F487198

General Info

Members Datasets Scaffolds Average Seq Length
973 649 656 321

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025501|2501075382
Length 358
Sequence AYARNVPQEYDMKSILPRHGVAASPTQPAQGAQPARSVAVDGHRQRMKSLVRTAGMLPVLVLLCIGFGLLNDGFFTLENLSIVTQQASINIVLAAGMTFVILTGGIDLSVGSVLAAAAMAAMIGSNIAGWGWLGVPMALAVGLGFGLVNGALISLLRLPPFIVTLGSLTAVRGIARLMGHDTTIFNPQLPFAFIGNGTVLGVPWLVIIALVVVAGSWFVLRRTVLGLRIYSVGGNPEAARLSGIKVWGIEMFVYAVSGLLAGLGAVMSAARLYAANGLQLGQSYELDAIAAVILGGTSFVGGVGSIIGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGLVIVGAVALDRYRQRGSART

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
7 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
8 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
9 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
10 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
11 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
12 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
13 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875024 Mesorhizobium loti R88b Isolate Nodule
20 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
21 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
22 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
23 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
24 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
25 2519103095 Burkholderia sp. KJ006 Isolate Nodule
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
28 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
29 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
30 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
31 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
32 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
33 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
34 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
35 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
36 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
37 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
38 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
39 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
40 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
41 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
42 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
43 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
44 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
45 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
46 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
47 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
48 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
49 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
50 2643221718 Rhizobium sp. Root268 Isolate Unclassified
51 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
52 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
53 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
54 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
55 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
56 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
57 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
58 2738541293 Rhizobium sp. GV031 Isolate Unclassified
59 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
60 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
61 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
62 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
63 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
64 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
65 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
66 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
67 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
68 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
69 2773857670 Pseudomonas sp. 478 Isolate Unclassified
70 2773857925 Microvirga vignae BR3299 Isolate Unclassified
71 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
72 2784132072 Pseudomonas sp. 460 Isolate Unclassified
73 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
74 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
75 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
76 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
77 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
78 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
79 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
80 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
81 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
82 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
83 2818991436 Collimonas arenae 515 Isolate Unclassified
84 2818991452 Burkholderia cepacia 561 Isolate Unclassified
85 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
86 2831426010 Nostoc sp. 106C Isolate Unclassified
87 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
88 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
89 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
90 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
91 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
92 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
93 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
94 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
95 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
96 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
97 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
98 2849660919 Nostoc sp. T09 Isolate Unclassified
99 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
100 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
101 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
102 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
103 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
104 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
105 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
106 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
107 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
108 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
109 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
110 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
111 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
112 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
113 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
114 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
115 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
116 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
117 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
118 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
119 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
120 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
121 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
122 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
123 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
124 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
125 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
126 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
127 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
128 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
129 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
130 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
131 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
132 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
133 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
134 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
135 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
136 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
137 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
138 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
139 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
140 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
141 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
142 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
143 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
144 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
145 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
146 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
147 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
148 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
149 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
150 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
151 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
152 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
153 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
154 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
155 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
156 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
157 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
158 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
159 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
160 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
161 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
162 2904564687 Burkholderia sp. 571 Isolate Unclassified
163 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
164 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
165 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
166 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
167 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
168 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
169 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
170 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
171 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
172 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
173 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
174 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
175 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
176 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
177 2909042592 Labrys sp. LIt4 Isolate Nodule
178 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
179 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
180 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
181 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
182 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
183 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
184 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
185 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
186 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
187 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
188 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
189 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
190 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
191 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
192 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
193 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
194 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
195 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
196 2928163908 Burkholderia sp. 567 Isolate Unclassified
197 2928170801 Burkholderia sp. 572 Isolate Unclassified
198 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
199 2928536128 Burkholderia sola 565 Isolate Unclassified
200 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
201 2932401849 Devosia sp. 2618 Isolate Rhizosphere
202 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
203 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
204 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
205 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
206 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
207 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
208 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
209 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
210 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
211 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
212 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
213 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
214 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
215 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
216 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
217 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
218 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
219 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
220 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
221 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
222 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
223 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
224 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
225 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
226 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
227 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
228 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
229 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
230 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
231 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
232 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
233 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
234 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
235 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
236 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
237 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
238 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
239 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
240 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
241 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
242 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
243 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
244 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
245 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
246 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
247 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
248 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
249 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
250 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
251 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
252 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
253 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
254 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
255 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
256 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
257 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
258 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
259 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
260 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
261 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
262 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
263 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
264 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
265 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
266 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
267 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
268 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
