3300044684 | Ga0466966_0000017 | Ga0466966_0000017_70301_71365 | 293 |
| 875 | 3300044693 | Ga0466961_0000433 | Ga0466961_0000433_11832_12896 | 293 |
| 876 | 3300044719 | Ga0466971_0037703 | Ga0466971_0037703_645_1709 | 293 |
| 877 | 3300045049 | Ga0466959_0018197 | Ga0466959_0018197_2826_3890 | 293 |
| 878 | 3300045836 | Ga0466958_0014521 | Ga0466958_0014521_2166_3230 | 293 |
| 879 | 3300046472 | Ga0495580_0011535 | Ga0495580_0011535_2088_3125 | 293 |
| 880 | 3300046477 | Ga0495664_0004705 | Ga0495664_0004705_3106_4143 | 293 |
| 881 | 3300046516 | Ga0495628_0000614 | Ga0495628_0000614_18356_19393 | 293 |
| 882 | 3300046517 | Ga0495630_0015418 | Ga0495630_0015418_2307_3344 | 293 |
| 883 | 3300046526 | Ga0495666_0009100 | Ga0495666_0009100_2301_3338 | 293 |
| 884 | 3300046531 | Ga0495665_0009851 | Ga0495665_0009851_4024_5061 | 293 |
| 885 | 3300046680 | Ga0495646_0002170 | Ga0495646_0002170_6090_7127 | 293 |
| 886 | 3300046690 | Ga0495624_0001912 | Ga0495624_0001912_12044_13081 | 293 |
| 887 | 3300047319 | Ga0495674_0000942 | Ga0495674_0000942_16456_17493 | 293 |
| 888 | 3300049460 | Ga0495682_0000040 | Ga0495682_0000040_13904_14941 | 293 |
| 889 | iso_pu_bacteria | 2501025501 | 2501075382 | 294 |
| 890 | iso_pu_bacteria | 2501025502 | 2501085467 | 294 |
| 891 | 3300046524 | Ga0495648_0002103 | Ga0495648_0002103_6422_7444 | 295 |
| 892 | 3300046530 | Ga0495654_0000770 | Ga0495654_0000770_13290_14312 | 295 |
| 893 | 3300046810 | Ga0495660_0070683 | Ga0495660_0070683_355_1377 | 295 |
| 894 | 3300047320 | Ga0495672_0006864 | Ga0495672_0006864_6149_7171 | 295 |
| 895 | 2124908027 | MRS2a_Contig_79 | MRS2a_00646750 | 296 |
| 896 | 2162886012 | MBSR1b_contig_478279 | MBSR1b_0508.00004630 | 296 |
| 897 | 3300005288 | Ga0065714_10000437 | Ga0065714_100004372 | 296 |
| 898 | 3300005290 | Ga0065712_10000438 | Ga0065712_1000043823 | 296 |
| 899 | 3300006058 | Ga0075432_10000758 | Ga0075432_100007585 | 296 |
| 900 | 3300006058 | Ga0075432_10022684 | Ga0075432_100226842 | 296 |
| 901 | 3300006058 | Ga0075432_10036132 | Ga0075432_100361322 | 296 |
| 902 | 3300009036 | Ga0105244_10007778 | Ga0105244_100077785 | 296 |
| 903 | 3300013100 | Ga0157373_10001522 | Ga0157373_1000152210 | 296 |
| 904 | 3300013104 | Ga0157370_10003190 | Ga0157370_1000319012 | 296 |
| 905 | 3300013308 | Ga0157375_10363670 | Ga0157375_103636701 | 296 |
| 906 | 3300025728 | Ga0207655_1004310 | Ga0207655_10043108 | 296 |
| 907 | 3300025728 | Ga0207655_1009973 | Ga0207655_10099734 | 296 |
| 908 | 3300025735 | Ga0207713_1002317 | Ga0207713_10023177 | 296 |
| 909 | 3300027907 | Ga0207428_10014760 | Ga0207428_100147604 | 296 |
| 910 | 3300027907 | Ga0207428_10015644 | Ga0207428_100156445 | 296 |
| 911 | 3300027907 | Ga0207428_10018964 | Ga0207428_100189642 | 296 |
| 912 | 3300027907 | Ga0207428_10224554 | Ga0207428_102245542 | 296 |
| 913 | 3300041405 | Ga0439438_001304 | Ga0439438_001304_8635_9657 | 296 |
