F487184

General Info

Members Datasets Scaffolds Average Seq Length
973 379 1946 87

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10057215|Ga0163163_100572155
Length 84
Sequence MEAVSILAQASLSATDQKKANAAIGAGFAYGLAAIGPYVVGKAIESMAHQPESAGMVRTTMFLGIAFTEALALIGFVVFILLGL

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
185 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
186 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
214 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.24
Metatranscriptomes 5.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.38
Nodule 0
Rhizoplane 9.04
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10057215 3300014325 Bacteria 3855
2 Ga0070676_11545311 3300005328 Bacteria 512
3 Ga0070683_101066947 3300005329 Bacteria 776
4 Ga0070683_101643057 3300005329 Bacteria 618
5 Ga0070683_102380673 3300005329 Bacteria 508
6 Ga0070690_100055325 3300005330 Bacteria 2541
7 Ga0070670_101172296 3300005331 Bacteria 702
8 Ga0070670_101234103 3300005331 Bacteria 684
9 Ga0070677_10367387 3300005333 Bacteria 750
10 Ga0068869_100557981 3300005334 Bacteria 963
11 Ga0070666_10415107 3300005335 Bacteria 969
12 Ga0070682_101069978 3300005337 Bacteria 674
13 Ga0068868_100420040 3300005338 Bacteria 1158
14 Ga0068868_100902925 3300005338 Bacteria 803
15 Ga0068868_101358046 3300005338 Bacteria 662
16 Ga0068868_102129047 3300005338 Bacteria 534
17 Ga0070689_100710917 3300005340 Bacteria 878
18 Ga0070691_10471134 3300005341 Bacteria 721
19 Ga0070687_100016934 3300005343 Bacteria 3339
20 Ga0070668_101841524 3300005347 Bacteria 557
21 Ga0070669_100340587 3300005353 Bacteria 1215
22 Ga0070669_100473713 3300005353 Bacteria 1035
23 Ga0070675_100211080 3300005354 Bacteria 1687
24 Ga0070675_100670841 3300005354 Bacteria 943
25 Ga0070671_100013725 3300005355 Bacteria 6534
26 Ga0070671_100398839 3300005355 Bacteria 1177
27 Ga0070671_101970888 3300005355 Bacteria 520
28 Ga0070674_100036531 3300005356 Bacteria 3299
29 Ga0070674_100296954 3300005356 Bacteria 1286
30 Ga0070674_100350150 3300005356 Bacteria 1193
31 Ga0070673_100202040 3300005364 Bacteria 1712
32 Ga0070673_100321909 3300005364 Bacteria 1366
33 Ga0070673_100598003 3300005364 Bacteria 1006
34 Ga0070688_100036879 3300005365 Bacteria 2976
35 Ga0070688_100037307 3300005365 Bacteria 2961
36 Ga0070659_101055871 3300005366 Bacteria 715
37 Ga0070667_100199094 3300005367 Bacteria 1777
38 Ga0070667_100323471 3300005367 Bacteria 1392
39 Ga0070667_100520233 3300005367 Bacteria 1092
40 Ga0070667_100617101 3300005367 Bacteria 1000
41 Ga0070709_11636584 3300005434 Bacteria 525
42 Ga0070713_101574394 3300005436 Bacteria 638
43 Ga0070701_10037919 3300005438 Bacteria 2436
44 Ga0070701_10206591 3300005438 Bacteria 1164
45 Ga0070701_10321375 3300005438 Bacteria 958
46 Ga0070705_100660195 3300005440 Bacteria 816
47 Ga0070705_101286359 3300005440 Bacteria 606
48 Ga0070700_100147045 3300005441 Bacteria 1607
49 Ga0070700_100250549 3300005441 Bacteria 1270
50 Ga0070694_100599133 3300005444 Bacteria 887
51 Ga0070678_100317728 3300005456 Bacteria 1329
52 Ga0070678_100360447 3300005456 Bacteria 1252
53 Ga0070678_101432322 3300005456 Bacteria 646
54 Ga0070678_101631877 3300005456 Bacteria 606
55 Ga0070662_100845587 3300005457 Bacteria 779
56 Ga0068867_100005274 3300005459 Bacteria 9132
57 Ga0068867_100428223 3300005459 Bacteria 1122
58 Ga0068867_102061758 3300005459 Bacteria 540
59 Ga0070685_10183200 3300005466 Bacteria 1350
60 Ga0070685_10920056 3300005466 Bacteria 652
61 Ga0070684_100917366 3300005535 Bacteria 821
62 Ga0070684_101309701 3300005535 Bacteria 682
63 Ga0070672_100832297 3300005543 Bacteria 813
64 Ga0070672_101936701 3300005543 Bacteria 530
65 Ga0070686_100012958 3300005544 Bacteria 4760
66 Ga0070686_100524240 3300005544 Bacteria 923
67 Ga0070695_100955090 3300005545 Bacteria 695
68 Ga0070696_101740012 3300005546 Bacteria 538
69 Ga0070693_101494479 3300005547 Bacteria 528
70 Ga0070665_100146522 3300005548 Bacteria 2364
71 Ga0070665_101052375 3300005548 Bacteria 826
72 Ga0070665_102536512 3300005548 Bacteria 514
73 Ga0070704_100274282 3300005549 Bacteria 1395
74 Ga0070704_100334134 3300005549 Bacteria 1274
75 Ga0068855_101767573 3300005563 Bacteria 629
76 Ga0070664_100329987 3300005564 Bacteria 1384
77 Ga0068854_100759638 3300005578 Bacteria 842
78 Ga0070702_100298285 3300005615 Bacteria 1114
79 Ga0070702_100373221 3300005615 Bacteria 1012
80 Ga0070702_101431713 3300005615 Bacteria 566
81 Ga0068852_100905799 3300005616 Bacteria 899
82 Ga0068859_100135778 3300005617 Bacteria 2533
83 Ga0068859_100286592 3300005617 Bacteria 1740
84 Ga0068859_100759843 3300005617 Bacteria 1058
85 Ga0068864_100326278 3300005618 Bacteria 1443
86 Ga0068866_10002295 3300005718 Bacteria 7921
87 Ga0068866_10627800 3300005718 Bacteria 729
88 Ga0068866_11459369 3300005718 Bacteria 502
89 Ga0068861_100070955 3300005719 Bacteria 2699
90 Ga0068861_100445793 3300005719 Bacteria 1159
91 Ga0068861_100538792 3300005719 Bacteria 1062
92 Ga0068861_101228750 3300005719 Bacteria 726
93 Ga0068861_101413840 3300005719 Bacteria 680
94 Ga0068870_10118031 3300005840 Bacteria 1524
95 Ga0068863_100148233 3300005841 Bacteria 2245
96 Ga0068863_101163376 3300005841 Bacteria 777
97 Ga0068863_101190390 3300005841 Bacteria 768
98 Ga0068858_100013307 3300005842 Bacteria 7759
99 Ga0068858_100221272 3300005842 Bacteria 1793
100 Ga0068858_100397467 3300005842 Bacteria 1324
101 Ga0068858_100957982 3300005842 Bacteria 838
102 Ga0068858_101424074 3300005842 Bacteria 683
103 Ga0068860_100612726 3300005843 Bacteria 1095
104 Ga0068860_101434389 3300005843 Bacteria 712
105 Ga0068862_100312024 3300005844 Bacteria 1450
106 Ga0081455_10202616 3300005937 Bacteria 1485
107 Ga0081455_10223268 3300005937 Bacteria 1394
108 Ga0081455_10330186 3300005937 Bacteria 1083
109 Ga0075365_10033015 3300006038 Bacteria 3332
110 Ga0075365_10036434 3300006038 Bacteria 3187
111 Ga0075365_10220233 3300006038 Bacteria 1331
112 Ga0075365_10261144 3300006038 Bacteria 1218
113 Ga0075365_10304074 3300006038 Bacteria 1123
114 Ga0075365_10507393 3300006038 Bacteria 852
115 Ga0075365_10694927 3300006038 Bacteria 719
116 Ga0075365_10890468 3300006038 Bacteria 627
117 Ga0075365_10948435 3300006038 Bacteria 606
118 Ga0075368_10042863 3300006042 Bacteria 1782
119 Ga0075368_10065866 3300006042 Bacteria 1456
120 Ga0075363_100056387 3300006048 Bacteria 2106
121 Ga0075363_100114819 3300006048 Bacteria 1499
122 Ga0075363_100129671 3300006048 Bacteria 1414
123 Ga0075363_100133061 3300006048 Bacteria 1396
124 Ga0075363_100176909 3300006048 Bacteria 1213
125 Ga0075363_100305490 3300006048 Bacteria 924
126 Ga0075363_100530403 3300006048 Bacteria 701
127 Ga0075364_10003203 3300006051 Bacteria 9276
128 Ga0075364_10106913 3300006051 Bacteria 1864
129 Ga0075364_10145177 3300006051 Bacteria 1597
130 Ga0075364_10182859 3300006051 Bacteria 1419
131 Ga0075364_10305877 3300006051 Bacteria 1082
132 Ga0075364_10322729 3300006051 Bacteria 1051
133 Ga0075364_10451211 3300006051 Bacteria 878
134 Ga0075364_10968600 3300006051 Bacteria 579
135 Ga0070716_101155594 3300006173 Bacteria 620
136 Ga0070712_100951715 3300006175 Bacteria 742
137 Ga0075362_10022618 3300006177 Bacteria 2650
138 Ga0075362_10253469 3300006177 Bacteria 866
139 Ga0075362_10470913 3300006177 Bacteria 640
140 Ga0075362_10480011 3300006177 Bacteria 634
141 Ga0075367_10023431 3300006178 Bacteria 3474
142 Ga0075367_10037111 3300006178 Bacteria 2829
143 Ga0075367_10393026 3300006178 Bacteria 877
144 Ga0075367_10465264 3300006178 Bacteria 802
145 Ga0075367_11122443 3300006178 Bacteria 503
146 Ga0075369_10097237 3300006186 Bacteria 1319
147 Ga0075369_10157911 3300006186 Bacteria 1039
148 Ga0075369_10221518 3300006186 Bacteria 876
149 Ga0075366_10121645 3300006195 Bacteria 1573
150 Ga0075366_10144134 3300006195 Bacteria 1441
151 Ga0075366_10525674 3300006195 Bacteria 732
152 Ga0075366_10825611 3300006195 Bacteria 577
153 Ga0097621_100145178 3300006237 Bacteria 2031
154 Ga0097621_100482341 3300006237 Bacteria 1121
155 Ga0097621_101037596 3300006237 Bacteria 768
156 Ga0075370_10064144 3300006353 Bacteria 2095
157 Ga0075370_10236407 3300006353 Bacteria 1082
158 Ga0075370_10465869 3300006353 Bacteria 761
159 Ga0075370_10516190 3300006353 Bacteria 722
160 Ga0068871_100147973 3300006358 Bacteria 2001
161 Ga0068871_100154422 3300006358 Bacteria 1959
162 Ga0068871_100567949 3300006358 Bacteria 1029
163 Ga0075428_100096082 3300006844 Bacteria 3230
164 Ga0075428_100531409 3300006844 Bacteria 1258
165 Ga0075428_101250326 3300006844 Bacteria 782
166 Ga0075430_100010771 3300006846 Bacteria 7750
167 Ga0075430_100233164 3300006846 Bacteria 1526
168 Ga0075430_101193412 3300006846 Bacteria 626
169 Ga0075430_101203875 3300006846 Bacteria 623
170 Ga0075431_100000612 3300006847 Bacteria 30144