269 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
270 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
271 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
272 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
273 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
274 3004167301 Mesorhizobium loti 582 Isolate Unclassified
275 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
276 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
277 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
278 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
279 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
280 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
281 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
282 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
283 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
284 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
285 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
286 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
287 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
288 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
289 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
290 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
291 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
292 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
293 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
294 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
295 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
296 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
297 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
298 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
299 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
300 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
301 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
302 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
303 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
304 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
305 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
306 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
307 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
308 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
309 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
310 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
311 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
312 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
313 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
314 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
315 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
316 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
317 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
318 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
319 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
320 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
321 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
322 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
323 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
324 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
325 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
326 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
327 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
328 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
329 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
330 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
331 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
332 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
333 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
334 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
335 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
336 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
337 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
338 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
339 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
340 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
341 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
342 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
343 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
344 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
345 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
346 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
347 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
348 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
349 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
350 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
351 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
352 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
353 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
354 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
355 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
356 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
357 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
358 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
359 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
366 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
367 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
369 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
370 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
373 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
374 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
375 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
382 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
411 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
412 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
413 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
414 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
416 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
417 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
418 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
419 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
420 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
421 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
422 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
423 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
424 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
425 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
426 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
427 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
428 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
429 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
430 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
431 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
432 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
433 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
434 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
435 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
436 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
437 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
438 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
439 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
440 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
441 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
442 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
443 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
444 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
445 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
446 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
447 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
448 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
449 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
450 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
451 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
452 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
453 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
454 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
455 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
456 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
457 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
458 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
459 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
460 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
461 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
462 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
463 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
464 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
465 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
466 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
467 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
468 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
469 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
470 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
471 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
472 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
473 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
474 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
475 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
476 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
477 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
478 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
479 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
480 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
481 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
482 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
483 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
484 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
485 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
486 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
487 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
488 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
489 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
490 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
491 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
492 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
493 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
494 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
495 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
496 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
497 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
498 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
499 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
500 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
501 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
502 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
503 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
504 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
505 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
506 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
507 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
508 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
509 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
510 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
511 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
512 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
513 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
514 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
515 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
516 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
517 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
518 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
519 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
520 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
521 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
522 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
523 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
524 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
525 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
526 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
527 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
528 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
529 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
530 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
531 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
532 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
533 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
534 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
535 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
536 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
537 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
538 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
539 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
540 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
541 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
542 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
543 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
544 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
545 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
546 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
547 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
548 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
549 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
550 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
551 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
552 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
553 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
554 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
555 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
556 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
557 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
558 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
559 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
560 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
561 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
562 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
563 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
564 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
565 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
566 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
567 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
568 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
569 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
570 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
571 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
572 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
573 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
574 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
575 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
576 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
577 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
578 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
579 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
580 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
581 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
582 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
583 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
584 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
585 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
586 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
587 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
588 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
589 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
592 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
595 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
596 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
597 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
598 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
599 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
600 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
601 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
602 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
603 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
604 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
605 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
606 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
607 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
608 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
609 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
610 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
611 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
612 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
613 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
614 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
615 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
616 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
617 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
619 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
620 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
621 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
622 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
623 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
624 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
625 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
626 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
627 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
628 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
629 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
630 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
631 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
632 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
633 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
634 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
635 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
636 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
637 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
638 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
639 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
640 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
641 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
642 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
643 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
644 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
645 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
646 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
647 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
648 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
649 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.01
Metatranscriptomes 0.41
Isolates 32.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 17.99
Rhizoplane 3.91
Rhizosphere 55.4
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_79 2124908027 Bacteria 37018
2 MBSR1b_contig_478279 2162886012 Bacteria 2110
3 JGI24741J21665_1001854 3300001915 Bacteria 5763
4 JGI24740J21852_10000029 3300001979 Bacteria 48171
5 JGI24740J21852_10001316 3300001979 Bacteria 11288
6 JGI24739J22299_10007978 3300001989 Bacteria 3962
7 JGI24739J22299_10016441 3300001989 Bacteria 2677
8 JGI24739J22299_10046749 3300001989 Bacteria 1416
9 JGI24735J21928_10000362 3300002067 Bacteria 15787
10 JGI25156J39149_1003309 3300002705 Bacteria 5333
11 JGI25156J39149_1003693 3300002705 Bacteria 4906
12 JGI25162J39368_1000036 3300002737 Bacteria 180433
13 JGI25154J39366_1000402 3300002738 Bacteria 23561
14 JGI25163J39215_1001653 3300002771 Bacteria 3286
15 Ga0006778J45830_1018533 3300003162 Bacteria 2347
16 JGI25151J46595_10001875 3300003187 Bacteria 13420
17 JGI25165J46597_1000022 3300003214 Bacteria 357959
18 Ga0007410J51695_1003197 3300003574 Bacteria 4992
19 Ga0055538_1000011 3300003751 Bacteria 357959
20 Ga0055538_1000534 3300003751 Bacteria 13427
21 Ga0055539_1000016 3300003752 Bacteria 358248
22 Ga0055539_1000073 3300003752 Bacteria 131094
23 Ga0055533_1000019 3300003756 Bacteria 357959
24 Ga0055533_1000561 3300003756 Bacteria 13045
25 Ga0055533_1003352 3300003756 Bacteria 3250
26 Ga0055532_1000564 3300003758 Bacteria 15555
27 Ga0055532_1004378 3300003758 Bacteria 2149
28 Ga0055532_1004404 3300003758 Bacteria 2138
29 Ga0055525_1000042 3300003759 Bacteria 279804
30 Ga0055525_1000383 3300003759 Bacteria 28771
31 Ga0055527_1000549 3300003760 Bacteria 12495
32 Ga0055535_1007205 3300003761 Bacteria 2149
33 Ga0055535_1007260 3300003761 Bacteria 2138
34 Ga0055542_1000928 3300003762 Bacteria 19416
35 Ga0055542_1007757 3300003762 Bacteria 2149
36 Ga0055542_1007805 3300003762 Bacteria 2138
37 Ga0055529_1000447 3300003763 Bacteria 41032
38 Ga0055529_1006454 3300003763 Bacteria 1639
39 Ga0055528_1002503 3300003790 Bacteria 9808
40 Ga0055541_1000017 3300003841 Bacteria 286811
41 Ga0055541_1000351 3300003841 Bacteria 14348
42 Ga0055541_1000473 3300003841 Bacteria 11535
43 Ga0065714_10000437 3300005288 Bacteria 4674
44 Ga0065714_10064853 3300005288 Bacteria 16996
45 Ga0065714_10093650 3300005288 Bacteria 1840
46 Ga0065712_10000438 3300005290 Bacteria 32737
47 Ga0065712_10072822 3300005290 Bacteria 4605
48 Ga0070658_10073348 3300005327 Bacteria 2806
49 Ga0070670_100000079 3300005331 Bacteria 92916
50 Ga0070666_10013971 3300005335 Bacteria 5105
51 Ga0070660_100000087 3300005339 Bacteria 55894
52 Ga0070660_100030766 3300005339 Bacteria 4028
53 Ga0070661_100000141 3300005344 Bacteria 58825
54 Ga0070661_100001004 3300005344 Bacteria 20032
55 Ga0070668_100099598 3300005347 Bacteria 2301
56 Ga0070669_100007493 3300005353 Bacteria 7815
57 Ga0070659_100000211 3300005366 Bacteria 45357
58 Ga0070659_100201703 3300005366 Bacteria 1638
59 Ga0070667_100049430 3300005367 Bacteria 3542
60 Ga0070663_100000034 3300005455 Bacteria 68516
61 Ga0070663_100002551 3300005455 Bacteria 10283
62 Ga0070662_100008560 3300005457 Bacteria 6672
63 Ga0070706_100093931 3300005467 Bacteria 2783
64 Ga0070698_100064473 3300005471 Bacteria 3691
65 Ga0070665_100274804 3300005548 Bacteria 1686
66 Ga0070665_100528649 3300005548 Bacteria 1191
67 Ga0070664_100000057 3300005564 Bacteria 68516
68 Ga0070664_100001292 3300005564 Bacteria 20032
69 Ga0068856_100001920 3300005614 Bacteria 21668
70 Ga0068852_100017539 3300005616 Bacteria 5620
71 Ga0081539_10109005 3300005985 Bacteria 1398
72 Ga0070717_10403811 3300006028 Bacteria 1228
73 Ga0075365_10037339 3300006038 Bacteria 3153
74 Ga0075432_10000758 3300006058 Bacteria 10034
75 Ga0075432_10022684 3300006058 Bacteria 2147
76 Ga0075432_10036132 3300006058 Bacteria 1717
77 Ga0075366_10096513 3300006195 Bacteria 1772
78 Ga0075370_10001724 3300006353 Bacteria 9729
79 Ga0075370_10144737 3300006353 Bacteria 1391
80 Ga0099824_1019296 3300006942 Bacteria 5355
81 Ga0099822_1004906 3300006943 Bacteria 17459
82 Ga0105251_10000357 3300009011 Bacteria 45041
83 Ga0105251_10002252 3300009011 Bacteria 15333
84 Ga0105251_10004723 3300009011 Bacteria 9135
85 Ga0105251_10014955 3300009011 Bacteria 4261
86 Ga0105244_10001369 3300009036 Bacteria 19810
87 Ga0105244_10001610 3300009036 Bacteria 17926
88 Ga0105244_10007778 3300009036 Bacteria 6773
89 Ga0105244_10100418 3300009036 Bacteria 1416
90 Ga0105250_10000015 3300009092 Bacteria 262683
91 Ga0105250_10039918 3300009092 Bacteria 1882
92 Ga0105240_10001380 3300009093 Bacteria 41739
93 Ga0105240_10019894 3300009093 Bacteria 8965
94 Ga0105240_10114973 3300009093 Bacteria 3249
95 Ga0105240_10170911 3300009093 Bacteria 2575
96 Ga0105242_10001326 3300009176 Bacteria 19534
97 Ga0105237_10000937 3300009545 Bacteria 39281
98 Ga0105237_10214218 3300009545 Bacteria 1926
99 Ga0105238_10006248 3300009551 Bacteria 11837
100 Ga0105239_10011798 3300010375 Bacteria 9752
101 Ga0105239_10203686 3300010375 Bacteria 2217
102 Ga0105246_10024013 3300011119 Bacteria 3953
103 Ga0157373_10000409 3300013100 Bacteria 34480
104 Ga0157373_10000598 3300013100 Bacteria 28031
105 Ga0157373_10001522 3300013100 Bacteria 17681
106 Ga0157373_10002881 3300013100 Bacteria 13009
107 Ga0157373_10013153 3300013100 Bacteria 6075
108 Ga0157373_10014396 3300013100 Bacteria 5798
109 Ga0157373_10135579 3300013100 Bacteria 1731
110 Ga0157371_10000323 3300013102 Bacteria 61980
111 Ga0157371_10053913 3300013102 Bacteria 2855
112 Ga0157370_10000038 3300013104 Bacteria 135182
113 Ga0157370_10003190 3300013104 Bacteria 19390
114 Ga0157370_10135089 3300013104 Bacteria 2299
115 Ga0157369_10002773 3300013105 Bacteria 20919
116 Ga0157369_10003376 3300013105 Bacteria 18972
117 Ga0157369_10128831 3300013105 Bacteria 2682
118 Ga0157369_10285749 3300013105 Bacteria 1718
119 Ga0157374_10092263 3300013296 Bacteria 2889
120 Ga0163162_10360388 3300013306 Bacteria 1587
121 Ga0163162_10519859 3300013306 Bacteria 1320
122 Ga0163162_10718549 3300013306 Bacteria 1120
123 Ga0157372_10013616 3300013307 Bacteria 8694
124 Ga0157375_10000100 3300013308 Bacteria 87522
125 Ga0157375_10002189 3300013308 Bacteria 16893
126 Ga0157375_10038747 3300013308 Bacteria 4579
127 Ga0157375_10363670 3300013308 Bacteria 1613
128 Ga0182008_10001638 3300014497 Bacteria 14811
129 Ga0182008_10038132 3300014497 Bacteria 2404
130 Ga0182006_1000099 3300015261 Bacteria 98453
131 Ga0182007_10000379 3300015262 Bacteria 28020
132 Ga0182005_1001696 3300015265 Bacteria 8522
133 Ga0182005_1002583 3300015265 Bacteria 6410
134 Ga0183362_10001 3300015683 Bacteria 2046624
135 Ga0163161_10018945 3300017792 Bacteria 4825
136 Ga0163161_10161357 3300017792 Bacteria 1709
137 Ga0209760_100730 3300025207 Bacteria 4865
138 Ga0209784_100006 3300025224 Bacteria 930704
139 Ga0209784_100019 3300025224 Bacteria 453558
140 Ga0209784_100303 3300025224 Bacteria 26446
141 Ga0209566_100002 3300025225 Bacteria 2614868
142 Ga0209566_100017 3300025225 Bacteria 453558
143 Ga0209566_100129 3300025225 Bacteria 92878
144 Ga0209566_100665 3300025225 Bacteria 20581
145 Ga0209674_100031 3300025226 Bacteria 453558
146 Ga0209674_100097 3300025226 Bacteria 167285
147 Ga0209674_100195 3300025226 Bacteria 64986
148 Ga0209672_100037 3300025228 Bacteria 287776
149 Ga0209672_100102 3300025228 Bacteria 104385
150 Ga0209147_100049 3300025229 Bacteria 274980
151 Ga0209147_100071 3300025229 Bacteria 215861
152 Ga0209147_100284 3300025229 Bacteria 43233
153 Ga0209563_100035 3300025230 Bacteria 453558
154 Ga0209563_100041 3300025230 Bacteria 407467
155 Ga0209563_102007 3300025230 Bacteria 4868
156 Ga0207427_100206 3300025231 Bacteria 53709
157 Ga0209437_100038 3300025233 Bacteria 453558
158 Ga0209258_100066 3300025242 Bacteria 287776
159 Ga0209258_100082 3300025242 Bacteria 247739
160 Ga0209646_1000063 3300025246 Bacteria 248065
161 Ga0209026_1003385 3300025250 Bacteria 5268
162 Ga0209677_100007 3300025253 Bacteria 1021332
163 Ga0209677_100020 3300025253 Bacteria 453558
164 Ga0209677_101172 3300025253 Bacteria 12051
165 Ga0209677_104837 3300025253 Bacteria 3716
166 Ga0209148_1000019 3300025254 Bacteria 748518
167 Ga0209148_1000168 3300025254 Bacteria 133952
168 Ga0209148_1001176 3300025254 Bacteria 15061
169 Ga0209148_1003323 3300025254 Bacteria 4531
170 Ga0209759_1000819 3300025256 Bacteria 24663
171 Ga0209759_1002792 3300025256 Bacteria 7381
172 Ga0209759_1007655 3300025256 Bacteria 3447
173 Ga0209129_1000016 3300025258 Bacteria 485491
174 Ga0209233_1000049 3300025261 Bacteria 453558
175 Ga0209455_1000141 3300025272 Bacteria 138212
176 Ga0209455_1000161 3300025272 Bacteria 117353
177 Ga0209455_1001584 3300025272 Bacteria 10019
178 Ga0209455_1003534 3300025272 Bacteria 5485
179 Ga0209455_1022539 3300025272 Bacteria 1197
180 Ga0209673_1000184 3300025273 Bacteria 126036
181 Ga0209025_1000338 3300025294 Bacteria 103479
182 Ga0209564_1013075 3300025295 Bacteria 3555
183 Ga0209758_1000048 3300025297 Bacteria 358400
184 Ga0209758_1003308 3300025297 Bacteria 14918
185 Ga0209758_1025482 3300025297 Bacteria 2594
186 Ga0209050_1005781 3300025298 Bacteria 7612
187 Ga0209257_1000334 3300025304 Bacteria 98054
188 Ga0207696_1000017 3300025711 Bacteria 491130
189 Ga0207696_1021938 3300025711 Bacteria 2037
190 Ga0207655_1000070 3300025728 Bacteria 239196
191 Ga0207655_1004310 3300025728 Bacteria 10166
192 Ga0207655_1009973 3300025728 Bacteria 5824
193 Ga0207713_1000058 3300025735 Bacteria 216911
194 Ga0207713_1000774 3300025735 Bacteria 29524
195 Ga0207713_1002317 3300025735 Bacteria 13989
196 Ga0207713_1007264 3300025735 Bacteria 6572
197 Ga0207713_1014153 3300025735 Bacteria 4161
198 Ga0207680_10084344 3300025903 Bacteria 2004
199 Ga0207647_10003229 3300025904 Bacteria 12230
200 Ga0207647_10007459 3300025904 Bacteria 7900
201 Ga0207705_10067526 3300025909 Bacteria 2588
202 Ga0207684_10005922 3300025910 Bacteria 11192
203 Ga0207695_10001136 3300025913 Bacteria 46129
204 Ga0207695_10001137 3300025913 Bacteria 46108
205 Ga0207695_10065674 3300025913 Bacteria 3730
206 Ga0207695_10239111 3300025913 Bacteria 1718
207 Ga0207695_10314452 3300025913 Bacteria 1456
208 Ga0207671_10001472 3300025914 Bacteria 27195
209 Ga0207657_10000078 3300025919 Bacteria 92019
210 Ga0207649_10000111 3300025920 Bacteria 68568
211 Ga0207649_10004380 3300025920 Bacteria 7662
212 Ga0207681_10015979 3300025923 Bacteria 4689
213 Ga0207681_10192931 3300025923 Bacteria 1560
214 Ga0207681_10254015 3300025923 Bacteria 1374
215 Ga0207694_10018442 3300025924 Bacteria 5274
216 Ga0207650_10001079 3300025925 Bacteria 20203
217 Ga0207690_10000026 3300025932 Bacteria 175904
218 Ga0207706_10013625 3300025933 Bacteria 7385
219 Ga0207686_10046851 3300025934 Bacteria 2669
220 Ga0207691_10069105 3300025940 Bacteria 3191
221 Ga0207711_10085423 3300025941 Bacteria 2765
222 Ga0207679_10000105 3300025945 Bacteria 68561
223 Ga0207679_10000818 3300025945 Bacteria 20047
224 Ga0207658_10036205 3300025986 Bacteria 3538
225 Ga0207639_10048044 3300026041 Bacteria 3228
226 Ga0207639_10115535 3300026041 Bacteria 2195
227 Ga0207678_10000106 3300026067 Bacteria 68474
228 Ga0207678_10006717 3300026067 Bacteria 10203
229 Ga0207678_10070213 3300026067 Bacteria 3003
230 Ga0207702_10000135 3300026078 Bacteria 88092
231 Ga0207702_10169762 3300026078 Bacteria 1999
232 Ga0207674_10242360 3300026116 Bacteria 1750
233 Ga0207683_10121325 3300026121 Bacteria 2347
234 Ga0207698_10044384 3300026142 Bacteria 3339
235 Ga0209371_1000488 3300027312 Bacteria 38733
236 Ga0209589_1000042 3300027357 Bacteria 122436
237 Ga0209489_100095 3300027361 Bacteria 122436
238 Ga0209700_100095 3300027363 Bacteria 122436
239 Ga0207428_10014760 3300027907 Bacteria 6767
240 Ga0207428_10015644 3300027907 Bacteria 6555
241 Ga0207428_10018964 3300027907 Bacteria 5867
242 Ga0207428_10224554 3300027907 Bacteria 1407
243 Ga0268265_10018107 3300028380 Bacteria 4876
244 Ga0307515_10066283 3300028794 Bacteria 5005
245 Ga0265338_10000037 3300028800 Bacteria 237244
246 Ga0310981_1009967 3300029285 Bacteria 1409
247 Ga0268256_1003581 3300030500 Bacteria 6933
248 Ga0265340_10014726 3300031247 Bacteria 4079
249 Ga0265316_10232510 3300031344 Bacteria 1357
250 Ga0307513_10041773 3300031456 Bacteria 5057
251 Ga0307408_100191534 3300031548 Bacteria 1648
252 Ga0307508_10125162 3300031616 Bacteria 2173
253 Ga0307405_10000479 3300031731 Bacteria 15021
254 Ga0307410_10302880 3300031852 Bacteria 1262
255 Ga0307411_10065341 3300032005 Bacteria 2440
256 Ga0307510_10151481 3300033180 Bacteria 1937
257 Ga0373923_0101801 3300035111 Bacteria 1267
258 Ga0373937_0047181 3300036401 Bacteria 3940
259 Ga0395899_0029919 3300037312 Bacteria 4098
260 Ga0395899_0115027 3300037312 Bacteria 1931
261 Ga0395900_0083216 3300037418 Bacteria 3288
262 Ga0395905_0026325 3300037471 Bacteria 5485
263 Ga0436364_0738766 3300037853 Bacteria 4033
264 Ga0237819_04710 3300038705 Bacteria 2215
265 Ga0436365_1255399 3300039437 Bacteria 3124
266 Ga0436361_0734299 3300039447 Bacteria 2461
267 Ga0436362_0478089 3300039453 Bacteria 1530
268 Ga0439438_001304 3300041405 Bacteria 11047
269 Ga0439438_010381 3300041405 Bacteria 2945
270 Ga0439439_0001544 3300041406 Bacteria 4624
271 Ga0439447_001045 3300041407 Bacteria 10069
272 Ga0439447_018421 3300041407 Bacteria 1882
273 Ga0439447_034028 3300041407 Bacteria 1268
274 Ga0439466_0007138 3300041411 Bacteria 4229
275 Ga0439466_0013904 3300041411 Bacteria 2939
276 Ga0439466_0019824 3300041411 Bacteria 2403
277 Ga0439465_0006173 3300041413 Bacteria 3811
278 Ga0439431_0021573 3300041997 Bacteria 1546
279 Ga0439445_0007986 3300042004 Bacteria 2468
280 Ga0439432_000292 3300042006 Bacteria 18051
281 Ga0439432_005525 3300042006 Bacteria 4548
282 Ga0439432_019836 3300042006 Bacteria 2237
283 Ga0439432_028798 3300042006 Bacteria 1807
284 Ga0439449_0001069 3300042007 Bacteria 10763
285 Ga0439449_0029879 3300042007 Bacteria 2030
286 Ga0439451_000584 3300042009 Bacteria 6925
287 Ga0439451_015658 3300042009 Bacteria 1529
288 Ga0439452_000134 3300042010 Bacteria 55915
289 Ga0439452_002617 3300042010 Bacteria 6578
290 Ga0439452_015506 3300042010 Bacteria 2089
291 Ga0439456_010692 3300042013 Bacteria 1897
292 Ga0439463_000532 3300042016 Bacteria 10687
293 Ga0439463_000642 3300042016 Bacteria 9676
294 Ga0450911_000827 3300042115 Bacteria 8468
295 Ga0450890_001166 3300042127 Bacteria 3805
296 Ga0450902_001559 3300042137 Bacteria 3136
297 Ga0450903_002672 3300042138 Bacteria 3141
298 Ga0450906_000568 3300042145 Bacteria 7814
299 Ga0450906_004068 3300042145 Bacteria 3094
300 Ga0450907_002608 3300042146 Bacteria 3376
301 Ga0450908_004697 3300042184 Bacteria 2632
302 Ga0450908_017573 3300042184 Bacteria 1268
303 Ga0439434_0005521 3300042435 Bacteria 3695
304 Ga0439464_0007775 3300042439 Bacteria 2805
305 Ga0439460_0013610 3300042461 Bacteria 2130
306 Ga0439440_0000266 3300042993 Bacteria 8442
307 Ga0466969_0001891 3300044656 Bacteria 11192
308 Ga0466969_0011954 3300044656 Bacteria 4590
309 Ga0466969_0098019 3300044656 Bacteria 1382
310 Ga0466972_0021255 3300044658 Bacteria 3237
311 Ga0466972_0035450 3300044658 Bacteria 2442
312 Ga0466965_0020425 3300044683 Bacteria 3183
313 Ga0466965_0078061 3300044683 Bacteria 1672
314 Ga0466966_0000017 3300044684 Bacteria 123642
315 Ga0466966_0008059 3300044684 Bacteria 6982
316 Ga0466966_0054990 3300044684 Bacteria 2521
317 Ga0466961_0000433 3300044693 Bacteria 26669
318 Ga0466961_0008995 3300044693 Bacteria 6371
319 Ga0466961_0039226 3300044693 Bacteria 3036
320 Ga0466963_0000944 3300044694 Bacteria 14881
321 Ga0466963_0103578 3300044694 Bacteria 1950
322 Ga0466964_0003050 3300044706 Bacteria 6079
323 Ga0466971_0007795 3300044719 Bacteria 4666
324 Ga0466971_0037703 3300044719 Bacteria 2167
325 Ga0466968_0009107 3300044735 Bacteria 3816
326 Ga0466968_0057733 3300044735 Bacteria 1669
327 Ga0466970_0004294 3300044765 Bacteria 7013
328 Ga0466957_0008225 3300044842 Bacteria 5926
329 Ga0466957_0140688 3300044842 Bacteria 1554
330 Ga0466957_0145319 3300044842 Bacteria 1530
331 Ga0466960_0004840 3300044901 Bacteria 5292
332 Ga0466959_0015380 3300045049 Bacteria 5572
333 Ga0466959_0018197 3300045049 Bacteria 5157
334 Ga0466958_0003813 3300045836 Bacteria 7875
335 Ga0466958_0004066 3300045836 Bacteria 7674
336 Ga0466958_0014521 3300045836 Bacteria 4495
337 Ga0495617_000278 3300046452 Bacteria 29586
338 Ga0495627_000263 3300046453 Bacteria 53912
339 Ga0495627_020422 3300046453 Bacteria 2207
340 Ga0495592_0034404 3300046454 Bacteria 3819
341 Ga0495603_0000631 3300046455 Bacteria 19774
342 Ga0495603_0000708 3300046455 Bacteria 18905
343 Ga0495590_0035811 3300046457 Bacteria 1732
344 Ga0495591_000130 3300046458 Bacteria 82467
345 Ga0495591_000208 3300046458 Bacteria 59856
346 Ga0495591_001119 3300046458 Bacteria 17719
347 Ga0495591_002961 3300046458 Bacteria 9068
348 Ga0495591_018643 3300046458 Bacteria 2348
349 Ga0495591_034846 3300046458 Bacteria 1478
350 Ga0495629_0000203 3300046459 Bacteria 52930
351 Ga0495629_0252329 3300046459 Bacteria 1214
352 Ga0495638_0002449 3300046460 Bacteria 15148
353 Ga0495638_0016207 3300046460 Bacteria 4995
354 Ga0495638_0070018 3300046460 Bacteria 2149
355 Ga0495638_0105132 3300046460 Bacteria 1683
356 Ga0495651_0096623 3300046462 Bacteria 2207
357 Ga0495651_0118815 3300046462 Bacteria 1945
358 Ga0495651_0137227 3300046462 Bacteria 1778
359 Ga0495653_0000400 3300046463 Bacteria 34828
360 Ga0495653_0038718 3300046463 Bacteria 3741
361 Ga0495653_0184809 3300046463 Bacteria 1427
362 Ga0495653_0261490 3300046463 Bacteria 1144
363 Ga0495650_0000617 3300046471 Bacteria 48235
364 Ga0495650_0000977 3300046471 Bacteria 32622
365 Ga0495650_0047282 3300046471 Bacteria 1800
366 Ga0495650_0047801 3300046471 Bacteria 1787
367 Ga0495650_0061071 3300046471 Bacteria 1511
368 Ga0495580_0011535 3300046472 Bacteria 6836
369 Ga0495605_0000060 3300046474 Bacteria 145530
370 Ga0495605_0000066 3300046474 Bacteria 139260
371 Ga0495605_0000129 3300046474 Bacteria 99505
372 Ga0495605_0000310 3300046474 Bacteria 51402
373 Ga0495605_0001183 3300046474 Bacteria 17357
374 Ga0495605_0002052 3300046474 Bacteria 12704
375 Ga0495662_0111691 3300046476 Bacteria 1340
376 Ga0495664_0004705 3300046477 Bacteria 7467
377 Ga0495664_0164551 3300046477 Bacteria 1346
378 Ga0495584_0027613 3300046491 Bacteria 2875
379 Ga0495584_0111672 3300046491 Bacteria 1383
380 Ga0495585_0001822 3300046492 Bacteria 16137
381 Ga0495585_0047975 3300046492 Bacteria 2376
382 Ga0495594_0001716 3300046499 Bacteria 11359
383 Ga0495596_0054830 3300046500 Bacteria 1558
384 Ga0495607_0000858 3300046501 Bacteria 28651
385 Ga0495607_0003325 3300046501 Bacteria 12347
386 Ga0495607_0006938 3300046501 Bacteria 7895
387 Ga0495607_0012819 3300046501 Bacteria 5513
388 Ga0495607_0015236 3300046501 Bacteria 4985
389 Ga0495607_0048743 3300046501 Bacteria 2475
390 Ga0495607_0068773 3300046501 Bacteria 1984
391 Ga0495583_0000086 3300046506 Bacteria 165176
392 Ga0495583_0000282 3300046506 Bacteria 82063
393 Ga0495583_0000312 3300046506 Bacteria 76605
394 Ga0495583_0000694 3300046506 Bacteria 43511
395 Ga0495583_0001046 3300046506 Bacteria 31212
396 Ga0495583_0001170 3300046506 Bacteria 28380
397 Ga0495583_0006932 3300046506 Bacteria 7275
398 Ga0495583_0082906 3300046506 Bacteria 1391
399 Ga0495606_0000274 3300046507 Bacteria 90529
400 Ga0495606_0005395 3300046507 Bacteria 12259
401 Ga0495606_0022702 3300046507 Bacteria 4561
402 Ga0495606_0026807 3300046507 Bacteria 4099
403 Ga0495606_0050412 3300046507 Bacteria 2723
404 Ga0495608_0004835 3300046511 Bacteria 9629
405 Ga0495610_0052406 3300046512 Bacteria 1980
406 Ga0495610_0080705 3300046512 Bacteria 1494
407 Ga0495616_0097822 3300046513 Bacteria 1380
408 Ga0495618_0037393 3300046514 Bacteria 3048
409 Ga0495620_0000061 3300046515 Bacteria 94469
410 Ga0495620_0000962 3300046515 Bacteria 17723
411 Ga0495620_0021769 3300046515 Bacteria 3105
412 Ga0495628_0000614 3300046516 Bacteria 32697
413 Ga0495628_0001445 3300046516 Bacteria 21790
414 Ga0495628_0001650 3300046516 Bacteria 20411
415 Ga0495628_0007899 3300046516 Bacteria 9169
416 Ga0495630_0001326 3300046517 Bacteria 17013
417 Ga0495630_0015418 3300046517 Bacteria 5581
418 Ga0495631_0002774 3300046518 Bacteria 9712
419 Ga0495631_0026707 3300046518 Bacteria 2648
420 Ga0495632_0002787 3300046519 Bacteria 12963
421 Ga0495632_0002802 3300046519 Bacteria 12909
422 Ga0495632_0003043 3300046519 Bacteria 12204
423 Ga0495637_0000043 3300046520 Bacteria 112526
424 Ga0495637_0000661 3300046520 Bacteria 24026
425 Ga0495637_0050732 3300046520 Bacteria 1739
426 Ga0495643_0020381 3300046522 Bacteria 3822
427 Ga0495643_0032144 3300046522 Bacteria 2915
428 Ga0495644_0002549 3300046523 Bacteria 7250
429 Ga0495644_0019462 3300046523 Bacteria 2592
430 Ga0495644_0036401 3300046523 Bacteria 1857
431 Ga0495648_0000218 3300046524 Bacteria 65786
432 Ga0495648_0002103 3300046524 Bacteria 18775
433 Ga0495648_0005363 3300046524 Bacteria 10673
434 Ga0495648_0077514 3300046524 Bacteria 1904
435 Ga0495666_0009100 3300046526 Bacteria 4968
436 Ga0495642_0007735 3300046528 Bacteria 4118
437 Ga0495642_0032826 3300046528 Bacteria 2084
438 Ga0495652_0003089 3300046529 Bacteria 16662
439 Ga0495652_0034716 3300046529 Bacteria 4394
440 Ga0495654_0000244 3300046530 Bacteria 50838
441 Ga0495654_0000770 3300046530 Bacteria 24726
442 Ga0495654_0008768 3300046530 Bacteria 5565
443 Ga0495654_0022451 3300046530 Bacteria 3276
444 Ga0495654_0033179 3300046530 Bacteria 2614
445 Ga0495665_0000050 3300046531 Bacteria 47033
446 Ga0495665_0009851 3300046531 Bacteria 5172
447 Ga0495609_0000045 3300046538 Bacteria 159595
448 Ga0495609_0000125 3300046538 Bacteria 83190
449 Ga0495609_0000144 3300046538 Bacteria 74360
450 Ga0495609_0005126 3300046538 Bacteria 6977
451 Ga0495621_0031343 3300046539 Bacteria 1823
452 Ga0495597_0038052 3300046542 Bacteria 2158
453 Ga0495645_0003414 3300046543 Bacteria 10766
454 Ga0495645_0038879 3300046543 Bacteria 3470
455 Ga0495622_0000667 3300046557 Bacteria 19434
456 Ga0495633_0000139 3300046558 Bacteria 96799
457 Ga0495667_0018909 3300046559 Bacteria 4653
458 Ga0495667_0088426 3300046559 Bacteria 2008
459 Ga0495656_0000060 3300046615 Bacteria 52471
460 Ga0495656_0008750 3300046615 Bacteria 3624
461 Ga0495668_0007195 3300046616 Bacteria 7155
462 Ga0495668_0026059 3300046616 Bacteria 3319
463 Ga0495668_0033949 3300046616 Bacteria 2865
464 Ga0495668_0090047 3300046616 Bacteria 1681
465 Ga0495634_0054589 3300046642 Bacteria 2674
466 Ga0495611_0001065 3300046648 Bacteria 14497
467 Ga0495611_0014154 3300046648 Bacteria 3404
468 Ga0495611_0093651 3300046648 Bacteria 1390
469 Ga0495625_0000070 3300046660 Bacteria 167336
470 Ga0495625_0050474 3300046660 Bacteria 2985
471 Ga0495625_0183694 3300046660 Bacteria 1389
472 Ga0495635_0068701 3300046663 Bacteria 2430
473 Ga0495635_0123188 3300046663 Bacteria 1768
474 Ga0495661_0000042 3300046665 Bacteria 150599
475 Ga0495661_0000043 3300046665 Bacteria 149067
476 Ga0495661_0000155 3300046665 Bacteria 80777
477 Ga0495661_0001686 3300046665 Bacteria 17933
478 Ga0495661_0164211 3300046665 Bacteria 1189
479 Ga0495588_0034818 3300046674 Bacteria 2549
480 Ga0495599_0053403 3300046678 Bacteria 2531
481 Ga0495623_0000473 3300046679 Bacteria 26592
482 Ga0495623_0001311 3300046679 Bacteria 16923
483 Ga0495623_0009070 3300046679 Bacteria 6452
484 Ga0495646_0001063 3300046680 Bacteria 15918
485 Ga0495646_0002170 3300046680 Bacteria 11954
486 Ga0495646_0006353 3300046680 Bacteria 7494
487 Ga0495646_0102622 3300046680 Bacteria 1638
488 Ga0495669_0002291 3300046684 Bacteria 7854
489 Ga0495669_0044164 3300046684 Bacteria 1985
490 Ga0495613_0121396 3300046689 Bacteria 1876
491 Ga0495624_0001912 3300046690 Bacteria 15847
492 Ga0495624_0026074 3300046690 Bacteria 3832
493 Ga0495624_0040213 3300046690 Bacteria 2996
494 Ga0495624_0068383 3300046690 Bacteria 2214
495 Ga0495670_0036289 3300046691 Bacteria 2456
496 Ga0495671_0001615 3300046692 Bacteria 14823
497 Ga0495671_0032256 3300046692 Bacteria 2674
498 Ga0495649_0000013 3300046694 Bacteria 316013
499 Ga0495649_0061928 3300046694 Bacteria 2011
500 Ga0495649_0065551 3300046694 Bacteria 1949
501 Ga0495589_0015683 3300046794 Bacteria 3895
502 Ga0495589_0034570 3300046794 Bacteria 2536
503 Ga0495600_0005356 3300046809 Bacteria 7732
504 Ga0495600_0101608 3300046809 Bacteria 1874
505 Ga0495660_0025466 3300046810 Bacteria 3359
506 Ga0495660_0034832 3300046810 Bacteria 2815
507 Ga0495660_0070045 3300046810 Bacteria 1862
508 Ga0495660_0070683 3300046810 Bacteria 1852
509 Ga0495581_0026107 3300047315 Bacteria 3389
510 Ga0495604_0000557 3300047317 Bacteria 32763
511 Ga0495604_0007691 3300047317 Bacteria 8537
512 Ga0495604_0020189 3300047317 Bacteria 5324
513 Ga0495674_0000364 3300047319 Bacteria 40183
514 Ga0495674_0000942 3300047319 Bacteria 27786
515 Ga0495674_0073734 3300047319 Bacteria 2941
516 Ga0495674_0145902 3300047319 Bacteria 1987
517 Ga0495672_0000313 3300047320 Bacteria 64731
518 Ga0495672_0001604 3300047320 Bacteria 22065
519 Ga0495672_0006864 3300047320 Bacteria 8691
520 Ga0495672_0053461 3300047320 Bacteria 2366
521 Ga0495672_0090183 3300047320 Bacteria 1685
522 Ga0495676_0000019 3300047321 Bacteria 167261
523 Ga0495680_0007331 3300047322 Bacteria 10144
524 Ga0495683_0000020 3300047323 Bacteria 181773
525 Ga0495683_0002228 3300047323 Bacteria 11855
526 Ga0495683_0041174 3300047323 Bacteria 2332
527 Ga0495683_0064584 3300047323 Bacteria 1807
528 Ga0495687_000020 3300047443 Bacteria 337717
529 Ga0495687_003689 3300047443 Bacteria 10892
530 Ga0495687_076483 3300047443 Bacteria 1325
531 Ga0495687_080791 3300047443 Bacteria 1274
532 Ga0495675_0005135 3300047444 Bacteria 7963
533 Ga0495675_0022533 3300047444 Bacteria 4015
534 Ga0495675_0049658 3300047444 Bacteria 2666
535 Ga0495675_0092267 3300047444 Bacteria 1900
536 Ga0495677_0000311 3300047445 Bacteria 21147
537 Ga0495679_000800 3300047446 Bacteria 19965
538 Ga0495679_001430 3300047446 Bacteria 13572
539 Ga0495673_0003719 3300047469 Bacteria 9915
540 Ga0495673_0023486 3300047469 Bacteria 2998
541 Ga0495673_0063403 3300047469 Bacteria 1575
542 Ga0495673_0095829 3300047469 Bacteria 1206
543 Ga0495681_0002002 3300047470 Bacteria 14888
544 Ga0495681_0043095 3300047470 Bacteria 2179
545 Ga0495684_0073107 3300047471 Bacteria 2605
546 Ga0495686_0073388 3300047472 Bacteria 2102
547 Ga0495593_0011379 3300047673 Bacteria 5111
548 Ga0495602_0000269 3300048088 Bacteria 47834
549 Ga0495602_0012534 3300048088 Bacteria 8705
550 Ga0495602_0018465 3300048088 Bacteria 6963
551 Ga0495602_0087373 3300048088 Bacteria 2599
552 Ga0495615_0020377 3300048090 Bacteria 1485
553 Ga0495626_0000378 3300048091 Bacteria 46400
554 Ga0495626_0018729 3300048091 Bacteria 3469
555 Ga0495626_0050015 3300048091 Bacteria 1933
556 Ga0496100_0125745 3300048903 Bacteria 1799
557 Ga0496100_0165232 3300048903 Bacteria 1589
558 Ga0496101_0145847 3300048904 Bacteria 1807
559 Ga0496102_0005456 3300048905 Bacteria 10785
560 Ga0496102_0010607 3300048905 Bacteria 7937
561 Ga0496103_0002801 3300048906 Bacteria 10850
562 Ga0496103_0237289 3300048906 Bacteria 1173
563 Ga0496104_0054958 3300048907 Bacteria 3764
564 Ga0496104_0135025 3300048907 Bacteria 2370
565 Ga0496104_0192865 3300048907 Bacteria 1949
566 Ga0496105_0091100 3300048908 Bacteria 2518
567 Ga0496105_0189862 3300048908 Bacteria 1680
568 Ga0496105_0200256 3300048908 Bacteria 1630
569 Ga0496106_0008681 3300048909 Bacteria 7521
570 Ga0496106_0027797 3300048909 Bacteria 4212
571 Ga0496108_0326904 3300048911 Bacteria 1337
572 Ga0496110_0001089 3300048913 Bacteria 19134
573 Ga0496110_0005839 3300048913 Bacteria 9675
574 Ga0496110_0372092 3300048913 Bacteria 1302
575 Ga0496111_0039594 3300048914 Bacteria 3380
576 Ga0496112_0022401 3300048915 Bacteria 6021
577 Ga0496112_0149002 3300048915 Bacteria 2307
578 Ga0496113_0027996 3300048916 Bacteria 4047
579 Ga0496114_0000165 3300048917 Bacteria 47058
580 Ga0496115_0150435 3300048918 Bacteria 1922
581 Ga0496116_0002414 3300048919 Bacteria 19679
582 Ga0496116_0129401 3300048919 Bacteria 1442
583 Ga0496117_0000205 3300048920 Bacteria 116761
584 Ga0496117_0040175 3300048920 Bacteria 3445
585 Ga0496117_0073826 3300048920 Bacteria 2274
586 Ga0496117_0119710 3300048920 Bacteria 1620
587 Ga0496118_0012794 3300048921 Bacteria 8008
588 Ga0496118_0024517 3300048921 Bacteria 5202
589 Ga0496118_0085589 3300048921 Bacteria 2194
590 Ga0496119_0000198 3300048922 Bacteria 84746
591 Ga0496120_0010682 3300048923 Bacteria 6374
592 Ga0496120_0109994 3300048923 Bacteria 1441
593 Ga0496121_0003265 3300048924 Bacteria 23309
594 Ga0496121_0030122 3300048924 Bacteria 4992
595 Ga0496121_0036718 3300048924 Bacteria 4362
596 Ga0496121_0089764 3300048924 Bacteria 2404
597 Ga0496121_0123765 3300048924 Bacteria 1948
598 Ga0496122_0000156 3300048925 Bacteria 160178
599 Ga0496122_0022808 3300048925 Bacteria 5549
600 Ga0496123_0000087 3300048926 Bacteria 182994
601 Ga0496123_0036720 3300048926 Bacteria 3469
602 Ga0496123_0148870 3300048926 Bacteria 1266
603 Ga0496124_0000118 3300048927 Bacteria 164259
604 Ga0496124_0002944 3300048927 Bacteria 21404
605 Ga0496124_0006644 3300048927 Bacteria 12547
606 Ga0496124_0124236 3300048927 Bacteria 2058
607 Ga0496124_0129726 3300048927 Bacteria 2004
608 Ga0496124_0179283 3300048927 Bacteria 1632
609 Ga0496125_0003318 3300048928 Bacteria 19669
610 Ga0496125_0003880 3300048928 Bacteria 17674
611 Ga0496125_0004583 3300048928 Bacteria 15809
612 Ga0496125_0075694 3300048928 Bacteria 2603
613 Ga0496126_0328336 3300048929 Bacteria 1256
614 Ga0495678_000077 3300049459 Bacteria 125025
615 Ga0495678_000137 3300049459 Bacteria 87580
616 Ga0495678_006070 3300049459 Bacteria 6506
617 Ga0495678_075695 3300049459 Bacteria 1221
618 Ga0495682_0000040 3300049460 Bacteria 119566
619 Ga0495682_0000051 3300049460 Bacteria 109996
620 Ga0495682_0024099 3300049460 Bacteria 2270
621 Ga0495682_0035493 3300049460 Bacteria 1837
622 Ga0501032_0048223 3300049569 Bacteria 2876
623 Ga0501034_0001273 3300049571 Bacteria 34174
624 Ga0501036_0177742 3300049572 Bacteria 1792
625 Ga0501046_0035863 3300049580 Bacteria 3994
626 Ga0501047_0004562 3300049581 Bacteria 13024
627 Ga0501047_0007211 3300049581 Bacteria 10452
628 Ga0501067_0018338 3300049583 Bacteria 3877
629 Ga0501069_0036326 3300049585 Bacteria 2717
630 Ga0501070_0122613 3300049586 Bacteria 2148
631 Ga0501070_0181510 3300049586 Bacteria 1732
632 Ga0501073_0007640 3300049589 Bacteria 8024
633 Ga0501074_0095163 3300049590 Bacteria 2133
634 Ga0501076_0109472 3300049592 Bacteria 2233
635 Ga0501076_0110343 3300049592 Bacteria 2224
636 Ga0501257_009654 3300049686 Bacteria 2181
637 Ga0501079_0192956 3300049741 Bacteria 1590
638 Ga0501080_0018053 3300049742 Bacteria 6530
639 Ga0501083_0104666 3300049744 Bacteria 1864
640 Ga0501035_0144614 3300049822 Bacteria 2066
641 nmdc:mga00v17_301546_c1 3300050491 Bacteria 1041
642 nmdc:mga0k408_114327_c1 3300050493 Bacteria 1596
643 nmdc:mga07m45_105967_c1 3300050496 Bacteria 1617
644 nmdc:mga07m45_89663_c1 3300050496 Bacteria 1761
645 nmdc:mga07m45_966_c1 3300050496 Bacteria 4412
646 Ga0495601_0006243 3300053077 Bacteria 6958
647 Ga0495619_0046835 3300053085 Bacteria 2845
648 Ga0500651_0009119 3300053093 Bacteria 5877
649 Ga0500595_005009 3300053119 Bacteria 5836
650 Ga0500642_0005236 3300053130 Bacteria 4168
651 Ga0500588_0098574 3300053146 Bacteria 1004
652 Ga0500611_023523 3300053727 Bacteria 1201
653 Ga0500609_001135 3300053731 Bacteria 3962
654 Ga0501084_0030279 3300054114 Bacteria 4527
655 Ga0587072_000271 3300059643 Bacteria 4793
656 Ga0501082_0012918 3300060353 Bacteria 7179

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10254015 Ga0207681_102540153 242
2 3300046519 Ga0495632_0002802 Ga0495632_0002802_12031_12897 244
3 3300048091 Ga0495626_0018729 Ga0495626_0018729_2591_3457 244
4 3300049459 Ga0495678_075695 Ga0495678_075695_343_1209 244
5 3300049590 Ga0501074_0095163 Ga0501074_0095163_1126_2112 244
6 iso_pu_bacteria 8019659431 8019660913 245
7 3300025272 Ga0209455_1022539 Ga0209455_10225391 246
8 3300048921 Ga0496118_0012794 Ga0496118_0012794_5730_6731 246
9 3300048924 Ga0496121_0089764 Ga0496121_0089764_1257_2258 246
10 3300003752 Ga0055539_1000073 Ga0055539_100007391 247
11 3300003759 Ga0055525_1000383 Ga0055525_10003839 247
12 3300009093 Ga0105240_10170911 Ga0105240_101709112 249
13 iso_pu_bacteria 2922178524 2922178567 249
14 iso_pu_bacteria 2924754689 2924755883 249
15 3300025272 Ga0209455_1003534 Ga0209455_10035343 250
16 3300048908 Ga0496105_0200256 Ga0496105_0200256_29_1069 253
17 3300031852 Ga0307410_10302880 Ga0307410_103028802 254
18 3300049581 Ga0501047_0007211 Ga0501047_0007211_68_1090 256
19 3300049822 Ga0501035_0144614 Ga0501035_0144614_688_1710 256
20 3300003762 Ga0055542_1000928 Ga0055542_10009286 257
21 3300005327 Ga0070658_10073348 Ga0070658_100733482 257
22 3300005339 Ga0070660_100030766 Ga0070660_1000307662 257
23 3300005366 Ga0070659_100201703 Ga0070659_1002017032 257
24 3300005548 Ga0070665_100274804 Ga0070665_1002748042 257
25 3300006038 Ga0075365_10037339 Ga0075365_100373393 257
26 3300025254 Ga0209148_1001176 Ga0209148_10011762 257
27 3300025272 Ga0209455_1000161 Ga0209455_100016199 257
28 3300025909 Ga0207705_10067526 Ga0207705_100675262 257
29 3300025913 Ga0207695_10314452 Ga0207695_103144522 257
30 3300026041 Ga0207639_10115535 Ga0207639_101155352 257
31 3300026067 Ga0207678_10070213 Ga0207678_100702132 257
32 3300048923 Ga0496120_0109994 Ga0496120_0109994_206_1198 257
33 3300048927 Ga0496124_0179283 Ga0496124_0179283_393_1385 257
34 3300050496 nmdc:mga07m45_105967_c1 nmdc:mga07m45_105967_c1_118_1110 257
35 iso_pu_bacteria 2965110997 2965118234 257
36 3300006942 Ga0099824_1019296 Ga0099824_10192962 258
37 3300006943 Ga0099822_1004906 Ga0099822_100490617 258
38 3300027357 Ga0209589_1000042 Ga0209589_100004251 258
39 3300027361 Ga0209489_100095 Ga0209489_10009551 258
40 3300027363 Ga0209700_100095 Ga0209700_10009551 258
41 3300042013 Ga0439456_010692 Ga0439456_010692_16_924 258
42 3300001989 JGI24739J22299_10007978 JGI24739J22299_100079782 259
43 3300010375 Ga0105239_10203686 Ga0105239_102036862 259
44 3300013105 Ga0157369_10128831 Ga0157369_101288312 259
45 3300025297 Ga0209758_1025482 Ga0209758_10254822 259
46 3300025904 Ga0207647_10007459 Ga0207647_100074593 259
47 3300026078 Ga0207702_10169762 Ga0207702_101697622 259
48 3300026116 Ga0207674_10242360 Ga0207674_102423602 259
49 3300039447 Ga0436361_0734299 Ga0436361_0734299_454_1467 259
50 3300044658 Ga0466972_0021255 Ga0466972_0021255_1599_2597 259
51 3300044901 Ga0466960_0004840 Ga0466960_0004840_2497_3495 259
52 3300046460 Ga0495638_0105132 Ga0495638_0105132_194_1222 259
53 3300046616 Ga0495668_0033949 Ga0495668_0033949_1010_2008 259
54 3300053146 Ga0500588_0098574 Ga0500588_0098574_16_978 259
55 3300025253 Ga0209677_101172 Ga0209677_1011725 260
56 3300025297 Ga0209758_1003308 Ga0209758_10033087 260
57 3300031548 Ga0307408_100191534 Ga0307408_1001915342 260
58 3300048913 Ga0496110_0372092 Ga0496110_0372092_326_1285 260
59 3300014497 Ga0182008_10038132 Ga0182008_100381322 262
60 3300049586 Ga0501070_0122613 Ga0501070_0122613_931_1950 262
61 3300049592 Ga0501076_0109472 Ga0501076_0109472_831_1850 262
62 3300049741 Ga0501079_0192956 Ga0501079_0192956_366_1394 262
63 3300046501 Ga0495607_0012819 Ga0495607_0012819_1799_2791 265
64 3300046506 Ga0495583_0001046 Ga0495583_0001046_14350_15342 265
65 3300046518 Ga0495631_0026707 Ga0495631_0026707_549_1541 265
66 3300046519 Ga0495632_0003043 Ga0495632_0003043_2393_3385 265
67 3300046524 Ga0495648_0000218 Ga0495648_0000218_51379_52371 265
68 3300046530 Ga0495654_0022451 Ga0495654_0022451_39_1031 265
69 3300046616 Ga0495668_0026059 Ga0495668_0026059_1896_2888 265
70 3300046665 Ga0495661_0001686 Ga0495661_0001686_15847_16839 265
71 3300046692 Ga0495671_0001615 Ga0495671_0001615_9492_10484 265
72 3300047320 Ga0495672_0001604 Ga0495672_0001604_14591_15583 265
73 3300047472 Ga0495686_0073388 Ga0495686_0073388_633_1625 265
74 3300049459 Ga0495678_006070 Ga0495678_006070_974_1966 265
75 3300046462 Ga0495651_0118815 Ga0495651_0118815_776_1753 266
76 3300046477 Ga0495664_0164551 Ga0495664_0164551_368_1306 266
77 3300047319 Ga0495674_0073734 Ga0495674_0073734_1542_2480 266
78 3300047444 Ga0495675_0092267 Ga0495675_0092267_797_1774 266
79 3300048906 Ga0496103_0237289 Ga0496103_0237289_110_1048 266
80 3300050491 nmdc:mga00v17_301546_c1 nmdc:mga00v17_301546_c1_58_993 266
81 3300053085 Ga0495619_0046835 Ga0495619_0046835_1556_2533 266
82 3300013306 Ga0163162_10360388 Ga0163162_103603882 267
83 3300013308 Ga0157375_10002189 Ga0157375_1000218914 267
84 3300014497 Ga0182008_10001638 Ga0182008_1000163816 267
85 3300042006 Ga0439432_028798 Ga0439432_028798_688_1656 267
86 3300046453 Ga0495627_000263 Ga0495627_000263_9477_10445 267
87 3300046458 Ga0495591_000208 Ga0495591_000208_56615_57583 267
88 3300046463 Ga0495653_0261490 Ga0495653_0261490_151_1089 267
89 3300046507 Ga0495606_0005395 Ga0495606_0005395_7638_8606 267
90 3300046519 Ga0495632_0002787 Ga0495632_0002787_9812_10780 267
91 3300046520 Ga0495637_0000661 Ga0495637_0000661_20287_21279 267
92 3300046522 Ga0495643_0032144 Ga0495643_0032144_72_1007 267
93 3300046665 Ga0495661_0000043 Ga0495661_0000043_9103_10071 267
94 3300048920 Ga0496117_0000205 Ga0496117_0000205_110434_111402 267
95 3300048921 Ga0496118_0085589 Ga0496118_0085589_367_1335 267
96 3300048923 Ga0496120_0010682 Ga0496120_0010682_5305_6273 267
97 3300048927 Ga0496124_0006644 Ga0496124_0006644_3610_4578 267
98 3300048928 Ga0496125_0004583 Ga0496125_0004583_5302_6270 267
99 3300049459 Ga0495678_000137 Ga0495678_000137_67606_68598 267
100 3300049460 Ga0495682_0035493 Ga0495682_0035493_52_987 267
101 3300028794 Ga0307515_10066283 Ga0307515_100662833 268
102 3300053731 Ga0500609_001135 Ga0500609_001135_637_1665 268
103 3300005985 Ga0081539_10109005 Ga0081539_101090052 269
104 3300031616 Ga0307508_10125162 Ga0307508_101251622 269
105 3300046665 Ga0495661_0000155 Ga0495661_0000155_11847_12866 269
106 3300048919 Ga0496116_0129401 Ga0496116_0129401_66_1016 269
107 3300001979 JGI24740J21852_10000029 JGI24740J21852_100000293 270
108 3300002705 JGI25156J39149_1003309 JGI25156J39149_10033093 270
109 3300002738 JGI25154J39366_1000402 JGI25154J39366_100040210 270
110 3300003756 Ga0055533_1003352 Ga0055533_10033523 270
111 3300003841 Ga0055541_1000473 Ga0055541_100047310 270
112 3300005288 Ga0065714_10064853 Ga0065714_1006485316 270
113 3300005288 Ga0065714_10093650 Ga0065714_100936502 270
114 3300005290 Ga0065712_10072822 Ga0065712_100728224 270
115 3300005331 Ga0070670_100000079 Ga0070670_10000007930 270
116 3300005353 Ga0070669_100007493 Ga0070669_1000074937 270
117 3300005457 Ga0070662_100008560 Ga0070662_1000085606 270
118 3300009011 Ga0105251_10014955 Ga0105251_100149552 270
119 3300009092 Ga0105250_10000015 Ga0105250_1000001576 270
120 3300013100 Ga0157373_10000409 Ga0157373_1000040931 270
121 3300013100 Ga0157373_10000598 Ga0157373_1000059824 270
122 3300013100 Ga0157373_10014396 Ga0157373_100143962 270
123 3300013102 Ga0157371_10053913 Ga0157371_100539132 270
124 3300013104 Ga0157370_10135089 Ga0157370_101350892 270
125 3300013105 Ga0157369_10002773 Ga0157369_100027738 270
126 3300013105 Ga0157369_10285749 Ga0157369_102857492 270
127 3300013306 Ga0163162_10519859 Ga0163162_105198591 270
128 3300013306 Ga0163162_10718549 Ga0163162_107185491 270
129 3300015262 Ga0182007_10000379 Ga0182007_100003797 270
130 3300017792 Ga0163161_10018945 Ga0163161_100189455 270
131 3300017792 Ga0163161_10161357 Ga0163161_101613572 270
132 3300025224 Ga0209784_100303 Ga0209784_10030324 270
133 3300025225 Ga0209566_100129 Ga0209566_10012974 270
134 3300025226 Ga0209674_100195 Ga0209674_10019538 270
135 3300025230 Ga0209563_102007 Ga0209563_1020073 270
136 3300025246 Ga0209646_1000063 Ga0209646_1000063101 270
137 3300025250 Ga0209026_1003385 Ga0209026_10033855 270
138 3300025253 Ga0209677_104837 Ga0209677_1048374 270
139 3300025254 Ga0209148_1000019 Ga0209148_1000019552 270
140 3300025256 Ga0209759_1007655 Ga0209759_10076553 270
141 3300025711 Ga0207696_1000017 Ga0207696_100001738 270
142 3300025735 Ga0207713_1000774 Ga0207713_100077424 270
143 3300025735 Ga0207713_1014153 Ga0207713_10141532 270
144 3300025923 Ga0207681_10015979 Ga0207681_100159792 270
145 3300025925 Ga0207650_10001079 Ga0207650_1000107912 270
146 3300025933 Ga0207706_10013625 Ga0207706_100136256 270
147 3300026041 Ga0207639_10048044 Ga0207639_100480443 270
148 3300031731 Ga0307405_10000479 Ga0307405_100004792 270
149 3300046506 Ga0495583_0000086 Ga0495583_0000086_43498_44475 270
150 3300046530 Ga0495654_0000244 Ga0495654_0000244_41323_42300 270
151 3300049569 Ga0501032_0048223 Ga0501032_0048223_938_1966 270
152 3300049572 Ga0501036_0177742 Ga0501036_0177742_492_1520 270
153 3300049580 Ga0501046_0035863 Ga0501046_0035863_2656_3684 270
154 3300049581 Ga0501047_0004562 Ga0501047_0004562_7540_8568 270
155 3300049583 Ga0501067_0018338 Ga0501067_0018338_1857_2885 270
156 3300049585 Ga0501069_0036326 Ga0501069_0036326_349_1377 270
157 3300049586 Ga0501070_0181510 Ga0501070_0181510_369_1397 270
158 3300049589 Ga0501073_0007640 Ga0501073_0007640_4359_5387 270
159 3300049592 Ga0501076_0110343 Ga0501076_0110343_328_1356 270
160 3300049742 Ga0501080_0018053 Ga0501080_0018053_2832_3860 270
161 3300049744 Ga0501083_0104666 Ga0501083_0104666_492_1520 270
162 3300054114 Ga0501084_0030279 Ga0501084_0030279_2457_3485 270
163 3300060353 Ga0501082_0012918 Ga0501082_0012918_2834_3862 270
164 3300048928 Ga0496125_0003318 Ga0496125_0003318_1006_1986 271
165 3300048929 Ga0496126_0328336 Ga0496126_0328336_45_1043 271
166 3300001915 JGI24741J21665_1001854 JGI24741J21665_10018544 272
167 3300001979 JGI24740J21852_10001316 JGI24740J21852_100013168 272
168 3300002705 JGI25156J39149_1003693 JGI25156J39149_10036933 272
169 3300003751 Ga0055538_1000534 Ga0055538_10005348 272
170 3300003756 Ga0055533_1000561 Ga0055533_10005617 272
171 3300003841 Ga0055541_1000351 Ga0055541_100035110 272
172 3300005344 Ga0070661_100000141 Ga0070661_10000014150 272
173 3300005455 Ga0070663_100000034 Ga0070663_10000003411 272
174 3300005548 Ga0070665_100528649 Ga0070665_1005286491 272
175 3300005564 Ga0070664_100000057 Ga0070664_10000005712 272
176 3300005614 Ga0068856_100001920 Ga0068856_10000192010 272
177 3300005616 Ga0068852_100017539 Ga0068852_1000175393 272
178 3300013100 Ga0157373_10002881 Ga0157373_100028813 272
179 3300013102 Ga0157371_10000323 Ga0157371_100003234 272
180 3300013104 Ga0157370_10000038 Ga0157370_100000383 272
181 3300013307 Ga0157372_10013616 Ga0157372_100136164 272
182 3300025224 Ga0209784_100006 Ga0209784_100006151 272
183 3300025225 Ga0209566_100002 Ga0209566_100002151 272
184 3300025226 Ga0209674_100097 Ga0209674_100097151 272
185 3300025230 Ga0209563_100041 Ga0209563_100041321 272
186 3300025253 Ga0209677_100007 Ga0209677_100007151 272
187 3300025256 Ga0209759_1000819 Ga0209759_100081922 272
188 3300025920 Ga0207649_10000111 Ga0207649_1000011111 272
189 3300025945 Ga0207679_10000105 Ga0207679_1000010555 272
190 3300026067 Ga0207678_10000106 Ga0207678_1000010611 272
191 3300026078 Ga0207702_10000135 Ga0207702_1000013533 272
192 3300037312 Ga0395899_0115027 Ga0395899_0115027_175_1209 272
193 3300046515 Ga0495620_0000061 Ga0495620_0000061_19543_20544 272
194 3300046538 Ga0495609_0000144 Ga0495609_0000144_66980_67981 272
195 3300048928 Ga0496125_0003880 Ga0496125_0003880_15129_16163 272
196 3300059643 Ga0587072_000271 Ga0587072_000271_2973_4007 272
197 iso_pu_bacteria 2838029111 2838032913 272
198 iso_pu_bacteria 2842475841 2842479646 272
199 iso_pu_bacteria 2842502639 2842506689 272
200 3300039453 Ga0436362_0478089 Ga0436362_0478089_72_1082 273
201 3300041407 Ga0439447_018421 Ga0439447_018421_817_1827 273
202 iso_pu_bacteria 2643221689 2644500963 273
203 3300005344 Ga0070661_100001004 Ga0070661_10000100417 274
204 3300005564 Ga0070664_100001292 Ga0070664_1000012925 274
205 3300009036 Ga0105244_10001369 Ga0105244_100013695 274
206 3300009176 Ga0105242_10001326 Ga0105242_100013264 274
207 3300009545 Ga0105237_10000937 Ga0105237_1000093717 274
208 3300011119 Ga0105246_10024013 Ga0105246_100240134 274
209 3300013100 Ga0157373_10013153 Ga0157373_100131532 274
210 3300013105 Ga0157369_10003376 Ga0157369_1000337617 274
211 3300015261 Ga0182006_1000099 Ga0182006_100009934 274
212 3300025728 Ga0207655_1000070 Ga0207655_1000070158 274
213 3300025914 Ga0207671_10001472 Ga0207671_100014724 274
214 3300025920 Ga0207649_10004380 Ga0207649_100043805 274
215 3300025934 Ga0207686_10046851 Ga0207686_100468512 274
216 3300025945 Ga0207679_10000818 Ga0207679_100008185 274
217 3300031344 Ga0265316_10232510 Ga0265316_102325102 274
218 iso_pu_bacteria 2945961074 2945963498 274
219 3300033180 Ga0307510_10151481 Ga0307510_101514812 275
220 3300042016 Ga0439463_000532 Ga0439463_000532_1836_2828 275
221 3300046458 Ga0495591_000130 Ga0495591_000130_42643_43635 275
222 3300046471 Ga0495650_0000617 Ga0495650_0000617_7826_8818 275
223 3300046474 Ga0495605_0000066 Ga0495605_0000066_132119_133111 275
224 3300046474 Ga0495605_0000310 Ga0495605_0000310_9236_10228 275
225 3300046474 Ga0495605_0002052 Ga0495605_0002052_9304_10296 275
226 3300046501 Ga0495607_0000858 Ga0495607_0000858_17220_18212 275
227 3300046501 Ga0495607_0003325 Ga0495607_0003325_11245_12237 275
228 3300046501 Ga0495607_0006938 Ga0495607_0006938_1479_2471 275
229 3300046501 Ga0495607_0068773 Ga0495607_0068773_554_1546 275
230 3300046506 Ga0495583_0000312 Ga0495583_0000312_56596_57588 275
231 3300046506 Ga0495583_0001170 Ga0495583_0001170_16725_17717 275
232 3300046506 Ga0495583_0006932 Ga0495583_0006932_117_1109 275
233 3300046507 Ga0495606_0000274 Ga0495606_0000274_25667_26659 275
234 3300046507 Ga0495606_0022702 Ga0495606_0022702_402_1394 275
235 3300046515 Ga0495620_0000962 Ga0495620_0000962_83_1075 275
236 3300046515 Ga0495620_0021769 Ga0495620_0021769_470_1462 275
237 3300046520 Ga0495637_0000043 Ga0495637_0000043_18174_19166 275
238 3300046522 Ga0495643_0020381 Ga0495643_0020381_1382_2374 275
239 3300046523 Ga0495644_0019462 Ga0495644_0019462_313_1305 275
240 3300046538 Ga0495609_0000045 Ga0495609_0000045_117115_118107 275
241 3300046538 Ga0495609_0000125 Ga0495609_0000125_51374_52366 275
242 3300046648 Ga0495611_0001065 Ga0495611_0001065_1477_2562 275
243 3300046660 Ga0495625_0000070 Ga0495625_0000070_99947_100939 275
244 3300046665 Ga0495661_0000042 Ga0495661_0000042_56984_57976 275
245 3300046694 Ga0495649_0061928 Ga0495649_0061928_706_1698 275
246 3300046810 Ga0495660_0025466 Ga0495660_0025466_1530_2522 275
247 3300047320 Ga0495672_0090183 Ga0495672_0090183_408_1400 275
248 3300047321 Ga0495676_0000019 Ga0495676_0000019_93261_94253 275
249 3300047446 Ga0495679_001430 Ga0495679_001430_3557_4549 275
250 3300047469 Ga0495673_0003719 Ga0495673_0003719_4106_5098 275
251 3300047469 Ga0495673_0023486 Ga0495673_0023486_1131_2123 275
252 3300047469 Ga0495673_0095829 Ga0495673_0095829_120_1112 275
253 3300047470 Ga0495681_0002002 Ga0495681_0002002_10134_11126 275
254 3300048091 Ga0495626_0000378 Ga0495626_0000378_4065_5057 275
255 3300048920 Ga0496117_0073826 Ga0496117_0073826_218_1210 275
256 3300048924 Ga0496121_0030122 Ga0496121_0030122_122_1114 275
257 3300048926 Ga0496123_0148870 Ga0496123_0148870_97_1089 275
258 3300048927 Ga0496124_0000118 Ga0496124_0000118_122908_123900 275
259 3300048927 Ga0496124_0002944 Ga0496124_0002944_3869_4861 275
260 3300048927 Ga0496124_0124236 Ga0496124_0124236_110_1102 275
261 3300049460 Ga0495682_0000051 Ga0495682_0000051_97174_98166 275
262 iso_pu_bacteria 2582581294 2585203268 275
263 iso_pu_bacteria 2643221634 2644192501 275
264 iso_pu_bacteria 2738541293 2738801680 275
265 iso_pu_bacteria 2891048133 2891048514 275
266 iso_pu_bacteria 2919100787 2919104817 275
267 iso_pu_bacteria 2923556063 2923561874 275
268 iso_pu_bacteria 2928521798 2928526044 275
269 iso_pu_bacteria 2954011201 2954011863 275
270 iso_pu_bacteria 2989771324 2989775554 275
271 iso_pu_bacteria 2995392953 2995396759 275
272 iso_pu_bacteria 3000405567 3000407059 275
273 iso_pu_bacteria 3003930520 3003935401 275
274 iso_pu_bacteria 3005409236 3005410051 275
275 iso_pu_bacteria 3005452660 3005457439 275
276 3300005339 Ga0070660_100000087 Ga0070660_10000008744 276
277 3300005366 Ga0070659_100000211 Ga0070659_10000021137 276
278 3300005455 Ga0070663_100002551 Ga0070663_1000025514 276
279 3300009092 Ga0105250_10039918 Ga0105250_100399182 276
280 3300009093 Ga0105240_10019894 Ga0105240_100198943 276
281 3300009551 Ga0105238_10006248 Ga0105238_1000624810 276
282 3300010375 Ga0105239_10011798 Ga0105239_100117986 276
283 3300013100 Ga0157373_10135579 Ga0157373_101355792 276
284 3300015265 Ga0182005_1002583 Ga0182005_10025834 276
285 3300025297 Ga0209758_1000048 Ga0209758_1000048117 276
286 3300025711 Ga0207696_1021938 Ga0207696_10219382 276
287 3300025904 Ga0207647_10003229 Ga0207647_100032298 276
288 3300025913 Ga0207695_10239111 Ga0207695_102391112 276
289 3300025919 Ga0207657_10000078 Ga0207657_100000784 276
290 3300025924 Ga0207694_10018442 Ga0207694_100184423 276
291 3300025932 Ga0207690_10000026 Ga0207690_100000268 276
292 3300026067 Ga0207678_10006717 Ga0207678_100067174 276
293 3300026142 Ga0207698_10044384 Ga0207698_100443842 276
294 3300028380 Ga0268265_10018107 Ga0268265_100181074 276
295 3300038705 Ga0237819_04710 Ga0237819_04710_413_1408 276
296 3300048920 Ga0496117_0119710 Ga0496117_0119710_403_1440 276
297 3300048924 Ga0496121_0123765 Ga0496121_0123765_587_1624 276
298 3300050493 nmdc:mga0k408_114327_c1 nmdc:mga0k408_114327_c1_152_1222 276
299 3300053093 Ga0500651_0009119 Ga0500651_0009119_3612_4640 276
300 3300053119 Ga0500595_005009 Ga0500595_005009_1144_2172 276
301 3300053130 Ga0500642_0005236 Ga0500642_0005236_1475_2503 276
302 3300053727 Ga0500611_023523 Ga0500611_023523_76_1104 276
303 3300003162 Ga0006778J45830_1018533 Ga0006778J45830_10185332 277
304 3300003574 Ga0007410J51695_1003197 Ga0007410J51695_10031973 277
305 3300006195 Ga0075366_10096513 Ga0075366_100965132 277
306 3300006353 Ga0075370_10001724 Ga0075370_100017242 277
307 3300025298 Ga0209050_1005781 Ga0209050_10057812 277
308 3300025304 Ga0209257_1000334 Ga0209257_100033475 277
309 3300029285 Ga0310981_1009967 Ga0310981_10099672 277
310 3300031456 Ga0307513_10041773 Ga0307513_100417732 277
311 3300041407 Ga0439447_034028 Ga0439447_034028_103_1152 277
312 3300050496 nmdc:mga07m45_966_c1 nmdc:mga07m45_966_c1_2657_3727 277
313 iso_pu_bacteria 2599185167 2599398301 277
314 iso_pu_bacteria 2599185179 2599450313 277
315 iso_pu_bacteria 2599185190 2599512805 277
316 iso_pu_bacteria 2599185191 2599521259 277
317 iso_pu_bacteria 2599185288 2599881384 277
318 iso_pu_bacteria 2599185290 2599891481 277
319 iso_pu_bacteria 2599185303 2599946586 277
320 iso_pu_bacteria 2675903420 2677896628 277
321 iso_pu_bacteria 2738541294 2738806900 277
322 iso_pu_bacteria 2738541309 2738894260 277
323 iso_pu_bacteria 2808606385 2808979723 277
324 iso_pu_bacteria 2808606388 2808995443 277
325 iso_pu_bacteria 2821443989 2821444556 277
326 iso_pu_bacteria 2831426010 2831429726 277
327 iso_pu_bacteria 2834028612 2834029883 277
328 iso_pu_bacteria 2848694841 2848697770 277
329 iso_pu_bacteria 2849660919 2849667308 277
330 iso_pu_bacteria 2852612431 2852614510 277
331 iso_pu_bacteria 2852667396 2852667752 277
332 iso_pu_bacteria 2886627955 2886632907 277
333 iso_pu_bacteria 2909042592 2909044838 277
334 iso_pu_bacteria 2931390751 2931394033 277
335 iso_pu_bacteria 2945928738 2945933431 277
336 iso_pu_bacteria 2946006987 2946009820 277
337 iso_pu_bacteria 8054002106 8054006643 277
338 iso_pu_bacteria 8054285046 8054291251 277
339 iso_pu_bacteria 8054503363 8054506325 277
340 iso_pu_bacteria 8055817908 8055821059 277
341 iso_pu_bacteria 8056161164 8056166041 277
342 3300001989 JGI24739J22299_10046749 JGI24739J22299_100467491 278
343 3300003758 Ga0055532_1000564 Ga0055532_10005644 278
344 3300003758 Ga0055532_1004378 Ga0055532_10043782 278
345 3300003758 Ga0055532_1004404 Ga0055532_10044042 278
346 3300003760 Ga0055527_1000549 Ga0055527_100054912 278
347 3300003761 Ga0055535_1007205 Ga0055535_10072052 278
348 3300003761 Ga0055535_1007260 Ga0055535_10072602 278
349 3300003762 Ga0055542_1007757 Ga0055542_10077572 278
350 3300003762 Ga0055542_1007805 Ga0055542_10078052 278
351 3300003763 Ga0055529_1000447 Ga0055529_100044737 278
352 3300003763 Ga0055529_1006454 Ga0055529_10064542 278
353 3300003790 Ga0055528_1002503 Ga0055528_10025037 278
354 3300006028 Ga0070717_10403811 Ga0070717_104038112 278
355 3300009011 Ga0105251_10004723 Ga0105251_100047238 278
356 3300009093 Ga0105240_10001380 Ga0105240_1000138034 278
357 3300025225 Ga0209566_100665 Ga0209566_10066511 278
358 3300025228 Ga0209672_100037 Ga0209672_10003784 278
359 3300025228 Ga0209672_100102 Ga0209672_10010264 278
360 3300025229 Ga0209147_100049 Ga0209147_10004969 278
361 3300025229 Ga0209147_100071 Ga0209147_10007137 278
362 3300025229 Ga0209147_100284 Ga0209147_10028434 278
363 3300025242 Ga0209258_100066 Ga0209258_10006684 278
364 3300025242 Ga0209258_100082 Ga0209258_100082171 278
365 3300025254 Ga0209148_1000168 Ga0209148_100016877 278
366 3300025254 Ga0209148_1003323 Ga0209148_10033232 278
367 3300025256 Ga0209759_1002792 Ga0209759_10027923 278
368 3300025272 Ga0209455_1000141 Ga0209455_100014177 278
369 3300025272 Ga0209455_1001584 Ga0209455_10015849 278
370 3300025273 Ga0209673_1000184 Ga0209673_100018450 278
371 3300025295 Ga0209564_1013075 Ga0209564_10130753 278
372 3300025913 Ga0207695_10001136 Ga0207695_1000113634 278
373 3300025913 Ga0207695_10001137 Ga0207695_1000113734 278
374 3300027312 Ga0209371_1000488 Ga0209371_100048849 278
375 3300030500 Ga0268256_1003581 Ga0268256_10035812 278
376 3300035111 Ga0373923_0101801 Ga0373923_0101801_30_1028 278
377 3300036401 Ga0373937_0047181 Ga0373937_0047181_1226_2224 278
378 3300039437 Ga0436365_1255399 Ga0436365_1255399_1074_2111 278
379 3300042007 Ga0439449_0001069 Ga0439449_0001069_7125_8132 278
380 3300044683 Ga0466965_0078061 Ga0466965_0078061_295_1332 278
381 3300044842 Ga0466957_0140688 Ga0466957_0140688_330_1367 278
382 3300046453 Ga0495627_020422 Ga0495627_020422_39_1058 278
383 3300046458 Ga0495591_018643 Ga0495591_018643_233_1252 278
384 3300046474 Ga0495605_0000060 Ga0495605_0000060_14010_15029 278
385 3300046506 Ga0495583_0000282 Ga0495583_0000282_67030_68049 278
386 3300046512 Ga0495610_0052406 Ga0495610_0052406_117_1136 278
387 3300046524 Ga0495648_0005363 Ga0495648_0005363_4245_5264 278
388 3300046530 Ga0495654_0008768 Ga0495654_0008768_616_1635 278
389 3300046558 Ga0495633_0000139 Ga0495633_0000139_21874_22893 278
390 3300046810 Ga0495660_0034832 Ga0495660_0034832_84_1103 278
391 3300047323 Ga0495683_0000020 Ga0495683_0000020_130776_131795 278
392 3300047446 Ga0495679_000800 Ga0495679_000800_14015_15034 278
393 3300048926 Ga0496123_0036720 Ga0496123_0036720_1630_2628 278
394 3300049459 Ga0495678_000077 Ga0495678_000077_104504_105523 278
395 iso_pu_bacteria 2512875016 2512933056 278
396 iso_pu_bacteria 2588253730 2588519103 278
397 iso_pu_bacteria 2617270889 2617916026 278
398 iso_pu_bacteria 2818991436 2819542614 278
399 iso_pu_bacteria 2876363079 2876364696 278
400 iso_pu_bacteria 2885312484 2885313144 278
401 iso_pu_bacteria 2903448605 2903449315 278
402 iso_pu_bacteria 2903521522 2903522568 278
403 iso_pu_bacteria 2903528002 2903528947 278
404 iso_pu_bacteria 2913844669 2913850212 278
405 iso_pu_bacteria 2913912277 2913914680 278
406 iso_pu_bacteria 2913939268 2913944116 278
407 iso_pu_bacteria 2937848649 2937855489 278
408 iso_pu_bacteria 2963644680 2963646152 278
409 iso_pu_bacteria 2968083720 2968085378 278
410 iso_pu_bacteria 2977922695 2977928804 278
411 iso_pu_bacteria 2977986579 2977987639 278
412 iso_pu_bacteria 3004211236 3004211448 278
413 iso_pu_bacteria 3004218560 3004225003 278
414 iso_pu_bacteria 3004334049 3004336260 278
415 iso_pu_bacteria 637000159 637076135 278
416 iso_pu_bacteria 641228493 641336578 278
417 iso_pu_bacteria 642555144 642604259 278
418 iso_pu_bacteria 643348555 643390371 278
419 3300005347 Ga0070668_100099598 Ga0070668_1000995982 279
420 3300005467 Ga0070706_100093931 Ga0070706_1000939312 279
421 3300005471 Ga0070698_100064473 Ga0070698_1000644732 279
422 3300025910 Ga0207684_10005922 Ga0207684_100059228 279
423 iso_pu_bacteria 2508501128 2509151679 279
424 iso_pu_bacteria 2643221637 2644210769 279
425 iso_pu_bacteria 2643221718 2644654303 279
426 iso_pu_bacteria 2860867994 2860870559 279
427 iso_pu_bacteria 2885192300 2885196253 279
428 iso_pu_bacteria 2932401849 2932405632 279
429 iso_pu_bacteria 2946027586 2946030982 279
430 3300003187 JGI25151J46595_10001875 JGI25151J46595_1000187511 280
431 3300025258 Ga0209129_1000016 Ga0209129_1000016150 280
432 3300025294 Ga0209025_1000338 Ga0209025_100033837 280
433 3300032005 Ga0307411_10065341 Ga0307411_100653412 280
434 3300041405 Ga0439438_010381 Ga0439438_010381_455_1465 280
435 3300041406 Ga0439439_0001544 Ga0439439_0001544_1128_2138 280
436 3300042006 Ga0439432_019836 Ga0439432_019836_828_1838 280
437 3300042145 Ga0450906_004068 Ga0450906_004068_1647_2657 280
438 3300042184 Ga0450908_004697 Ga0450908_004697_63_1073 280
439 3300042435 Ga0439434_0005521 Ga0439434_0005521_707_1717 280
440 3300049686 Ga0501257_009654 Ga0501257_009654_857_1861 280
441 iso_pu_bacteria 2508501123 2509115263 280
442 iso_pu_bacteria 2508501127 2509142482 280
443 iso_pu_bacteria 2509276018 2509370995 280
444 iso_pu_bacteria 2512875024 2512961101 280
445 iso_pu_bacteria 2597489875 2597811098 280
446 iso_pu_bacteria 2643221595 2643988153 280
447 iso_pu_bacteria 2643221627 2644155111 280
448 iso_pu_bacteria 2687453392 2688596803 280
449 iso_pu_bacteria 2756170246 2756677334 280
450 iso_pu_bacteria 2791355197 2793072869 280
451 iso_pu_bacteria 2841734538 2841737450 280
452 iso_pu_bacteria 2844002411 2844009242 280
453 iso_pu_bacteria 2844009547 2844012062 280
454 iso_pu_bacteria 2847670302 2847673122 280
455 iso_pu_bacteria 2856314179 2856319845 280
456 iso_pu_bacteria 2856320880 2856322632 280
457 iso_pu_bacteria 2856328259 2856328897 280
458 iso_pu_bacteria 2856334872 2856340449 280
459 iso_pu_bacteria 2856342000 2856342347 280
460 iso_pu_bacteria 2857367948 2857370511 280
461 iso_pu_bacteria 2869169390 2869171635 280
462 iso_pu_bacteria 2869234852 2869239540 280
463 iso_pu_bacteria 2869242130 2869244710 280
464 iso_pu_bacteria 2869249662 2869252308 280
465 iso_pu_bacteria 2869256925 2869258988 280
466 iso_pu_bacteria 2869264136 2869268618 280
467 iso_pu_bacteria 2869271264 2869275555 280
468 iso_pu_bacteria 2869278585 2869285851 280
469 iso_pu_bacteria 2871435913 2871441810 280
470 iso_pu_bacteria 2871451962 2871452647 280
471 iso_pu_bacteria 2871459585 2871465807 280
472 iso_pu_bacteria 2871466892 2871473945 280
473 iso_pu_bacteria 2871474448 2871474453 280
474 iso_pu_bacteria 2874109183 2874110684 280
475 iso_pu_bacteria 2874116593 2874118048 280
476 iso_pu_bacteria 2874131515 2874134504 280
477 iso_pu_bacteria 2874139085 2874141837 280
478 iso_pu_bacteria 2874162495 2874167557 280
479 iso_pu_bacteria 2876386047 2876389678 280
480 iso_pu_bacteria 2876399893 2876401317 280
481 iso_pu_bacteria 2876406927 2876407712 280
482 iso_pu_bacteria 2878035449 2878035726 280
483 iso_pu_bacteria 2878730984 2878732273 280
484 iso_pu_bacteria 2878738818 2878739425 280
485 iso_pu_bacteria 2878774303 2878775949 280
486 iso_pu_bacteria 2878781027 2878788715 280
487 iso_pu_bacteria 2881147464 2881147847 280
488 iso_pu_bacteria 2885374607 2885382887 280
489 iso_pu_bacteria 2888337043 2888337916 280
490 iso_pu_bacteria 2888343758 2888345364 280
491 iso_pu_bacteria 2888350351 2888352729 280
492 iso_pu_bacteria 2889010040 2889014500 280
493 iso_pu_bacteria 2889016732 2889020514 280
494 iso_pu_bacteria 2903513507 2903519178 280
495 iso_pu_bacteria 2906354277 2906359637 280
496 iso_pu_bacteria 2906363423 2906364976 280
497 iso_pu_bacteria 2906370794 2906372959 280
498 iso_pu_bacteria 2906378014 2906383254 280
499 iso_pu_bacteria 2906386501 2906393476 280
500 iso_pu_bacteria 2906393657 2906394656 280
501 iso_pu_bacteria 2906401398 2906405609 280
502 iso_pu_bacteria 2906408224 2906413509 280
503 iso_pu_bacteria 2906414383 2906420621 280
504 iso_pu_bacteria 2906427513 2906433338 280
505 iso_pu_bacteria 2908739725 2908745883 280
506 iso_pu_bacteria 2922130491 2922137542 280
507 iso_pu_bacteria 2922151315 2922157552 280
508 iso_pu_bacteria 2922172374 2922177661 280
509 iso_pu_bacteria 2922185730 2922186457 280
510 iso_pu_bacteria 2924718760 2924722030 280
511 iso_pu_bacteria 2924733363 2924736309 280
512 iso_pu_bacteria 2924741084 2924744495 280
513 iso_pu_bacteria 2924748358 2924750326 280
514 iso_pu_bacteria 2924776078 2924776946 280
515 iso_pu_bacteria 2935630451 2935630624 280
516 iso_pu_bacteria 2937836603 2937840320 280
517 iso_pu_bacteria 2937861824 2937868670 280
518 iso_pu_bacteria 2937868953 2937873351 280
519 iso_pu_bacteria 2937877337 2937883454 280
520 iso_pu_bacteria 2937972304 2937973566 280
521 iso_pu_bacteria 2937980651 2937986759 280
522 iso_pu_bacteria 2941507105 2941507276 280
523 iso_pu_bacteria 2941515067 2941515703 280
524 iso_pu_bacteria 2941523033 2941523589 280
525 iso_pu_bacteria 2958034702 2958041867 280
526 iso_pu_bacteria 2958041894 2958050398 280
527 iso_pu_bacteria 2958071322 2958071529 280
528 iso_pu_bacteria 2958084443 2958090621 280
529 iso_pu_bacteria 2958122699 2958128200 280
530 iso_pu_bacteria 2958137437 2958141130 280
531 iso_pu_bacteria 2958144490 2958147081 280
532 iso_pu_bacteria 2958158011 2958159457 280
533 iso_pu_bacteria 2958172287 2958177423 280
534 iso_pu_bacteria 2961136820 2961140208 280
535 iso_pu_bacteria 2965025482 2965025629 280
536 iso_pu_bacteria 2965032056 2965032502 280
537 iso_pu_bacteria 2965040258 2965044021 280
538 iso_pu_bacteria 2965047637 2965055215 280
539 iso_pu_bacteria 2965089291 2965092043 280
540 iso_pu_bacteria 2965102966 2965104727 280
541 iso_pu_bacteria 2965119406 2965121593 280
542 iso_pu_bacteria 2968016561 2968016635 280
543 iso_pu_bacteria 2970469710 2970469977 280
544 iso_pu_bacteria 2970489779 2970492658 280
545 iso_pu_bacteria 2970510686 2970517346 280
546 iso_pu_bacteria 2970524798 2970527079 280
547 iso_pu_bacteria 2970532167 2970532937 280
548 iso_pu_bacteria 2970540015 2970546535 280
549 iso_pu_bacteria 2970547951 2970552964 280
550 iso_pu_bacteria 2970593180 2970600468 280
551 iso_pu_bacteria 2970619444 2970622851 280
552 iso_pu_bacteria 2970627176 2970633379 280
553 iso_pu_bacteria 2977851361 2977854080 280
554 iso_pu_bacteria 2977872689 2977873335 280
555 iso_pu_bacteria 2977898635 2977903090 280
556 iso_pu_bacteria 2977907340 2977909373 280
557 iso_pu_bacteria 2977915119 2977921330 280
558 iso_pu_bacteria 2977935797 2977935969 280
559 iso_pu_bacteria 2977950692 2977952193 280
560 iso_pu_bacteria 2977971508 2977976966 280
561 iso_pu_bacteria 2979710463 2979717203 280
562 iso_pu_bacteria 2979764755 2979771026 280
563 iso_pu_bacteria 2979772303 2979777071 280
564 iso_pu_bacteria 2979793036 2979796062 280
565 iso_pu_bacteria 2987645492 2987650049 280
566 iso_pu_bacteria 2987652177 2987659195 280
567 iso_pu_bacteria 2987673487 2987675599 280
568 iso_pu_bacteria 2996348954 2996353092 280
569 iso_pu_bacteria 2996386984 2996389711 280
570 iso_pu_bacteria 3004167301 3004174191 280
571 iso_pu_bacteria 3004195979 3004202087 280
572 iso_pu_bacteria 3004239961 3004240491 280
573 iso_pu_bacteria 3004268573 3004270627 280
574 iso_pu_bacteria 3004275668 3004279774 280
575 iso_pu_bacteria 3004289098 3004293475 280
576 iso_pu_bacteria 649633066 649871357 280
577 iso_pu_bacteria 8004300914 8004302084 280
578 iso_pu_bacteria 8004312739 8004316346 280
579 iso_pu_bacteria 8004361976 8004363734 280
580 iso_pu_bacteria 8004395343 8004403501 280
581 iso_pu_bacteria 8004633249 8004639471 280
582 iso_pu_bacteria 8004640170 8004644328 280
583 iso_pu_bacteria 8004695233 8004701784 280
584 iso_pu_bacteria 8055617313 8055619168 280
585 iso_pu_bacteria 8056131705 8056134765 280
586 3300006353 Ga0075370_10144737 Ga0075370_101447371 281
587 3300009036 Ga0105244_10001610 Ga0105244_100016107 281
588 3300013308 Ga0157375_10000100 Ga0157375_1000010013 281
589 3300025940 Ga0207691_10069105 Ga0207691_100691052 281
590 3300041997 Ga0439431_0021573 Ga0439431_0021573_420_1433 281
591 3300042004 Ga0439445_0007986 Ga0439445_0007986_391_1404 281
592 3300042006 Ga0439432_005525 Ga0439432_005525_369_1382 281
593 3300042007 Ga0439449_0029879 Ga0439449_0029879_932_1945 281
594 3300042010 Ga0439452_002617 Ga0439452_002617_1006_2019 281
595 3300046539 Ga0495621_0031343 Ga0495621_0031343_758_1771 281
596 3300046615 Ga0495656_0000060 Ga0495656_0000060_34706_35719 281
597 3300046691 Ga0495670_0036289 Ga0495670_0036289_579_1592 281
598 3300048090 Ga0495615_0020377 Ga0495615_0020377_330_1343 281
599 3300048907 Ga0496104_0054958 Ga0496104_0054958_1161_2141 281
600 3300048915 Ga0496112_0022401 Ga0496112_0022401_3734_4771 281
601 3300048916 Ga0496113_0027996 Ga0496113_0027996_2277_3314 281
602 3300048922 Ga0496119_0000198 Ga0496119_0000198_55811_56848 281
603 3300050496 nmdc:mga07m45_89663_c1 nmdc:mga07m45_89663_c1_245_1288 281
604 iso_pu_bacteria 2508501125 2509128588 281
605 iso_pu_bacteria 2619619299 2621299653 281
606 iso_pu_bacteria 2738541265 2738669653 281
607 iso_pu_bacteria 2738541282 2738748046 281
608 iso_pu_bacteria 2738541303 2738857088 281
609 iso_pu_bacteria 2808606384 2808968009 281
610 iso_pu_bacteria 2808606390 2809002840 281
611 iso_pu_bacteria 2808606391 2809010118 281
612 iso_pu_bacteria 2816332298 2817491005 281
613 iso_pu_bacteria 2842333319 2842337354 281
614 iso_pu_bacteria 2869162929 2869168209 281
615 iso_pu_bacteria 2874123672 2874127115 281
616 iso_pu_bacteria 2876369609 2876374700 281
617 3300002737 JGI25162J39368_1000036 JGI25162J39368_100003628 282
618 3300002771 JGI25163J39215_1001653 JGI25163J39215_10016532 282
619 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022330 282
620 3300003751 Ga0055538_1000011 Ga0055538_100001127 282
621 3300003752 Ga0055539_1000016 Ga0055539_1000016330 282
622 3300003756 Ga0055533_1000019 Ga0055533_1000019330 282
623 3300003759 Ga0055525_1000042 Ga0055525_100004228 282
624 3300003841 Ga0055541_1000017 Ga0055541_1000017265 282
625 3300015265 Ga0182005_1001696 Ga0182005_10016964 282
626 3300015683 Ga0183362_10001 Ga0183362_100011974 282
627 3300025207 Ga0209760_100730 Ga0209760_1007303 282
628 3300025224 Ga0209784_100019 Ga0209784_100019407 282
629 3300025225 Ga0209566_100017 Ga0209566_100017407 282
630 3300025226 Ga0209674_100031 Ga0209674_100031407 282
631 3300025230 Ga0209563_100035 Ga0209563_100035407 282
632 3300025231 Ga0207427_100206 Ga0207427_10020638 282
633 3300025233 Ga0209437_100038 Ga0209437_100038407 282
634 3300025253 Ga0209677_100020 Ga0209677_100020407 282
635 3300025261 Ga0209233_1000049 Ga0209233_1000049407 282
636 3300046454 Ga0495592_0034404 Ga0495592_0034404_1633_2649 282
637 3300046463 Ga0495653_0038718 Ga0495653_0038718_1016_2032 282
638 3300046463 Ga0495653_0184809 Ga0495653_0184809_244_1260 282
639 3300046511 Ga0495608_0004835 Ga0495608_0004835_621_1637 282
640 3300046514 Ga0495618_0037393 Ga0495618_0037393_1285_2271 282
641 3300046516 Ga0495628_0001650 Ga0495628_0001650_4673_5689 282
642 3300046516 Ga0495628_0007899 Ga0495628_0007899_7345_8361 282
643 3300046529 Ga0495652_0003089 Ga0495652_0003089_2134_3150 282
644 3300046559 Ga0495667_0088426 Ga0495667_0088426_551_1573 282
645 3300046663 Ga0495635_0068701 Ga0495635_0068701_585_1601 282
646 3300046663 Ga0495635_0123188 Ga0495635_0123188_554_1576 282
647 3300046679 Ga0495623_0001311 Ga0495623_0001311_2298_3314 282
648 3300046680 Ga0495646_0006353 Ga0495646_0006353_714_1730 282
649 3300046690 Ga0495624_0068383 Ga0495624_0068383_631_1647 282
650 3300046809 Ga0495600_0005356 Ga0495600_0005356_5749_6765 282
651 3300047317 Ga0495604_0020189 Ga0495604_0020189_1828_2844 282
652 3300047319 Ga0495674_0145902 Ga0495674_0145902_579_1601 282
653 3300047471 Ga0495684_0073107 Ga0495684_0073107_128_1150 282
654 3300048088 Ga0495602_0012534 Ga0495602_0012534_1063_2079 282
655 3300048088 Ga0495602_0087373 Ga0495602_0087373_54_1076 282
656 3300053077 Ga0495601_0006243 Ga0495601_0006243_591_1607 282
657 iso_pu_bacteria 2599185307 2599971255 282
658 iso_pu_bacteria 2600255283 2601624826 282
659 iso_pu_bacteria 2738541271 2738691170 282
660 iso_pu_bacteria 2738543016 2739266944 282
661 iso_pu_bacteria 2738543031 2739351981 282
662 iso_pu_bacteria 2908446538 2908449670 282
663 3300046512 Ga0495610_0080705 Ga0495610_0080705_238_1233 283
664 iso_pu_bacteria 2738543031 2739349961 283
665 3300025923 Ga0207681_10192931 Ga0207681_101929312 284
666 3300028800 Ga0265338_10000037 Ga0265338_1000003781 284
667 3300031247 Ga0265340_10014726 Ga0265340_100147262 284
668 3300046462 Ga0495651_0096623 Ga0495651_0096623_196_1233 284
669 3300046679 Ga0495623_0000473 Ga0495623_0000473_9498_10535 284
670 3300047317 Ga0495604_0000557 Ga0495604_0000557_10414_11451 284
671 3300047322 Ga0495680_0007331 Ga0495680_0007331_6810_7847 284
672 3300047444 Ga0495675_0005135 Ga0495675_0005135_3575_4612 284
673 3300048088 Ga0495602_0018465 Ga0495602_0018465_1930_2967 284
674 3300049571 Ga0501034_0001273 Ga0501034_0001273_18128_19159 284
675 iso_pu_bacteria 2501025502 2501079719 284
676 iso_pu_bacteria 2510917013 2511094059 284
677 iso_pu_bacteria 2513237082 2513555432 284
678 iso_pu_bacteria 2513237083 2513562707 284
679 iso_pu_bacteria 2671180139 2671692637 284
680 iso_pu_bacteria 2917554339 2917557335 284
681 iso_pu_bacteria 2935769743 2935771289 284
682 iso_pu_bacteria 8003955200 8003959894 284
683 3300046680 Ga0495646_0001063 Ga0495646_0001063_3634_4632 285
684 3300046690 Ga0495624_0040213 Ga0495624_0040213_824_1822 285
685 3300047443 Ga0495687_076483 Ga0495687_076483_198_1235 285
686 iso_pu_bacteria 2773857925 2774872969 285
687 iso_pu_bacteria 2775506901 2776260054 285
688 iso_pu_bacteria 2835312727 2835319240 285
689 iso_pu_bacteria 2882456835 2882460780 285
690 iso_pu_bacteria 2894232714 2894234075 285
691 3300009011 Ga0105251_10000357 Ga0105251_1000035716 286
692 3300025735 Ga0207713_1000058 Ga0207713_1000058174 286
693 3300037853 Ga0436364_0738766 Ga0436364_0738766_2428_3462 286
694 3300046458 Ga0495591_001119 Ga0495591_001119_9154_10146 286
695 3300048924 Ga0496121_0003265 Ga0496121_0003265_22198_23190 286
696 3300048925 Ga0496122_0000156 Ga0496122_0000156_25634_26626 286
697 3300048926 Ga0496123_0000087 Ga0496123_0000087_156167_157159 286
698 3300046462 Ga0495651_0137227 Ga0495651_0137227_395_1417 287
699 3300046476 Ga0495662_0111691 Ga0495662_0111691_288_1310 287
700 3300046680 Ga0495646_0102622 Ga0495646_0102622_188_1210 287
701 3300047323 Ga0495683_0064584 Ga0495683_0064584_536_1570 287
702 iso_pu_bacteria 2510917013 2511092217 287
703 iso_pu_bacteria 2856287931 2856291497 287
704 iso_pu_bacteria 2857357740 2857363893 287
705 3300005335 Ga0070666_10013971 Ga0070666_100139712 288
706 3300005367 Ga0070667_100049430 Ga0070667_1000494302 288
707 3300013308 Ga0157375_10038747 Ga0157375_100387473 288
708 3300025903 Ga0207680_10084344 Ga0207680_100843442 288
709 3300025941 Ga0207711_10085423 Ga0207711_100854233 288
710 3300025986 Ga0207658_10036205 Ga0207658_100362052 288
711 3300026121 Ga0207683_10121325 Ga0207683_101213252 288
712 3300046460 Ga0495638_0002449 Ga0495638_0002449_6922_7956 288
713 3300046471 Ga0495650_0061071 Ga0495650_0061071_356_1390 288
714 3300046474 Ga0495605_0001183 Ga0495605_0001183_1425_2459 288
715 3300046492 Ga0495585_0047975 Ga0495585_0047975_1010_2044 288
716 3300046501 Ga0495607_0048743 Ga0495607_0048743_296_1330 288
717 3300046506 Ga0495583_0082906 Ga0495583_0082906_138_1172 288
718 3300046523 Ga0495644_0036401 Ga0495644_0036401_288_1322 288
719 3300046542 Ga0495597_0038052 Ga0495597_0038052_308_1342 288
720 3300046616 Ga0495668_0090047 Ga0495668_0090047_364_1398 288
721 3300046648 Ga0495611_0014154 Ga0495611_0014154_2178_3176 288
722 3300046648 Ga0495611_0093651 Ga0495611_0093651_131_1165 288
723 3300046660 Ga0495625_0183694 Ga0495625_0183694_309_1343 288
724 3300046684 Ga0495669_0044164 Ga0495669_0044164_248_1282 288
725 3300046794 Ga0495589_0015683 Ga0495589_0015683_1055_2089 288
726 3300047443 Ga0495687_000020 Ga0495687_000020_331314_332336 288
727 3300048091 Ga0495626_0050015 Ga0495626_0050015_499_1533 288
728 3300048903 Ga0496100_0165232 Ga0496100_0165232_429_1463 288
729 3300048905 Ga0496102_0010607 Ga0496102_0010607_5250_6284 288
730 3300048907 Ga0496104_0135025 Ga0496104_0135025_615_1649 288
731 3300048908 Ga0496105_0189862 Ga0496105_0189862_330_1364 288
732 3300048909 Ga0496106_0027797 Ga0496106_0027797_2809_3843 288
733 3300048918 Ga0496115_0150435 Ga0496115_0150435_653_1687 288
734 iso_pu_bacteria 2513237165 2514041978 288
735 iso_pu_bacteria 2904434214 2904435666 288
736 3300037312 Ga0395899_0029919 Ga0395899_0029919_882_1946 289
737 3300037418 Ga0395900_0083216 Ga0395900_0083216_182_1246 289
738 3300042137 Ga0450902_001559 Ga0450902_001559_1558_2580 289
739 3300046459 Ga0495629_0252329 Ga0495629_0252329_139_1128 289
740 iso_pu_bacteria 2512047030 2512351828 289
741 iso_pu_bacteria 2515154123 2515689981 289
742 iso_pu_bacteria 2519103095 2519458635 289
743 iso_pu_bacteria 2582581311 2585294973 289
744 iso_pu_bacteria 2599185239 2599737314 289
745 iso_pu_bacteria 2599185240 2599746955 289
746 iso_pu_bacteria 2599185355 2600208890 289
747 iso_pu_bacteria 2675903129 2676744518 289
748 iso_pu_bacteria 2744054900 2746091193 289
749 iso_pu_bacteria 2744054901 2746097626 289
750 iso_pu_bacteria 2816332253 2817260856 289
751 iso_pu_bacteria 2816332256 2817278490 289
752 iso_pu_bacteria 2816332286 2817454959 289
753 iso_pu_bacteria 2818991452 2819634974 289
754 iso_pu_bacteria 2863421361 2863424460 289
755 iso_pu_bacteria 2870068957 2870071619 289
756 iso_pu_bacteria 2904564687 2904568763 289
757 iso_pu_bacteria 2904571731 2904575805 289
758 iso_pu_bacteria 2928157003 2928160552 289
759 iso_pu_bacteria 2928163908 2928164908 289
760 iso_pu_bacteria 2928170801 2928172849 289
761 iso_pu_bacteria 2928536128 2928540822 289
762 iso_pu_bacteria 2981990288 2981996477 289
763 iso_pu_bacteria 641736154 642415734 289
764 iso_pu_bacteria 8018845410 8018853231 289
765 iso_pu_bacteria 8020807995 8020813128 289
766 iso_pu_bacteria 8020938398 8020944238 289
767 iso_pu_bacteria 8020945358 8020949406 289
768 iso_pu_bacteria 8020953355 8020958033 289
769 iso_pu_bacteria 8021120328 8021124255 289
770 iso_pu_bacteria 8039098773 8039101152 289
771 iso_pu_bacteria 8040167225 8040172237 289
772 iso_pu_bacteria 8040173305 8040177915 289
773 iso_pu_bacteria 2501025504 2501409248 290
774 iso_pu_bacteria 2510917013 2511090886 290
775 iso_pu_bacteria 2510917014 2511098809 290
776 iso_pu_bacteria 2510917015 2511109097 290
777 iso_pu_bacteria 2515154189 2516020860 290
778 iso_pu_bacteria 2883087390 2883092339 290
779 iso_pu_bacteria 2885270888 2885271685 290
780 iso_pu_bacteria 2904615490 2904622860 290
781 3300037471 Ga0395905_0026325 Ga0395905_0026325_1157_2188 291
782 3300044656 Ga0466969_0001891 Ga0466969_0001891_6247_7305 291
783 3300044658 Ga0466972_0035450 Ga0466972_0035450_754_1812 291
784 3300044683 Ga0466965_0020425 Ga0466965_0020425_983_2041 291
785 3300044684 Ga0466966_0054990 Ga0466966_0054990_1138_2196 291
786 3300044693 Ga0466961_0008995 Ga0466961_0008995_5321_6355 291
787 3300044694 Ga0466963_0000944 Ga0466963_0000944_5131_6189 291
788 3300044719 Ga0466971_0007795 Ga0466971_0007795_2268_3326 291
789 3300044735 Ga0466968_0057733 Ga0466968_0057733_197_1255 291
790 3300044842 Ga0466957_0008225 Ga0466957_0008225_3164_4222 291
791 3300045836 Ga0466958_0004066 Ga0466958_0004066_5276_6334 291
792 3300046455 Ga0495603_0000708 Ga0495603_0000708_7579_8613 291
793 3300046458 Ga0495591_034846 Ga0495591_034846_303_1337 291
794 3300046459 Ga0495629_0000203 Ga0495629_0000203_15360_16394 291
795 3300046471 Ga0495650_0000977 Ga0495650_0000977_10476_11510 291
796 3300046471 Ga0495650_0047801 Ga0495650_0047801_241_1275 291
797 3300046507 Ga0495606_0050412 Ga0495606_0050412_678_1712 291
798 3300046513 Ga0495616_0097822 Ga0495616_0097822_13_1047 291
799 3300046530 Ga0495654_0033179 Ga0495654_0033179_1007_2041 291
800 3300046543 Ga0495645_0003414 Ga0495645_0003414_4395_5429 291
801 3300046559 Ga0495667_0018909 Ga0495667_0018909_727_1761 291
802 3300046674 Ga0495588_0034818 Ga0495588_0034818_1001_2035 291
803 3300046689 Ga0495613_0121396 Ga0495613_0121396_291_1325 291
804 3300046694 Ga0495649_0065551 Ga0495649_0065551_585_1619 291
805 3300046809 Ga0495600_0101608 Ga0495600_0101608_481_1515 291
806 3300047315 Ga0495581_0026107 Ga0495581_0026107_382_1416 291
807 3300047323 Ga0495683_0041174 Ga0495683_0041174_956_1990 291
808 3300047444 Ga0495675_0022533 Ga0495675_0022533_2149_3183 291
809 3300048903 Ga0496100_0125745 Ga0496100_0125745_410_1444 291
810 3300048908 Ga0496105_0091100 Ga0496105_0091100_468_1502 291
811 3300048917 Ga0496114_0000165 Ga0496114_0000165_40570_41604 291
812 3300001989 JGI24739J22299_10016441 JGI24739J22299_100164412 292
813 3300002067 JGI24735J21928_10000362 JGI24735J21928_1000036214 292
814 3300009011 Ga0105251_10002252 Ga0105251_100022523 292
815 3300009036 Ga0105244_10100418 Ga0105244_101004182 292
816 3300009093 Ga0105240_10114973 Ga0105240_101149733 292
817 3300009545 Ga0105237_10214218 Ga0105237_102142182 292
818 3300013296 Ga0157374_10092263 Ga0157374_100922632 292
819 3300025735 Ga0207713_1007264 Ga0207713_10072645 292
820 3300025913 Ga0207695_10065674 Ga0207695_100656742 292
821 3300044656 Ga0466969_0011954 Ga0466969_0011954_2220_3281 292
822 3300044684 Ga0466966_0008059 Ga0466966_0008059_956_2017 292
823 3300044693 Ga0466961_0039226 Ga0466961_0039226_1156_2217 292
824 3300044694 Ga0466963_0103578 Ga0466963_0103578_693_1754 292
825 3300044706 Ga0466964_0003050 Ga0466964_0003050_4460_5521 292
826 3300044735 Ga0466968_0009107 Ga0466968_0009107_1089_2150 292
827 3300044765 Ga0466970_0004294 Ga0466970_0004294_5469_6530 292
828 3300044842 Ga0466957_0145319 Ga0466957_0145319_131_1192 292
829 3300045049 Ga0466959_0015380 Ga0466959_0015380_2440_3501 292
830 3300045836 Ga0466958_0003813 Ga0466958_0003813_608_1669 292
831 3300046463 Ga0495653_0000400 Ga0495653_0000400_9402_10439 292
832 3300046491 Ga0495584_0111672 Ga0495584_0111672_45_1082 292
833 3300046500 Ga0495596_0054830 Ga0495596_0054830_97_1134 292
834 3300046507 Ga0495606_0026807 Ga0495606_0026807_1147_2184 292
835 3300046516 Ga0495628_0001445 Ga0495628_0001445_10508_11545 292
836 3300046517 Ga0495630_0001326 Ga0495630_0001326_6030_7067 292
837 3300046529 Ga0495652_0034716 Ga0495652_0034716_440_1477 292
838 3300046531 Ga0495665_0000050 Ga0495665_0000050_28511_29548 292
839 3300046543 Ga0495645_0038879 Ga0495645_0038879_1636_2673 292
840 3300046642 Ga0495634_0054589 Ga0495634_0054589_787_1824 292
841 3300046678 Ga0495599_0053403 Ga0495599_0053403_985_2022 292
842 3300046679 Ga0495623_0009070 Ga0495623_0009070_2547_3584 292
843 3300046690 Ga0495624_0026074 Ga0495624_0026074_1022_2059 292
844 3300047317 Ga0495604_0007691 Ga0495604_0007691_7033_8070 292
845 3300047319 Ga0495674_0000364 Ga0495674_0000364_1897_2934 292
846 3300047323 Ga0495683_0002228 Ga0495683_0002228_8021_9058 292
847 3300047443 Ga0495687_080791 Ga0495687_080791_87_1124 292
848 3300047444 Ga0495675_0049658 Ga0495675_0049658_472_1509 292
849 3300047673 Ga0495593_0011379 Ga0495593_0011379_1303_2340 292
850 3300048088 Ga0495602_0000269 Ga0495602_0000269_16904_17941 292
851 3300048904 Ga0496101_0145847 Ga0496101_0145847_424_1461 292
852 3300048905 Ga0496102_0005456 Ga0496102_0005456_6800_7837 292
853 3300048906 Ga0496103_0002801 Ga0496103_0002801_5444_6481 292
854 3300048907 Ga0496104_0192865 Ga0496104_0192865_644_1681 292
855 3300048909 Ga0496106_0008681 Ga0496106_0008681_716_1753 292
856 3300048911 Ga0496108_0326904 Ga0496108_0326904_195_1232 292
857 3300048913 Ga0496110_0001089 Ga0496110_0001089_6799_7836 292
858 3300048915 Ga0496112_0149002 Ga0496112_0149002_539_1576 292
859 3300048919 Ga0496116_0002414 Ga0496116_0002414_7364_8401 292
860 3300048920 Ga0496117_0040175 Ga0496117_0040175_1498_2535 292
861 3300048921 Ga0496118_0024517 Ga0496118_0024517_2050_3087 292
862 3300048924 Ga0496121_0036718 Ga0496121_0036718_1833_2870 292
863 3300048925 Ga0496122_0022808 Ga0496122_0022808_3055_4092 292
864 3300048928 Ga0496125_0075694 Ga0496125_0075694_685_1722 292
865 iso_pu_bacteria 2511231016 2511324356 292
866 iso_pu_bacteria 2511231017 2511329879 292
867 iso_pu_bacteria 2511231022 2511364514 292
868 iso_pu_bacteria 2643221633 2644185122 292
869 iso_pu_bacteria 2738543004 2739201672 292
870 iso_pu_bacteria 2738543015 2739262466 292
871 iso_pu_bacteria 2773857670 2774119947 292
872 iso_pu_bacteria 2784132072 2784312122 292
873 3300044656 Ga0466969_0098019 Ga0466969_0098019_159_1223 293
874 3300044684 Ga0466966_0000017 Ga0466966_0000017_70301_71365 293
875 3300044693 Ga0466961_0000433 Ga0466961_0000433_11832_12896 293
876 3300044719 Ga0466971_0037703 Ga0466971_0037703_645_1709 293
877 3300045049 Ga0466959_0018197 Ga0466959_0018197_2826_3890 293
878 3300045836 Ga0466958_0014521 Ga0466958_0014521_2166_3230 293
879 3300046472 Ga0495580_0011535 Ga0495580_0011535_2088_3125 293
880 3300046477 Ga0495664_0004705 Ga0495664_0004705_3106_4143 293
881 3300046516 Ga0495628_0000614 Ga0495628_0000614_18356_19393 293
882 3300046517 Ga0495630_0015418 Ga0495630_0015418_2307_3344 293
883 3300046526 Ga0495666_0009100 Ga0495666_0009100_2301_3338 293
884 3300046531 Ga0495665_0009851 Ga0495665_0009851_4024_5061 293
885 3300046680 Ga0495646_0002170 Ga0495646_0002170_6090_7127 293
886 3300046690 Ga0495624_0001912 Ga0495624_0001912_12044_13081 293
887 3300047319 Ga0495674_0000942 Ga0495674_0000942_16456_17493 293
888 3300049460 Ga0495682_0000040 Ga0495682_0000040_13904_14941 293
889 iso_pu_bacteria 2501025501 2501075382 294
890 iso_pu_bacteria 2501025502 2501085467 294
891 3300046524 Ga0495648_0002103 Ga0495648_0002103_6422_7444 295
892 3300046530 Ga0495654_0000770 Ga0495654_0000770_13290_14312 295
893 3300046810 Ga0495660_0070683 Ga0495660_0070683_355_1377 295
894 3300047320 Ga0495672_0006864 Ga0495672_0006864_6149_7171 295
895 2124908027 MRS2a_Contig_79 MRS2a_00646750 296
896 2162886012 MBSR1b_contig_478279 MBSR1b_0508.00004630 296
897 3300005288 Ga0065714_10000437 Ga0065714_100004372 296
898 3300005290 Ga0065712_10000438 Ga0065712_1000043823 296
899 3300006058 Ga0075432_10000758 Ga0075432_100007585 296
900 3300006058 Ga0075432_10022684 Ga0075432_100226842 296
901 3300006058 Ga0075432_10036132 Ga0075432_100361322 296
902 3300009036 Ga0105244_10007778 Ga0105244_100077785 296
903 3300013100 Ga0157373_10001522 Ga0157373_1000152210 296
904 3300013104 Ga0157370_10003190 Ga0157370_1000319012 296
905 3300013308 Ga0157375_10363670 Ga0157375_103636701 296
906 3300025728 Ga0207655_1004310 Ga0207655_10043108 296
907 3300025728 Ga0207655_1009973 Ga0207655_10099734 296
908 3300025735 Ga0207713_1002317 Ga0207713_10023177 296
909 3300027907 Ga0207428_10014760 Ga0207428_100147604 296
910 3300027907 Ga0207428_10015644 Ga0207428_100156445 296
911 3300027907 Ga0207428_10018964 Ga0207428_100189642 296
912 3300027907 Ga0207428_10224554 Ga0207428_102245542 296
913 3300041405 Ga0439438_001304 Ga0439438_001304_8635_9657 296
914 3300041407 Ga0439447_001045 Ga0439447_001045_1078_2100 296
915 3300041411 Ga0439466_0007138 Ga0439466_0007138_3168_4190 296
916 3300041411 Ga0439466_0013904 Ga0439466_0013904_1573_2595 296
917 3300041411 Ga0439466_0019824 Ga0439466_0019824_360_1382 296
918 3300041413 Ga0439465_0006173 Ga0439465_0006173_1858_2880 296
919 3300042006 Ga0439432_000292 Ga0439432_000292_8796_9818 296
920 3300042009 Ga0439451_000584 Ga0439451_000584_3932_4954 296
921 3300042009 Ga0439451_015658 Ga0439451_015658_478_1500 296
922 3300042010 Ga0439452_000134 Ga0439452_000134_44380_45402 296
923 3300042010 Ga0439452_015506 Ga0439452_015506_788_1810 296
924 3300042016 Ga0439463_000642 Ga0439463_000642_2014_3036 296
925 3300042115 Ga0450911_000827 Ga0450911_000827_1477_2499 296
926 3300042127 Ga0450890_001166 Ga0450890_001166_2050_3072 296
927 3300042138 Ga0450903_002672 Ga0450903_002672_1663_2685 296
928 3300042145 Ga0450906_000568 Ga0450906_000568_5443_6465 296
929 3300042146 Ga0450907_002608 Ga0450907_002608_554_1576 296
930 3300042184 Ga0450908_017573 Ga0450908_017573_85_1107 296
931 3300042439 Ga0439464_0007775 Ga0439464_0007775_73_1095 296
932 3300042461 Ga0439460_0013610 Ga0439460_0013610_521_1543 296
933 3300042993 Ga0439440_0000266 Ga0439440_0000266_2261_3283 296
934 3300046452 Ga0495617_000278 Ga0495617_000278_28099_29121 296
935 3300046455 Ga0495603_0000631 Ga0495603_0000631_8366_9388 296
936 3300046457 Ga0495590_0035811 Ga0495590_0035811_13_1035 296
937 3300046458 Ga0495591_002961 Ga0495591_002961_1557_2579 296
938 3300046460 Ga0495638_0016207 Ga0495638_0016207_1017_2039 296
939 3300046460 Ga0495638_0070018 Ga0495638_0070018_116_1138 296
940 3300046471 Ga0495650_0047282 Ga0495650_0047282_240_1262 296
941 3300046474 Ga0495605_0000129 Ga0495605_0000129_94918_95940 296
942 3300046491 Ga0495584_0027613 Ga0495584_0027613_77_1099 296
943 3300046492 Ga0495585_0001822 Ga0495585_0001822_2989_4011 296
944 3300046499 Ga0495594_0001716 Ga0495594_0001716_377_1399 296
945 3300046501 Ga0495607_0015236 Ga0495607_0015236_1110_2132 296
946 3300046506 Ga0495583_0000694 Ga0495583_0000694_26138_27160 296
947 3300046518 Ga0495631_0002774 Ga0495631_0002774_3526_4548 296
948 3300046520 Ga0495637_0050732 Ga0495637_0050732_587_1609 296
949 3300046523 Ga0495644_0002549 Ga0495644_0002549_5897_6919 296
950 3300046524 Ga0495648_0077514 Ga0495648_0077514_138_1160 296
951 3300046528 Ga0495642_0007735 Ga0495642_0007735_2530_3552 296
952 3300046528 Ga0495642_0032826 Ga0495642_0032826_550_1572 296
953 3300046538 Ga0495609_0005126 Ga0495609_0005126_2390_3412 296
954 3300046557 Ga0495622_0000667 Ga0495622_0000667_7168_8190 296
955 3300046615 Ga0495656_0008750 Ga0495656_0008750_2112_3134 296
956 3300046616 Ga0495668_0007195 Ga0495668_0007195_2168_3190 296
957 3300046660 Ga0495625_0050474 Ga0495625_0050474_13_1035 296
958 3300046665 Ga0495661_0164211 Ga0495661_0164211_130_1152 296
959 3300046684 Ga0495669_0002291 Ga0495669_0002291_3529_4551 296
960 3300046692 Ga0495671_0032256 Ga0495671_0032256_61_1083 296
961 3300046694 Ga0495649_0000013 Ga0495649_0000013_252856_253878 296
962 3300046794 Ga0495589_0034570 Ga0495589_0034570_948_1970 296
963 3300046810 Ga0495660_0070045 Ga0495660_0070045_326_1348 296
964 3300047320 Ga0495672_0000313 Ga0495672_0000313_3566_4588 296
965 3300047320 Ga0495672_0053461 Ga0495672_0053461_1181_2203 296
966 3300047443 Ga0495687_003689 Ga0495687_003689_6175_7197 296
967 3300047445 Ga0495677_0000311 Ga0495677_0000311_16111_17133 296
968 3300047469 Ga0495673_0063403 Ga0495673_0063403_87_1109 296
969 3300047470 Ga0495681_0043095 Ga0495681_0043095_220_1242 296
970 3300048913 Ga0496110_0005839 Ga0496110_0005839_1996_3018 296
971 3300048914 Ga0496111_0039594 Ga0496111_0039594_714_1736 296
972 3300048927 Ga0496124_0129726 Ga0496124_0129726_965_1987 296
973 3300049460 Ga0495682_0024099 Ga0495682_0024099_467_1489 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

79

345

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4196 55 291
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3722 55 291
7uwa-assembly1.cif.gz_c citrus v-atpase state 1, h in contact with subunits ab 0.3098 61 221
7uwa-assembly1.cif.gz_c citrus v-atpase state 1, h in contact with subunits ab 0.2853 61 221
6f0k-assembly1.cif.gz_F alternative complex iii 0.2781 42 295
ID Description Score Start End Superfamily
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6643 63 283 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6571 62 283 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6563 62 283 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.656 62 283 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6494 62 283 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4Q2WMS4-F1-model_v4 deleted 0.7639 44 224
AF-A0A5D0UFM2-F1-model_v4 ABC transporter permease 0.7621 25 222 GO:0005886
GO:0022857
AF-A0A7X3ZBI2-F1-model_v4 Ribose ABC transporter permease 0.7597 25 217 GO:0005886
GO:0022857
AF-A0A531MQ55-F1-model_v4 L-arabinose ABC transporter permease AraH (EC 3.6.3.17) 0.7589 28 224 GO:0005886
GO:0016787
GO:0022857
AF-A0A528BGR4-F1-model_v4 ABC transporter permease 0.7582 48 222 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
63.63 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map