| 914 | 3300041407 | Ga0439447_001045 | Ga0439447_001045_1078_2100 | 296 |
| 915 | 3300041411 | Ga0439466_0007138 | Ga0439466_0007138_3168_4190 | 296 |
| 916 | 3300041411 | Ga0439466_0013904 | Ga0439466_0013904_1573_2595 | 296 |
| 917 | 3300041411 | Ga0439466_0019824 | Ga0439466_0019824_360_1382 | 296 |
| 918 | 3300041413 | Ga0439465_0006173 | Ga0439465_0006173_1858_2880 | 296 |
| 919 | 3300042006 | Ga0439432_000292 | Ga0439432_000292_8796_9818 | 296 |
| 920 | 3300042009 | Ga0439451_000584 | Ga0439451_000584_3932_4954 | 296 |
| 921 | 3300042009 | Ga0439451_015658 | Ga0439451_015658_478_1500 | 296 |
| 922 | 3300042010 | Ga0439452_000134 | Ga0439452_000134_44380_45402 | 296 |
| 923 | 3300042010 | Ga0439452_015506 | Ga0439452_015506_788_1810 | 296 |
| 924 | 3300042016 | Ga0439463_000642 | Ga0439463_000642_2014_3036 | 296 |
| 925 | 3300042115 | Ga0450911_000827 | Ga0450911_000827_1477_2499 | 296 |
| 926 | 3300042127 | Ga0450890_001166 | Ga0450890_001166_2050_3072 | 296 |
| 927 | 3300042138 | Ga0450903_002672 | Ga0450903_002672_1663_2685 | 296 |
| 928 | 3300042145 | Ga0450906_000568 | Ga0450906_000568_5443_6465 | 296 |
| 929 | 3300042146 | Ga0450907_002608 | Ga0450907_002608_554_1576 | 296 |
| 930 | 3300042184 | Ga0450908_017573 | Ga0450908_017573_85_1107 | 296 |
| 931 | 3300042439 | Ga0439464_0007775 | Ga0439464_0007775_73_1095 | 296 |
| 932 | 3300042461 | Ga0439460_0013610 | Ga0439460_0013610_521_1543 | 296 |
| 933 | 3300042993 | Ga0439440_0000266 | Ga0439440_0000266_2261_3283 | 296 |
| 934 | 3300046452 | Ga0495617_000278 | Ga0495617_000278_28099_29121 | 296 |
| 935 | 3300046455 | Ga0495603_0000631 | Ga0495603_0000631_8366_9388 | 296 |
| 936 | 3300046457 | Ga0495590_0035811 | Ga0495590_0035811_13_1035 | 296 |
| 937 | 3300046458 | Ga0495591_002961 | Ga0495591_002961_1557_2579 | 296 |
| 938 | 3300046460 | Ga0495638_0016207 | Ga0495638_0016207_1017_2039 | 296 |
| 939 | 3300046460 | Ga0495638_0070018 | Ga0495638_0070018_116_1138 | 296 |
| 940 | 3300046471 | Ga0495650_0047282 | Ga0495650_0047282_240_1262 | 296 |
| 941 | 3300046474 | Ga0495605_0000129 | Ga0495605_0000129_94918_95940 | 296 |
| 942 | 3300046491 | Ga0495584_0027613 | Ga0495584_0027613_77_1099 | 296 |
| 943 | 3300046492 | Ga0495585_0001822 | Ga0495585_0001822_2989_4011 | 296 |
| 944 | 3300046499 | Ga0495594_0001716 | Ga0495594_0001716_377_1399 | 296 |
| 945 | 3300046501 | Ga0495607_0015236 | Ga0495607_0015236_1110_2132 | 296 |
| 946 | 3300046506 | Ga0495583_0000694 | Ga0495583_0000694_26138_27160 | 296 |
| 947 | 3300046518 | Ga0495631_0002774 | Ga0495631_0002774_3526_4548 | 296 |
| 948 | 3300046520 | Ga0495637_0050732 | Ga0495637_0050732_587_1609 | 296 |
| 949 | 3300046523 | Ga0495644_0002549 | Ga0495644_0002549_5897_6919 | 296 |
| 950 | 3300046524 | Ga0495648_0077514 | Ga0495648_0077514_138_1160 | 296 |
| 951 | 3300046528 | Ga0495642_0007735 | Ga0495642_0007735_2530_3552 | 296 |
| 952 | 3300046528 | Ga0495642_0032826 | Ga0495642_0032826_550_1572 | 296 |