171 Ga0075431_100138222 3300006847 Bacteria 2512
172 Ga0075431_100351405 3300006847 Bacteria 1482
173 Ga0075431_100495261 3300006847 Bacteria 1214
174 Ga0075429_100045294 3300006880 Bacteria 3827
175 Ga0075429_100370438 3300006880 Bacteria 1254
176 Ga0068865_100197544 3300006881 Bacteria 1560
177 Ga0068865_100273213 3300006881 Bacteria 1343
178 Ga0068865_100395627 3300006881 Bacteria 1130
179 Ga0097620_100135781 3300006931 Bacteria 2533
180 Ga0097620_100286614 3300006931 Bacteria 1740
181 Ga0097620_100759850 3300006931 Bacteria 1058
182 Ga0105244_10272140 3300009036 Bacteria 786
183 Ga0111539_10031462 3300009094 Bacteria 6445
184 Ga0111539_10443189 3300009094 Bacteria 1512
185 Ga0111539_10620824 3300009094 Bacteria 1259
186 Ga0111539_10709946 3300009094 Bacteria 1170
187 Ga0111539_10838387 3300009094 Bacteria 1070
188 Ga0111539_10929360 3300009094 Bacteria 1012
189 Ga0111539_11481458 3300009094 Bacteria 787
190 Ga0111539_13049636 3300009094 Bacteria 541
191 Ga0105245_10082865 3300009098 Bacteria 2935
192 Ga0105245_10180661 3300009098 Bacteria 2016
193 Ga0105245_10441504 3300009098 Bacteria 1308
194 Ga0105245_10654935 3300009098 Bacteria 1081
195 Ga0105245_11176245 3300009098 Bacteria 814
196 Ga0105245_12159826 3300009098 Bacteria 610
197 Ga0105247_10401879 3300009101 Bacteria 976
198 Ga0114129_10125221 3300009147 Bacteria 3534
199 Ga0114129_10211417 3300009147 Bacteria 2622
200 Ga0114129_10916623 3300009147 Bacteria 1109
201 Ga0114129_12030396 3300009147 Bacteria 695
202 Ga0114129_12201211 3300009147 Bacteria 663
203 Ga0105243_10112062 3300009148 Bacteria 2285
204 Ga0105243_11049165 3300009148 Bacteria 820
205 Ga0105243_11789613 3300009148 Bacteria 645
206 Ga0105243_12659545 3300009148 Bacteria 540
207 Ga0105241_12359635 3300009174 Bacteria 530
208 Ga0105242_10023019 3300009176 Bacteria 4908
209 Ga0105242_10755542 3300009176 Bacteria 958
210 Ga0105242_10815538 3300009176 Bacteria 925
211 Ga0105248_10189707 3300009177 Bacteria 2316
212 Ga0105248_11034155 3300009177 Bacteria 928
213 Ga0105248_11475220 3300009177 Bacteria 770
214 Ga0105248_11618015 3300009177 Bacteria 734
215 Ga0105248_13011377 3300009177 Bacteria 537
216 Ga0105237_10232970 3300009545 Bacteria 1842
217 Ga0105238_11340730 3300009551 Bacteria 742
218 Ga0105238_11627735 3300009551 Bacteria 676
219 Ga0105238_12562695 3300009551 Bacteria 546
220 Ga0105249_10069799 3300009553 Bacteria 3243
221 Ga0105249_10217471 3300009553 Bacteria 1878
222 Ga0105249_10239930 3300009553 Bacteria 1792
223 Ga0105249_10987193 3300009553 Bacteria 911
224 Ga0105249_11307627 3300009553 Bacteria 797
225 Ga0105249_12110020 3300009553 Bacteria 636
226 Ga0105249_12577949 3300009553 Bacteria 581
227 Ga0105028_102730 3300009993 Bacteria 1855
228 Ga0105239_10949639 3300010375 Bacteria 987
229 Ga0105239_11413993 3300010375 Bacteria 803
230 Ga0105246_10502772 3300011119 Bacteria 1030
231 Ga0105246_10638420 3300011119 Bacteria 925
232 Ga0105246_10904191 3300011119 Bacteria 792
233 Ga0157374_10392847 3300013296 Bacteria 1383
234 Ga0157374_11276872 3300013296 Bacteria 756
235 Ga0163162_10240833 3300013306 Bacteria 1940
236 Ga0163162_10329577 3300013306 Bacteria 1659
237 Ga0163162_10580819 3300013306 Bacteria 1248
238 Ga0163162_11038542 3300013306 Bacteria 927
239 Ga0163162_11400005 3300013306 Bacteria 796
240 Ga0157375_10067378 3300013308 Bacteria 3577
241 Ga0157375_10196166 3300013308 Bacteria 2174
242 Ga0157375_10291697 3300013308 Bacteria 1794
243 Ga0157375_10547387 3300013308 Bacteria 1319
244 Ga0157375_11707788 3300013308 Bacteria 745
245 Ga0157375_12474732 3300013308 Bacteria 620
246 Ga0163163_10031797 3300014325 Bacteria 5096
247 Ga0163163_11091551 3300014325 Bacteria 861
248 Ga0163163_11751673 3300014325 Bacteria 682
249 Ga0157380_10455624 3300014326 Bacteria 1230
250 Ga0157380_10714276 3300014326 Bacteria 1009
251 Ga0157380_10724732 3300014326 Bacteria 1002
252 Ga0157380_10785060 3300014326 Bacteria 968
253 Ga0157380_11644618 3300014326 Bacteria 699
254 Ga0157380_12225063 3300014326 Bacteria 612
255 Ga0157380_13034506 3300014326 Bacteria 535
256 Ga0157377_10148633 3300014745 Bacteria 1447
257 Ga0157377_10567705 3300014745 Bacteria 804
258 Ga0157377_10842877 3300014745 Bacteria 680
259 Ga0157377_11662218 3300014745 Bacteria 514
260 Ga0157379_10056359 3300014968 Bacteria 3512
261 Ga0157379_10163819 3300014968 Bacteria 2007
262 Ga0157376_10564535 3300014969 Bacteria 1128
263 Ga0157376_12871443 3300014969 Bacteria 521
264 Ga0163161_10009926 3300017792 Bacteria 6594
265 Ga0163161_10403728 3300017792 Bacteria 1096
266 Ga0163161_10444798 3300017792 Bacteria 1046
267 Ga0163161_11083138 3300017792 Bacteria 688
268 Ga0163161_11878978 3300017792 Bacteria 533
269 Ga0197907_10965783 3300020069 Bacteria 812
270 Ga0197907_11503367 3300020069 Bacteria 552
271 Ga0206356_10665808 3300020070 Bacteria 611
272 Ga0206355_1103962 3300020076 Bacteria 768
273 Ga0206350_11469110 3300020080 Bacteria 560
274 Ga0206354_10002648 3300020081 Bacteria 531
275 Ga0206353_10304879 3300020082 Bacteria 829
276 Ga0213874_10094341 3300021377 Bacteria 987
277 Ga0224712_10298503 3300022467 Bacteria 753
278 Ga0207666_1027523 3300025271 Bacteria 860
279 Ga0207682_10052856 3300025893 Bacteria 1684
280 Ga0207692_10465357 3300025898 Bacteria 798
281 Ga0207642_10378854 3300025899 Bacteria 841
282 Ga0207642_10414971 3300025899 Bacteria 808
283 Ga0207688_10114826 3300025901 Bacteria 1566
284 Ga0207688_10126143 3300025901 Bacteria 1497
285 Ga0207688_10301323 3300025901 Bacteria 980
286 Ga0207688_10479759 3300025901 Bacteria 777
287 Ga0207680_10217365 3300025903 Bacteria 1309
288 Ga0207680_10829797 3300025903 Bacteria 663
289 Ga0207645_10393078 3300025907 Bacteria 932
290 Ga0207645_10630708 3300025907 Bacteria 728
291 Ga0207643_10807027 3300025908 Bacteria 608
292 Ga0207705_10982342 3300025909 Bacteria 653
293 Ga0207671_10464687 3300025914 Bacteria 1008
294 Ga0207663_10381137 3300025916 Bacteria 1074
295 Ga0207662_10208052 3300025918 Bacteria 1269
296 Ga0207662_10835730 3300025918 Bacteria 650
297 Ga0207649_10967547 3300025920 Bacteria 669
298 Ga0207681_10436063 3300025923 Bacteria 1064
299 Ga0207650_10470220 3300025925 Bacteria 1048
300 Ga0207650_11877793 3300025925 Bacteria 506
301 Ga0207659_10076979 3300025926 Bacteria 2454
302 Ga0207687_10177154 3300025927 Bacteria 1649
303 Ga0207687_10228757 3300025927 Bacteria 1468
304 Ga0207687_10348576 3300025927 Bacteria 1206
305 Ga0207687_11152739 3300025927 Bacteria 666
306 Ga0207687_11383220 3300025927 Bacteria 605
307 Ga0207700_10764789 3300025928 Bacteria 863
308 Ga0207664_11049277 3300025929 Bacteria 730
309 Ga0207644_10005852 3300025931 Bacteria 8012
310 Ga0207644_10344569 3300025931 Bacteria 1209
311 Ga0207706_10043057 3300025933 Bacteria 4001
312 Ga0207706_11494756 3300025933 Bacteria 551
313 Ga0207686_10015332 3300025934 Bacteria 4284
314 Ga0207686_10790596 3300025934 Bacteria 760
315 Ga0207686_11525291 3300025934 Bacteria 551
316 Ga0207709_10011292 3300025935 Bacteria 4927
317 Ga0207709_10100851 3300025935 Bacteria 1908
318 Ga0207709_10173949 3300025935 Bacteria 1514
319 Ga0207709_10373721 3300025935 Bacteria 1083
320 Ga0207709_10736299 3300025935 Bacteria 792
321 Ga0207709_10911690 3300025935 Bacteria 715
322 Ga0207670_10694245 3300025936 Bacteria 842
323 Ga0207669_10036491 3300025937 Bacteria 2810
324 Ga0207669_10095068 3300025937 Bacteria 1952
325 Ga0207669_10227009 3300025937 Bacteria 1375
326 Ga0207669_10558742 3300025937 Bacteria 925
327 Ga0207669_10886341 3300025937 Bacteria 745
328 Ga0207704_10345890 3300025938 Bacteria 1156
329 Ga0207665_11305115 3300025939 Bacteria 579
330 Ga0207691_10187293 3300025940 Bacteria 1806
331 Ga0207691_10650737 3300025940 Bacteria 890
332 Ga0207711_10113749 3300025941 Bacteria 2410
333 Ga0207711_10631387 3300025941 Bacteria 999
334 Ga0207689_10547598 3300025942 Bacteria 972
335 Ga0207661_11088365 3300025944 Bacteria 736
336 Ga0207661_12093907 3300025944 Bacteria 512
337 Ga0207679_10874373 3300025945 Bacteria 821
338 Ga0207651_10507552 3300025960 Bacteria 1043
339 Ga0207712_10098406 3300025961 Bacteria 2169
340 Ga0207712_10250521 3300025961 Bacteria 1431
341 Ga0207712_10414364 3300025961 Bacteria 1135
342 Ga0207712_11262790 3300025961 Bacteria 660
343 Ga0207668_10237493 3300025972 Bacteria 1473
344 Ga0207668_10238217 3300025972 Bacteria 1471
345 Ga0207668_10650303 3300025972 Bacteria 923
346 Ga0207640_10493140 3300025981 Bacteria 1018
347 Ga0207640_11920924 3300025981 Bacteria 536
348 Ga0207658_10275261 3300025986 Bacteria 1441
349 Ga0207658_10477239 3300025986 Bacteria 1108
350 Ga0207658_11647989 3300025986 Bacteria 586
351 Ga0207677_10233374 3300026023 Bacteria 1483
352 Ga0207677_10769546 3300026023 Bacteria 859
353 Ga0207677_11746768 3300026023 Bacteria 577
354 Ga0207703_10004895 3300026035 Bacteria 10887
355 Ga0207703_10084486 3300026035 Bacteria 2654
356 Ga0207703_10386564 3300026035 Bacteria 1296
357 Ga0207703_10535780 3300026035 Bacteria 1103
358 Ga0207703_10570366 3300026035 Bacteria 1068
359 Ga0207703_10790423 3300026035 Bacteria 906
360 Ga0207703_12183680 3300026035 Bacteria 530
361 Ga0207639_10996563 3300026041 Bacteria 784
362 Ga0207639_11964501 3300026041 Bacteria 546
363 Ga0207678_10291974 3300026067 Bacteria 1400
364 Ga0207678_11519500 3300026067 Bacteria 591
365 Ga0207708_10149303 3300026075 Bacteria 1839
366 Ga0207708_10362927 3300026075 Bacteria 1191
367 Ga0207702_11225191 3300026078 Bacteria 745
368 Ga0207641_10070929 3300026088 Bacteria 2995
369 Ga0207641_11363224 3300026088 Bacteria 710
370 Ga0207648_10018524 3300026089 Bacteria 6301
371 Ga0207648_10208463 3300026089 Bacteria 1734
372 Ga0207648_10750700 3300026089 Bacteria 906
373 Ga0207676_10101802 3300026095 Bacteria 2383
374 Ga0207676_10836313 3300026095 Bacteria 900
375 Ga0207676_11269749 3300026095 Bacteria 731
376 Ga0207676_11304338 3300026095 Bacteria 721
377 Ga0207674_12209858 3300026116 Bacteria 513
378 Ga0207675_100015959 3300026118 Bacteria 7008
379 Ga0207675_100050481 3300026118 Bacteria 3881
380 Ga0207675_100076174 3300026118 Bacteria 3141
381 Ga0207675_100189885 3300026118 Bacteria 1970
382 Ga0207675_100743419 3300026118 Bacteria 992
383 Ga0207675_101622567 3300026118 Bacteria 667
384 Ga0207675_101695261 3300026118 Bacteria 652
385 Ga0207683_10207043 3300026121 Bacteria 1784
386 Ga0207683_10395145 3300026121 Bacteria 1272
387 Ga0207683_10723739 3300026121 Bacteria 923
388 Ga0207698_10138046 3300026142 Bacteria 2095
389 Ga0209984_1063339 3300027424 Bacteria 548
390 Ga0209971_1034789 3300027682 Bacteria 1211
391 Ga0209998_10141539 3300027717 Bacteria 615
392 Ga0209813_10014671 3300027866 Bacteria 2113
393 Ga0209813_10029126 3300027866 Bacteria 1615
394 Ga0209813_10140148 3300027866 Bacteria 858
395 Ga0209813_10187584 3300027866 Bacteria 759
396 Ga0209974_10162297 3300027876 Bacteria 811
397 Ga0207428_10014181 3300027907 Bacteria 6936
398 Ga0207428_10358375 3300027907 Bacteria 1072
399 Ga0207428_10766715 3300027907 Bacteria 687
400 Ga0268266_10739563 3300028379 Bacteria 949
401 Ga0268265_11104220 3300028380 Bacteria 787
402 Ga0268264_10041718 3300028381 Bacteria 3797
403 Ga0268264_10346527 3300028381 Bacteria 1413
404 Ga0268264_10547173 3300028381 Bacteria 1135
405 Ga0265326_10080609 3300028558 Bacteria 921
406 Ga0265327_10010527 3300031251 Bacteria 6488
407 Ga0307408_102072257 3300031548 Bacteria 548
408 Ga0316575_10022587 3300031665 Bacteria 2428
409 Ga0316579_10123523 3300031691 Bacteria 1245
410 Ga0316579_10145896 3300031691 Bacteria 1141
411 Ga0316576_10005282 3300031727 Bacteria 7866
412 Ga0316576_10047479 3300031727 Bacteria 3111
413 Ga0316576_10091464 3300031727 Bacteria 2267
414 Ga0316576_10203026 3300031727 Bacteria 1493
415 Ga0316576_10275687 3300031727 Bacteria 1260
416 Ga0316576_11286442 3300031727 Bacteria 515
417 Ga0316578_10058254 3300031728 Bacteria 2271
418 Ga0316578_10188582 3300031728 Bacteria 1242
419 Ga0316578_10215238 3300031728 Bacteria 1155
420 Ga0316578_10598518 3300031728 Bacteria 646
421 Ga0316578_10896610 3300031728 Bacteria 512
422 Ga0307405_10763776 3300031731 Bacteria 806
423 Ga0316577_10238440 3300031733 Bacteria 1028
424 Ga0316577_10878534 3300031733 Bacteria 508
425 Ga0307413_10070340 3300031824 Bacteria 2200
426 Ga0307410_10099480 3300031852 Bacteria 2082
427 Ga0307410_10157027 3300031852 Bacteria 1700
428 Ga0307410_11154375 3300031852 Bacteria 673
429 Ga0307406_11424586 3300031901 Bacteria 608
430 Ga0307407_10023157 3300031903 Bacteria 3236
431 Ga0307407_10136173 3300031903 Bacteria 1578
432 Ga0307407_10174024 3300031903 Bacteria 1421
433 Ga0307412_10305293 3300031911 Bacteria 1260
434 Ga0307412_10337452 3300031911 Bacteria 1205
435 Ga0307412_11257387 3300031911 Bacteria 665
436 Ga0307409_100003770 3300031995 Bacteria 8342
437 Ga0307409_100006795 3300031995 Bacteria 6769
438 Ga0307409_100522735 3300031995 Bacteria 1160
439 Ga0307409_101978104 3300031995 Bacteria 612
440 Ga0307409_102212936 3300031995 Bacteria 579
441 Ga0307409_102722390 3300031995 Bacteria 523
442 Ga0307416_100358692 3300032002 Bacteria 1479
443 Ga0307416_100502341 3300032002 Bacteria 1277
444 Ga0307414_10204555 3300032004 Bacteria 1609
445 Ga0307414_10658037 3300032004 Bacteria 945
446 Ga0307414_11940198 3300032004 Bacteria 550
447 Ga0307411_10145068 3300032005 Bacteria 1756
448 Ga0307415_100039453 3300032126 Bacteria 3121
449 Ga0307415_100054123 3300032126 Bacteria 2738
450 Ga0307415_100885322 3300032126 Bacteria 822
451 Ga0316585_10075716 3300032137 Bacteria 1094
452 Ga0316580_10042547 3300032139 Bacteria 1402
453 Ga0316580_10214668 3300032139 Bacteria 593
454 Ga0316586_1114453 3300033527 Bacteria 523
455 Ga0316596_1008695 3300033541 Bacteria 2427
456 Ga0316596_1016974 3300033541 Bacteria 1827
457 Ga0373928_0139931 3300035084 Bacteria 663
458 Ga0373949_0186101 3300035090 Bacteria 617
459 Ga0373939_0099887 3300035114 Bacteria 994
460 Ga0373941_0343921 3300035115 Bacteria 605
461 Ga0373960_0177514 3300035121 Bacteria 742
462 Ga0316574_0005901 3300035398 Bacteria 6569
463 Ga0316574_0021651 3300035398 Bacteria 3819
464 Ga0316574_0029826 3300035398 Bacteria 3298
465 Ga0316574_0046950 3300035398 Bacteria 2679
466 Ga0316574_0069573 3300035398 Bacteria 2222
467 Ga0316574_0112668 3300035398 Bacteria 1744
468 Ga0316574_0276920 3300035398 Bacteria 1069
469 Ga0316574_0348180 3300035398 Bacteria 938
470 Ga0316574_0713571 3300035398 Bacteria 614
471 Ga0373931_0183286 3300035691 Bacteria 1241
472 Ga0373931_1077316 3300035691 Bacteria 546
473 Ga0373931_1223679 3300035691 Bacteria 515
474 Ga0316582_0034196 3300036647 Bacteria 3128
475 Ga0316584_0003705 3300036712 Bacteria 10000
476 Ga0316584_0527525 3300036712 Bacteria 827
477 Ga0316584_0987243 3300036712 Bacteria 563
478 Ga0373925_0771121 3300037068 Bacteria 793
479 Ga0400483_006841 3300039062 Bacteria 5203
480 Ga0400483_007036 3300039062 Bacteria 33110
481 Ga0400483_010748 3300039062 Bacteria 8501
482 Ga0400483_077252 3300039062 Bacteria 9879
483 Ga0400483_104651 3300039062 Bacteria 1886
484 Ga0400483_148410 3300039062 Bacteria 3954
485 Ga0400483_150100 3300039062 Bacteria 9605
486 Ga0400483_179186 3300039062 Bacteria 8921
487 Ga0400483_220471 3300039062 Bacteria 2917
488 Ga0400483_220481 3300039062 Bacteria 22518
489 Ga0400483_258026 3300039062 Bacteria 11670
490 Ga0436365_0795719 3300039437 Bacteria 516
491 Ga0439447_060303 3300041407 Bacteria 894
492 Ga0439461_0190057 3300041410 Bacteria 548
493 Ga0451791_0208836 3300041451 Bacteria 722
494 Ga0451791_0711832 3300041451 Bacteria 588
495 Ga0451791_0767930 3300041451 Bacteria 867
496 Ga0451791_0869931 3300041451 Bacteria 678
497 Ga0451791_1650700 3300041451 Bacteria 582
498 Ga0451791_1794192 3300041451 Bacteria 567
499 Ga0451793_0248178 3300041452 Bacteria 728
500 Ga0451797_1468140 3300041453 Bacteria 769
501 Ga0451800_1689637 3300041459 Bacteria 737
502 Ga0451802_0913525 3300041460 Bacteria 1063
503 Ga0451802_1621887 3300041460 Bacteria 652
504 Ga0451807_0410089 3300041486 Bacteria 711
505 Ga0451833_1029105 3300041491 Bacteria 637
506 Ga0451835_0857280 3300041492 Bacteria 696
507 Ga0451837_0317183 3300041494 Bacteria 1371
508 Ga0451839_0752461 3300041496 Bacteria 583
509 Ga0451841_0427574 3300041498 Bacteria 517
510 Ga0451841_0452739 3300041498 Bacteria 606
511 Ga0451847_0286056 3300041503 Bacteria 555
512 Ga0451847_0747282 3300041503 Bacteria 672
513 Ga0451849_0007537 3300041505 Bacteria 739
514 Ga0451849_1095960 3300041505 Bacteria 862
515 Ga0451843_0856430 3300041509 Bacteria 729
516 Ga0451843_1318818 3300041509 Bacteria 531
517 Ga0451855_0817411 3300041511 Bacteria 667
518 Ga0451855_1177845 3300041511 Bacteria 546
519 Ga0451855_1495184 3300041511 Bacteria 644
520 Ga0451853_1622660 3300041512 Bacteria 1337
521 Ga0451853_1817403 3300041512 Bacteria 2743
522 Ga0451853_2880310 3300041512 Bacteria 637
523 Ga0451853_3179491 3300041512 Bacteria 1618
524 Ga0439445_0099936 3300042004 Bacteria 822
525 Ga0439432_181276 3300042006 Bacteria 613
526 Ga0439449_0374640 3300042007 Bacteria 540
527 Ga0439446_0160145 3300042156 Bacteria 744
528 Ga0439434_0014033 3300042435 Bacteria 2382
529 Ga0439435_0109772 3300042436 Bacteria 855
530 Ga0451577_0001613 3300042876 Bacteria 29346
531 Ga0439440_0093959 3300042993 Bacteria 808
532 Ga0453684_0243023 3300044712 Bacteria 2071
533 Ga0453684_1437239 3300044712 Bacteria 714
534 Ga0466967_0746517 3300045976 Bacteria 970
535 Ga0466967_0958503 3300045976 Bacteria 851
536 Ga0495592_0004286 3300046454 Bacteria 10430
537 Ga0495603_0260093 3300046455 Bacteria 999
538 Ga0495603_0886407 3300046455 Bacteria 507
539 Ga0495638_0371357 3300046460 Bacteria 750
540 Ga0495641_0057889 3300046461 Bacteria 1755
541 Ga0495651_0436732 3300046462 Bacteria 848
542 Ga0495653_0001345 3300046463 Bacteria 19087
543 Ga0495653_0148948 3300046463 Bacteria 1637
544 Ga0495582_0289112 3300046473 Bacteria 942
545 Ga0495662_0093102 3300046476 Bacteria 1471
546 Ga0495664_0211175 3300046477 Bacteria 1175
547 Ga0495594_0785679 3300046499 Bacteria 537
548 Ga0495608_0075595 3300046511 Bacteria 2195
549 Ga0495608_0111557 3300046511 Bacteria 1758
550 Ga0495628_0002818 3300046516 Bacteria 15595
551 Ga0495628_0006457 3300046516 Bacteria 10240
552 Ga0495630_0009175 3300046517 Bacteria 7114
553 Ga0495630_0011734 3300046517 Bacteria 6349
554 Ga0495630_0382973 3300046517 Bacteria 1077
555 Ga0495630_0434548 3300046517 Bacteria 1006
556 Ga0495644_0442363 3300046523 Bacteria 517
557 Ga0495666_0006469 3300046526 Bacteria 5897
558 Ga0495652_0501216 3300046529 Bacteria 842
559 Ga0495654_0277787 3300046530 Bacteria 690
560 Ga0495665_0412234 3300046531 Bacteria 685
561 Ga0495640_0037494 3300046533 Bacteria 3419
562 Ga0495640_0956774 3300046533 Bacteria 506
563 Ga0495586_0602456 3300046535 Bacteria 635
564 Ga0495587_0194855 3300046536 Bacteria 1147
565 Ga0495587_0329609 3300046536 Bacteria 852
566 Ga0495645_0276416 3300046543 Bacteria 1106
567 Ga0495667_0067324 3300046559 Bacteria 2340
568 Ga0495667_0078450 3300046559 Bacteria 2147
569 Ga0495667_0779857 3300046559 Bacteria 590
570 Ga0495634_0120686 3300046642 Bacteria 1679
571 Ga0495634_0200633 3300046642 Bacteria 1239
572 Ga0495657_0026092 3300046675 Bacteria 4142
573 Ga0495657_0442610 3300046675 Bacteria 761
574 Ga0495646_0210802 3300046680 Bacteria 1054
575 Ga0495647_0190840 3300046681 Bacteria 895
576 Ga0495658_0033714 3300046683 Bacteria 2806
577 Ga0495658_0079391 3300046683 Bacteria 1923
578 Ga0495658_0178948 3300046683 Bacteria 1315
579 Ga0495658_0235300 3300046683 Bacteria 1149
580 Ga0495613_0117946 3300046689 Bacteria 1908
581 Ga0495613_0213280 3300046689 Bacteria 1357
582 Ga0495624_0215430 3300046690 Bacteria 1165
583 Ga0495624_0260385 3300046690 Bacteria 1048
584 Ga0495670_0693686 3300046691 Bacteria 555
585 Ga0495649_0131634 3300046694 Bacteria 1320
586 Ga0495600_0842569 3300046809 Bacteria 544
587 Ga0495604_0074223 3300047317 Bacteria 2564
588 Ga0495604_0706660 3300047317 Bacteria 640
589 Ga0495674_0063018 3300047319 Bacteria 3226
590 Ga0495674_0097226 3300047319 Bacteria 2508
591 Ga0495674_0235006 3300047319 Bacteria 1512
592 Ga0495674_0380044 3300047319 Bacteria 1143
593 Ga0495672_0215069 3300047320 Bacteria 952
594 Ga0495672_0239400 3300047320 Bacteria 887
595 Ga0495676_0124390 3300047321 Bacteria 1871
596 Ga0495676_0210757 3300047321 Bacteria 1344
597 Ga0495680_0075209 3300047322 Bacteria 2563
598 Ga0495680_0148813 3300047322 Bacteria 1708
599 Ga0495680_0328567 3300047322 Bacteria 1069
600 Ga0495680_0602459 3300047322 Bacteria 735
601 Ga0495675_0119303 3300047444 Bacteria 1643
602 Ga0495684_0019831 3300047471 Bacteria 5181
603 Ga0495684_0382724 3300047471 Bacteria 992
604 Ga0495686_0486215 3300047472 Bacteria 652
605 Ga0495593_0331474 3300047673 Bacteria 761
606 Ga0495602_0369715 3300048088 Bacteria 1030
607 Ga0495614_0664631 3300048089 Bacteria 503
608 Ga0496100_0099940 3300048903 Bacteria 1997
609 Ga0496100_0107762 3300048903 Bacteria 1931
610 Ga0496100_0745706 3300048903 Bacteria 766
611 Ga0496100_1087342 3300048903 Bacteria 630
612 Ga0496100_1463057 3300048903 Bacteria 539
613 Ga0496101_0026438 3300048904 Bacteria 4036
614 Ga0496101_0369391 3300048904 Bacteria 1128
615 Ga0496101_1002466 3300048904 Bacteria 657
616 Ga0496102_0084297 3300048905 Bacteria 2933
617 Ga0496102_0162582 3300048905 Bacteria 2100
618 Ga0496102_0178238 3300048905 Bacteria 2002
619 Ga0496102_0195923 3300048905 Bacteria 1904
620 Ga0496102_0652891 3300048905 Bacteria 975
621 Ga0496102_0807918 3300048905 Bacteria 860
622 Ga0496102_1972752 3300048905 Bacteria 500
623 Ga0496103_0026219 3300048906 Bacteria 3529
624 Ga0496103_0387073 3300048906 Bacteria 898
625 Ga0496103_0406269 3300048906 Bacteria 875
626 Ga0496103_0781423 3300048906 Bacteria 603
627 Ga0496104_0017186 3300048907 Bacteria 6580
628 Ga0496104_0272275 3300048907 Bacteria 1606
629 Ga0496104_0279735 3300048907 Bacteria 1582
630 Ga0496104_0518243 3300048907 Bacteria 1103
631 Ga0496104_1819767 3300048907 Bacteria 511
632 Ga0496105_0050197 3300048908 Bacteria 3446
633 Ga0496105_0098162 3300048908 Bacteria 2419
634 Ga0496105_0305625 3300048908 Bacteria 1278
635 Ga0496105_1416904 3300048908 Bacteria 503
636 Ga0496105_1426761 3300048908 Bacteria 500
637 Ga0496106_0077237 3300048909 Bacteria 2553
638 Ga0496106_0877456 3300048909 Bacteria 709
639 Ga0496107_0106155 3300048910 Bacteria 2062
640 Ga0496107_0500837 3300048910 Bacteria 901
641 Ga0496108_0091207 3300048911 Bacteria 2590
642 Ga0496108_0096922 3300048911 Bacteria 2513
643 Ga0496108_0497631 3300048911 Bacteria 1065
644 Ga0496108_0682423 3300048911 Bacteria 891
645 Ga0496108_0724659 3300048911 Bacteria 861
646 Ga0496109_0064933 3300048912 Bacteria 3341
647 Ga0496109_0115670 3300048912 Bacteria 2496
648 Ga0496109_0148344 3300048912 Bacteria 2195
649 Ga0496109_0324728 3300048912 Bacteria 1453
650 Ga0496109_0430685 3300048912 Bacteria 1246
651 Ga0496109_0811092 3300048912 Bacteria 874
652 Ga0496109_1356732 3300048912 Bacteria 647
653 Ga0496110_0040289 3300048913 Bacteria 4071
654 Ga0496110_0045608 3300048913 Bacteria 3832
655 Ga0496110_0053678 3300048913 Bacteria 3544
656 Ga0496110_0076763 3300048913 Bacteria 2971
657 Ga0496110_0084551 3300048913 Bacteria 2832
658 Ga0496110_0144397 3300048913 Bacteria 2152
659 Ga0496110_0334725 3300048913 Bacteria 1379
660 Ga0496110_0573413 3300048913 Bacteria 1025
661 Ga0496110_1171805 3300048913 Bacteria 677
662 Ga0496110_1187022 3300048913 Bacteria 672
663 Ga0496111_0017855 3300048914 Bacteria 4907
664 Ga0496111_0022101 3300048914 Bacteria 4449
665 Ga0496111_0369265 3300048914 Bacteria 1062
666 Ga0496111_0437947 3300048914 Bacteria 965
667 Ga0496111_0468330 3300048914 Bacteria 929
668 Ga0496111_0637046 3300048914 Bacteria 778
669 Ga0496111_0862359 3300048914 Bacteria 653
670 Ga0496112_0138869 3300048915 Bacteria 2400
671 Ga0496113_0105580 3300048916 Bacteria 2187
672 Ga0496113_0542336 3300048916 Bacteria 933
673 Ga0496113_0731462 3300048916 Bacteria 789
674 Ga0496114_0026480 3300048917 Bacteria 4747
675 Ga0496114_0139799 3300048917 Bacteria 2096
676 Ga0496114_0225933 3300048917 Bacteria 1644
677 Ga0496114_0433327 3300048917 Bacteria 1164
678 Ga0496114_0436936 3300048917 Bacteria 1159
679 Ga0496114_0562610 3300048917 Bacteria 1007
680 Ga0496114_0591961 3300048917 Bacteria 978
681 Ga0496114_0829154 3300048917 Bacteria 804
682 Ga0496115_0628505 3300048918 Bacteria 851
683 Ga0496115_0841469 3300048918 Bacteria 711
684 Ga0501306_035519 3300049127 Bacteria 756
685 Ga0501306_049985 3300049127 Bacteria 668
686 Ga0501306_108947 3300049127 Bacteria 502
687 Ga0501309_069249 3300049129 Bacteria 578
688 Ga0501310_057109 3300049130 Bacteria 575
689 Ga0501315_062883 3300049531 Bacteria 603
690 Ga0501317_032437 3300049533 Bacteria 764
691 Ga0501317_045333 3300049533 Bacteria 684
692 Ga0501317_063172 3300049533 Bacteria 611
693 Ga0501317_102537 3300049533 Bacteria 518
694 Ga0501323_044902 3300049539 Bacteria 657
695 Ga0501323_081473 3300049539 Bacteria 530
696 Ga0501325_049274 3300049541 Bacteria 532
697 Ga0501031_0044387 3300049568 Bacteria 2901
698 Ga0501031_0390721 3300049568 Bacteria 900
699 Ga0501031_0505342 3300049568 Bacteria 779
700 Ga0501031_0829011 3300049568 Bacteria 593
701 Ga0501032_0103920 3300049569 Bacteria 1882
702 Ga0501033_0000342 3300049570 Bacteria 44372
703 Ga0501033_0095175 3300049570 Bacteria 2177
704 Ga0501033_0382339 3300049570 Bacteria 983
705 Ga0501034_0000986 3300049571 Bacteria 40824
706 Ga0501034_0004559 3300049571 Bacteria 15367
707 Ga0501034_0020259 3300049571 Bacteria 6792
708 Ga0501034_0044468 3300049571 Bacteria 4492
709 Ga0501034_0119073 3300049571 Bacteria 2627
710 Ga0501034_0728669 3300049571 Bacteria 888
711 Ga0501034_1675536 3300049571 Bacteria 508
712 Ga0501036_0058738 3300049572 Bacteria 3259
713 Ga0501036_0063663 3300049572 Bacteria 3122
714 Ga0501036_0134217 3300049572 Bacteria 2089
715 Ga0501036_0535756 3300049572 Bacteria 973
716 Ga0501036_1449231 3300049572 Bacteria 556
717 Ga0501037_0008590 3300049573 Bacteria 7492
718 Ga0501037_0274867 3300049573 Bacteria 1175
719 Ga0501038_0072945 3300049574 Bacteria 2908
720 Ga0501038_0099878 3300049574 Bacteria 2419
721 Ga0501038_0341242 3300049574 Bacteria 1168
722 Ga0501038_0470481 3300049574 Bacteria 964
723 Ga0501038_1160869 3300049574 Bacteria 562
724 Ga0501039_0090597 3300049575 Bacteria 2383
725 Ga0501039_0100116 3300049575 Bacteria 2262
726 Ga0501039_0211351 3300049575 Bacteria 1525
727 Ga0501039_0326852 3300049575 Bacteria 1205
728 Ga0501039_0449650 3300049575 Bacteria 1012
729 Ga0501039_0641598 3300049575 Bacteria 832
730 Ga0501039_0786407 3300049575 Bacteria 743
731 Ga0501040_0019713 3300049576 Bacteria 4488
732 Ga0501040_0082569 3300049576 Bacteria 2228
733 Ga0501040_0135739 3300049576 Bacteria 1732
734 Ga0501040_0226074 3300049576 Bacteria 1332
735 Ga0501040_0741137 3300049576 Bacteria 711
736 Ga0501041_0114891 3300049577 Bacteria 1671
737 Ga0501041_0139992 3300049577 Bacteria 1509
738 Ga0501041_0548932 3300049577 Bacteria 736
739 Ga0501041_0650860 3300049577 Bacteria 674
740 Ga0501041_0714881 3300049577 Bacteria 641
741 Ga0501042_0064879 3300049578 Bacteria 2610
742 Ga0501042_0166616 3300049578 Bacteria 1590
743 Ga0501042_0262718 3300049578 Bacteria 1246
744 Ga0501042_0385006 3300049578 Bacteria 1015
745 Ga0501042_0802080 3300049578 Bacteria 685
746 Ga0501042_0875397 3300049578 Bacteria 654
747 Ga0501043_0415277 3300049579 Bacteria 1015
748 Ga0501043_0911731 3300049579 Bacteria 630
749 Ga0501043_0997999 3300049579 Bacteria 596
750 Ga0501046_0071588 3300049580 Bacteria 2694
751 Ga0501046_0086291 3300049580 Bacteria 2420
752 Ga0501047_0104338 3300049581 Bacteria 2715
753 Ga0501047_0561446 3300049581 Bacteria 965
754 Ga0501047_1194350 3300049581 Bacteria 574
755 Ga0501048_0021691 3300049582 Bacteria 4700
756 Ga0501048_0029208 3300049582 Bacteria 4000
757 Ga0501048_0067116 3300049582 Bacteria 2536
758 Ga0501048_0177704 3300049582 Bacteria 1509
759 Ga0501048_0228192 3300049582 Bacteria 1321
760 Ga0501067_0185612 3300049583 Bacteria 1158
761 Ga0501067_0714788 3300049583 Bacteria 563
762 Ga0501068_0000178 3300049584 Bacteria 29882
763 Ga0501068_0705457 3300049584 Bacteria 660
764 Ga0501068_0713444 3300049584 Bacteria 656
765 Ga0501069_0002824 3300049585 Bacteria 8887
766 Ga0501069_0047414 3300049585 Bacteria 2385
767 Ga0501069_0714173 3300049585 Bacteria 605
768 Ga0501069_0792729 3300049585 Bacteria 574
769 Ga0501070_0001076 3300049586 Bacteria 24470
770 Ga0501070_0276684 3300049586 Bacteria 1370
771 Ga0501070_1390880 3300049586 Bacteria 533
772 Ga0501071_0019510 3300049587 Bacteria 4705
773 Ga0501071_0034603 3300049587 Bacteria 3597
774 Ga0501071_0195580 3300049587 Bacteria 1518
775 Ga0501071_0385210 3300049587 Bacteria 1069
776 Ga0501071_1334536 3300049587 Bacteria 554
777 Ga0501071_1382212 3300049587 Bacteria 544
778 Ga0501071_1480784 3300049587 Bacteria 524
779 Ga0501072_0006449 3300049588 Bacteria 8932
780 Ga0501072_0009386 3300049588 Bacteria 7440
781 Ga0501072_0145705 3300049588 Bacteria 1888
782 Ga0501072_0230485 3300049588 Bacteria 1475
783 Ga0501072_0439329 3300049588 Bacteria 1034
784 Ga0501072_0573533 3300049588 Bacteria 890
785 Ga0501072_0916398 3300049588 Bacteria 684
786 Ga0501073_0000128 3300049589 Bacteria 49589
787 Ga0501073_0000908 3300049589 Bacteria 21287
788 Ga0501073_0780429 3300049589 Bacteria 659
789 Ga0501073_1162528 3300049589 Bacteria 530
790 Ga0501074_0000373 3300049590 Bacteria 26438
791 Ga0501074_0064860 3300049590 Bacteria 2629
792 Ga0501074_0075039 3300049590 Bacteria 2428
793 Ga0501074_0130883 3300049590 Bacteria 1795
794 Ga0501074_0225732 3300049590 Bacteria 1333
795 Ga0501074_0259751 3300049590 Bacteria 1235
796 Ga0501074_1160444 3300049590 Bacteria 542
797 Ga0501074_1260301 3300049590 Bacteria 518
798 Ga0501075_0110251 3300049591 Bacteria 2092
799 Ga0501075_0174259 3300049591 Bacteria 1642
800 Ga0501075_0336516 3300049591 Bacteria 1150
801 Ga0501075_0352245 3300049591 Bacteria 1122
802 Ga0501075_0654350 3300049591 Bacteria 801
803 Ga0501075_0735294 3300049591 Bacteria 751
804 Ga0501076_0059177 3300049592 Bacteria 3047
805 Ga0501076_0168710 3300049592 Bacteria 1784
806 Ga0501076_0198184 3300049592 Bacteria 1639
807 Ga0501076_1154720 3300049592 Bacteria 637
808 Ga0501076_1285356 3300049592 Bacteria 602
809 Ga0501076_1388374 3300049592 Bacteria 577
810 Ga0501077_0175886 3300049593 Bacteria 1360
811 Ga0501077_0413784 3300049593 Bacteria 862
812 Ga0501077_0423625 3300049593 Bacteria 851
813 Ga0501079_0037457 3300049741 Bacteria 3738
814 Ga0501079_0059608 3300049741 Bacteria 2944
815 Ga0501079_0264394 3300049741 Bacteria 1345
816 Ga0501079_0951735 3300049741 Bacteria 676
817 Ga0501080_0015388 3300049742 Bacteria 7051
818 Ga0501080_0060889 3300049742 Bacteria 3514
819 Ga0501080_0457458 3300049742 Bacteria 1144
820 Ga0501080_1058577 3300049742 Bacteria 702
821 Ga0501081_0013514 3300049743 Bacteria 5367
822 Ga0501081_0053978 3300049743 Bacteria 2776
823 Ga0501081_0196896 3300049743 Bacteria 1461
824 Ga0501081_1306327 3300049743 Bacteria 550
825 Ga0501083_0008307 3300049744 Bacteria 7341
826 Ga0501083_0323724 3300049744 Bacteria 1002
827 Ga0501083_0802581 3300049744 Bacteria 612
828 Ga0501035_0290597 3300049822 Bacteria 1380
829 Ga0501035_0307744 3300049822 Bacteria 1334
830 Ga0501035_0492567 3300049822 Bacteria 1010
831 Ga0501044_0005868 3300049823 Bacteria 13604
832 Ga0501044_0571033 3300049823 Bacteria 1026
833 Ga0501044_0820745 3300049823 Bacteria 808
834 Ga0501044_1437839 3300049823 Bacteria 555
835 Ga0501045_0031046 3300049824 Bacteria 3869
836 Ga0501045_0070994 3300049824 Bacteria 2563
837 Ga0501045_0080037 3300049824 Bacteria 2409
838 Ga0501045_0227833 3300049824 Bacteria 1387
839 Ga0501045_0264699 3300049824 Bacteria 1280
840 Ga0501045_1079292 3300049824 Bacteria 588
841 Ga0501045_1106923 3300049824 Bacteria 579
842 nmdc:mga03683_115859_c1 3300050489 Bacteria 1188
843 nmdc:mga03683_245891_c1 3300050489 Bacteria 830
844 nmdc:mga03683_25479_c1 3300050489 Bacteria 779
845 nmdc:mga03n38_160916_c1 3300050490 Bacteria 1137
846 nmdc:mga03n38_173244_c1 3300050490 Bacteria 1101
847 nmdc:mga03n38_24290_c1 3300050490 Bacteria 2476
848 nmdc:mga03n38_38710_c1 3300050490 Bacteria 2064
849 nmdc:mga03n38_514838_c1 3300050490 Bacteria 673
850 nmdc:mga03n38_77350_c1 3300050490 Bacteria 1555
851 nmdc:mga03n38_970207_c1 3300050490 Bacteria 502
852 nmdc:mga00v17_181264_c1 3300050491 Bacteria 1359
853 nmdc:mga00v17_21162_c1 3300050491 Bacteria 2120
854 nmdc:mga00v17_232987_c1 3300050491 Bacteria 1193
855 nmdc:mga00v17_2865_c1 3300050491 Bacteria 8837
856 nmdc:mga00v17_319662_c1 3300050491 Bacteria 1009
857 nmdc:mga00v17_565574_c1 3300050491 Bacteria 735
858 nmdc:mga00v17_59411_c1 3300050491 Bacteria 2346
859 nmdc:mga00v17_81061_c1 3300050491 Bacteria 2026
860 nmdc:mga00v17_893894_c1 3300050491 Bacteria 563
861 nmdc:mga0yw44_1163173_c1 3300050492 Bacteria 521
862 nmdc:mga0yw44_266927_c1 3300050492 Bacteria 1142
863 nmdc:mga0yw44_360395_c1 3300050492 Bacteria 980
864 nmdc:mga0yw44_40578_c1 3300050492 Bacteria 2766
865 nmdc:mga0yw44_462261_c1 3300050492 Bacteria 860
866 nmdc:mga0yw44_55869_c1 3300050492 Bacteria 2403
867 nmdc:mga0yw44_798941_c1 3300050492 Bacteria 641
868 nmdc:mga0yw44_912606_c1 3300050492 Bacteria 596
869 nmdc:mga0k408_178996_c1 3300050493 Bacteria 1264
870 nmdc:mga0k408_385677_c1 3300050493 Bacteria 834
871 nmdc:mga0k408_92305_c1 3300050493 Bacteria 1779
872 nmdc:mga06z11_10607_c1 3300050494 Bacteria 3935
873 nmdc:mga06z11_115146_c1 3300050494 Bacteria 1493
874 nmdc:mga06z11_150361_c1 3300050494 Bacteria 1323
875 nmdc:mga06z11_15280_c1 3300050494 Bacteria 3423
876 nmdc:mga06z11_163140_c1 3300050494 Bacteria 1275
877 nmdc:mga06z11_336797_c1 3300050494 Bacteria 902
878 nmdc:mga06z11_409844_c1 3300050494 Bacteria 816
879 nmdc:mga06z11_486463_c1 3300050494 Bacteria 747
880 nmdc:mga04h51_163617_c1 3300050495 Bacteria 858
881 nmdc:mga04h51_188843_c1 3300050495 Bacteria 805
882 nmdc:mga07m45_252887_c1 3300050496 Bacteria 1025
883 nmdc:mga07m45_285251_c1 3300050496 Bacteria 960
884 nmdc:mga07m45_409227_c1 3300050496 Bacteria 787
885 nmdc:mga07m45_537625_c1 3300050496 Bacteria 676
886 nmdc:mga05p37_114538_c1 3300050507 Bacteria 3314
887 nmdc:mga05p37_385664_c1 3300050507 Bacteria 1640
888 nmdc:mga09592_1241214_c1 3300050508 Bacteria 615
889 nmdc:mga09592_135569_c1 3300050508 Bacteria 2120
890 nmdc:mga09592_6888_c1 3300050508 Bacteria 9246
891 nmdc:mga09592_840952_c1 3300050508 Bacteria 774
892 nmdc:mga0qj67_10560_c1 3300050509 Bacteria 6898
893 nmdc:mga0qj67_421501_c1 3300050509 Bacteria 1076
894 nmdc:mga0qj67_532951_c1 3300050509 Bacteria 943
895 nmdc:mga0qj67_799345_c1 3300050509 Bacteria 747
896 nmdc:mga06r32_1133433_c1 3300050510 Bacteria 730
897 nmdc:mga06r32_144_c1 3300050510 Bacteria 53470
898 nmdc:mga06r32_381072_c1 3300050510 Bacteria 1393
899 nmdc:mga06r32_563808_c1 3300050510 Bacteria 1112
900 nmdc:mga08y16_211310_c1 3300050511 Bacteria 2009
901 nmdc:mga08y16_30798_c1 3300050511 Bacteria 5643
902 nmdc:mga08y16_603669_c1 3300050511 Bacteria 1106
903 nmdc:mga08y16_854947_c1 3300050511 Bacteria 899
904 nmdc:mga08y16_89079_c1 3300050511 Bacteria 3216
905 nmdc:mga0n895_782884_c1 3300050512 Bacteria 945
906 Ga0495601_0380505 3300053077 Bacteria 916
907 Ga0495601_1054197 3300053077 Bacteria 510
908 Ga0495612_0015953 3300053078 Bacteria 3010
909 Ga0495612_0560140 3300053078 Bacteria 527
910 Ga0495595_0036739 3300053084 Bacteria 2224
911 Ga0495595_0232634 3300053084 Bacteria 921
912 Ga0495619_0018926 3300053085 Bacteria 4373
913 Ga0500646_0067422 3300053090 Bacteria 1067
914 Ga0500566_0001020 3300053094 Bacteria 16145
915 Ga0500641_0325161 3300053096 Bacteria 625
916 Ga0500628_099691 3300053129 Bacteria 767
917 Ga0500628_176781 3300053129 Bacteria 608
918 Ga0500568_0040463 3300053139 Bacteria 1876
919 Ga0500616_0000457 3300053153 Bacteria 53510
920 Ga0501084_0003125 3300054114 Bacteria 13410
921 Ga0501084_0045458 3300054114 Bacteria 3676
922 Ga0501084_0182762 3300054114 Bacteria 1770
923 Ga0501084_0222675 3300054114 Bacteria 1592
924 Ga0501084_0349630 3300054114 Bacteria 1249
925 Ga0501084_0541533 3300054114 Bacteria 984
926 Ga0501084_1280620 3300054114 Bacteria 615
927 Ga0590071_105687 3300059421 Bacteria 712
928 Ga0590074_112761 3300059423 Bacteria 537
929 Ga0590075_206255 3300059424 Bacteria 520
930 Ga0587066_098204 3300059490 Bacteria 661
931 Ga0587070_025456 3300059491 Bacteria 1032
932 Ga0587070_043076 3300059491 Bacteria 872
933 Ga0587082_017000 3300059504 Bacteria 1142
934 Ga0587083_0128459 3300059505 Bacteria 663
935 Ga0587090_028526 3300059510 Bacteria 920
936 Ga0587091_077168 3300059511 Bacteria 740
937 Ga0587091_110473 3300059511 Bacteria 656
938 Ga0587125_005773 3300059607 Bacteria 1148
939 Ga0587125_027980 3300059607 Bacteria 705
940 Ga0587101_110573 3300059623 Bacteria 557
941 Ga0587115_042101 3300059626 Bacteria 717
942 Ga0587115_060412 3300059626 Bacteria 634
943 Ga0587115_089902 3300059626 Bacteria 556
944 Ga0587127_027987 3300059629 Bacteria 529
945 Ga0587128_093809 3300059630 Bacteria 620
946 Ga0587130_030647 3300059631 Bacteria 619
947 Ga0587062_093664 3300059639 Bacteria 576
948 Ga0587067_018957 3300059640 Bacteria 1160
949 Ga0587072_017400 3300059643 Bacteria 1239
950 Ga0587072_086506 3300059643 Bacteria 685
951 Ga0587072_198721 3300059643 Bacteria 509
952 Ga0587076_206630 3300059645 Bacteria 508
953 Ga0587107_115730 3300059652 Bacteria 547
954 Ga0587114_035717 3300059655 Bacteria 783
955 Ga0587114_102168 3300059655 Bacteria 560
956 Ga0587119_053175 3300059658 Bacteria 609
957 Ga0587124_033333 3300059660 Bacteria 578
958 Ga0587124_033840 3300059660 Bacteria 575
959 Ga0587071_072632 3300060344 Bacteria 752
960 Ga0587071_106855 3300060344 Bacteria 654
961 Ga0587111_0126894 3300060346 Bacteria 663
962 Ga0501082_0123612 3300060353 Bacteria 2244
963 Ga0501082_0170008 3300060353 Bacteria 1895
964 Ga0501082_0634744 3300060353 Bacteria 935
965 Ga0530510_0013749 3300061734 Bacteria 5698
966 Ga0530510_0022859 3300061734 Bacteria 4456
967 Ga0530510_0115037 3300061734 Bacteria 1972
968 Ga0530510_0131887 3300061734 Bacteria 1838
969 Ga0530510_0311154 3300061734 Bacteria 1180
970 Ga0530510_0353305 3300061734 Bacteria 1104
971 Ga0530510_0485126 3300061734 Bacteria 936
972 Ga0530510_0700627 3300061734 Bacteria 772
973 Ga0530510_1258456 3300061734 Bacteria 567
974 Ga0163163_10057215
975 Ga0070676_11545311
976 Ga0070683_101066947
977 Ga0070683_101643057
978 Ga0070683_102380673
979 Ga0070690_100055325
980 Ga0070670_101172296
981 Ga0070670_101234103
982 Ga0070677_10367387
983 Ga0068869_100557981
984 Ga0070666_10415107
985 Ga0070682_101069978
986 Ga0068868_100420040
987 Ga0068868_100902925
988 Ga0068868_101358046
989 Ga0068868_102129047
990 Ga0070689_100710917
991 Ga0070691_10471134
992 Ga0070687_100016934
993 Ga0070668_101841524
994 Ga0070669_100340587
995 Ga0070669_100473713
996 Ga0070675_100211080
997 Ga0070675_100670841
998 Ga0070671_100013725
999 Ga0070671_100398839
1000 Ga0070671_101970888
1001 Ga0070674_100036531
1002 Ga0070674_100296954
1003 Ga0070674_100350150
1004 Ga0070673_100202040
1005 Ga0070673_100321909
1006 Ga0070673_100598003
1007 Ga0070688_100036879
1008 Ga0070688_100037307
1009 Ga0070659_101055871
1010 Ga0070667_100199094
1011 Ga0070667_100323471
1012 Ga0070667_100520233
1013 Ga0070667_100617101
1014 Ga0070709_11636584
1015 Ga0070713_101574394
1016 Ga0070701_10037919
1017 Ga0070701_10206591
1018 Ga0070701_10321375
1019 Ga0070705_100660195
1020 Ga0070705_101286359
1021 Ga0070700_100147045
1022 Ga0070700_100250549
1023 Ga0070694_100599133
1024 Ga0070678_100317728
1025 Ga0070678_100360447
1026 Ga0070678_101432322
1027 Ga0070678_101631877
1028 Ga0070662_100845587
1029 Ga0068867_100005274
1030 Ga0068867_100428223
1031 Ga0068867_102061758
1032 Ga0070685_10183200
1033 Ga0070685_10920056
1034 Ga0070684_100917366
1035 Ga0070684_101309701
1036 Ga0070672_100832297
1037 Ga0070672_101936701
1038 Ga0070686_100012958
1039 Ga0070686_100524240
1040 Ga0070695_100955090
1041 Ga0070696_101740012
1042 Ga0070693_101494479
1043 Ga0070665_100146522
1044 Ga0070665_101052375
1045 Ga0070665_102536512
1046 Ga0070704_100274282
1047 Ga0070704_100334134
1048 Ga0068855_101767573
1049 Ga0070664_100329987
1050 Ga0068854_100759638
1051 Ga0070702_100298285
1052 Ga0070702_100373221
1053 Ga0070702_101431713
1054 Ga0068852_100905799
1055 Ga0068859_100135778
1056 Ga0068859_100286592
1057 Ga0068859_100759843
1058 Ga0068864_100326278
1059 Ga0068866_10002295
1060 Ga0068866_10627800
1061 Ga0068866_11459369
1062 Ga0068861_100070955
1063 Ga0068861_100445793
1064 Ga0068861_100538792
1065 Ga0068861_101228750
1066 Ga0068861_101413840
1067 Ga0068870_10118031
1068 Ga0068863_100148233
1069 Ga0068863_101163376
1070 Ga0068863_101190390
1071 Ga0068858_100013307
1072 Ga0068858_100221272
1073 Ga0068858_100397467
1074 Ga0068858_100957982
1075 Ga0068858_101424074
1076 Ga0068860_100612726
1077 Ga0068860_101434389
1078 Ga0068862_100312024
1079 Ga0081455_10202616
1080 Ga0081455_10223268
1081 Ga0081455_10330186
1082 Ga0075365_10033015
1083 Ga0075365_10036434
1084 Ga0075365_10220233
1085 Ga0075365_10261144
1086 Ga0075365_10304074
1087 Ga0075365_10507393
1088 Ga0075365_10694927
1089 Ga0075365_10890468
1090 Ga0075365_10948435
1091 Ga0075368_10042863
1092 Ga0075368_10065866
1093 Ga0075363_100056387
1094 Ga0075363_100114819
1095 Ga0075363_100129671
1096 Ga0075363_100133061
1097 Ga0075363_100176909
1098 Ga0075363_100305490
1099 Ga0075363_100530403
1100 Ga0075364_10003203
1101 Ga0075364_10106913
1102 Ga0075364_10145177
1103 Ga0075364_10182859
1104 Ga0075364_10305877
1105 Ga0075364_10322729
1106 Ga0075364_10451211
1107 Ga0075364_10968600
1108 Ga0070716_101155594
1109 Ga0070712_100951715
1110 Ga0075362_10022618
1111 Ga0075362_10253469
1112 Ga0075362_10470913
1113 Ga0075362_10480011
1114 Ga0075367_10023431
1115 Ga0075367_10037111
1116 Ga0075367_10393026
1117 Ga0075367_10465264
1118 Ga0075367_11122443
1119 Ga0075369_10097237
1120 Ga0075369_10157911
1121 Ga0075369_10221518
1122 Ga0075366_10121645
1123 Ga0075366_10144134
1124 Ga0075366_10525674
1125 Ga0075366_10825611
1126 Ga0097621_100145178
1127 Ga0097621_100482341
1128 Ga0097621_101037596
1129 Ga0075370_10064144
1130 Ga0075370_10236407
1131 Ga0075370_10465869
1132 Ga0075370_10516190
1133 Ga0068871_100147973
1134 Ga0068871_100154422
1135 Ga0068871_100567949
1136 Ga0075428_100096082
1137 Ga0075428_100531409
1138 Ga0075428_101250326
1139 Ga0075430_100010771
1140 Ga0075430_100233164
1141 Ga0075430_101193412
1142 Ga0075430_101203875
1143 Ga0075431_100000612
1144 Ga0075431_100138222
1145 Ga0075431_100351405
1146 Ga0075431_100495261
1147 Ga0075429_100045294
1148 Ga0075429_100370438
1149 Ga0068865_100197544
1150 Ga0068865_100273213
1151 Ga0068865_100395627
1152 Ga0097620_100135781
1153 Ga0097620_100286614
1154 Ga0097620_100759850
1155 Ga0105244_10272140
1156 Ga0111539_10031462
1157 Ga0111539_10443189
1158 Ga0111539_10620824
1159 Ga0111539_10709946
1160 Ga0111539_10838387
1161 Ga0111539_10929360
1162 Ga0111539_11481458
1163 Ga0111539_13049636
1164 Ga0105245_10082865
1165 Ga0105245_10180661
1166 Ga0105245_10441504
1167 Ga0105245_10654935
1168 Ga0105245_11176245
1169 Ga0105245_12159826
1170 Ga0105247_10401879
1171 Ga0114129_10125221
1172 Ga0114129_10211417
1173 Ga0114129_10916623
1174 Ga0114129_12030396
1175 Ga0114129_12201211
1176 Ga0105243_10112062
1177 Ga0105243_11049165
1178 Ga0105243_11789613
1179 Ga0105243_12659545
1180 Ga0105241_12359635
1181 Ga0105242_10023019
1182 Ga0105242_10755542
1183 Ga0105242_10815538
1184 Ga0105248_10189707
1185 Ga0105248_11034155
1186 Ga0105248_11475220
1187 Ga0105248_11618015
1188 Ga0105248_13011377
1189 Ga0105237_10232970
1190 Ga0105238_11340730
1191 Ga0105238_11627735
1192 Ga0105238_12562695
1193 Ga0105249_10069799
1194 Ga0105249_10217471
1195 Ga0105249_10239930
1196 Ga0105249_10987193
1197 Ga0105249_11307627
1198 Ga0105249_12110020
1199 Ga0105249_12577949
1200 Ga0105028_102730
1201 Ga0105239_10949639
1202 Ga0105239_11413993
1203 Ga0105246_10502772
1204 Ga0105246_10638420
1205 Ga0105246_10904191
1206 Ga0157374_10392847
1207 Ga0157374_11276872
1208 Ga0163162_10240833
1209 Ga0163162_10329577
1210 Ga0163162_10580819
1211 Ga0163162_11038542
1212 Ga0163162_11400005
1213 Ga0157375_10067378
1214 Ga0157375_10196166
1215 Ga0157375_10291697
1216 Ga0157375_10547387
1217 Ga0157375_11707788
1218 Ga0157375_12474732
1219 Ga0163163_10031797
1220 Ga0163163_11091551
1221 Ga0163163_11751673
1222 Ga0157380_10455624
1223 Ga0157380_10714276
1224 Ga0157380_10724732
1225 Ga0157380_10785060
1226 Ga0157380_11644618
1227 Ga0157380_12225063
1228 Ga0157380_13034506
1229 Ga0157377_10148633
1230 Ga0157377_10567705
1231 Ga0157377_10842877
1232 Ga0157377_11662218
1233 Ga0157379_10056359
1234 Ga0157379_10163819
1235 Ga0157376_10564535
1236 Ga0157376_12871443
1237 Ga0163161_10009926
1238 Ga0163161_10403728
1239 Ga0163161_10444798
1240 Ga0163161_11083138
1241 Ga0163161_11878978
1242 Ga0197907_10965783
1243 Ga0197907_11503367
1244 Ga0206356_10665808
1245 Ga0206355_1103962
1246 Ga0206350_11469110
1247 Ga0206354_10002648
1248 Ga0206353_10304879
1249 Ga0213874_10094341
1250 Ga0224712_10298503
1251 Ga0207666_1027523
1252 Ga0207682_10052856
1253 Ga0207692_10465357
1254 Ga0207642_10378854
1255 Ga0207642_10414971
1256 Ga0207688_10114826
1257 Ga0207688_10126143
1258 Ga0207688_10301323
1259 Ga0207688_10479759
1260 Ga0207680_10217365
1261 Ga0207680_10829797
1262 Ga0207645_10393078
1263 Ga0207645_10630708
1264 Ga0207643_10807027
1265 Ga0207705_10982342
1266 Ga0207671_10464687
1267 Ga0207663_10381137
1268 Ga0207662_10208052
1269 Ga0207662_10835730
1270 Ga0207649_10967547
1271 Ga0207681_10436063
1272 Ga0207650_10470220
1273 Ga0207650_11877793
1274 Ga0207659_10076979
1275 Ga0207687_10177154
1276 Ga0207687_10228757
1277 Ga0207687_10348576
1278 Ga0207687_11152739
1279 Ga0207687_11383220
1280 Ga0207700_10764789
1281 Ga0207664_11049277
1282 Ga0207644_10005852
1283 Ga0207644_10344569
1284 Ga0207706_10043057
1285 Ga0207706_11494756
1286 Ga0207686_10015332
1287 Ga0207686_10790596
1288 Ga0207686_11525291
1289 Ga0207709_10011292
1290 Ga0207709_10100851
1291 Ga0207709_10173949
1292 Ga0207709_10373721
1293 Ga0207709_10736299
1294 Ga0207709_10911690
1295 Ga0207670_10694245
1296 Ga0207669_10036491
1297 Ga0207669_10095068
1298 Ga0207669_10227009
1299 Ga0207669_10558742
1300 Ga0207669_10886341
1301 Ga0207704_10345890
1302 Ga0207665_11305115
1303 Ga0207691_10187293
1304 Ga0207691_10650737
1305 Ga0207711_10113749
1306 Ga0207711_10631387
1307 Ga0207689_10547598
1308 Ga0207661_11088365
1309 Ga0207661_12093907
1310 Ga0207679_10874373
1311 Ga0207651_10507552
1312 Ga0207712_10098406
1313 Ga0207712_10250521
1314 Ga0207712_10414364
1315 Ga0207712_11262790
1316 Ga0207668_10237493
1317 Ga0207668_10238217
1318 Ga0207668_10650303
1319 Ga0207640_10493140
1320 Ga0207640_11920924
1321 Ga0207658_10275261
1322 Ga0207658_10477239
1323 Ga0207658_11647989
1324 Ga0207677_10233374
1325 Ga0207677_10769546
1326 Ga0207677_11746768
1327 Ga0207703_10004895
1328 Ga0207703_10084486
1329 Ga0207703_10386564
1330 Ga0207703_10535780
1331 Ga0207703_10570366
1332 Ga0207703_10790423
1333 Ga0207703_12183680
1334 Ga0207639_10996563
1335 Ga0207639_11964501
1336 Ga0207678_10291974
1337 Ga0207678_11519500
1338 Ga0207708_10149303
1339 Ga0207708_10362927
1340 Ga0207702_11225191
1341 Ga0207641_10070929
1342 Ga0207641_11363224
1343 Ga0207648_10018524
1344 Ga0207648_10208463
1345 Ga0207648_10750700
1346 Ga0207676_10101802
1347 Ga0207676_10836313
1348 Ga0207676_11269749
1349 Ga0207676_11304338
1350 Ga0207674_12209858
1351 Ga0207675_100015959
1352 Ga0207675_100050481
1353 Ga0207675_100076174
1354 Ga0207675_100189885
1355 Ga0207675_100743419
1356 Ga0207675_101622567
1357 Ga0207675_101695261
1358 Ga0207683_10207043
1359 Ga0207683_10395145
1360 Ga0207683_10723739
1361 Ga0207698_10138046
1362 Ga0209984_1063339
1363 Ga0209971_1034789
1364 Ga0209998_10141539
1365 Ga0209813_10014671
1366 Ga0209813_10029126
1367 Ga0209813_10140148
1368 Ga0209813_10187584
1369 Ga0209974_10162297
1370 Ga0207428_10014181
1371 Ga0207428_10358375
1372 Ga0207428_10766715
1373 Ga0268266_10739563
1374 Ga0268265_11104220
1375 Ga0268264_10041718
1376 Ga0268264_10346527
1377 Ga0268264_10547173
1378 Ga0265326_10080609
1379 Ga0265327_10010527
1380 Ga0307408_102072257
1381 Ga0316575_10022587
1382 Ga0316579_10123523
1383 Ga0316579_10145896
1384 Ga0316576_10005282
1385 Ga0316576_10047479
1386 Ga0316576_10091464
1387 Ga0316576_10203026
1388 Ga0316576_10275687
1389 Ga0316576_11286442
1390 Ga0316578_10058254
1391 Ga0316578_10188582
1392 Ga0316578_10215238
1393 Ga0316578_10598518
1394 Ga0316578_10896610
1395 Ga0307405_10763776
1396 Ga0316577_10238440
1397 Ga0316577_10878534
1398 Ga0307413_10070340
1399 Ga0307410_10099480
1400 Ga0307410_10157027
1401 Ga0307410_11154375
1402 Ga0307406_11424586
1403 Ga0307407_10023157
1404 Ga0307407_10136173
1405 Ga0307407_10174024
1406 Ga0307412_10305293
1407 Ga0307412_10337452
1408 Ga0307412_11257387
1409 Ga0307409_100003770
1410 Ga0307409_100006795
1411 Ga0307409_100522735
1412 Ga0307409_101978104
1413 Ga0307409_102212936
1414 Ga0307409_102722390
1415 Ga0307416_100358692
1416 Ga0307416_100502341
1417 Ga0307414_10204555
1418 Ga0307414_10658037
1419 Ga0307414_11940198
1420 Ga0307411_10145068
1421 Ga0307415_100039453
1422 Ga0307415_100054123
1423 Ga0307415_100885322
1424 Ga0316585_10075716
1425 Ga0316580_10042547
1426 Ga0316580_10214668
1427 Ga0316586_1114453
1428 Ga0316596_1008695
1429 Ga0316596_1016974
1430 Ga0373928_0139931
1431 Ga0373949_0186101
1432 Ga0373939_0099887
1433 Ga0373941_0343921
1434 Ga0373960_0177514
1435 Ga0316574_0005901
1436 Ga0316574_0021651
1437 Ga0316574_0029826
1438 Ga0316574_0046950
1439 Ga0316574_0069573
1440 Ga0316574_0112668
1441 Ga0316574_0276920
1442 Ga0316574_0348180
1443 Ga0316574_0713571
1444 Ga0373931_0183286
1445 Ga0373931_1077316
1446 Ga0373931_1223679
1447 Ga0316582_0034196
1448 Ga0316584_0003705
1449 Ga0316584_0527525
1450 Ga0316584_0987243
1451 Ga0373925_0771121
1452 Ga0400483_006841
1453 Ga0400483_007036
1454 Ga0400483_010748
1455 Ga0400483_077252
1456 Ga0400483_104651
1457 Ga0400483_148410
1458 Ga0400483_150100
1459 Ga0400483_179186
1460 Ga0400483_220471
1461 Ga0400483_220481
1462 Ga0400483_258026
1463 Ga0436365_0795719
1464 Ga0439447_060303
1465 Ga0439461_0190057
1466 Ga0451791_0208836
1467 Ga0451791_0711832
1468 Ga0451791_0767930
1469 Ga0451791_0869931
1470 Ga0451791_1650700
1471 Ga0451791_1794192
1472 Ga0451793_0248178
1473 Ga0451797_1468140
1474 Ga0451800_1689637
1475 Ga0451802_0913525
1476 Ga0451802_1621887
1477 Ga0451807_0410089
1478 Ga0451833_1029105
1479 Ga0451835_0857280
1480 Ga0451837_0317183
1481 Ga0451839_0752461
1482 Ga0451841_0427574
1483 Ga0451841_0452739
1484 Ga0451847_0286056
1485 Ga0451847_0747282
1486 Ga0451849_0007537
1487 Ga0451849_1095960
1488 Ga0451843_0856430
1489 Ga0451843_1318818
1490 Ga0451855_0817411
1491 Ga0451855_1177845
1492 Ga0451855_1495184
1493 Ga0451853_1622660
1494 Ga0451853_1817403
1495 Ga0451853_2880310
1496 Ga0451853_3179491
1497 Ga0439445_0099936
1498 Ga0439432_181276
1499 Ga0439449_0374640
1500 Ga0439446_0160145
1501 Ga0439434_0014033
1502 Ga0439435_0109772
1503 Ga0451577_0001613
1504 Ga0439440_0093959
1505 Ga0453684_0243023
1506 Ga0453684_1437239
1507 Ga0466967_0746517
1508 Ga0466967_0958503
1509 Ga0495592_0004286
1510 Ga0495603_0260093
1511 Ga0495603_0886407
1512 Ga0495638_0371357
1513 Ga0495641_0057889
1514 Ga0495651_0436732
1515 Ga0495653_0001345
1516 Ga0495653_0148948
1517 Ga0495582_0289112
1518 Ga0495662_0093102
1519 Ga0495664_0211175
1520 Ga0495594_0785679
1521 Ga0495608_0075595
1522 Ga0495608_0111557
1523 Ga0495628_0002818
1524 Ga0495628_0006457
1525 Ga0495630_0009175
1526 Ga0495630_0011734
1527 Ga0495630_0382973
1528 Ga0495630_0434548
1529 Ga0495644_0442363
1530 Ga0495666_0006469
1531 Ga0495652_0501216
1532 Ga0495654_0277787
1533 Ga0495665_0412234
1534 Ga0495640_0037494
1535 Ga0495640_0956774
1536 Ga0495586_0602456
1537 Ga0495587_0194855
1538 Ga0495587_0329609
1539 Ga0495645_0276416
1540 Ga0495667_0067324
1541 Ga0495667_0078450
1542 Ga0495667_0779857
1543 Ga0495634_0120686
1544 Ga0495634_0200633
1545 Ga0495657_0026092
1546 Ga0495657_0442610
1547 Ga0495646_0210802
1548 Ga0495647_0190840
1549 Ga0495658_0033714
1550 Ga0495658_0079391
1551 Ga0495658_0178948
1552 Ga0495658_0235300
1553 Ga0495613_0117946
1554 Ga0495613_0213280
1555 Ga0495624_0215430
1556 Ga0495624_0260385
1557 Ga0495670_0693686
1558 Ga0495649_0131634
1559 Ga0495600_0842569
1560 Ga0495604_0074223
1561 Ga0495604_0706660
1562 Ga0495674_0063018
1563 Ga0495674_0097226
1564 Ga0495674_0235006
1565 Ga0495674_0380044
1566 Ga0495672_0215069
1567 Ga0495672_0239400
1568 Ga0495676_0124390
1569 Ga0495676_0210757
1570 Ga0495680_0075209
1571 Ga0495680_0148813
1572 Ga0495680_0328567
1573 Ga0495680_0602459
1574 Ga0495675_0119303
1575 Ga0495684_0019831
1576 Ga0495684_0382724
1577 Ga0495686_0486215
1578 Ga0495593_0331474
1579 Ga0495602_0369715
1580 Ga0495614_0664631
1581 Ga0496100_0099940
1582 Ga0496100_0107762
1583 Ga0496100_0745706
1584 Ga0496100_1087342
1585 Ga0496100_1463057
1586 Ga0496101_0026438
1587 Ga0496101_0369391
1588 Ga0496101_1002466
1589 Ga0496102_0084297
1590 Ga0496102_0162582
1591 Ga0496102_0178238
1592 Ga0496102_0195923
1593 Ga0496102_0652891
1594 Ga0496102_0807918
1595 Ga0496102_1972752
1596 Ga0496103_0026219
1597 Ga0496103_0387073
1598 Ga0496103_0406269
1599 Ga0496103_0781423
1600 Ga0496104_0017186
1601 Ga0496104_0272275
1602 Ga0496104_0279735
1603 Ga0496104_0518243
1604 Ga0496104_1819767
1605 Ga0496105_0050197
1606 Ga0496105_0098162
1607 Ga0496105_0305625
1608 Ga0496105_1416904
1609 Ga0496105_1426761
1610 Ga0496106_0077237
1611 Ga0496106_0877456
1612 Ga0496107_0106155
1613 Ga0496107_0500837
1614 Ga0496108_0091207
1615 Ga0496108_0096922
1616 Ga0496108_0497631
1617 Ga0496108_0682423
1618 Ga0496108_0724659
1619 Ga0496109_0064933
1620 Ga0496109_0115670
1621 Ga0496109_0148344
1622 Ga0496109_0324728
1623 Ga0496109_0430685
1624 Ga0496109_0811092
1625 Ga0496109_1356732
1626 Ga0496110_0040289
1627 Ga0496110_0045608
1628 Ga0496110_0053678
1629 Ga0496110_0076763
1630 Ga0496110_0084551
1631 Ga0496110_0144397
1632 Ga0496110_0334725
1633 Ga0496110_0573413
1634 Ga0496110_1171805
1635 Ga0496110_1187022
1636 Ga0496111_0017855
1637 Ga0496111_0022101
1638 Ga0496111_0369265
1639 Ga0496111_0437947
1640 Ga0496111_0468330
1641 Ga0496111_0637046
1642 Ga0496111_0862359
1643 Ga0496112_0138869
1644 Ga0496113_0105580
1645 Ga0496113_0542336
1646 Ga0496113_0731462
1647 Ga0496114_0026480
1648 Ga0496114_0139799
1649 Ga0496114_0225933
1650 Ga0496114_0433327
1651 Ga0496114_0436936
1652 Ga0496114_0562610
1653 Ga0496114_0591961
1654 Ga0496114_0829154
1655 Ga0496115_0628505
1656 Ga0496115_0841469
1657 Ga0501306_035519
1658 Ga0501306_049985
1659 Ga0501306_108947
1660 Ga0501309_069249
1661 Ga0501310_057109
1662 Ga0501315_062883
1663 Ga0501317_032437
1664 Ga0501317_045333
1665 Ga0501317_063172
1666 Ga0501317_102537
1667 Ga0501323_044902
1668 Ga0501323_081473
1669 Ga0501325_049274
1670 Ga0501031_0044387
1671 Ga0501031_0390721
1672 Ga0501031_0505342
1673 Ga0501031_0829011
1674 Ga0501032_0103920
1675 Ga0501033_0000342
1676 Ga0501033_0095175
1677 Ga0501033_0382339
1678 Ga0501034_0000986
1679 Ga0501034_0004559
1680 Ga0501034_0020259
1681 Ga0501034_0044468
1682 Ga0501034_0119073
1683 Ga0501034_0728669
1684 Ga0501034_1675536
1685 Ga0501036_0058738
1686 Ga0501036_0063663
1687 Ga0501036_0134217
1688 Ga0501036_0535756
1689 Ga0501036_1449231
1690 Ga0501037_0008590
1691 Ga0501037_0274867
1692 Ga0501038_0072945
1693 Ga0501038_0099878
1694 Ga0501038_0341242
1695 Ga0501038_0470481
1696 Ga0501038_1160869
1697 Ga0501039_0090597
1698 Ga0501039_0100116
1699 Ga0501039_0211351
1700 Ga0501039_0326852
1701 Ga0501039_0449650
1702 Ga0501039_0641598
1703 Ga0501039_0786407
1704 Ga0501040_0019713
1705 Ga0501040_0082569
1706 Ga0501040_0135739
1707 Ga0501040_0226074
1708 Ga0501040_0741137
1709 Ga0501041_0114891
1710 Ga0501041_0139992
1711 Ga0501041_0548932
1712 Ga0501041_0650860
1713 Ga0501041_0714881
1714 Ga0501042_0064879
1715 Ga0501042_0166616
1716 Ga0501042_0262718
1717 Ga0501042_0385006
1718 Ga0501042_0802080
1719 Ga0501042_0875397
1720 Ga0501043_0415277
1721 Ga0501043_0911731
1722 Ga0501043_0997999
1723 Ga0501046_0071588
1724 Ga0501046_0086291
1725 Ga0501047_0104338
1726 Ga0501047_0561446
1727 Ga0501047_1194350
1728 Ga0501048_0021691
1729 Ga0501048_0029208
1730 Ga0501048_0067116
1731 Ga0501048_0177704
1732 Ga0501048_0228192
1733 Ga0501067_0185612
1734 Ga0501067_0714788
1735 Ga0501068_0000178
1736 Ga0501068_0705457
1737 Ga0501068_0713444
1738 Ga0501069_0002824
1739 Ga0501069_0047414
1740 Ga0501069_0714173
1741 Ga0501069_0792729
1742 Ga0501070_0001076
1743 Ga0501070_0276684
1744 Ga0501070_1390880
1745 Ga0501071_0019510
1746 Ga0501071_0034603
1747 Ga0501071_0195580
1748 Ga0501071_0385210
1749 Ga0501071_1334536
1750 Ga0501071_1382212
1751 Ga0501071_1480784
1752 Ga0501072_0006449
1753 Ga0501072_0009386
1754 Ga0501072_0145705
1755 Ga0501072_0230485
1756 Ga0501072_0439329
1757 Ga0501072_0573533
1758 Ga0501072_0916398
1759 Ga0501073_0000128
1760 Ga0501073_0000908
1761 Ga0501073_0780429
1762 Ga0501073_1162528
1763 Ga0501074_0000373
1764 Ga0501074_0064860
1765 Ga0501074_0075039
1766 Ga0501074_0130883
1767 Ga0501074_0225732
1768 Ga0501074_0259751
1769 Ga0501074_1160444
1770 Ga0501074_1260301
1771 Ga0501075_0110251
1772 Ga0501075_0174259
1773 Ga0501075_0336516
1774 Ga0501075_0352245
1775 Ga0501075_0654350
1776 Ga0501075_0735294
1777 Ga0501076_0059177
1778 Ga0501076_0168710
1779 Ga0501076_0198184
1780 Ga0501076_1154720
1781 Ga0501076_1285356
1782 Ga0501076_1388374
1783 Ga0501077_0175886
1784 Ga0501077_0413784
1785 Ga0501077_0423625
1786 Ga0501079_0037457
1787 Ga0501079_0059608
1788 Ga0501079_0264394
1789 Ga0501079_0951735
1790 Ga0501080_0015388
1791 Ga0501080_0060889
1792 Ga0501080_0457458
1793 Ga0501080_1058577
1794 Ga0501081_0013514
1795 Ga0501081_0053978
1796 Ga0501081_0196896
1797 Ga0501081_1306327
1798 Ga0501083_0008307
1799 Ga0501083_0323724
1800 Ga0501083_0802581
1801 Ga0501035_0290597
1802 Ga0501035_0307744
1803 Ga0501035_0492567
1804 Ga0501044_0005868
1805 Ga0501044_0571033
1806 Ga0501044_0820745
1807 Ga0501044_1437839
1808 Ga0501045_0031046
1809 Ga0501045_0070994
1810 Ga0501045_0080037
1811 Ga0501045_0227833
1812 Ga0501045_0264699
1813 Ga0501045_1079292
1814 Ga0501045_1106923
1815 nmdc:mga03683_115859_c1
1816 nmdc:mga03683_245891_c1
1817 nmdc:mga03683_25479_c1
1818 nmdc:mga03n38_160916_c1
1819 nmdc:mga03n38_173244_c1
1820 nmdc:mga03n38_24290_c1
1821 nmdc:mga03n38_38710_c1
1822 nmdc:mga03n38_514838_c1
1823 nmdc:mga03n38_77350_c1
1824 nmdc:mga03n38_970207_c1
1825 nmdc:mga00v17_181264_c1
1826 nmdc:mga00v17_21162_c1
1827 nmdc:mga00v17_232987_c1
1828 nmdc:mga00v17_2865_c1
1829 nmdc:mga00v17_319662_c1
1830 nmdc:mga00v17_565574_c1
1831 nmdc:mga00v17_59411_c1
1832 nmdc:mga00v17_81061_c1
1833 nmdc:mga00v17_893894_c1
1834 nmdc:mga0yw44_1163173_c1
1835 nmdc:mga0yw44_266927_c1
1836 nmdc:mga0yw44_360395_c1
1837 nmdc:mga0yw44_40578_c1
1838 nmdc:mga0yw44_462261_c1
1839 nmdc:mga0yw44_55869_c1
1840 nmdc:mga0yw44_798941_c1
1841 nmdc:mga0yw44_912606_c1
1842 nmdc:mga0k408_178996_c1
1843 nmdc:mga0k408_385677_c1
1844 nmdc:mga0k408_92305_c1
1845 nmdc:mga06z11_10607_c1
1846 nmdc:mga06z11_115146_c1
1847 nmdc:mga06z11_150361_c1
1848 nmdc:mga06z11_15280_c1
1849 nmdc:mga06z11_163140_c1
1850 nmdc:mga06z11_336797_c1
1851 nmdc:mga06z11_409844_c1
1852 nmdc:mga06z11_486463_c1
1853 nmdc:mga04h51_163617_c1
1854 nmdc:mga04h51_188843_c1
1855 nmdc:mga07m45_252887_c1
1856 nmdc:mga07m45_285251_c1
1857 nmdc:mga07m45_409227_c1
1858 nmdc:mga07m45_537625_c1
1859 nmdc:mga05p37_114538_c1
1860 nmdc:mga05p37_385664_c1
1861 nmdc:mga09592_1241214_c1
1862 nmdc:mga09592_135569_c1
1863 nmdc:mga09592_6888_c1
1864 nmdc:mga09592_840952_c1
1865 nmdc:mga0qj67_10560_c1
1866 nmdc:mga0qj67_421501_c1
1867 nmdc:mga0qj67_532951_c1
1868 nmdc:mga0qj67_799345_c1
1869 nmdc:mga06r32_1133433_c1
1870 nmdc:mga06r32_144_c1
1871 nmdc:mga06r32_381072_c1
1872 nmdc:mga06r32_563808_c1
1873 nmdc:mga08y16_211310_c1
1874 nmdc:mga08y16_30798_c1
1875 nmdc:mga08y16_603669_c1
1876 nmdc:mga08y16_854947_c1
1877 nmdc:mga08y16_89079_c1
1878 nmdc:mga0n895_782884_c1
1879 Ga0495601_0380505
1880 Ga0495601_1054197
1881 Ga0495612_0015953
1882 Ga0495612_0560140
1883 Ga0495595_0036739
1884 Ga0495595_0232634
1885 Ga0495619_0018926
1886 Ga0500646_0067422
1887 Ga0500566_0001020
1888 Ga0500641_0325161
1889 Ga0500628_099691
1890 Ga0500628_176781
1891 Ga0500568_0040463
1892 Ga0500616_0000457
1893 Ga0501084_0003125
1894 Ga0501084_0045458
1895 Ga0501084_0182762
1896 Ga0501084_0222675
1897 Ga0501084_0349630
1898 Ga0501084_0541533
1899 Ga0501084_1280620
1900 Ga0590071_105687
1901 Ga0590074_112761
1902 Ga0590075_206255
1903 Ga0587066_098204
1904 Ga0587070_025456
1905 Ga0587070_043076
1906 Ga0587082_017000
1907 Ga0587083_0128459
1908 Ga0587090_028526
1909 Ga0587091_077168
1910 Ga0587091_110473
1911 Ga0587125_005773
1912 Ga0587125_027980
1913 Ga0587101_110573
1914 Ga0587115_042101
1915 Ga0587115_060412
1916 Ga0587115_089902
1917 Ga0587127_027987
1918 Ga0587128_093809
1919 Ga0587130_030647
1920 Ga0587062_093664
1921 Ga0587067_018957
1922 Ga0587072_017400
1923 Ga0587072_086506
1924 Ga0587072_198721
1925 Ga0587076_206630
1926 Ga0587107_115730
1927 Ga0587114_035717
1928 Ga0587114_102168
1929 Ga0587119_053175
1930 Ga0587124_033333
1931 Ga0587124_033840
1932 Ga0587071_072632
1933 Ga0587071_106855
1934 Ga0587111_0126894
1935 Ga0501082_0123612
1936 Ga0501082_0170008
1937 Ga0501082_0634744
1938 Ga0530510_0013749
1939 Ga0530510_0022859
1940 Ga0530510_0115037
1941 Ga0530510_0131887
1942 Ga0530510_0311154
1943 Ga0530510_0353305
1944 Ga0530510_0485126
1945 Ga0530510_0700627
1946 Ga0530510_1258456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

22

82

0.85

Map