| 953 | 3300046538 | Ga0495609_0005126 | Ga0495609_0005126_2390_3412 | 296 |
| 954 | 3300046557 | Ga0495622_0000667 | Ga0495622_0000667_7168_8190 | 296 |
| 955 | 3300046615 | Ga0495656_0008750 | Ga0495656_0008750_2112_3134 | 296 |
| 956 | 3300046616 | Ga0495668_0007195 | Ga0495668_0007195_2168_3190 | 296 |
| 957 | 3300046660 | Ga0495625_0050474 | Ga0495625_0050474_13_1035 | 296 |
| 958 | 3300046665 | Ga0495661_0164211 | Ga0495661_0164211_130_1152 | 296 |
| 959 | 3300046684 | Ga0495669_0002291 | Ga0495669_0002291_3529_4551 | 296 |
| 960 | 3300046692 | Ga0495671_0032256 | Ga0495671_0032256_61_1083 | 296 |
| 961 | 3300046694 | Ga0495649_0000013 | Ga0495649_0000013_252856_253878 | 296 |
| 962 | 3300046794 | Ga0495589_0034570 | Ga0495589_0034570_948_1970 | 296 |
| 963 | 3300046810 | Ga0495660_0070045 | Ga0495660_0070045_326_1348 | 296 |
| 964 | 3300047320 | Ga0495672_0000313 | Ga0495672_0000313_3566_4588 | 296 |
| 965 | 3300047320 | Ga0495672_0053461 | Ga0495672_0053461_1181_2203 | 296 |
| 966 | 3300047443 | Ga0495687_003689 | Ga0495687_003689_6175_7197 | 296 |
| 967 | 3300047445 | Ga0495677_0000311 | Ga0495677_0000311_16111_17133 | 296 |
| 968 | 3300047469 | Ga0495673_0063403 | Ga0495673_0063403_87_1109 | 296 |
| 969 | 3300047470 | Ga0495681_0043095 | Ga0495681_0043095_220_1242 | 296 |
| 970 | 3300048913 | Ga0496110_0005839 | Ga0496110_0005839_1996_3018 | 296 |
| 971 | 3300048914 | Ga0496111_0039594 | Ga0496111_0039594_714_1736 | 296 |
| 972 | 3300048927 | Ga0496124_0129726 | Ga0496124_0129726_965_1987 | 296 |
| 973 | 3300049460 | Ga0495682_0024099 | Ga0495682_0024099_467_1489 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4196 | 55 | 291 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.3722 | 55 | 291 |
| 7uwa-assembly1.cif.gz_c | citrus v-atpase state 1, h in contact with subunits ab | 0.3098 | 61 | 221 |
| 7uwa-assembly1.cif.gz_c | citrus v-atpase state 1, h in contact with subunits ab | 0.2853 | 61 | 221 |
| 6f0k-assembly1.cif.gz_F | alternative complex iii | 0.2781 | 42 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6643 | 63 | 283 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6571 | 62 | 283 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6563 | 62 | 283 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.656 | 62 | 283 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6494 | 62 | 283 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2WMS4-F1-model_v4 | deleted | 0.7639 | 44 | 224 |
|
| AF-A0A5D0UFM2-F1-model_v4 | ABC transporter permease | 0.7621 | 25 | 222 |
GO:0005886
GO:0022857 |
| AF-A0A7X3ZBI2-F1-model_v4 | Ribose ABC transporter permease | 0.7597 | 25 | 217 |
GO:0005886
GO:0022857 |
| AF-A0A531MQ55-F1-model_v4 | L-arabinose ABC transporter permease AraH (EC 3.6.3.17) | 0.7589 | 28 | 224 |
GO:0005886
GO:0016787 GO:0022857 |
| AF-A0A528BGR4-F1-model_v4 | ABC transporter permease | 0.7582 | 48 | 222 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar