F487170

General Info

Members Datasets Scaffolds Average Seq Length
972 495 857 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904690495|2904696288
Length 292
Sequence EAARAAAEAAPEPAKHASEAASEQGSRNLVMRVVAALVLAPVAIMLAYVGGIAWTLLVTLAAIGLFVEWLMVTDVGRELRVVGPGVAALLLAGLGLIAGRIDAALIVLAIGAVAVALTSGERRNWATAGLLYAAAAEVASVLVRLDTAKGFGALMFVLLVVWVTDIGGYFAGRSIGGPKLWVRISPKKTWAGAIGGFAASLLVAAGFAAFEIGSTAPLLVLGALLSVVSQLGDLFESAVKRRFGVKDSSHIIPGHGGVLDRLDGFVAAVIVAAILGFVRGGADGVGRGLMVW

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
13 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2643221651 Afipia sp. Root123D2 Isolate Unclassified
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
21 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
22 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
23 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
24 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
25 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
26 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
27 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
28 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
29 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
30 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
31 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
34 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355256 Rhizobium sp. M10 Isolate Nodule
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
39 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
40 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
41 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
42 2838048938 Rhizobium pisi 27/80 Isolate Nodule
43 2838061910 Rhizobium phaseoli L15 Isolate Nodule
44 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
45 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
46 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
47 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
48 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
49 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
50 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
51 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
52 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
53 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
54 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
55 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
56 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
57 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
58 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
59 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
60 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
61 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
62 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
63 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
64 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
65 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
66 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
67 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
68 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
69 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
70 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
71 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
72 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
73 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
74 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
75 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
76 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
77 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
78 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
79 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
80 2904699407
81 2906610324
82 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
83 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
84 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
85 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
86 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
87 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
88 2922425934
89 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
90 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
91 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
92 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
93 2933599457 Rhizobium phaseoli M3 Isolate Nodule
94 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
95 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
96 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
97 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
98 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
99 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
100 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
101 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
102 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
103 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
104 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
105 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
106 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
108 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
109 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
110 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
112 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
113 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
114 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
115 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
116 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
117 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
118 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
119 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
120 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
121 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
122 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
123 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
124 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
125 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
128 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
129 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
130 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
131 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
134 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
135 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
136 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
137 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
141 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
142 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
143 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
144 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
153 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
154 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
162 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
163 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
164 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
165 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
166 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
167 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
168 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
172 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
176 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
177 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
180 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
192 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
193 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
194 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
195 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
196 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
197 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
198 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
200 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
201 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
202 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
253 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
255 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
256 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
261 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
262 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
263 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
264 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
265 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
268 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
275 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
281 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
282 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
283 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
284 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
305 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
306 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
325 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
376 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
377 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
387 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
405 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
421 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
422 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
428 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
439 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
442 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
446 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
447 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
448 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
449 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
450 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
451 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
452 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
453 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
454 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
455 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
456 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
457 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
458 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
459 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
460 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
463 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
464 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
465 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
466 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
467 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
468 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
469 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
470 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
471 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
472 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
473 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
474 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
475 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
478 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
479 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
480 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
481 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
482 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
483 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
484 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
485 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
486 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
487 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
488 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
489 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
490 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
491 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
492 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
493 8024501048 Rhizobium sp. H4 Isolate Nodule
494 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
495 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.34
Metatranscriptomes 0.1
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.98
Nodule 11.42
Rhizoplane 5.76
Rhizosphere 63.68
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000011 3300002704 Bacteria 207685
2 JGI25156J39149_1000027 3300002705 Bacteria 127396
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25162J39368_1002279 3300002737 Bacteria 7737
5 JGI25154J39366_1000057 3300002738 Bacteria 110584
6 JGI25157J39369_1000010 3300002741 Bacteria 207685
7 JGI25406J46586_10000070 3300003203 Bacteria 46611
8 JGI25406J46586_10003047 3300003203 Bacteria 7890
9 JGI25406J46586_10018431 3300003203 Bacteria 2868
10 JGI25165J46597_1001792 3300003214 Bacteria 9172
11 JGI25153J46596_10010551 3300003215 Bacteria 4168
12 JGI25160J50197_1008364 3300003354 Bacteria 3948
13 JGI25160J50197_1008754 3300003354 Bacteria 3829
14 JGI25404J52841_10000116 3300003659 Bacteria 8083
15 JGI25404J52841_10001163 3300003659 Bacteria 4475
16 Ga0055524_1016278 3300003775 Bacteria 2674
17 Ga0055524_1019303 3300003775 Bacteria 2335
18 Ga0055524_1029987 3300003775 Bacteria 1595
19 Ga0055528_1006461 3300003790 Bacteria 5317
20 Ga0055531_10007514 3300003794 Bacteria 5927
21 Ga0055543_1005252 3300004625 Bacteria 3340
22 Ga0065165_1007304 3300005262 Bacteria 5476
23 Ga0065165_1022430 3300005262 Bacteria 2164
24 Ga0070658_10137963 3300005327 Bacteria 2036
25 Ga0070658_10569759 3300005327 Bacteria 980
26 Ga0070683_100006551 3300005329 Bacteria 9780
27 Ga0070683_100013368 3300005329 Bacteria 7157
28 Ga0070683_100014283 3300005329 Bacteria 6943
29 Ga0068869_100189427 3300005334 Bacteria 1617
30 Ga0070680_100011442 3300005336 Bacteria 6865
31 Ga0070680_100023908 3300005336 Bacteria 4877
32 Ga0070680_100306071 3300005336 Bacteria 1348
33 Ga0070682_100138662 3300005337 Bacteria 1655
34 Ga0070682_100149109 3300005337 Bacteria 1603
35 Ga0068868_100024123 3300005338 Bacteria 4611
36 Ga0070660_100008040 3300005339 Bacteria 7373
37 Ga0070660_100103114 3300005339 Bacteria 2262
38 Ga0070691_10221549 3300005341 Bacteria 1003
39 Ga0070661_100470866 3300005344 Bacteria 1002
40 Ga0070668_100005342 3300005347 Bacteria 9534
41 Ga0070671_100086709 3300005355 Bacteria 2620
42 Ga0070671_100100233 3300005355 Bacteria 2430
43 Ga0070673_100286700 3300005364 Bacteria 1446
44 Ga0070709_10000310 3300005434 Bacteria 30908
45 Ga0070709_10031725 3300005434 Bacteria 3180
46 Ga0070709_10182392 3300005434 Bacteria 1475
47 Ga0070714_100008130 3300005435 Bacteria 8175
48 Ga0070714_100042796 3300005435 Bacteria 3828
49 Ga0070713_100021728 3300005436 Bacteria 4943
50 Ga0070713_100030030 3300005436 Bacteria 4311
51 Ga0070713_100115699 3300005436 Bacteria 2344
52 Ga0070713_100150200 3300005436 Bacteria 2072
53 Ga0070713_100204497 3300005436 Bacteria 1785
54 Ga0070713_100266642 3300005436 Bacteria 1567
55 Ga0070713_100375896 3300005436 Bacteria 1323
56 Ga0070710_10003001 3300005437 Bacteria 8024
57 Ga0070710_10005946 3300005437 Bacteria 5826
58 Ga0070710_10013542 3300005437 Bacteria 4088
59 Ga0070710_10013756 3300005437 Bacteria 4060
60 Ga0070711_100007725 3300005439 Bacteria 6551
61 Ga0070711_100014986 3300005439 Bacteria 4898
62 Ga0070711_100066115 3300005439 Bacteria 2531
63 Ga0070708_100349258 3300005445 Bacteria 1394
64 Ga0070663_100038934 3300005455 Bacteria 3320
65 Ga0070663_100091183 3300005455 Bacteria 2258
66 Ga0070678_100233421 3300005456 Bacteria 1535
67 Ga0070678_100376999 3300005456 Bacteria 1226
68 Ga0070681_10062013 3300005458 Bacteria 3713
69 Ga0070681_10120655 3300005458 Bacteria 2556
70 Ga0070681_10361193 3300005458 Bacteria 1362
71 Ga0070698_100336120 3300005471 Bacteria 1442
72 Ga0070679_100023927 3300005530 Bacteria 5984
73 Ga0070679_100378437 3300005530 Bacteria 1362
74 Ga0070684_100012368 3300005535 Bacteria 6837
75 Ga0070684_100106419 3300005535 Bacteria 2511
76 Ga0070684_100176277 3300005535 Bacteria 1943
77 Ga0070697_100412396 3300005536 Bacteria 1173
78 Ga0068853_100010883 3300005539 Bacteria 7368
79 Ga0068853_100011456 3300005539 Bacteria 7207
80 Ga0068853_100102014 3300005539 Bacteria 2539
81 Ga0068853_100246035 3300005539 Bacteria 1640
82 Ga0070693_100081143 3300005547 Bacteria 1934
83 Ga0070665_100149718 3300005548 Bacteria 2337
84 Ga0070665_100398255 3300005548 Bacteria 1384
85 Ga0068855_100038066 3300005563 Bacteria 5716
86 Ga0068855_100083944 3300005563 Bacteria 3689
87 Ga0068855_100105358 3300005563 Bacteria 3242
88 Ga0068855_100235270 3300005563 Bacteria 2049
89 Ga0068855_100283484 3300005563 Bacteria 1839
90 Ga0068855_100492181 3300005563 Bacteria 1334
91 Ga0068857_100006838 3300005577 Bacteria 9816
92 Ga0068857_100052409 3300005577 Bacteria 3620
93 Ga0068854_100027544 3300005578 Bacteria 3918
94 Ga0068856_100006824 3300005614 Bacteria 11171
95 Ga0068852_100007152 3300005616 Bacteria 8132
96 Ga0068852_100327976 3300005616 Bacteria 1488
97 Ga0068852_100449513 3300005616 Bacteria 1275
98 Ga0068851_10009128 3300005834 Bacteria 4606
99 Ga0068858_100154655 3300005842 Bacteria 2157
100 Ga0068860_100000469 3300005843 Bacteria 50219
101 Ga0081455_10005182 3300005937 Bacteria 14347
102 Ga0081455_10010602 3300005937 Bacteria 9323
103 Ga0081455_10020599 3300005937 Bacteria 6205
104 Ga0081540_1000194 3300005983 Bacteria 62934
105 Ga0081540_1004830 3300005983 Bacteria 10155
106 Ga0081540_1044943 3300005983 Bacteria 2249
107 Ga0081539_10000250 3300005985 Bacteria 125352
108 Ga0081539_10000269 3300005985 Bacteria 119082
109 Ga0070717_10002902 3300006028 Bacteria 12176
110 Ga0070717_10211271 3300006028 Bacteria 1703
111 Ga0075364_10073751 3300006051 Bacteria 2250
112 Ga0070712_100010474 3300006175 Bacteria 5852
113 Ga0070712_100016083 3300006175 Bacteria 4827
114 Ga0070712_100069625 3300006175 Bacteria 2511
115 Ga0070712_100083278 3300006175 Bacteria 2322
116 Ga0070712_100194091 3300006175 Bacteria 1591
117 Ga0075367_10348013 3300006178 Bacteria 935
118 Ga0075369_10000673 3300006186 Bacteria 10899
119 Ga0075369_10003758 3300006186 Bacteria 5552
120 Ga0075369_10027572 3300006186 Bacteria 2375
121 Ga0097621_100098471 3300006237 Bacteria 2456
122 Ga0075434_100026275 3300006871 Bacteria 5702
123 Ga0075434_100048322 3300006871 Bacteria 4222
124 Ga0068865_100262939 3300006881 Bacteria 1367
125 Ga0075436_100012308 3300006914 Bacteria 5862
126 Ga0099824_1024504 3300006942 Bacteria 3514
127 Ga0099822_1001268 3300006943 Bacteria 28825
128 Ga0099823_1033009 3300006944 Bacteria 4179
129 Ga0099794_10018633 3300007265 Bacteria 3115
130 Ga0099794_10074857 3300007265 Bacteria 1663
131 Ga0099795_10007245 3300007788 Bacteria 3082
132 Ga0099795_10022566 3300007788 Bacteria 2079
133 Ga0099795_10135524 3300007788 Bacteria 997
134 Ga0105250_10048216 3300009092 Bacteria 1709
135 Ga0105240_10013520 3300009093 Bacteria 11205
136 Ga0105240_10083717 3300009093 Bacteria 3913
137 Ga0105240_10210667 3300009093 Bacteria 2271
138 Ga0105240_10250326 3300009093 Bacteria 2049
139 Ga0105245_10033536 3300009098 Bacteria 4552
140 Ga0105245_10192066 3300009098 Bacteria 1956
141 Ga0105245_10655061 3300009098 Bacteria 1081
142 Ga0105247_10204573 3300009101 Bacteria 1328
143 Ga0105247_10392264 3300009101 Bacteria 987
144 Ga0105247_10417599 3300009101 Bacteria 960
145 Ga0105241_10047312 3300009174 Bacteria 3271
146 Ga0105241_10096542 3300009174 Bacteria 2342
147 Ga0105241_10325928 3300009174 Bacteria 1326
148 Ga0105242_10102162 3300009176 Bacteria 2431
149 Ga0105242_10122393 3300009176 Bacteria 2235
150 Ga0105248_10071650 3300009177 Bacteria 3893
151 Ga0105248_10298507 3300009177 Bacteria 1814
152 Ga0105248_10332398 3300009177 Bacteria 1711
153 Ga0105237_10013053 3300009545 Bacteria 8723
154 Ga0105237_10078218 3300009545 Bacteria 3297
155 Ga0105237_10128390 3300009545 Bacteria 2529
156 Ga0105237_10152321 3300009545 Bacteria 2309
157 Ga0105237_10177506 3300009545 Bacteria 2130
158 Ga0105238_10013890 3300009551 Bacteria 8143
159 Ga0105238_10040291 3300009551 Bacteria 4734
160 Ga0105238_10061026 3300009551 Bacteria 3774
161 Ga0105238_10178225 3300009551 Bacteria 2102
162 Ga0105249_10237164 3300009553 Bacteria 1802
163 Ga0123342_1010917 3300009766 Bacteria 10193
164 Ga0099796_10019663 3300010159 Bacteria 2051
165 Ga0099796_10027048 3300010159 Bacteria 1828
166 Ga0099796_10062739 3300010159 Bacteria 1322
167 Ga0105239_10006580 3300010375 Bacteria 13459
168 Ga0105239_10137458 3300010375 Bacteria 2721
169 Ga0105239_10296739 3300010375 Bacteria 1820
170 Ga0105239_10321912 3300010375 Bacteria 1744
171 Ga0105246_10001020 3300011119 Bacteria 16085
172 Ga0105246_10049935 3300011119 Bacteria 2867
173 Ga0157370_10060974 3300013104 Bacteria 3580
174 Ga0157370_10095170 3300013104 Bacteria 2794
175 Ga0157369_10010618 3300013105 Bacteria 10482
176 Ga0157369_10013468 3300013105 Bacteria 9243
177 Ga0157369_10016315 3300013105 Bacteria 8360
178 Ga0157374_10014119 3300013296 Bacteria 6982
179 Ga0163162_10058709 3300013306 Bacteria 3877
180 Ga0163162_10253578 3300013306 Bacteria 1891
181 Ga0163162_10572396 3300013306 Bacteria 1257
182 Ga0157375_10007265 3300013308 Bacteria 9691
183 Ga0157375_10093773 3300013308 Bacteria 3068
184 Ga0163163_10039525 3300014325 Bacteria 4604
185 Ga0163163_10060338 3300014325 Bacteria 3755
186 Ga0163163_10082533 3300014325 Bacteria 3218
187 Ga0163163_10244970 3300014325 Bacteria 1842
188 Ga0157379_10117978 3300014968 Bacteria 2387
189 Ga0157379_10214304 3300014968 Bacteria 1744
190 Ga0157376_10003464 3300014969 Bacteria 10870
191 Ga0214544_1000009 3300021320 Bacteria 285865
192 Ga0214542_1000002 3300021321 Bacteria 720798
193 Ga0214545_1000002 3300021324 Bacteria 727485
194 Ga0214543_1000011 3300021327 Bacteria 344093
195 Ga0214543_1000013 3300021327 Bacteria 329117
196 Ga0213874_10004378 3300021377 Bacteria 3218
197 Ga0213876_10004782 3300021384 Bacteria 7524
198 Ga0209435_100022 3300025206 Bacteria 207766
199 Ga0209437_100310 3300025233 Bacteria 65905
200 Ga0209646_1000078 3300025246 Bacteria 207766
201 Ga0209026_1000065 3300025250 Bacteria 207766
202 Ga0209759_1000055 3300025256 Bacteria 207766
203 Ga0209233_1000594 3300025261 Bacteria 18858
204 Ga0209233_1013319 3300025261 Bacteria 2351
205 Ga0209673_1018254 3300025273 Bacteria 2559
206 Ga0209673_1024757 3300025273 Bacteria 2010
207 Ga0209130_1009475 3300025284 Bacteria 2770
208 Ga0209025_1011109 3300025294 Bacteria 5994
209 Ga0209025_1027154 3300025294 Bacteria 2848
210 Ga0209564_1004055 3300025295 Bacteria 9237
211 Ga0209564_1009468 3300025295 Bacteria 4631
212 Ga0209564_1021588 3300025295 Bacteria 2307
213 Ga0209564_1045525 3300025295 Bacteria 1128
214 Ga0209758_1000021 3300025297 Bacteria 697691
215 Ga0209758_1012306 3300025297 Bacteria 4803
216 Ga0209256_1006335 3300025299 Bacteria 6316
217 Ga0209256_1007922 3300025299 Bacteria 5075
218 Ga0209256_1016885 3300025299 Bacteria 2458
219 Ga0209256_1034176 3300025299 Bacteria 1357
220 Ga0207426_1000352 3300025302 Bacteria 84141
221 Ga0207426_1000854 3300025302 Bacteria 32034
222 Ga0207426_1019301 3300025302 Bacteria 2386
223 Ga0207656_10036565 3300025321 Bacteria 2062
224 Ga0207682_10167539 3300025893 Bacteria 998
225 Ga0207692_10010453 3300025898 Bacteria 3911
226 Ga0207692_10014687 3300025898 Bacteria 3427
227 Ga0207710_10179528 3300025900 Bacteria 1038
228 Ga0207688_10182726 3300025901 Bacteria 1251
229 Ga0207699_10002283 3300025906 Bacteria 9057
230 Ga0207699_10050465 3300025906 Bacteria 2453
231 Ga0207699_10282184 3300025906 Bacteria 1154
232 Ga0207643_10124029 3300025908 Bacteria 1532
233 Ga0207705_10112367 3300025909 Bacteria 2014
234 Ga0207654_10001822 3300025911 Bacteria 11062
235 Ga0207654_10100216 3300025911 Bacteria 1783
236 Ga0207707_10001692 3300025912 Bacteria 20292
237 Ga0207707_10010614 3300025912 Bacteria 7999
238 Ga0207695_10000402 3300025913 Bacteria 96771
239 Ga0207695_10047854 3300025913 Bacteria 4521
240 Ga0207695_10111595 3300025913 Bacteria 2713
241 Ga0207671_10011788 3300025914 Bacteria 7077
242 Ga0207671_10331047 3300025914 Bacteria 1206
243 Ga0207671_10401098 3300025914 Bacteria 1091
244 Ga0207693_10009963 3300025915 Bacteria 7727
245 Ga0207693_10019275 3300025915 Bacteria 5429
246 Ga0207693_10023378 3300025915 Bacteria 4908
247 Ga0207693_10025304 3300025915 Bacteria 4707
248 Ga0207693_10036543 3300025915 Bacteria 3872
249 Ga0207693_10044359 3300025915 Bacteria 3495
250 Ga0207663_10001328 3300025916 Bacteria 11435
251 Ga0207663_10111235 3300025916 Bacteria 1859
252 Ga0207660_10132693 3300025917 Bacteria 1897
253 Ga0207657_10003043 3300025919 Bacteria 17943
254 Ga0207657_10018606 3300025919 Bacteria 6621
255 Ga0207657_10180860 3300025919 Bacteria 1704
256 Ga0207657_10270483 3300025919 Bacteria 1351
257 Ga0207652_10014144 3300025921 Bacteria 6461
258 Ga0207652_10203913 3300025921 Bacteria 1780
259 Ga0207646_10540065 3300025922 Bacteria 1049
260 Ga0207694_10001125 3300025924 Bacteria 23154
261 Ga0207694_10007985 3300025924 Bacteria 8001
262 Ga0207694_10013513 3300025924 Bacteria 6150
263 Ga0207694_10068895 3300025924 Bacteria 2764
264 Ga0207659_10057139 3300025926 Bacteria 2797
265 Ga0207687_10394115 3300025927 Bacteria 1137
266 Ga0207700_10061785 3300025928 Bacteria 2842
267 Ga0207700_10093155 3300025928 Bacteria 2383
268 Ga0207700_10205203 3300025928 Bacteria 1663
269 Ga0207700_10247016 3300025928 Bacteria 1523
270 Ga0207664_10029111 3300025929 Bacteria 4204
271 Ga0207664_10095350 3300025929 Bacteria 2447
272 Ga0207644_10105416 3300025931 Bacteria 2124
273 Ga0207704_10047009 3300025938 Bacteria 2577
274 Ga0207704_10237674 3300025938 Bacteria 1359
275 Ga0207665_10016296 3300025939 Bacteria 4879
276 Ga0207665_10067322 3300025939 Bacteria 2439
277 Ga0207665_10074733 3300025939 Bacteria 2320
278 Ga0207665_10147109 3300025939 Bacteria 1684
279 Ga0207665_10199248 3300025939 Bacteria 1458
280 Ga0207665_10289180 3300025939 Bacteria 1222
281 Ga0207691_10368920 3300025940 Bacteria 1226
282 Ga0207711_10389757 3300025941 Bacteria 1293
283 Ga0207689_10186246 3300025942 Bacteria 1712
284 Ga0207661_10002409 3300025944 Bacteria 12880
285 Ga0207661_10010713 3300025944 Bacteria 6608
286 Ga0207661_10117278 3300025944 Bacteria 2261
287 Ga0207667_10011695 3300025949 Bacteria 10183
288 Ga0207667_10028182 3300025949 Bacteria 6101
289 Ga0207667_10351139 3300025949 Bacteria 1504
290 Ga0207667_10387139 3300025949 Bacteria 1424
291 Ga0207651_10271838 3300025960 Bacteria 1396
292 Ga0207712_10345666 3300025961 Bacteria 1235
293 Ga0207640_10031645 3300025981 Bacteria 3272
294 Ga0207640_10051574 3300025981 Bacteria 2675
295 Ga0207640_10540288 3300025981 Bacteria 977
296 Ga0207677_10048467 3300026023 Bacteria 2861
297 Ga0207639_10018267 3300026041 Bacteria 4982
298 Ga0207639_10048165 3300026041 Bacteria 3224
299 Ga0207639_10171061 3300026041 Bacteria 1840
300 Ga0207678_10024581 3300026067 Bacteria 5262
301 Ga0207678_10110444 3300026067 Bacteria 2346
302 Ga0207702_10000025 3300026078 Bacteria 186312
303 Ga0207702_10000075 3300026078 Bacteria 112303
304 Ga0207702_10122437 3300026078 Bacteria 2330
305 Ga0207702_10391099 3300026078 Bacteria 1339
306 Ga0207676_10021699 3300026095 Bacteria 4713
307 Ga0207674_10003345 3300026116 Bacteria 19680
308 Ga0207674_10008172 3300026116 Bacteria 12134
309 Ga0207674_10059101 3300026116 Bacteria 3881
310 Ga0207674_10197480 3300026116 Bacteria 1961
311 Ga0207683_10008466 3300026121 Bacteria 8802
312 Ga0207683_10018149 3300026121 Bacteria 6001
313 Ga0207683_10343157 3300026121 Bacteria 1370
314 Ga0207698_10031132 3300026142 Bacteria 3847
315 Ga0207698_10036174 3300026142 Bacteria 3621
316 Ga0207698_10073533 3300026142 Bacteria 2722
317 Ga0207698_10090063 3300026142 Bacteria 2508
318 Ga0207698_10101166 3300026142 Bacteria 2389
319 Ga0209389_1000026 3300027296 Bacteria 147580
320 Ga0209389_1000117 3300027296 Bacteria 71506
321 Ga0209589_1000003 3300027357 Bacteria 629130
322 Ga0209589_1000022 3300027357 Bacteria 180757
323 Ga0209489_100003 3300027361 Bacteria 663105
324 Ga0209489_100058 3300027361 Bacteria 147117
325 Ga0209489_105776 3300027361 Bacteria 20900
326 Ga0209700_100003 3300027363 Bacteria 663105
327 Ga0209700_100021 3300027363 Bacteria 230859
328 Ga0209179_1000519 3300027512 Bacteria 3975
329 Ga0209588_1027652 3300027671 Bacteria 1805
330 Ga0209588_1039063 3300027671 Bacteria 1530
331 Ga0268266_10040338 3300028379 Bacteria 3979
332 Ga0268266_10108521 3300028379 Bacteria 2456
333 Ga0268266_10196336 3300028379 Bacteria 1845
334 Ga0268266_10247313 3300028379 Bacteria 1648
335 Ga0268264_10000022 3300028381 Bacteria 476624
336 Ga0307517_10000111 3300028786 Bacteria 120304
337 Ga0307515_10001215 3300028794 Bacteria 58879
338 Ga0265332_10015585 3300031238 Bacteria 3356
339 Ga0265325_10003304 3300031241 Bacteria 10607
340 Ga0265340_10011918 3300031247 Bacteria 4604
341 Ga0265339_10041083 3300031249 Bacteria 2569
342 Ga0307513_10459117 3300031456 Bacteria 997
343 Ga0307509_10041596 3300031507 Bacteria 4986
344 Ga0307509_10073995 3300031507 Bacteria 3545
345 Ga0307508_10000515 3300031616 Bacteria 46360
346 Ga0307508_10139942 3300031616 Bacteria 2023
347 Ga0307508_10187206 3300031616 Bacteria 1672
348 Ga0265314_10023185 3300031711 Bacteria 4739
349 Ga0265314_10037042 3300031711 Bacteria 3537
350 Ga0265314_10049893 3300031711 Bacteria 2927
351 Ga0265314_10183469 3300031711 Bacteria 1251
352 Ga0265342_10018556 3300031712 Bacteria 4502
353 Ga0265342_10028442 3300031712 Bacteria 3482
354 Ga0265342_10131712 3300031712 Bacteria 1400
355 Ga0265342_10185106 3300031712 Bacteria 1139
356 Ga0307516_10018947 3300031730 Bacteria 7142
357 Ga0307507_10118283 3300033179 Bacteria 2131
358 Ga0307507_10264310 3300033179 Bacteria 1095
359 Ga0307510_10019345 3300033180 Bacteria 7988
360 Ga0315911_1000001 3300033442 Bacteria 1088602
361 Ga0373926_0030368 3300035083 Bacteria 1903
362 Ga0373926_0083654 3300035083 Bacteria 1182
363 Ga0373929_0024203 3300035085 Bacteria 1253
364 Ga0373934_0004274 3300035086 Bacteria 5272
365 Ga0373934_0113757 3300035086 Bacteria 1099
366 Ga0373923_0000310 3300035111 Bacteria 10856
367 Ga0373936_0005876 3300035113 Bacteria 4619
368 Ga0373936_0015755 3300035113 Bacteria 2899
369 Ga0373945_0002999 3300035116 Bacteria 5309
370 Ga0373953_0002273 3300035117 Bacteria 5776
371 Ga0373954_0000035 3300035118 Bacteria 51266
372 Ga0373954_0021760 3300035118 Bacteria 2904
373 Ga0373954_0029454 3300035118 Bacteria 2527
374 Ga0373954_0066288 3300035118 Bacteria 1710
375 Ga0373956_0000798 3300035119 Bacteria 13105
376 Ga0373956_0006725 3300035119 Bacteria 4611
377 Ga0373957_0007552 3300035120 Bacteria 3482
378 Ga0373957_0048788 3300035120 Bacteria 1614
379 Ga0373946_0007829 3300035171 Bacteria 3922
380 Ga0373946_0027108 3300035171 Bacteria 2264
381 Ga0373955_0010436 3300035172 Bacteria 4387
382 Ga0373955_0015377 3300035172 Bacteria 3745
383 Ga0373955_0022680 3300035172 Bacteria 3187
384 Ga0373924_0011073 3300035410 Bacteria 3342
385 Ga0373931_0023783 3300035691 Bacteria 3096
386 Ga0373931_0025759 3300035691 Bacteria 2987
387 Ga0373935_0199533 3300035692 Bacteria 1382
388 Ga0373935_0217665 3300035692 Bacteria 1325
389 Ga0373927_0000055 3300035695 Bacteria 81098
390 Ga0373927_0007107 3300035695 Bacteria 7595
391 Ga0373927_0009804 3300035695 Bacteria 6421
392 Ga0373927_0010862 3300035695 Bacteria 6066
393 Ga0373927_0020113 3300035695 Bacteria 4377
394 Ga0373927_0225088 3300035695 Bacteria 1232
395 Ga0373933_0000037 3300035724 Bacteria 81092
396 Ga0373947_0003833 3300035725 Bacteria 8854
397 Ga0373947_0014430 3300035725 Bacteria 4532
398 Ga0373947_0015479 3300035725 Bacteria 4380
399 Ga0373947_0065428 3300035725 Bacteria 2218
400 Ga0373947_0228706 3300035725 Bacteria 1224
401 Ga0373937_0064445 3300036401 Bacteria 3370
402 Ga0373937_0093056 3300036401 Bacteria 2794
403 Ga0373937_0209747 3300036401 Bacteria 1833
404 Ga0373937_0519163 3300036401 Bacteria 1132
405 Ga0372808_002270 3300036459 Bacteria 2189
406 Ga0373925_0002732 3300037068 Bacteria 13961
407 Ga0373925_0022291 3300037068 Bacteria 4619
408 Ga0373925_0041570 3300037068 Bacteria 3408
409 Ga0373925_0066477 3300037068 Bacteria 2718
410 Ga0373925_0283568 3300037068 Bacteria 1334
411 Ga0395900_0004044 3300037418 Bacteria 15647
412 Ga0395900_0252112 3300037418 Bacteria 1766
413 Ga0395900_0777142 3300037418 Bacteria 887
414 Ga0395898_0014868 3300037466 Bacteria 7990
415 Ga0395905_0015125 3300037471 Bacteria 7343
416 Ga0395905_0054406 3300037471 Bacteria 3746
417 Ga0395905_0170896 3300037471 Bacteria 2042
418 Ga0395905_0236109 3300037471 Bacteria 1709
419 Ga0436364_0713413 3300037853 Bacteria 9562
420 Ga0436364_1207970 3300037853 Bacteria 1361
421 Ga0395901_0026961 3300038443 Bacteria 5900
422 Ga0395901_0078519 3300038443 Bacteria 3447
423 Ga0395901_0436649 3300038443 Bacteria 1341
424 Ga0436365_0816602 3300039437 Bacteria 6220
425 Ga0436360_1185964 3300039438 Bacteria 1476
426 Ga0436363_0597393 3300039450 Bacteria 9259
427 Ga0436363_0990757 3300039450 Bacteria 2477
428 Ga0436362_0053894 3300039453 Bacteria 2768
429 Ga0436362_0386716 3300039453 Bacteria 1837
430 Ga0439465_0002663 3300041413 Bacteria 5834
431 Ga0451853_1526884 3300041512 Bacteria 1323
432 Ga0439432_059869 3300042006 Bacteria 1176
433 Ga0439449_0039829 3300042007 Bacteria 1747
434 Ga0439449_0104524 3300042007 Bacteria 1048
435 Ga0466972_0000125 3300044658 Bacteria 65105
436 Ga0466972_0003074 3300044658 Bacteria 8267
437 Ga0466963_0029408 3300044694 Bacteria 3537
438 Ga0466963_0073222 3300044694 Bacteria 2309
439 Ga0466963_0130819 3300044694 Bacteria 1733
440 Ga0466968_0003815 3300044735 Bacteria 5589
441 Ga0466968_0130373 3300044735 Bacteria 1144
442 Ga0466960_0119251 3300044901 Bacteria 1380
443 Ga0466960_0230327 3300044901 Bacteria 1022
444 Ga0466960_0261465 3300044901 Bacteria 964
445 Ga0466967_0008029 3300045976 Bacteria 7692
446 Ga0466967_0110589 3300045976 Bacteria 2524
447 Ga0495592_0000406 3300046454 Bacteria 32823
448 Ga0495592_0020678 3300046454 Bacteria 5008
449 Ga0495592_0029619 3300046454 Bacteria 4145
450 Ga0495592_0029939 3300046454 Bacteria 4118
451 Ga0495603_0000011 3300046455 Bacteria 69832
452 Ga0495603_0008868 3300046455 Bacteria 6080
453 Ga0495603_0023363 3300046455 Bacteria 3742
454 Ga0495603_0341457 3300046455 Bacteria 859
455 Ga0495629_0000382 3300046459 Bacteria 37088
456 Ga0495629_0000678 3300046459 Bacteria 27584
457 Ga0495629_0053747 3300046459 Bacteria 2817
458 Ga0495629_0086335 3300046459 Bacteria 2189
459 Ga0495638_0016433 3300046460 Bacteria 4956
460 Ga0495638_0026451 3300046460 Bacteria 3760
461 Ga0495638_0082443 3300046460 Bacteria 1951
462 Ga0495641_0000910 3300046461 Bacteria 25244
463 Ga0495651_0012419 3300046462 Bacteria 6568
464 Ga0495651_0019954 3300046462 Bacteria 5200
465 Ga0495651_0021239 3300046462 Bacteria 5045
466 Ga0495651_0037905 3300046462 Bacteria 3754
467 Ga0495651_0303209 3300046462 Bacteria 1071
468 Ga0495653_0000161 3300046463 Bacteria 55322
469 Ga0495580_0000174 3300046472 Bacteria 47868
470 Ga0495580_0005823 3300046472 Bacteria 10113
471 Ga0495605_0109787 3300046474 Bacteria 1260
472 Ga0495639_0000017 3300046475 Bacteria 76508
473 Ga0495639_0013479 3300046475 Bacteria 3531
474 Ga0495639_0044661 3300046475 Bacteria 2003
475 Ga0495662_0000549 3300046476 Bacteria 17200
476 Ga0495662_0010116 3300046476 Bacteria 4626
477 Ga0495664_0027870 3300046477 Bacteria 3296
478 Ga0495664_0091289 3300046477 Bacteria 1831
479 Ga0495664_0258601 3300046477 Bacteria 1053
480 Ga0495594_0000445 3300046499 Bacteria 20938
481 Ga0495607_0029223 3300046501 Bacteria 3394
482 Ga0495606_0006147 3300046507 Bacteria 11189
483 Ga0495606_0132410 3300046507 Bacteria 1481
484 Ga0495608_0000403 3300046511 Bacteria 30220
485 Ga0495608_0016022 3300046511 Bacteria 5189
486 Ga0495608_0092943 3300046511 Bacteria 1949
487 Ga0495616_0064932 3300046513 Bacteria 1780
488 Ga0495618_0053124 3300046514 Bacteria 2562
489 Ga0495618_0126789 3300046514 Bacteria 1634
490 Ga0495628_0003039 3300046516 Bacteria 15033
491 Ga0495628_0006463 3300046516 Bacteria 10235
492 Ga0495628_0133077 3300046516 Bacteria 1901
493 Ga0495630_0004919 3300046517 Bacteria 9392
494 Ga0495630_0043783 3300046517 Bacteria 3345
495 Ga0495643_0073713 3300046522 Bacteria 1789
496 Ga0495643_0277262 3300046522 Bacteria 773
497 Ga0495648_0001444 3300046524 Bacteria 23251
498 Ga0495648_0003981 3300046524 Bacteria 12784
499 Ga0495648_0152062 3300046524 Bacteria 1206
500 Ga0495666_0003988 3300046526 Bacteria 7465
501 Ga0495652_0000604 3300046529 Bacteria 42071
502 Ga0495652_0007725 3300046529 Bacteria 9900
503 Ga0495652_0024880 3300046529 Bacteria 5297
504 Ga0495665_0024725 3300046531 Bacteria 3226
505 Ga0495640_0004435 3300046533 Bacteria 11201
506 Ga0495640_0004810 3300046533 Bacteria 10755
507 Ga0495640_0014243 3300046533 Bacteria 6027
508 Ga0495640_0058762 3300046533 Bacteria 2621
509 Ga0495586_0120638 3300046535 Bacteria 1465
510 Ga0495586_0178448 3300046535 Bacteria 1201
511 Ga0495587_0012949 3300046536 Bacteria 5244
512 Ga0495587_0039594 3300046536 Bacteria 2820
513 Ga0495609_0121429 3300046538 Bacteria 1123
514 Ga0495621_0034537 3300046539 Bacteria 1747
515 Ga0495645_0004657 3300046543 Bacteria 9359
516 Ga0495645_0005046 3300046543 Bacteria 9044
517 Ga0495645_0006519 3300046543 Bacteria 8104
518 Ga0495622_0005239 3300046557 Bacteria 6011
519 Ga0495622_0006151 3300046557 Bacteria 5579
520 Ga0495667_0006181 3300046559 Bacteria 8115
521 Ga0495667_0010646 3300046559 Bacteria 6218
522 Ga0495667_0085014 3300046559 Bacteria 2053
523 Ga0495656_0282399 3300046615 Bacteria 846
524 Ga0495668_0062161 3300046616 Bacteria 2058
525 Ga0495634_0001440 3300046642 Bacteria 21158
526 Ga0495634_0035824 3300046642 Bacteria 3396
527 Ga0495634_0068211 3300046642 Bacteria 2350
528 Ga0495611_0105223 3300046648 Bacteria 1312
529 Ga0495625_0245226 3300046660 Bacteria 1165
530 Ga0495625_0300671 3300046660 Bacteria 1027
531 Ga0495635_0000133 3300046663 Bacteria 44583
532 Ga0495635_0083302 3300046663 Bacteria 2188
533 Ga0495635_0144259 3300046663 Bacteria 1621
534 Ga0495661_0047522 3300046665 Bacteria 2613
535 Ga0495588_0027330 3300046674 Bacteria 2852
536 Ga0495588_0125932 3300046674 Bacteria 1351
537 Ga0495657_0030199 3300046675 Bacteria 3797
538 Ga0495657_0039482 3300046675 Bacteria 3242
539 Ga0495657_0052105 3300046675 Bacteria 2745
540 Ga0495599_0005543 3300046678 Bacteria 7566
541 Ga0495599_0021687 3300046678 Bacteria 4008
542 Ga0495599_0097650 3300046678 Bacteria 1831
543 Ga0495599_0116018 3300046678 Bacteria 1666
544 Ga0495623_0011880 3300046679 Bacteria 5642
545 Ga0495623_0043749 3300046679 Bacteria 2847
546 Ga0495623_0072531 3300046679 Bacteria 2141
547 Ga0495623_0210258 3300046679 Bacteria 1114
548 Ga0495646_0000291 3300046680 Bacteria 25624
549 Ga0495646_0053411 3300046680 Bacteria 2436
550 Ga0495646_0135529 3300046680 Bacteria 1382
551 Ga0495647_0002310 3300046681 Bacteria 5986
552 Ga0495658_0000371 3300046683 Bacteria 25211
553 Ga0495658_0159500 3300046683 Bacteria 1390
554 Ga0495658_0171094 3300046683 Bacteria 1344
555 Ga0495669_0221824 3300046684 Bacteria 906
556 Ga0495613_0013181 3300046689 Bacteria 6142
557 Ga0495613_0181733 3300046689 Bacteria 1489
558 Ga0495624_0000384 3300046690 Bacteria 35148
559 Ga0495624_0153750 3300046690 Bacteria 1407
560 Ga0495671_0141834 3300046692 Bacteria 1171
561 Ga0495600_0010426 3300046809 Bacteria 5769
562 Ga0495600_0026213 3300046809 Bacteria 3760
563 Ga0495600_0050610 3300046809 Bacteria 2711
564 Ga0495600_0191323 3300046809 Bacteria 1316
565 Ga0495581_0000361 3300047315 Bacteria 22781
566 Ga0495581_0048972 3300047315 Bacteria 2440
567 Ga0495581_0075233 3300047315 Bacteria 1954
568 Ga0495581_0088964 3300047315 Bacteria 1791
569 Ga0495604_0010123 3300047317 Bacteria 7469
570 Ga0495604_0025605 3300047317 Bacteria 4699
571 Ga0495604_0185100 3300047317 Bacteria 1455
572 Ga0495674_0001034 3300047319 Bacteria 26723
573 Ga0495674_0037678 3300047319 Bacteria 4345
574 Ga0495674_0041943 3300047319 Bacteria 4084
575 Ga0495674_0174811 3300047319 Bacteria 1790
576 Ga0495672_0044951 3300047320 Bacteria 2646
577 Ga0495672_0115352 3300047320 Bacteria 1436
578 Ga0495676_0047317 3300047321 Bacteria 3479
579 Ga0495680_0006723 3300047322 Bacteria 10634
580 Ga0495680_0037759 3300047322 Bacteria 3867
581 Ga0495680_0080400 3300047322 Bacteria 2463
582 Ga0495675_0037589 3300047444 Bacteria 3083
583 Ga0495675_0125446 3300047444 Bacteria 1597
584 Ga0495675_0149928 3300047444 Bacteria 1441
585 Ga0495684_0002274 3300047471 Bacteria 15383
586 Ga0495684_0018553 3300047471 Bacteria 5359
587 Ga0495684_0162408 3300047471 Bacteria 1665
588 Ga0495686_0050929 3300047472 Bacteria 2601
589 Ga0495686_0139342 3300047472 Bacteria 1432
590 Ga0495686_0158587 3300047472 Bacteria 1324
591 Ga0495593_0000077 3300047673 Bacteria 41818
592 Ga0495593_0002962 3300047673 Bacteria 10210
593 Ga0495593_0070275 3300047673 Bacteria 1820
594 Ga0495602_0020070 3300048088 Bacteria 6611
595 Ga0495602_0181878 3300048088 Bacteria 1620
596 Ga0495614_0063156 3300048089 Bacteria 1592
597 Ga0496100_0032337 3300048903 Bacteria 3262
598 Ga0496100_0148449 3300048903 Bacteria 1669
599 Ga0496101_0022694 3300048904 Bacteria 4324
600 Ga0496101_0130228 3300048904 Bacteria 1910
601 Ga0496102_0003232 3300048905 Bacteria 13822
602 Ga0496102_0612786 3300048905 Bacteria 1012
603 Ga0496103_0015633 3300048906 Bacteria 4522
604 Ga0496103_0027535 3300048906 Bacteria 3445
605 Ga0496104_0000169 3300048907 Bacteria 57859
606 Ga0496104_0012033 3300048907 Bacteria 7766
607 Ga0496105_0009216 3300048908 Bacteria 7708
608 Ga0496105_0016624 3300048908 Bacteria 5875
609 Ga0496105_0031207 3300048908 Bacteria 4368
610 Ga0496105_0032167 3300048908 Bacteria 4304
611 Ga0496106_0002592 3300048909 Bacteria 13459
612 Ga0496106_0020768 3300048909 Bacteria 4873
613 Ga0496106_0033696 3300048909 Bacteria 3822
614 Ga0496106_0156780 3300048909 Bacteria 1798
615 Ga0496106_0346089 3300048909 Bacteria 1194
616 Ga0496107_0117099 3300048910 Bacteria 1961
617 Ga0496107_0694773 3300048910 Bacteria 748
618 Ga0496108_0001206 3300048911 Bacteria 20278
619 Ga0496108_0012291 3300048911 Bacteria 6964
620 Ga0496108_0030082 3300048911 Bacteria 4501
621 Ga0496108_0032059 3300048911 Bacteria 4362
622 Ga0496108_0057791 3300048911 Bacteria 3259
623 Ga0496108_0235302 3300048911 Bacteria 1593
624 Ga0496109_0000201 3300048912 Bacteria 59452
625 Ga0496109_0005985 3300048912 Bacteria 10216
626 Ga0496109_0014074 3300048912 Bacteria 6955
627 Ga0496109_0082013 3300048912 Bacteria 2972
628 Ga0496110_0000578 3300048913 Bacteria 25127
629 Ga0496110_0007681 3300048913 Bacteria 8628
630 Ga0496110_0057478 3300048913 Bacteria 3424
631 Ga0496110_0367867 3300048913 Bacteria 1310
632 Ga0496111_0034908 3300048914 Bacteria 3592
633 Ga0496111_0073640 3300048914 Bacteria 2487
634 Ga0496111_0176022 3300048914 Bacteria 1590
635 Ga0496111_0310100 3300048914 Bacteria 1169
636 Ga0496112_0000009 3300048915 Bacteria 299708
637 Ga0496112_0002812 3300048915 Bacteria 14129
638 Ga0496112_0012427 3300048915 Bacteria 7828
639 Ga0496112_0101393 3300048915 Bacteria 2848
640 Ga0496112_0547135 3300048915 Bacteria 1091
641 Ga0496113_0001268 3300048916 Bacteria 13916
642 Ga0496113_0001356 3300048916 Bacteria 13562
643 Ga0496113_0045884 3300048916 Bacteria 3243
644 Ga0496113_0055600 3300048916 Bacteria 2967
645 Ga0496114_0031108 3300048917 Bacteria 4391
646 Ga0496115_0000528 3300048918 Bacteria 29725
647 Ga0496115_0011483 3300048918 Bacteria 6641
648 Ga0496115_0032531 3300048918 Bacteria 4114
649 Ga0496115_0082432 3300048918 Bacteria 2620
650 Ga0496115_0137975 3300048918 Bacteria 2011
651 Ga0496116_0035861 3300048919 Bacteria 3479
652 Ga0496116_0081559 3300048919 Bacteria 2005
653 Ga0496117_0008274 3300048920 Bacteria 9903
654 Ga0496117_0009682 3300048920 Bacteria 8913
655 Ga0496117_0041154 3300048920 Bacteria 3389
656 Ga0496117_0134558 3300048920 Bacteria 1492
657 Ga0496118_0006468 3300048921 Bacteria 12866
658 Ga0496118_0213075 3300048921 Bacteria 1132
659 Ga0496120_0013523 3300048923 Bacteria 5491
660 Ga0496120_0052867 3300048923 Bacteria 2311
661 Ga0496121_0000001 3300048924 Bacteria 1830318
662 Ga0496121_0002243 3300048924 Bacteria 30120
663 Ga0496121_0002708 3300048924 Bacteria 26478
664 Ga0496121_0055410 3300048924 Bacteria 3303
665 Ga0496121_0164105 3300048924 Bacteria 1621
666 Ga0496121_0237642 3300048924 Bacteria 1272
667 Ga0496121_0298541 3300048924 Bacteria 1094
668 Ga0496122_0057942 3300048925 Bacteria 2872
669 Ga0496122_0231376 3300048925 Bacteria 1050
670 Ga0496123_0037776 3300048926 Bacteria 3404
671 Ga0496123_0087264 3300048926 Bacteria 1867
672 Ga0496124_0009457 3300048927 Bacteria 10037
673 Ga0496125_0000001 3300048928 Bacteria 1766138
674 Ga0496125_0034392 3300048928 Bacteria 4468
675 Ga0496125_0048127 3300048928 Bacteria 3559
676 Ga0496125_0063266 3300048928 Bacteria 2952
677 Ga0496125_0110227 3300048928 Bacteria 1996
678 Ga0496125_0304680 3300048928 Bacteria 974
679 Ga0496126_0001585 3300048929 Bacteria 34700
680 Ga0496126_0012277 3300048929 Bacteria 8791
681 Ga0496126_0030328 3300048929 Bacteria 5124
682 Ga0496126_0036403 3300048929 Bacteria 4603
683 Ga0496126_0049624 3300048929 Bacteria 3830
684 Ga0496126_0084889 3300048929 Bacteria 2792
685 Ga0496126_0102600 3300048929 Bacteria 2500
686 Ga0496126_0107203 3300048929 Bacteria 2437
687 Ga0496126_0199052 3300048929 Bacteria 1693
688 Ga0496126_0261527 3300048929 Bacteria 1439
689 Ga0496126_0360947 3300048929 Bacteria 1186
690 Ga0496126_0475118 3300048929 Bacteria 1002
691 Ga0495682_0091903 3300049460 Bacteria 1090
692 Ga0501031_0003646 3300049568 Bacteria 9911
693 Ga0501031_0007682 3300049568 Bacteria 7018
694 Ga0501031_0058711 3300049568 Bacteria 2507
695 Ga0501031_0096091 3300049568 Bacteria 1933
696 Ga0501032_0000273 3300049569 Bacteria 43466
697 Ga0501032_0014051 3300049569 Bacteria 5679
698 Ga0501032_0027107 3300049569 Bacteria 3939
699 Ga0501032_0197211 3300049569 Bacteria 1314
700 Ga0501033_0000914 3300049570 Bacteria 26957
701 Ga0501033_0005767 3300049570 Bacteria 9745
702 Ga0501033_0116629 3300049570 Bacteria 1940
703 Ga0501033_0169279 3300049570 Bacteria 1569
704 Ga0501034_0000175 3300049571 Bacteria 119465
705 Ga0501036_0000158 3300049572 Bacteria 44516
706 Ga0501036_0130677 3300049572 Bacteria 2120
707 Ga0501036_0218974 3300049572 Bacteria 1599
708 Ga0501037_0000126 3300049573 Bacteria 71116
709 Ga0501037_0000476 3300049573 Bacteria 32421
710 Ga0501037_0073405 3300049573 Bacteria 2487
711 Ga0501038_0000034 3300049574 Bacteria 128854
712 Ga0501038_0010386 3300049574 Bacteria 8514
713 Ga0501038_0045437 3300049574 Bacteria 3812
714 Ga0501039_0034561 3300049575 Bacteria 3901
715 Ga0501039_0323752 3300049575 Bacteria 1211
716 Ga0501040_0146295 3300049576 Bacteria 1666
717 Ga0501041_0031672 3300049577 Bacteria 3196
718 Ga0501042_0001807 3300049578 Bacteria 12820
719 Ga0501042_0043526 3300049578 Bacteria 3197
720 Ga0501043_0007605 3300049579 Bacteria 8592
721 Ga0501043_0012802 3300049579 Bacteria 6558
722 Ga0501043_0046455 3300049579 Bacteria 3414
723 Ga0501043_0077394 3300049579 Bacteria 2613
724 Ga0501043_0087125 3300049579 Bacteria 2454
725 Ga0501043_0271238 3300049579 Bacteria 1302
726 Ga0501046_0016164 3300049580 Bacteria 6257
727 Ga0501046_0052091 3300049580 Bacteria 3227
728 Ga0501047_0000255 3300049581 Bacteria 62993
729 Ga0501047_0002820 3300049581 Bacteria 16496
730 Ga0501047_0053662 3300049581 Bacteria 3898
731 Ga0501047_0092561 3300049581 Bacteria 2901
732 Ga0501047_0244639 3300049581 Bacteria 1643
733 Ga0501048_0002884 3300049582 Bacteria 13122
734 Ga0501048_0007019 3300049582 Bacteria 8558
735 Ga0501067_0002077 3300049583 Bacteria 11031
736 Ga0501067_0003267 3300049583 Bacteria 8928
737 Ga0501068_0012997 3300049584 Bacteria 4730
738 Ga0501068_0030639 3300049584 Bacteria 3192
739 Ga0501069_0003837 3300049585 Bacteria 7747
740 Ga0501069_0005663 3300049585 Bacteria 6506
741 Ga0501070_0001459 3300049586 Bacteria 21155
742 Ga0501070_0004542 3300049586 Bacteria 11911
743 Ga0501070_0172835 3300049586 Bacteria 1779
744 Ga0501070_0253628 3300049586 Bacteria 1439
745 Ga0501070_0320673 3300049586 Bacteria 1260
746 Ga0501070_0365200 3300049586 Bacteria 1170
747 Ga0501071_0017836 3300049587 Bacteria 4905
748 Ga0501072_0009104 3300049588 Bacteria 7540
749 Ga0501072_0034878 3300049588 Bacteria 3942
750 Ga0501073_0000035 3300049589 Bacteria 94077
751 Ga0501073_0007705 3300049589 Bacteria 7992
752 Ga0501073_0072904 3300049589 Bacteria 2391
753 Ga0501074_0000543 3300049590 Bacteria 23250
754 Ga0501074_0126050 3300049590 Bacteria 1831
755 Ga0501079_0032645 3300049741 Bacteria 4003
756 Ga0501079_0067161 3300049741 Bacteria 2767
757 Ga0501079_0141135 3300049741 Bacteria 1877
758 Ga0501080_0000911 3300049742 Bacteria 24227
759 Ga0501080_0006146 3300049742 Bacteria 10774
760 Ga0501080_0067267 3300049742 Bacteria 3332
761 Ga0501080_0092942 3300049742 Bacteria 2801
762 Ga0501080_0220630 3300049742 Bacteria 1735
763 Ga0501081_0095211 3300049743 Bacteria 2099
764 Ga0501083_0005638 3300049744 Bacteria 8863
765 Ga0501083_0019181 3300049744 Bacteria 4763
766 Ga0501035_0000319 3300049822 Bacteria 55737
767 Ga0501035_0001024 3300049822 Bacteria 29439
768 Ga0501035_0023494 3300049822 Bacteria 5655
769 Ga0501035_0255004 3300049822 Bacteria 1488
770 Ga0501035_0312230 3300049822 Bacteria 1322
771 Ga0501044_0000061 3300049823 Bacteria 133207
772 Ga0501044_0024290 3300049823 Bacteria 6438
773 Ga0501044_0035700 3300049823 Bacteria 5204
774 Ga0501044_0039475 3300049823 Bacteria 4925
775 Ga0501044_0523303 3300049823 Bacteria 1085
776 Ga0501044_0921400 3300049823 Bacteria 748
777 Ga0501045_0046427 3300049824 Bacteria 3163
778 nmdc:mga00v17_38647_c1 3300050491 Bacteria 2855
779 nmdc:mga00v17_71209_c1 3300050491 Bacteria 2155
780 nmdc:mga0rr50_120291_c1 3300050513 Bacteria 2089
781 nmdc:mga08x19_4420_c1 3300050514 Bacteria 8333
782 nmdc:mga0sz30_172352_c1 3300050516 Bacteria 959
783 nmdc:mga0sz30_26303_c1 3300050516 Bacteria 2385
784 Ga0495601_0012797 3300053077 Bacteria 5036
785 Ga0495601_0020511 3300053077 Bacteria 4037
786 Ga0495601_0092187 3300053077 Bacteria 1951
787 Ga0495612_0003344 3300053078 Bacteria 6643
788 Ga0495612_0008915 3300053078 Bacteria 4067
789 Ga0495612_0037453 3300053078 Bacteria 1970
790 Ga0500635_0004071 3300053080 Bacteria 3737
791 Ga0500635_0028962 3300053080 Bacteria 1773
792 Ga0495655_0006946 3300053083 Bacteria 2083
793 Ga0495595_0000225 3300053084 Bacteria 22503
794 Ga0495595_0014528 3300053084 Bacteria 3343
795 Ga0495595_0031315 3300053084 Bacteria 2390
796 Ga0495619_0003532 3300053085 Bacteria 10085
797 Ga0495619_0069038 3300053085 Bacteria 2361
798 Ga0495619_0090951 3300053085 Bacteria 2066
799 Ga0495619_0189124 3300053085 Bacteria 1425
800 Ga0495619_0222557 3300053085 Bacteria 1307
801 Ga0500578_0039793 3300053086 Bacteria 3021
802 Ga0500644_0011834 3300053088 Bacteria 2395
803 Ga0500647_0132385 3300053091 Bacteria 1175
804 Ga0500566_0000951 3300053094 Bacteria 16642
805 Ga0500566_0024630 3300053094 Bacteria 3531
806 Ga0500640_001381 3300053095 Bacteria 7313
807 Ga0500641_0042152 3300053096 Bacteria 1849
808 Ga0500650_0107777 3300053098 Bacteria 1301
809 Ga0500554_003396 3300053102 Bacteria 3256
810 Ga0500554_067289 3300053102 Bacteria 1160
811 Ga0500569_060064 3300053109 Bacteria 1171
812 Ga0500572_000425 3300053111 Bacteria 14822
813 Ga0500595_002192 3300053119 Bacteria 9918
814 Ga0500595_002446 3300053119 Bacteria 9204
815 Ga0500595_006319 3300053119 Bacteria 5041
816 Ga0500595_012858 3300053119 Bacteria 3221
817 Ga0500595_084312 3300053119 Bacteria 926
818 Ga0500608_008861 3300053122 Bacteria 4249
819 Ga0500614_006190 3300053123 Bacteria 2513
820 Ga0500626_105196 3300053128 Bacteria 1226
821 Ga0500642_0027553 3300053130 Bacteria 2334
822 Ga0500655_003338 3300053133 Bacteria 2905
823 Ga0500559_0000574 3300053136 Bacteria 25178
824 Ga0500559_0002746 3300053136 Bacteria 8928
825 Ga0500559_0003351 3300053136 Bacteria 7927
826 Ga0500568_0001771 3300053139 Bacteria 13330
827 Ga0500568_0018059 3300053139 Bacteria 3097
828 Ga0500573_0001192 3300053140 Bacteria 12152
829 Ga0500573_0019429 3300053140 Bacteria 3886
830 Ga0500573_0021180 3300053140 Bacteria 3724
831 Ga0500590_060820 3300053148 Bacteria 1898
832 Ga0500603_000256 3300053150 Bacteria 14013
833 Ga0500603_000419 3300053150 Bacteria 11022
834 Ga0500603_007947 3300053150 Bacteria 2339
835 Ga0500604_0104992 3300053151 Bacteria 934
836 Ga0500616_0021370 3300053153 Bacteria 3630
837 Ga0500619_042928 3300053154 Bacteria 1436
838 Ga0500622_0002624 3300053156 Bacteria 12786
839 Ga0500622_0013188 3300053156 Bacteria 4461
840 Ga0500624_005422 3300053157 Bacteria 1696
841 Ga0500627_0012577 3300053158 Bacteria 3178
842 Ga0500630_000417 3300053159 Bacteria 18274
843 Ga0500633_0004402 3300053160 Bacteria 3225
844 Ga0500638_000928 3300053162 Bacteria 8341
845 Ga0500638_025774 3300053162 Bacteria 2813
846 Ga0500638_093059 3300053162 Bacteria 1417
847 Ga0500639_000075 3300053163 Bacteria 45979
848 Ga0500636_0073851 3300053177 Bacteria 1974
849 Ga0500636_0231457 3300053177 Bacteria 955
850 Ga0500637_0000344 3300053178 Bacteria 17596
851 Ga0500596_000206 3300053735 Bacteria 9839
852 Ga0500596_002064 3300053735 Bacteria 4000
853 Ga0501084_0017189 3300054114 Bacteria 6009
854 Ga0501084_0077665 3300054114 Bacteria 2783
855 Ga0501082_0003295 3300060353 Bacteria 14092
856 Ga0501082_0031358 3300060353 Bacteria 4582
857 Ga0501082_0547762 3300060353 Bacteria 1012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031616 Ga0307508_10187206 Ga0307508_101872062 206
2 3300006871 Ga0075434_100048322 Ga0075434_1000483223 207
3 3300003659 JGI25404J52841_10000116 JGI25404J52841_100001165 209
4 3300005983 Ga0081540_1000194 Ga0081540_100019426 209
5 3300046539 Ga0495621_0034537 Ga0495621_0034537_699_1544 209
6 3300047673 Ga0495593_0070275 Ga0495593_0070275_746_1588 213
7 3300053085 Ga0495619_0069038 Ga0495619_0069038_1205_2050 214
8 iso_pu_bacteria 2602042107 2603858898 214
9 iso_pu_bacteria 2893066018 2893068413 214
10 iso_pu_bacteria 2919073203 2919075393 214
11 iso_pu_bacteria 8019597564 8019601835 214
12 3300006051 Ga0075364_10073751 Ga0075364_100737512 215
13 3300006178 Ga0075367_10348013 Ga0075367_103480132 215
14 3300006186 Ga0075369_10003758 Ga0075369_100037582 215
15 3300025295 Ga0209564_1045525 Ga0209564_10455252 215
16 3300044901 Ga0466960_0119251 Ga0466960_0119251_229_1071 215
17 3300046522 Ga0495643_0277262 Ga0495643_0277262_44_763 215
18 3300048919 Ga0496116_0035861 Ga0496116_0035861_1861_2580 215
19 3300048920 Ga0496117_0041154 Ga0496117_0041154_2034_2753 215
20 3300048926 Ga0496123_0087264 Ga0496123_0087264_630_1349 215
21 3300048928 Ga0496125_0110227 Ga0496125_0110227_845_1564 215
22 3300048929 Ga0496126_0102600 Ga0496126_0102600_861_1580 215
23 3300050491 nmdc:mga00v17_71209_c1 nmdc:mga00v17_71209_c1_425_1144 215
24 3300050516 nmdc:mga0sz30_26303_c1 nmdc:mga0sz30_26303_c1_261_980 215
25 3300053094 Ga0500566_0024630 Ga0500566_0024630_1744_2475 215
26 3300053102 Ga0500554_067289 Ga0500554_067289_79_810 215
27 3300053136 Ga0500559_0000574 Ga0500559_0000574_1589_2320 215
28 3300053157 Ga0500624_005422 Ga0500624_005422_721_1452 215
29 3300053162 Ga0500638_093059 Ga0500638_093059_94_825 215
30 3300053177 Ga0500636_0073851 Ga0500636_0073851_558_1289 215
31 3300035692 Ga0373935_0199533 Ga0373935_0199533_320_1132 216
32 3300046474 Ga0495605_0109787 Ga0495605_0109787_201_986 216
33 3300005548 Ga0070665_100398255 Ga0070665_1003982552 217
34 3300005937 Ga0081455_10010602 Ga0081455_100106026 217
35 3300028379 Ga0268266_10247313 Ga0268266_102473131 217
36 3300035118 Ga0373954_0021760 Ga0373954_0021760_1863_2708 217
37 3300035119 Ga0373956_0006725 Ga0373956_0006725_1146_1991 217
38 3300035120 Ga0373957_0007552 Ga0373957_0007552_491_1336 217
39 3300035172 Ga0373955_0022680 Ga0373955_0022680_2092_2937 217
40 3300046454 Ga0495592_0029619 Ga0495592_0029619_1602_2447 217
41 3300046511 Ga0495608_0016022 Ga0495608_0016022_2772_3617 217
42 3300046529 Ga0495652_0024880 Ga0495652_0024880_1919_2764 217
43 3300046533 Ga0495640_0058762 Ga0495640_0058762_164_1009 217
44 3300046535 Ga0495586_0178448 Ga0495586_0178448_107_952 217
45 3300046543 Ga0495645_0004657 Ga0495645_0004657_5599_6444 217
46 3300046663 Ga0495635_0083302 Ga0495635_0083302_1258_2103 217
47 3300046665 Ga0495661_0047522 Ga0495661_0047522_1751_2596 217
48 3300046675 Ga0495657_0052105 Ga0495657_0052105_1609_2454 217
49 3300046679 Ga0495623_0011880 Ga0495623_0011880_3226_4071 217
50 3300046680 Ga0495646_0135529 Ga0495646_0135529_291_1136 217
51 3300046809 Ga0495600_0026213 Ga0495600_0026213_2413_3258 217
52 3300047317 Ga0495604_0010123 Ga0495604_0010123_5526_6371 217
53 3300047319 Ga0495674_0041943 Ga0495674_0041943_3126_3971 217
54 3300047322 Ga0495680_0080400 Ga0495680_0080400_1371_2216 217
55 3300047444 Ga0495675_0125446 Ga0495675_0125446_633_1478 217
56 3300047471 Ga0495684_0162408 Ga0495684_0162408_19_864 217
57 3300048915 Ga0496112_0101393 Ga0496112_0101393_34_735 217
58 3300048923 Ga0496120_0052867 Ga0496120_0052867_1047_1889 217
59 3300053077 Ga0495601_0020511 Ga0495601_0020511_3126_3971 217
60 3300053078 Ga0495612_0008915 Ga0495612_0008915_1318_2163 217
61 3300053080 Ga0500635_0028962 Ga0500635_0028962_1008_1733 217
62 3300053084 Ga0495595_0014528 Ga0495595_0014528_2092_2937 217
63 3300005539 Ga0068853_100246035 Ga0068853_1002460352 218
64 3300005563 Ga0068855_100038066 Ga0068855_1000380664 218
65 3300009098 Ga0105245_10192066 Ga0105245_101920663 218
66 3300009545 Ga0105237_10078218 Ga0105237_100782182 218
67 3300009551 Ga0105238_10178225 Ga0105238_101782252 218
68 3300010375 Ga0105239_10137458 Ga0105239_101374584 218
69 3300025924 Ga0207694_10068895 Ga0207694_100688952 218
70 3300025927 Ga0207687_10394115 Ga0207687_103941152 218
71 3300026041 Ga0207639_10171061 Ga0207639_101710612 218
72 3300028379 Ga0268266_10196336 Ga0268266_101963363 218
73 3300037471 Ga0395905_0015125 Ga0395905_0015125_4612_5454 218
74 3300046455 Ga0495603_0341457 Ga0495603_0341457_83_847 218
75 3300046648 Ga0495611_0105223 Ga0495611_0105223_268_1110 218
76 3300048920 Ga0496117_0134558 Ga0496117_0134558_215_1060 218
77 3300044694 Ga0466963_0029408 Ga0466963_0029408_506_1348 219
78 3300045976 Ga0466967_0110589 Ga0466967_0110589_398_1240 219
79 3300046679 Ga0495623_0210258 Ga0495623_0210258_383_1090 219
80 3300049823 Ga0501044_0523303 Ga0501044_0523303_77_784 219
81 3300049823 Ga0501044_0921400 Ga0501044_0921400_15_722 219
82 3300005329 Ga0070683_100006551 Ga0070683_1000065518 220
83 3300005336 Ga0070680_100023908 Ga0070680_1000239082 220
84 3300005547 Ga0070693_100081143 Ga0070693_1000811432 220
85 3300013105 Ga0157369_10013468 Ga0157369_100134684 220
86 3300025917 Ga0207660_10132693 Ga0207660_101326932 220
87 3300025944 Ga0207661_10010713 Ga0207661_100107132 220
88 3300026116 Ga0207674_10197480 Ga0207674_101974801 220
89 3300053119 Ga0500595_002446 Ga0500595_002446_2342_3202 220
90 3300005539 Ga0068853_100102014 Ga0068853_1001020142 221
91 3300010159 Ga0099796_10027048 Ga0099796_100270482 221
92 3300035083 Ga0373926_0030368 Ga0373926_0030368_11_724 221
93 3300035118 Ga0373954_0029454 Ga0373954_0029454_1804_2517 221
94 3300035172 Ga0373955_0015377 Ga0373955_0015377_646_1494 221
95 3300035725 Ga0373947_0065428 Ga0373947_0065428_716_1588 221
96 3300037068 Ga0373925_0283568 Ga0373925_0283568_444_1316 221
97 3300046455 Ga0495603_0008868 Ga0495603_0008868_3799_4671 221
98 3300046475 Ga0495639_0044661 Ga0495639_0044661_259_1131 221
99 3300047315 Ga0495581_0075233 Ga0495581_0075233_642_1514 221
100 3300048910 Ga0496107_0694773 Ga0496107_0694773_23_736 221
101 3300031711 Ga0265314_10049893 Ga0265314_100498932 222
102 3300042007 Ga0439449_0104524 Ga0439449_0104524_312_1037 223
103 3300044694 Ga0466963_0130819 Ga0466963_0130819_153_995 223
104 3300045976 Ga0466967_0008029 Ga0466967_0008029_4495_5337 223
105 3300003354 JGI25160J50197_1008364 JGI25160J50197_10083643 224
106 3300006186 Ga0075369_10027572 Ga0075369_100275722 224
107 3300006944 Ga0099823_1033009 Ga0099823_10330093 224
108 3300009098 Ga0105245_10655061 Ga0105245_106550612 224
109 3300009101 Ga0105247_10392264 Ga0105247_103922641 224
110 3300009174 Ga0105241_10096542 Ga0105241_100965422 224
111 3300009177 Ga0105248_10298507 Ga0105248_102985071 224
112 3300009545 Ga0105237_10152321 Ga0105237_101523213 224
113 3300011119 Ga0105246_10049935 Ga0105246_100499352 224
114 3300014325 Ga0163163_10039525 Ga0163163_100395253 224
115 3300025261 Ga0209233_1013319 Ga0209233_10133192 224
116 3300025302 Ga0207426_1000352 Ga0207426_10003526 224
117 3300025908 Ga0207643_10124029 Ga0207643_101240292 224
118 3300025919 Ga0207657_10270483 Ga0207657_102704832 224
119 3300027296 Ga0209389_1000026 Ga0209389_100002685 224
120 3300027296 Ga0209389_1000117 Ga0209389_100011717 224
121 3300027357 Ga0209589_1000022 Ga0209589_100002285 224
122 3300027361 Ga0209489_100058 Ga0209489_10005886 224
123 3300027361 Ga0209489_105776 Ga0209489_1057765 224
124 3300027363 Ga0209700_100021 Ga0209700_10002117 224
125 3300046462 Ga0495651_0012419 Ga0495651_0012419_971_1813 224
126 3300046511 Ga0495608_0092943 Ga0495608_0092943_971_1813 224
127 3300046516 Ga0495628_0006463 Ga0495628_0006463_76_918 224
128 3300046524 Ga0495648_0152062 Ga0495648_0152062_234_1076 224
129 3300046529 Ga0495652_0007725 Ga0495652_0007725_2718_3560 224
130 3300046559 Ga0495667_0085014 Ga0495667_0085014_1120_1962 224
131 3300046660 Ga0495625_0300671 Ga0495625_0300671_86_928 224
132 3300046675 Ga0495657_0030199 Ga0495657_0030199_812_1654 224
133 3300046678 Ga0495599_0021687 Ga0495599_0021687_1930_2772 224
134 3300046680 Ga0495646_0053411 Ga0495646_0053411_639_1481 224
135 3300046689 Ga0495613_0181733 Ga0495613_0181733_627_1469 224
136 3300046809 Ga0495600_0050610 Ga0495600_0050610_741_1583 224
137 3300047317 Ga0495604_0025605 Ga0495604_0025605_1057_1899 224
138 3300047319 Ga0495674_0037678 Ga0495674_0037678_372_1214 224
139 3300047322 Ga0495680_0006723 Ga0495680_0006723_986_1828 224
140 3300048088 Ga0495602_0181878 Ga0495602_0181878_68_910 224
141 3300048911 Ga0496108_0057791 Ga0496108_0057791_1141_1983 224
142 3300048928 Ga0496125_0034392 Ga0496125_0034392_2475_3317 224
143 3300048928 Ga0496125_0063266 Ga0496125_0063266_1872_2714 224
144 3300053085 Ga0495619_0090951 Ga0495619_0090951_1166_2008 224
145 3300053086 Ga0500578_0039793 Ga0500578_0039793_1488_2330 224
146 3300053098 Ga0500650_0107777 Ga0500650_0107777_23_865 224
147 3300053109 Ga0500569_060064 Ga0500569_060064_269_1111 224
148 3300053151 Ga0500604_0104992 Ga0500604_0104992_50_892 224
149 3300053153 Ga0500616_0021370 Ga0500616_0021370_1232_2074 224
150 3300053156 Ga0500622_0013188 Ga0500622_0013188_211_1053 224
151 3300053160 Ga0500633_0004402 Ga0500633_0004402_2140_2982 224
152 3300009101 Ga0105247_10417599 Ga0105247_104175991 225
153 3300025981 Ga0207640_10031645 Ga0207640_100316453 225
154 3300046462 Ga0495651_0303209 Ga0495651_0303209_131_979 225
155 3300046678 Ga0495599_0116018 Ga0495599_0116018_96_944 225
156 3300048928 Ga0496125_0304680 Ga0496125_0304680_28_927 225
157 3300050514 nmdc:mga08x19_4420_c1 nmdc:mga08x19_4420_c1_3920_4702 225
158 3300007788 Ga0099795_10022566 Ga0099795_100225663 226
159 3300025915 Ga0207693_10025304 Ga0207693_100253045 226
160 3300025939 Ga0207665_10074733 Ga0207665_100747332 226
161 3300035171 Ga0373946_0027108 Ga0373946_0027108_862_1710 226
162 3300035695 Ga0373927_0020113 Ga0373927_0020113_2795_3643 226
163 3300035725 Ga0373947_0014430 Ga0373947_0014430_3206_4054 226
164 3300036401 Ga0373937_0093056 Ga0373937_0093056_525_1373 226
165 3300037068 Ga0373925_0041570 Ga0373925_0041570_2156_3004 226
166 3300044658 Ga0466972_0000125 Ga0466972_0000125_2362_3204 226
167 3300046454 Ga0495592_0029939 Ga0495592_0029939_59_907 226
168 3300046459 Ga0495629_0053747 Ga0495629_0053747_99_947 226
169 3300046472 Ga0495580_0005823 Ga0495580_0005823_6291_7139 226
170 3300046475 Ga0495639_0013479 Ga0495639_0013479_721_1569 226
171 3300046476 Ga0495662_0010116 Ga0495662_0010116_1369_2217 226
172 3300046514 Ga0495618_0053124 Ga0495618_0053124_382_1230 226
173 3300046516 Ga0495628_0133077 Ga0495628_0133077_173_1021 226
174 3300046531 Ga0495665_0024725 Ga0495665_0024725_516_1364 226
175 3300046533 Ga0495640_0014243 Ga0495640_0014243_3210_4058 226
176 3300046683 Ga0495658_0171094 Ga0495658_0171094_385_1233 226
177 3300047471 Ga0495684_0018553 Ga0495684_0018553_1799_2647 226
178 3300048089 Ga0495614_0063156 Ga0495614_0063156_730_1578 226
179 3300053085 Ga0495619_0222557 Ga0495619_0222557_71_919 226
180 3300053119 Ga0500595_084312 Ga0500595_084312_22_813 226
181 3300005563 Ga0068855_100492181 Ga0068855_1004921812 227
182 3300005616 Ga0068852_100007152 Ga0068852_1000071524 227
183 3300014325 Ga0163163_10082533 Ga0163163_100825333 227
184 3300025914 Ga0207671_10011788 Ga0207671_100117882 227
185 3300025926 Ga0207659_10057139 Ga0207659_100571392 227
186 3300025939 Ga0207665_10199248 Ga0207665_101992482 227
187 3300026142 Ga0207698_10036174 Ga0207698_100361742 227
188 3300046663 Ga0495635_0144259 Ga0495635_0144259_340_1173 227
189 3300047444 Ga0495675_0149928 Ga0495675_0149928_561_1403 227
190 3300005327 Ga0070658_10569759 Ga0070658_105697591 228
191 3300005614 Ga0068856_100006824 Ga0068856_1000068242 228
192 3300026078 Ga0207702_10000075 Ga0207702_1000007535 228
193 3300046683 Ga0495658_0159500 Ga0495658_0159500_416_1252 228
194 3300021321 Ga0214542_1000002 Ga0214542_1000002706 229
195 3300021324 Ga0214545_1000002 Ga0214545_100000214 229
196 3300021327 Ga0214543_1000013 Ga0214543_1000013308 229
197 3300021384 Ga0213876_10004782 Ga0213876_100047822 229
198 3300035086 Ga0373934_0113757 Ga0373934_0113757_156_1004 229
199 3300039437 Ga0436365_0816602 Ga0436365_0816602_4533_5402 229
200 3300039453 Ga0436362_0386716 Ga0436362_0386716_677_1546 229
201 3300046477 Ga0495664_0258601 Ga0495664_0258601_118_960 229
202 3300025906 Ga0207699_10282184 Ga0207699_102821842 230
203 3300039450 Ga0436363_0990757 Ga0436363_0990757_1489_2361 230
204 3300048924 Ga0496121_0002708 Ga0496121_0002708_4244_5092 230
205 3300048929 Ga0496126_0049624 Ga0496126_0049624_2455_3315 230
206 3300005436 Ga0070713_100115699 Ga0070713_1001156992 231
207 3300005456 Ga0070678_100376999 Ga0070678_1003769992 231
208 3300006028 Ga0070717_10002902 Ga0070717_100029022 231
209 3300013308 Ga0157375_10093773 Ga0157375_100937732 231
210 3300025893 Ga0207682_10167539 Ga0207682_101675392 231
211 3300025929 Ga0207664_10095350 Ga0207664_100953503 231
212 3300025938 Ga0207704_10047009 Ga0207704_100470092 231
213 3300026121 Ga0207683_10008466 Ga0207683_1000846610 231
214 3300027671 Ga0209588_1039063 Ga0209588_10390631 231
215 3300044694 Ga0466963_0073222 Ga0466963_0073222_89_928 231
216 3300046524 Ga0495648_0001444 Ga0495648_0001444_9178_10026 231
217 3300048924 Ga0496121_0055410 Ga0496121_0055410_617_1465 231
218 3300006175 Ga0070712_100083278 Ga0070712_1000832783 232
219 3300010375 Ga0105239_10321912 Ga0105239_103219122 232
220 3300025321 Ga0207656_10036565 Ga0207656_100365652 232
221 3300025915 Ga0207693_10023378 Ga0207693_100233783 232
222 3300025949 Ga0207667_10351139 Ga0207667_103511392 232
223 3300046513 Ga0495616_0064932 Ga0495616_0064932_43_807 232
224 3300047315 Ga0495581_0088964 Ga0495581_0088964_579_1427 232
225 3300047320 Ga0495672_0044951 Ga0495672_0044951_842_1630 232
226 3300048914 Ga0496111_0310100 Ga0496111_0310100_353_1117 232
227 3300006914 Ga0075436_100012308 Ga0075436_1000123086 233
228 3300028794 Ga0307515_10001215 Ga0307515_1000121540 233
229 3300003215 JGI25153J46596_10010551 JGI25153J46596_100105512 234
230 3300003794 Ga0055531_10007514 Ga0055531_100075146 234
231 3300005262 Ga0065165_1022430 Ga0065165_10224302 234
232 3300005434 Ga0070709_10182392 Ga0070709_101823922 234
233 3300005437 Ga0070710_10013542 Ga0070710_100135422 234
234 3300006175 Ga0070712_100069625 Ga0070712_1000696252 234
235 3300009176 Ga0105242_10122393 Ga0105242_101223933 234
236 3300013306 Ga0163162_10058709 Ga0163162_100587094 234
237 3300025295 Ga0209564_1004055 Ga0209564_10040553 234
238 3300025297 Ga0209758_1000021 Ga0209758_100002185 234
239 3300025299 Ga0209256_1006335 Ga0209256_10063353 234
240 3300025898 Ga0207692_10014687 Ga0207692_100146872 234
241 3300025919 Ga0207657_10018606 Ga0207657_100186067 234
242 3300028379 Ga0268266_10040338 Ga0268266_100403385 234
243 3300035695 Ga0373927_0000055 Ga0373927_0000055_10366_11187 234
244 3300037068 Ga0373925_0002732 Ga0373925_0002732_2662_3483 234
245 3300037418 Ga0395900_0004044 Ga0395900_0004044_12685_13527 234
246 3300037418 Ga0395900_0777142 Ga0395900_0777142_23_865 234
247 3300037466 Ga0395898_0014868 Ga0395898_0014868_1315_2157 234
248 3300038443 Ga0395901_0026961 Ga0395901_0026961_1773_2615 234
249 3300038443 Ga0395901_0078519 Ga0395901_0078519_1887_2729 234
250 3300046477 Ga0495664_0027870 Ga0495664_0027870_661_1509 234
251 3300046543 Ga0495645_0006519 Ga0495645_0006519_3780_4628 234
252 3300048903 Ga0496100_0148449 Ga0496100_0148449_615_1460 234
253 3300053077 Ga0495601_0012797 Ga0495601_0012797_4088_4936 234
254 3300053078 Ga0495612_0003344 Ga0495612_0003344_4802_5650 234
255 3300053139 Ga0500568_0018059 Ga0500568_0018059_1247_2083 234
256 3300005937 Ga0081455_10005182 Ga0081455_1000518211 235
257 3300031238 Ga0265332_10015585 Ga0265332_100155852 235
258 3300031712 Ga0265342_10185106 Ga0265342_101851062 235
259 3300037068 Ga0373925_0022291 Ga0373925_0022291_3209_4054 235
260 3300042006 Ga0439432_059869 Ga0439432_059869_200_1030 235
261 3300046460 Ga0495638_0082443 Ga0495638_0082443_10_855 235
262 3300053096 Ga0500641_0042152 Ga0500641_0042152_968_1813 235
263 3300053119 Ga0500595_002192 Ga0500595_002192_5549_6394 235
264 3300053130 Ga0500642_0027553 Ga0500642_0027553_877_1722 235
265 iso_pu_bacteria 2511231028 2511394307 235
266 iso_pu_bacteria 2513237095 2513646710 235
267 iso_pu_bacteria 2513237161 2514010860 235
268 iso_pu_bacteria 2528768022 2528854807 235
269 iso_pu_bacteria 2617270741 2617376416 235
270 iso_pu_bacteria 2802429603 2805919797 235
271 iso_pu_bacteria 2842038055 2842039698 235
272 iso_pu_bacteria 2842045827 2842047356 235
273 iso_pu_bacteria 2932794094 2932796564 235
274 iso_pu_bacteria 2932801729 2932803442 235
275 iso_pu_bacteria 2935883170 2935886513 235
276 3300006237 Ga0097621_100098471 Ga0097621_1000984712 236
277 3300009093 Ga0105240_10013520 Ga0105240_100135204 236
278 3300025911 Ga0207654_10001822 Ga0207654_100018228 236
279 3300025913 Ga0207695_10000402 Ga0207695_1000040251 236
280 3300026078 Ga0207702_10000025 Ga0207702_1000002553 236
281 3300046535 Ga0495586_0120638 Ga0495586_0120638_667_1455 236
282 3300047320 Ga0495672_0115352 Ga0495672_0115352_20_838 236
283 3300048910 Ga0496107_0117099 Ga0496107_0117099_374_1216 236
284 3300048924 Ga0496121_0164105 Ga0496121_0164105_121_987 236
285 3300048929 Ga0496126_0084889 Ga0496126_0084889_600_1466 236
286 3300049572 Ga0501036_0130677 Ga0501036_0130677_220_1068 236
287 3300049586 Ga0501070_0365200 Ga0501070_0365200_263_1111 236
288 3300049822 Ga0501035_0255004 Ga0501035_0255004_599_1447 236
289 3300036459 Ga0372808_002270 Ga0372808_002270_1133_1981 237
290 3300046462 Ga0495651_0019954 Ga0495651_0019954_2451_3302 237
291 3300046679 Ga0495623_0072531 Ga0495623_0072531_1185_2036 237
292 3300005436 Ga0070713_100021728 Ga0070713_1000217282 238
293 3300025302 Ga0207426_1019301 Ga0207426_10193012 238
294 3300025915 Ga0207693_10019275 Ga0207693_100192754 238
295 3300025919 Ga0207657_10180860 Ga0207657_101808601 238
296 3300025928 Ga0207700_10093155 Ga0207700_100931552 238
297 3300033179 Ga0307507_10264310 Ga0307507_102643101 238
298 3300033180 Ga0307510_10019345 Ga0307510_100193455 238
299 3300046507 Ga0495606_0132410 Ga0495606_0132410_589_1455 238
300 3300048929 Ga0496126_0261527 Ga0496126_0261527_596_1408 238
301 3300049579 Ga0501043_0087125 Ga0501043_0087125_1336_2178 238
302 3300049581 Ga0501047_0244639 Ga0501047_0244639_290_1141 238
303 3300053158 Ga0500627_0012577 Ga0500627_0012577_1977_2813 238
304 3300004625 Ga0055543_1005252 Ga0055543_10052522 239
305 3300005262 Ga0065165_1007304 Ga0065165_10073043 239
306 3300021320 Ga0214544_1000009 Ga0214544_1000009264 239
307 3300025299 Ga0209256_1034176 Ga0209256_10341762 239
308 3300031456 Ga0307513_10459117 Ga0307513_104591171 239
309 3300037471 Ga0395905_0236109 Ga0395905_0236109_718_1503 239
310 3300044901 Ga0466960_0261465 Ga0466960_0261465_47_832 239
311 3300046477 Ga0495664_0091289 Ga0495664_0091289_837_1622 239
312 3300046522 Ga0495643_0073713 Ga0495643_0073713_709_1494 239
313 3300046524 Ga0495648_0003981 Ga0495648_0003981_10189_11037 239
314 3300046684 Ga0495669_0221824 Ga0495669_0221824_101_886 239
315 3300048904 Ga0496101_0130228 Ga0496101_0130228_494_1279 239
316 3300049460 Ga0495682_0091903 Ga0495682_0091903_259_1044 239
317 3300049569 Ga0501032_0197211 Ga0501032_0197211_137_988 239
318 3300049573 Ga0501037_0073405 Ga0501037_0073405_1027_1878 239
319 3300049579 Ga0501043_0077394 Ga0501043_0077394_216_1067 239
320 3300049586 Ga0501070_0320673 Ga0501070_0320673_103_954 239
321 3300049589 Ga0501073_0072904 Ga0501073_0072904_561_1412 239
322 3300049742 Ga0501080_0092942 Ga0501080_0092942_256_1107 239
323 3300053128 Ga0500626_105196 Ga0500626_105196_262_1047 239
324 3300053154 Ga0500619_042928 Ga0500619_042928_616_1401 239
325 3300005539 Ga0068853_100011456 Ga0068853_1000114562 240
326 3300005577 Ga0068857_100052409 Ga0068857_1000524093 240
327 3300005578 Ga0068854_100027544 Ga0068854_1000275442 240
328 3300005616 Ga0068852_100327976 Ga0068852_1003279762 240
329 3300021327 Ga0214543_1000011 Ga0214543_1000011282 240
330 3300026142 Ga0207698_10073533 Ga0207698_100735332 240
331 3300046660 Ga0495625_0245226 Ga0495625_0245226_257_1105 240
332 3300047472 Ga0495686_0139342 Ga0495686_0139342_335_1123 240
333 3300049570 Ga0501033_0116629 Ga0501033_0116629_513_1304 240
334 3300049572 Ga0501036_0218974 Ga0501036_0218974_301_1092 240
335 3300049581 Ga0501047_0053662 Ga0501047_0053662_188_979 240
336 3300005336 Ga0070680_100306071 Ga0070680_1003060712 241
337 3300005337 Ga0070682_100149109 Ga0070682_1001491092 241
338 3300005458 Ga0070681_10120655 Ga0070681_101206552 241
339 3300005563 Ga0068855_100235270 Ga0068855_1002352702 241
340 3300007265 Ga0099794_10074857 Ga0099794_100748572 241
341 3300009174 Ga0105241_10047312 Ga0105241_100473122 241
342 3300009174 Ga0105241_10325928 Ga0105241_103259282 241
343 3300009551 Ga0105238_10040291 Ga0105238_100402912 241
344 3300025911 Ga0207654_10100216 Ga0207654_101002162 241
345 3300025912 Ga0207707_10001692 Ga0207707_100016928 241
346 3300025921 Ga0207652_10014144 Ga0207652_100141444 241
347 3300025924 Ga0207694_10001125 Ga0207694_100011254 241
348 3300025949 Ga0207667_10011695 Ga0207667_100116958 241
349 3300025981 Ga0207640_10051574 Ga0207640_100515742 241
350 3300026116 Ga0207674_10059101 Ga0207674_100591015 241
351 3300028786 Ga0307517_10000111 Ga0307517_1000011161 241
352 3300035113 Ga0373936_0015755 Ga0373936_0015755_1958_2800 241
353 3300035116 Ga0373945_0002999 Ga0373945_0002999_3727_4569 241
354 3300035120 Ga0373957_0048788 Ga0373957_0048788_736_1578 241
355 3300035692 Ga0373935_0217665 Ga0373935_0217665_211_1053 241
356 3300046460 Ga0495638_0026451 Ga0495638_0026451_704_1543 241
357 3300046517 Ga0495630_0043783 Ga0495630_0043783_118_960 241
358 3300046642 Ga0495634_0068211 Ga0495634_0068211_71_913 241
359 3300048929 Ga0496126_0199052 Ga0496126_0199052_692_1540 241
360 3300049568 Ga0501031_0096091 Ga0501031_0096091_855_1706 241
361 3300049569 Ga0501032_0014051 Ga0501032_0014051_1168_2019 241
362 3300049570 Ga0501033_0169279 Ga0501033_0169279_132_983 241
363 3300049574 Ga0501038_0045437 Ga0501038_0045437_2126_2977 241
364 3300049578 Ga0501042_0001807 Ga0501042_0001807_7718_8569 241
365 3300049579 Ga0501043_0271238 Ga0501043_0271238_228_1079 241
366 3300049581 Ga0501047_0092561 Ga0501047_0092561_390_1241 241
367 3300049582 Ga0501048_0002884 Ga0501048_0002884_8957_9808 241
368 3300049583 Ga0501067_0003267 Ga0501067_0003267_1085_1936 241
369 3300049584 Ga0501068_0030639 Ga0501068_0030639_1897_2748 241
370 3300049585 Ga0501069_0003837 Ga0501069_0003837_5474_6325 241
371 3300049586 Ga0501070_0172835 Ga0501070_0172835_524_1375 241
372 3300049588 Ga0501072_0034878 Ga0501072_0034878_2506_3357 241
373 3300049589 Ga0501073_0007705 Ga0501073_0007705_5974_6825 241
374 3300049590 Ga0501074_0126050 Ga0501074_0126050_632_1483 241
375 3300049741 Ga0501079_0067161 Ga0501079_0067161_1401_2252 241
376 3300049742 Ga0501080_0067267 Ga0501080_0067267_2254_3105 241
377 3300049744 Ga0501083_0019181 Ga0501083_0019181_2503_3354 241
378 3300049822 Ga0501035_0312230 Ga0501035_0312230_248_1099 241
379 3300049823 Ga0501044_0024290 Ga0501044_0024290_5414_6256 241
380 3300049823 Ga0501044_0039475 Ga0501044_0039475_1568_2419 241
381 3300053088 Ga0500644_0011834 Ga0500644_0011834_78_917 241
382 3300053156 Ga0500622_0002624 Ga0500622_0002624_3102_3941 241
383 3300054114 Ga0501084_0077665 Ga0501084_0077665_355_1206 241
384 3300060353 Ga0501082_0031358 Ga0501082_0031358_1779_2630 241
385 3300005436 Ga0070713_100266642 Ga0070713_1002666422 242
386 3300005437 Ga0070710_10013756 Ga0070710_100137563 242
387 3300005439 Ga0070711_100066115 Ga0070711_1000661152 242
388 3300006175 Ga0070712_100194091 Ga0070712_1001940912 242
389 3300025906 Ga0207699_10050465 Ga0207699_100504652 242
390 3300025915 Ga0207693_10036543 Ga0207693_100365434 242
391 3300031241 Ga0265325_10003304 Ga0265325_100033044 242
392 3300031711 Ga0265314_10183469 Ga0265314_101834692 242
393 3300031712 Ga0265342_10028442 Ga0265342_100284422 242
394 3300039438 Ga0436360_1185964 Ga0436360_1185964_457_1329 242
395 3300048911 Ga0496108_0235302 Ga0496108_0235302_140_988 242
396 3300053140 Ga0500573_0001192 Ga0500573_0001192_2395_3231 242
397 3300053140 Ga0500573_0021180 Ga0500573_0021180_1765_2601 242
398 iso_pu_bacteria 2513237098 2513672213 242
399 iso_pu_bacteria 2524023210 2524465232 242
400 3300005327 Ga0070658_10137963 Ga0070658_101379633 243
401 3300005535 Ga0070684_100106419 Ga0070684_1001064192 243
402 3300006871 Ga0075434_100026275 Ga0075434_1000262754 243
403 3300013104 Ga0157370_10095170 Ga0157370_100951702 243
404 3300025909 Ga0207705_10112367 Ga0207705_101123673 243
405 3300025913 Ga0207695_10047854 Ga0207695_100478543 243
406 3300025913 Ga0207695_10111595 Ga0207695_101115952 243
407 3300025921 Ga0207652_10203913 Ga0207652_102039132 243
408 3300025922 Ga0207646_10540065 Ga0207646_105400651 243
409 3300025944 Ga0207661_10117278 Ga0207661_101172782 243
410 3300026078 Ga0207702_10122437 Ga0207702_101224372 243
411 3300044735 Ga0466968_0130373 Ga0466968_0130373_40_876 243
412 3300049568 Ga0501031_0058711 Ga0501031_0058711_903_1754 243
413 3300049574 Ga0501038_0010386 Ga0501038_0010386_4244_5095 243
414 3300049579 Ga0501043_0046455 Ga0501043_0046455_87_938 243
415 3300049823 Ga0501044_0035700 Ga0501044_0035700_218_1069 243
416 iso_pu_bacteria 2791355197 2793070136 243
417 3300005347 Ga0070668_100005342 Ga0070668_1000053424 244
418 3300025939 Ga0207665_10147109 Ga0207665_101471092 244
419 3300038443 Ga0395901_0436649 Ga0395901_0436649_156_1004 244
420 3300044901 Ga0466960_0230327 Ga0466960_0230327_203_994 244
421 3300046462 Ga0495651_0037905 Ga0495651_0037905_1844_2626 244
422 3300047472 Ga0495686_0158587 Ga0495686_0158587_88_936 244
423 3300011119 Ga0105246_10001020 Ga0105246_1000102011 245
424 3300013296 Ga0157374_10014119 Ga0157374_100141193 245
425 3300013308 Ga0157375_10007265 Ga0157375_100072653 245
426 3300014325 Ga0163163_10244970 Ga0163163_102449702 245
427 3300037471 Ga0395905_0170896 Ga0395905_0170896_948_1793 245
428 3300041512 Ga0451853_1526884 Ga0451853_1526884_308_1177 245
429 3300046460 Ga0495638_0016433 Ga0495638_0016433_2158_3003 245
430 3300048907 Ga0496104_0000169 Ga0496104_0000169_5515_6390 245
431 3300048908 Ga0496105_0009216 Ga0496105_0009216_4979_5854 245
432 3300048911 Ga0496108_0012291 Ga0496108_0012291_5588_6463 245
433 3300048912 Ga0496109_0005985 Ga0496109_0005985_7711_8586 245
434 3300048912 Ga0496109_0014074 Ga0496109_0014074_4501_5370 245
435 3300048913 Ga0496110_0000578 Ga0496110_0000578_19634_20509 245
436 3300048914 Ga0496111_0034908 Ga0496111_0034908_1643_2518 245
437 3300048915 Ga0496112_0002812 Ga0496112_0002812_8697_9572 245
438 3300048916 Ga0496113_0001268 Ga0496113_0001268_4524_5399 245
439 3300049580 Ga0501046_0052091 Ga0501046_0052091_1875_2732 245
440 3300053078 Ga0495612_0037453 Ga0495612_0037453_415_1260 245
441 3300003659 JGI25404J52841_10001163 JGI25404J52841_100011634 246
442 3300005985 Ga0081539_10000250 Ga0081539_1000025029 246
443 3300025960 Ga0207651_10271838 Ga0207651_102718382 246
444 3300037418 Ga0395900_0252112 Ga0395900_0252112_675_1463 246
445 3300037471 Ga0395905_0054406 Ga0395905_0054406_763_1551 246
446 3300046615 Ga0495656_0282399 Ga0495656_0282399_23_811 246
447 3300048917 Ga0496114_0031108 Ga0496114_0031108_2337_3155 246
448 3300048929 Ga0496126_0030328 Ga0496126_0030328_1597_2385 246
449 3300050513 nmdc:mga0rr50_120291_c1 nmdc:mga0rr50_120291_c1_895_1683 246
450 3300005339 Ga0070660_100103114 Ga0070660_1001031143 247
451 3300005434 Ga0070709_10000310 Ga0070709_100003104 247
452 3300005458 Ga0070681_10361193 Ga0070681_103611932 247
453 3300005530 Ga0070679_100378437 Ga0070679_1003784372 247
454 3300006028 Ga0070717_10211271 Ga0070717_102112712 247
455 3300025906 Ga0207699_10002283 Ga0207699_100022835 247
456 3300025939 Ga0207665_10016296 Ga0207665_100162963 247
457 3300026142 Ga0207698_10031132 Ga0207698_100311325 247
458 3300049586 Ga0501070_0253628 Ga0501070_0253628_301_1092 247
459 iso_pu_bacteria 8056681323 8056683359 247
460 3300044658 Ga0466972_0003074 Ga0466972_0003074_4871_5716 248
461 3300044735 Ga0466968_0003815 Ga0466968_0003815_2058_2903 248
462 3300048908 Ga0496105_0032167 Ga0496105_0032167_3283_4122 248
463 3300048909 Ga0496106_0156780 Ga0496106_0156780_109_948 248
464 3300048911 Ga0496108_0001206 Ga0496108_0001206_5311_6150 248
465 3300048912 Ga0496109_0000201 Ga0496109_0000201_31172_32011 248
466 3300048916 Ga0496113_0045884 Ga0496113_0045884_1500_2339 248
467 3300053091 Ga0500647_0132385 Ga0500647_0132385_53_877 248
468 3300053094 Ga0500566_0000951 Ga0500566_0000951_4071_4895 248
469 3300053095 Ga0500640_001381 Ga0500640_001381_1403_2227 248
470 3300053111 Ga0500572_000425 Ga0500572_000425_1403_2227 248
471 3300053122 Ga0500608_008861 Ga0500608_008861_2697_3521 248
472 3300053123 Ga0500614_006190 Ga0500614_006190_1111_1935 248
473 3300053136 Ga0500559_0002746 Ga0500559_0002746_1569_2393 248
474 3300053148 Ga0500590_060820 Ga0500590_060820_736_1560 248
475 3300053150 Ga0500603_000256 Ga0500603_000256_1520_2344 248
476 3300053159 Ga0500630_000417 Ga0500630_000417_16100_16924 248
477 3300053162 Ga0500638_000928 Ga0500638_000928_4951_5775 248
478 3300053163 Ga0500639_000075 Ga0500639_000075_40434_41258 248
479 3300053735 Ga0500596_000206 Ga0500596_000206_524_1348 248
480 iso_pu_bacteria 2513237096 2513656744 248
481 iso_pu_bacteria 2513237137 2513857930 248
482 iso_pu_bacteria 2513237145 2513917929 248
483 iso_pu_bacteria 2517572143 2517893028 248
484 iso_pu_bacteria 2524023228 2524536860 248
485 iso_pu_bacteria 2643221651 2644288370 248
486 iso_pu_bacteria 2667528175 2671117649 248
487 iso_pu_bacteria 2728368998 2728750406 248
488 iso_pu_bacteria 2876808645 2876809084 248
489 iso_pu_bacteria 2879110137 2879118458 248
490 iso_pu_bacteria 2885374607 2885375406 248
491 iso_pu_bacteria 2885383462 2885384981 248
492 iso_pu_bacteria 2903748898 2903751932 248
493 iso_pu_bacteria 2903768456 2903776387 248
494 iso_pu_bacteria 2904699407 2904702634 248
495 iso_pu_bacteria 2906610324 2906617969 248
496 iso_pu_bacteria 2906635258 2906642707 248
497 iso_pu_bacteria 2906660503 2906661462 248
498 iso_pu_bacteria 2908739725 2908743418 248
499 iso_pu_bacteria 2922386360 2922392451 248
500 iso_pu_bacteria 2922425934 2922429478 248
501 iso_pu_bacteria 3005474847 3005479633 248
502 iso_pu_bacteria 8006933436 8006941486 248
503 iso_pu_bacteria 8006973647 8006981198 248
504 iso_pu_bacteria 8019555841 8019557391 248
505 iso_pu_bacteria 8019565922 8019567910 248
506 iso_pu_bacteria 8056689827 8056690124 248
507 3300009766 Ga0123342_1010917 Ga0123342_10109176 249
508 3300031249 Ga0265339_10041083 Ga0265339_100410833 249
509 3300031711 Ga0265314_10037042 Ga0265314_100370422 249
510 3300031712 Ga0265342_10018556 Ga0265342_100185563 249
511 3300035118 Ga0373954_0066288 Ga0373954_0066288_653_1501 249
512 3300048918 Ga0496115_0082432 Ga0496115_0082432_1339_2184 249
513 3300048921 Ga0496118_0213075 Ga0496118_0213075_100_945 249
514 3300048929 Ga0496126_0360947 Ga0496126_0360947_105_950 249
515 3300048929 Ga0496126_0475118 Ga0496126_0475118_56_901 249
516 3300053136 Ga0500559_0003351 Ga0500559_0003351_279_1154 249
517 iso_pu_bacteria 2513237141 2513892764 249
518 iso_pu_bacteria 2935630451 2935633657 249
519 iso_pu_bacteria 2941507105 2941510548 249
520 iso_pu_bacteria 2941515067 2941517713 249
521 iso_pu_bacteria 2941523033 2941525730 249
522 3300005456 Ga0070678_100233421 Ga0070678_1002334212 250
523 3300007265 Ga0099794_10018633 Ga0099794_100186332 250
524 3300007788 Ga0099795_10135524 Ga0099795_101355241 250
525 3300010159 Ga0099796_10062739 Ga0099796_100627392 250
526 3300026121 Ga0207683_10343157 Ga0207683_103431572 250
527 3300027512 Ga0209179_1000519 Ga0209179_10005193 250
528 3300027671 Ga0209588_1027652 Ga0209588_10276522 250
529 3300031711 Ga0265314_10023185 Ga0265314_100231852 250
530 3300031712 Ga0265342_10131712 Ga0265342_101317122 250
531 3300048913 Ga0496110_0367867 Ga0496110_0367867_377_1222 250
532 3300048915 Ga0496112_0547135 Ga0496112_0547135_121_966 250
533 3300003203 JGI25406J46586_10000070 JGI25406J46586_1000007027 251
534 3300003203 JGI25406J46586_10003047 JGI25406J46586_100030477 251
535 3300003203 JGI25406J46586_10018431 JGI25406J46586_100184312 251
536 3300005329 Ga0070683_100013368 Ga0070683_1000133682 251
537 3300005329 Ga0070683_100014283 Ga0070683_1000142834 251
538 3300005334 Ga0068869_100189427 Ga0068869_1001894272 251
539 3300005336 Ga0070680_100011442 Ga0070680_1000114424 251
540 3300005337 Ga0070682_100138662 Ga0070682_1001386622 251
541 3300005338 Ga0068868_100024123 Ga0068868_1000241233 251
542 3300005339 Ga0070660_100008040 Ga0070660_1000080403 251
543 3300005341 Ga0070691_10221549 Ga0070691_102215491 251
544 3300005344 Ga0070661_100470866 Ga0070661_1004708661 251
545 3300005355 Ga0070671_100086709 Ga0070671_1000867092 251
546 3300005355 Ga0070671_100100233 Ga0070671_1001002333 251
547 3300005364 Ga0070673_100286700 Ga0070673_1002867002 251
548 3300005434 Ga0070709_10031725 Ga0070709_100317254 251
549 3300005435 Ga0070714_100008130 Ga0070714_1000081306 251
550 3300005435 Ga0070714_100042796 Ga0070714_1000427963 251
551 3300005436 Ga0070713_100030030 Ga0070713_1000300304 251
552 3300005436 Ga0070713_100150200 Ga0070713_1001502002 251
553 3300005436 Ga0070713_100204497 Ga0070713_1002044972 251
554 3300005436 Ga0070713_100375896 Ga0070713_1003758962 251
555 3300005437 Ga0070710_10003001 Ga0070710_100030014 251
556 3300005437 Ga0070710_10005946 Ga0070710_100059463 251
557 3300005439 Ga0070711_100007725 Ga0070711_1000077254 251
558 3300005439 Ga0070711_100014986 Ga0070711_1000149864 251
559 3300005445 Ga0070708_100349258 Ga0070708_1003492582 251
560 3300005455 Ga0070663_100038934 Ga0070663_1000389341 251
561 3300005455 Ga0070663_100091183 Ga0070663_1000911832 251
562 3300005458 Ga0070681_10062013 Ga0070681_100620133 251
563 3300005471 Ga0070698_100336120 Ga0070698_1003361202 251
564 3300005530 Ga0070679_100023927 Ga0070679_1000239274 251
565 3300005535 Ga0070684_100012368 Ga0070684_1000123683 251
566 3300005535 Ga0070684_100176277 Ga0070684_1001762772 251
567 3300005536 Ga0070697_100412396 Ga0070697_1004123961 251
568 3300005539 Ga0068853_100010883 Ga0068853_1000108833 251
569 3300005548 Ga0070665_100149718 Ga0070665_1001497183 251
570 3300005563 Ga0068855_100083944 Ga0068855_1000839443 251
571 3300005563 Ga0068855_100105358 Ga0068855_1001053583 251
572 3300005563 Ga0068855_100283484 Ga0068855_1002834842 251
573 3300005577 Ga0068857_100006838 Ga0068857_1000068386 251
574 3300005616 Ga0068852_100449513 Ga0068852_1004495132 251
575 3300005834 Ga0068851_10009128 Ga0068851_100091284 251
576 3300005842 Ga0068858_100154655 Ga0068858_1001546553 251
577 3300005843 Ga0068860_100000469 Ga0068860_1000004694 251
578 3300005937 Ga0081455_10020599 Ga0081455_100205994 251
579 3300005983 Ga0081540_1044943 Ga0081540_10449432 251
580 3300005985 Ga0081539_10000269 Ga0081539_10000269101 251
581 3300006175 Ga0070712_100010474 Ga0070712_1000104742 251
582 3300006175 Ga0070712_100016083 Ga0070712_1000160836 251
583 3300006881 Ga0068865_100262939 Ga0068865_1002629392 251
584 3300006942 Ga0099824_1024504 Ga0099824_10245044 251
585 3300006943 Ga0099822_1001268 Ga0099822_100126813 251
586 3300007788 Ga0099795_10007245 Ga0099795_100072453 251
587 3300009093 Ga0105240_10083717 Ga0105240_100837175 251
588 3300009093 Ga0105240_10210667 Ga0105240_102106672 251
589 3300009093 Ga0105240_10250326 Ga0105240_102503262 251
590 3300009098 Ga0105245_10033536 Ga0105245_100335364 251
591 3300009101 Ga0105247_10204573 Ga0105247_102045732 251
592 3300009176 Ga0105242_10102162 Ga0105242_101021622 251
593 3300009177 Ga0105248_10332398 Ga0105248_103323982 251
594 3300009545 Ga0105237_10013053 Ga0105237_100130534 251
595 3300009545 Ga0105237_10128390 Ga0105237_101283903 251
596 3300009545 Ga0105237_10177506 Ga0105237_101775062 251
597 3300009551 Ga0105238_10013890 Ga0105238_100138909 251
598 3300009551 Ga0105238_10061026 Ga0105238_100610264 251
599 3300010159 Ga0099796_10019663 Ga0099796_100196632 251
600 3300010375 Ga0105239_10006580 Ga0105239_100065806 251
601 3300010375 Ga0105239_10296739 Ga0105239_102967392 251
602 3300013104 Ga0157370_10060974 Ga0157370_100609742 251
603 3300013105 Ga0157369_10010618 Ga0157369_100106186 251
604 3300013105 Ga0157369_10016315 Ga0157369_100163153 251
605 3300013306 Ga0163162_10253578 Ga0163162_102535782 251
606 3300013306 Ga0163162_10572396 Ga0163162_105723962 251
607 3300014325 Ga0163163_10060338 Ga0163163_100603382 251
608 3300014968 Ga0157379_10117978 Ga0157379_101179782 251
609 3300014968 Ga0157379_10214304 Ga0157379_102143042 251
610 3300014969 Ga0157376_10003464 Ga0157376_100034644 251
611 3300021377 Ga0213874_10004378 Ga0213874_100043782 251
612 3300025898 Ga0207692_10010453 Ga0207692_100104532 251
613 3300025900 Ga0207710_10179528 Ga0207710_101795282 251
614 3300025901 Ga0207688_10182726 Ga0207688_101827262 251
615 3300025912 Ga0207707_10010614 Ga0207707_100106142 251
616 3300025914 Ga0207671_10331047 Ga0207671_103310472 251
617 3300025914 Ga0207671_10401098 Ga0207671_104010982 251
618 3300025915 Ga0207693_10009963 Ga0207693_100099633 251
619 3300025915 Ga0207693_10044359 Ga0207693_100443594 251
620 3300025916 Ga0207663_10001328 Ga0207663_100013286 251
621 3300025916 Ga0207663_10111235 Ga0207663_101112352 251
622 3300025919 Ga0207657_10003043 Ga0207657_100030437 251
623 3300025924 Ga0207694_10007985 Ga0207694_100079854 251
624 3300025924 Ga0207694_10013513 Ga0207694_100135136 251
625 3300025928 Ga0207700_10061785 Ga0207700_100617853 251
626 3300025928 Ga0207700_10205203 Ga0207700_102052032 251
627 3300025928 Ga0207700_10247016 Ga0207700_102470162 251
628 3300025929 Ga0207664_10029111 Ga0207664_100291114 251
629 3300025931 Ga0207644_10105416 Ga0207644_101054162 251
630 3300025938 Ga0207704_10237674 Ga0207704_102376742 251
631 3300025939 Ga0207665_10067322 Ga0207665_100673223 251
632 3300025939 Ga0207665_10289180 Ga0207665_102891801 251
633 3300025940 Ga0207691_10368920 Ga0207691_103689202 251
634 3300025942 Ga0207689_10186246 Ga0207689_101862462 251
635 3300025944 Ga0207661_10002409 Ga0207661_100024098 251
636 3300025949 Ga0207667_10028182 Ga0207667_100281821 251
637 3300025949 Ga0207667_10387139 Ga0207667_103871392 251
638 3300025981 Ga0207640_10540288 Ga0207640_105402881 251
639 3300026023 Ga0207677_10048467 Ga0207677_100484673 251
640 3300026041 Ga0207639_10018267 Ga0207639_100182676 251
641 3300026041 Ga0207639_10048165 Ga0207639_100481654 251
642 3300026067 Ga0207678_10024581 Ga0207678_100245813 251
643 3300026067 Ga0207678_10110444 Ga0207678_101104442 251
644 3300026078 Ga0207702_10391099 Ga0207702_103910992 251
645 3300026095 Ga0207676_10021699 Ga0207676_100216993 251
646 3300026116 Ga0207674_10003345 Ga0207674_1000334515 251
647 3300026116 Ga0207674_10008172 Ga0207674_100081725 251
648 3300026121 Ga0207683_10018149 Ga0207683_100181494 251
649 3300026142 Ga0207698_10090063 Ga0207698_100900632 251
650 3300026142 Ga0207698_10101166 Ga0207698_101011662 251
651 3300027357 Ga0209589_1000003 Ga0209589_100000356 251
652 3300027361 Ga0209489_100003 Ga0209489_100003107 251
653 3300027363 Ga0209700_100003 Ga0209700_100003107 251
654 3300028379 Ga0268266_10108521 Ga0268266_101085213 251
655 3300028381 Ga0268264_10000022 Ga0268264_10000022176 251
656 3300031247 Ga0265340_10011918 Ga0265340_100119184 251
657 3300031507 Ga0307509_10041596 Ga0307509_100415962 251
658 3300031507 Ga0307509_10073995 Ga0307509_100739953 251
659 3300031616 Ga0307508_10000515 Ga0307508_1000051530 251
660 3300031616 Ga0307508_10139942 Ga0307508_101399422 251
661 3300031730 Ga0307516_10018947 Ga0307516_100189476 251
662 3300033179 Ga0307507_10118283 Ga0307507_101182832 251
663 3300033442 Ga0315911_1000001 Ga0315911_10000011002 251
664 3300035083 Ga0373926_0083654 Ga0373926_0083654_139_987 251
665 3300035085 Ga0373929_0024203 Ga0373929_0024203_119_967 251
666 3300035086 Ga0373934_0004274 Ga0373934_0004274_1460_2323 251
667 3300035111 Ga0373923_0000310 Ga0373923_0000310_4308_5171 251
668 3300035113 Ga0373936_0005876 Ga0373936_0005876_3620_4468 251
669 3300035117 Ga0373953_0002273 Ga0373953_0002273_850_1713 251
670 3300035118 Ga0373954_0000035 Ga0373954_0000035_44845_45708 251
671 3300035119 Ga0373956_0000798 Ga0373956_0000798_3019_3882 251
672 3300035171 Ga0373946_0007829 Ga0373946_0007829_1074_1922 251
673 3300035172 Ga0373955_0010436 Ga0373955_0010436_2368_3231 251
674 3300035410 Ga0373924_0011073 Ga0373924_0011073_49_912 251
675 3300035691 Ga0373931_0023783 Ga0373931_0023783_1139_1987 251
676 3300035691 Ga0373931_0025759 Ga0373931_0025759_420_1268 251
677 3300035695 Ga0373927_0007107 Ga0373927_0007107_4695_5543 251
678 3300035695 Ga0373927_0009804 Ga0373927_0009804_775_1623 251
679 3300035695 Ga0373927_0010862 Ga0373927_0010862_4206_5051 251
680 3300035695 Ga0373927_0225088 Ga0373927_0225088_365_1201 251
681 3300035724 Ga0373933_0000037 Ga0373933_0000037_69207_70070 251
682 3300035725 Ga0373947_0003833 Ga0373947_0003833_3377_4225 251
683 3300035725 Ga0373947_0015479 Ga0373947_0015479_57_905 251
684 3300035725 Ga0373947_0228706 Ga0373947_0228706_49_894 251
685 3300036401 Ga0373937_0064445 Ga0373937_0064445_942_1805 251
686 3300036401 Ga0373937_0209747 Ga0373937_0209747_757_1599 251
687 3300036401 Ga0373937_0519163 Ga0373937_0519163_200_1048 251
688 3300037068 Ga0373925_0066477 Ga0373925_0066477_1406_2251 251
689 3300037853 Ga0436364_0713413 Ga0436364_0713413_2110_2958 251
690 3300037853 Ga0436364_1207970 Ga0436364_1207970_249_1097 251
691 3300039450 Ga0436363_0597393 Ga0436363_0597393_6701_7552 251
692 3300046454 Ga0495592_0000406 Ga0495592_0000406_16014_16877 251
693 3300046454 Ga0495592_0020678 Ga0495592_0020678_1040_1888 251
694 3300046455 Ga0495603_0000011 Ga0495603_0000011_1016_1864 251
695 3300046455 Ga0495603_0023363 Ga0495603_0023363_931_1779 251
696 3300046459 Ga0495629_0000382 Ga0495629_0000382_13870_14718 251
697 3300046459 Ga0495629_0000678 Ga0495629_0000678_16199_17062 251
698 3300046459 Ga0495629_0086335 Ga0495629_0086335_296_1144 251
699 3300046461 Ga0495641_0000910 Ga0495641_0000910_10478_11326 251
700 3300046462 Ga0495651_0021239 Ga0495651_0021239_4055_4918 251
701 3300046463 Ga0495653_0000161 Ga0495653_0000161_53805_54668 251
702 3300046472 Ga0495580_0000174 Ga0495580_0000174_9791_10639 251
703 3300046475 Ga0495639_0000017 Ga0495639_0000017_3359_4207 251
704 3300046476 Ga0495662_0000549 Ga0495662_0000549_2413_3261 251
705 3300046499 Ga0495594_0000445 Ga0495594_0000445_16621_17469 251
706 3300046507 Ga0495606_0006147 Ga0495606_0006147_2373_3221 251
707 3300046511 Ga0495608_0000403 Ga0495608_0000403_8442_9305 251
708 3300046514 Ga0495618_0126789 Ga0495618_0126789_183_1046 251
709 3300046516 Ga0495628_0003039 Ga0495628_0003039_3666_4529 251
710 3300046517 Ga0495630_0004919 Ga0495630_0004919_5187_6035 251
711 3300046526 Ga0495666_0003988 Ga0495666_0003988_3712_4560 251
712 3300046529 Ga0495652_0000604 Ga0495652_0000604_11947_12810 251
713 3300046533 Ga0495640_0004435 Ga0495640_0004435_9158_10021 251
714 3300046533 Ga0495640_0004810 Ga0495640_0004810_7627_8475 251
715 3300046536 Ga0495587_0012949 Ga0495587_0012949_1566_2429 251
716 3300046536 Ga0495587_0039594 Ga0495587_0039594_1291_2139 251
717 3300046538 Ga0495609_0121429 Ga0495609_0121429_255_1103 251
718 3300046543 Ga0495645_0005046 Ga0495645_0005046_2507_3370 251
719 3300046557 Ga0495622_0005239 Ga0495622_0005239_104_970 251
720 3300046557 Ga0495622_0006151 Ga0495622_0006151_1475_2323 251
721 3300046559 Ga0495667_0006181 Ga0495667_0006181_1694_2557 251
722 3300046559 Ga0495667_0010646 Ga0495667_0010646_352_1200 251
723 3300046616 Ga0495668_0062161 Ga0495668_0062161_696_1544 251
724 3300046642 Ga0495634_0001440 Ga0495634_0001440_3254_4102 251
725 3300046642 Ga0495634_0035824 Ga0495634_0035824_1224_2087 251
726 3300046663 Ga0495635_0000133 Ga0495635_0000133_41480_42343 251
727 3300046674 Ga0495588_0027330 Ga0495588_0027330_1232_2080 251
728 3300046674 Ga0495588_0125932 Ga0495588_0125932_338_1183 251
729 3300046675 Ga0495657_0039482 Ga0495657_0039482_1566_2429 251
730 3300046678 Ga0495599_0005543 Ga0495599_0005543_2073_2936 251
731 3300046678 Ga0495599_0097650 Ga0495599_0097650_342_1208 251
732 3300046679 Ga0495623_0043749 Ga0495623_0043749_1694_2557 251
733 3300046680 Ga0495646_0000291 Ga0495646_0000291_15247_16110 251
734 3300046681 Ga0495647_0002310 Ga0495647_0002310_4419_5267 251
735 3300046683 Ga0495658_0000371 Ga0495658_0000371_21856_22704 251
736 3300046689 Ga0495613_0013181 Ga0495613_0013181_573_1436 251
737 3300046690 Ga0495624_0000384 Ga0495624_0000384_30199_31047 251
738 3300046690 Ga0495624_0153750 Ga0495624_0153750_253_1098 251
739 3300046692 Ga0495671_0141834 Ga0495671_0141834_278_1126 251
740 3300046809 Ga0495600_0010426 Ga0495600_0010426_2369_3232 251
741 3300046809 Ga0495600_0191323 Ga0495600_0191323_296_1144 251
742 3300047315 Ga0495581_0000361 Ga0495581_0000361_14112_14960 251
743 3300047315 Ga0495581_0048972 Ga0495581_0048972_1237_2082 251
744 3300047317 Ga0495604_0185100 Ga0495604_0185100_438_1286 251
745 3300047319 Ga0495674_0001034 Ga0495674_0001034_8086_8934 251
746 3300047319 Ga0495674_0174811 Ga0495674_0174811_146_1009 251
747 3300047321 Ga0495676_0047317 Ga0495676_0047317_2261_3109 251
748 3300047322 Ga0495680_0037759 Ga0495680_0037759_1311_2174 251
749 3300047444 Ga0495675_0037589 Ga0495675_0037589_655_1518 251
750 3300047471 Ga0495684_0002274 Ga0495684_0002274_9375_10238 251
751 3300047472 Ga0495686_0050929 Ga0495686_0050929_925_1773 251
752 3300047673 Ga0495593_0000077 Ga0495593_0000077_8988_9836 251
753 3300047673 Ga0495593_0002962 Ga0495593_0002962_7166_8029 251
754 3300048088 Ga0495602_0020070 Ga0495602_0020070_1694_2557 251
755 3300048903 Ga0496100_0032337 Ga0496100_0032337_1530_2399 251
756 3300048904 Ga0496101_0022694 Ga0496101_0022694_935_1783 251
757 3300048905 Ga0496102_0003232 Ga0496102_0003232_7399_8268 251
758 3300048905 Ga0496102_0612786 Ga0496102_0612786_20_868 251
759 3300048906 Ga0496103_0015633 Ga0496103_0015633_622_1491 251
760 3300048906 Ga0496103_0027535 Ga0496103_0027535_2546_3394 251
761 3300048907 Ga0496104_0012033 Ga0496104_0012033_3918_4766 251
762 3300048908 Ga0496105_0016624 Ga0496105_0016624_972_1820 251
763 3300048908 Ga0496105_0031207 Ga0496105_0031207_210_1079 251
764 3300048909 Ga0496106_0020768 Ga0496106_0020768_3898_4767 251
765 3300048909 Ga0496106_0033696 Ga0496106_0033696_858_1706 251
766 3300048909 Ga0496106_0346089 Ga0496106_0346089_198_1082 251
767 3300048911 Ga0496108_0030082 Ga0496108_0030082_3051_3899 251
768 3300048911 Ga0496108_0032059 Ga0496108_0032059_102_971 251
769 3300048912 Ga0496109_0082013 Ga0496109_0082013_238_1086 251
770 3300048913 Ga0496110_0007681 Ga0496110_0007681_2637_3485 251
771 3300048913 Ga0496110_0057478 Ga0496110_0057478_926_1795 251
772 3300048914 Ga0496111_0073640 Ga0496111_0073640_1357_2226 251
773 3300048914 Ga0496111_0176022 Ga0496111_0176022_674_1522 251
774 3300048915 Ga0496112_0000009 Ga0496112_0000009_11446_12294 251
775 3300048915 Ga0496112_0012427 Ga0496112_0012427_2283_3131 251
776 3300048916 Ga0496113_0001356 Ga0496113_0001356_3575_4423 251
777 3300048916 Ga0496113_0055600 Ga0496113_0055600_200_1069 251
778 3300048918 Ga0496115_0000528 Ga0496115_0000528_11213_12082 251
779 3300048918 Ga0496115_0011483 Ga0496115_0011483_2971_3819 251
780 3300048918 Ga0496115_0032531 Ga0496115_0032531_826_1674 251
781 3300048918 Ga0496115_0137975 Ga0496115_0137975_157_1020 251
782 3300048924 Ga0496121_0237642 Ga0496121_0237642_190_1080 251
783 3300048925 Ga0496122_0057942 Ga0496122_0057942_545_1393 251
784 3300048929 Ga0496126_0001585 Ga0496126_0001585_22167_23015 251
785 3300048929 Ga0496126_0036403 Ga0496126_0036403_248_1096 251
786 3300048929 Ga0496126_0107203 Ga0496126_0107203_157_1005 251
787 3300049568 Ga0501031_0003646 Ga0501031_0003646_2249_3100 251
788 3300049568 Ga0501031_0007682 Ga0501031_0007682_5794_6636 251
789 3300049569 Ga0501032_0000273 Ga0501032_0000273_34383_35234 251
790 3300049569 Ga0501032_0027107 Ga0501032_0027107_2662_3504 251
791 3300049570 Ga0501033_0000914 Ga0501033_0000914_24401_25252 251
792 3300049570 Ga0501033_0005767 Ga0501033_0005767_1099_1941 251
793 3300049571 Ga0501034_0000175 Ga0501034_0000175_41500_42351 251
794 3300049572 Ga0501036_0000158 Ga0501036_0000158_36465_37316 251
795 3300049573 Ga0501037_0000126 Ga0501037_0000126_10779_11630 251
796 3300049573 Ga0501037_0000476 Ga0501037_0000476_11712_12554 251
797 3300049574 Ga0501038_0000034 Ga0501038_0000034_22681_23532 251
798 3300049575 Ga0501039_0034561 Ga0501039_0034561_1020_1871 251
799 3300049575 Ga0501039_0323752 Ga0501039_0323752_99_941 251
800 3300049576 Ga0501040_0146295 Ga0501040_0146295_247_1098 251
801 3300049577 Ga0501041_0031672 Ga0501041_0031672_1188_2030 251
802 3300049578 Ga0501042_0043526 Ga0501042_0043526_2236_3078 251
803 3300049579 Ga0501043_0007605 Ga0501043_0007605_1446_2297 251
804 3300049579 Ga0501043_0012802 Ga0501043_0012802_3919_4761 251
805 3300049580 Ga0501046_0016164 Ga0501046_0016164_191_1033 251
806 3300049581 Ga0501047_0000255 Ga0501047_0000255_11514_12365 251
807 3300049581 Ga0501047_0002820 Ga0501047_0002820_2642_3493 251
808 3300049582 Ga0501048_0007019 Ga0501048_0007019_1041_1892 251
809 3300049583 Ga0501067_0002077 Ga0501067_0002077_8169_9020 251
810 3300049584 Ga0501068_0012997 Ga0501068_0012997_811_1662 251
811 3300049585 Ga0501069_0005663 Ga0501069_0005663_4294_5145 251
812 3300049586 Ga0501070_0001459 Ga0501070_0001459_15700_16551 251
813 3300049586 Ga0501070_0004542 Ga0501070_0004542_6095_6946 251
814 3300049587 Ga0501071_0017836 Ga0501071_0017836_1842_2693 251
815 3300049588 Ga0501072_0009104 Ga0501072_0009104_6317_7168 251
816 3300049589 Ga0501073_0000035 Ga0501073_0000035_40292_41143 251
817 3300049590 Ga0501074_0000543 Ga0501074_0000543_8301_9152 251
818 3300049741 Ga0501079_0032645 Ga0501079_0032645_705_1556 251
819 3300049741 Ga0501079_0141135 Ga0501079_0141135_25_867 251
820 3300049742 Ga0501080_0000911 Ga0501080_0000911_19092_19943 251
821 3300049742 Ga0501080_0006146 Ga0501080_0006146_5252_6103 251
822 3300049742 Ga0501080_0220630 Ga0501080_0220630_359_1201 251
823 3300049743 Ga0501081_0095211 Ga0501081_0095211_294_1136 251
824 3300049744 Ga0501083_0005638 Ga0501083_0005638_4955_5806 251
825 3300049822 Ga0501035_0000319 Ga0501035_0000319_21095_21946 251
826 3300049822 Ga0501035_0001024 Ga0501035_0001024_23983_24825 251
827 3300049822 Ga0501035_0023494 Ga0501035_0023494_4387_5229 251
828 3300049823 Ga0501044_0000061 Ga0501044_0000061_1286_2137 251
829 3300049824 Ga0501045_0046427 Ga0501045_0046427_120_971 251
830 3300053077 Ga0495601_0092187 Ga0495601_0092187_256_1119 251
831 3300053080 Ga0500635_0004071 Ga0500635_0004071_765_1613 251
832 3300053083 Ga0495655_0006946 Ga0495655_0006946_672_1541 251
833 3300053084 Ga0495595_0000225 Ga0495595_0000225_15667_16530 251
834 3300053084 Ga0495595_0031315 Ga0495595_0031315_465_1313 251
835 3300053085 Ga0495619_0003532 Ga0495619_0003532_6982_7845 251
836 3300053085 Ga0495619_0189124 Ga0495619_0189124_29_877 251
837 3300053102 Ga0500554_003396 Ga0500554_003396_1548_2396 251
838 3300053119 Ga0500595_006319 Ga0500595_006319_761_1609 251
839 3300053119 Ga0500595_012858 Ga0500595_012858_1769_2635 251
840 3300053139 Ga0500568_0001771 Ga0500568_0001771_2304_3152 251
841 3300053140 Ga0500573_0019429 Ga0500573_0019429_2455_3321 251
842 3300053150 Ga0500603_000419 Ga0500603_000419_1295_2143 251
843 3300053150 Ga0500603_007947 Ga0500603_007947_628_1494 251
844 3300053162 Ga0500638_025774 Ga0500638_025774_1568_2434 251
845 3300053177 Ga0500636_0231457 Ga0500636_0231457_59_925 251
846 3300053178 Ga0500637_0000344 Ga0500637_0000344_13276_14124 251
847 3300053735 Ga0500596_002064 Ga0500596_002064_2355_3221 251
848 3300054114 Ga0501084_0017189 Ga0501084_0017189_2710_3561 251
849 3300060353 Ga0501082_0003295 Ga0501082_0003295_8278_9129 251
850 3300060353 Ga0501082_0547762 Ga0501082_0547762_24_866 251
851 iso_pu_bacteria 2904690495 2904696288 251
852 iso_pu_bacteria 2908756301 2908760925 251
853 3300005983 Ga0081540_1004830 Ga0081540_10048305 252
854 3300039453 Ga0436362_0053894 Ga0436362_0053894_702_1550 252
855 3300048909 Ga0496106_0002592 Ga0496106_0002592_8077_8946 252
856 3300048919 Ga0496116_0081559 Ga0496116_0081559_479_1348 252
857 3300048920 Ga0496117_0009682 Ga0496117_0009682_2231_3100 252
858 3300048921 Ga0496118_0006468 Ga0496118_0006468_5743_6612 252
859 3300048924 Ga0496121_0002243 Ga0496121_0002243_3919_4788 252
860 3300048927 Ga0496124_0009457 Ga0496124_0009457_3568_4437 252
861 3300048928 Ga0496125_0048127 Ga0496125_0048127_641_1510 252
862 3300003775 Ga0055524_1016278 Ga0055524_10162784 253
863 3300003775 Ga0055524_1019303 Ga0055524_10193032 253
864 3300003775 Ga0055524_1029987 Ga0055524_10299872 253
865 3300025273 Ga0209673_1024757 Ga0209673_10247572 253
866 3300025294 Ga0209025_1027154 Ga0209025_10271543 253
867 3300025295 Ga0209564_1009468 Ga0209564_10094683 253
868 3300025295 Ga0209564_1021588 Ga0209564_10215882 253
869 3300025299 Ga0209256_1007922 Ga0209256_10079223 253
870 3300025299 Ga0209256_1016885 Ga0209256_10168852 253
871 3300048920 Ga0496117_0008274 Ga0496117_0008274_2060_2893 253
872 3300048923 Ga0496120_0013523 Ga0496120_0013523_4459_5292 253
873 3300048924 Ga0496121_0000001 Ga0496121_0000001_1315792_1316625 253
874 3300048925 Ga0496122_0231376 Ga0496122_0231376_33_866 253
875 3300048926 Ga0496123_0037776 Ga0496123_0037776_234_1067 253
876 3300048928 Ga0496125_0000001 Ga0496125_0000001_1474770_1475603 253
877 3300050491 nmdc:mga00v17_38647_c1 nmdc:mga00v17_38647_c1_1678_2511 253
878 3300048929 Ga0496126_0012277 Ga0496126_0012277_5390_6262 254
879 3300003354 JGI25160J50197_1008754 JGI25160J50197_10087543 256
880 3300003790 Ga0055528_1006461 Ga0055528_10064613 256
881 3300009092 Ga0105250_10048216 Ga0105250_100482162 256
882 3300009177 Ga0105248_10071650 Ga0105248_100716505 256
883 3300009553 Ga0105249_10237164 Ga0105249_102371642 256
884 3300025273 Ga0209673_1018254 Ga0209673_10182542 256
885 3300025284 Ga0209130_1009475 Ga0209130_10094752 256
886 3300025302 Ga0207426_1000854 Ga0207426_100085419 256
887 3300025941 Ga0207711_10389757 Ga0207711_103897572 256
888 3300025961 Ga0207712_10345666 Ga0207712_103456662 256
889 3300048924 Ga0496121_0298541 Ga0496121_0298541_238_1071 256
890 3300046501 Ga0495607_0029223 Ga0495607_0029223_651_1487 259
891 3300006186 Ga0075369_10000673 Ga0075369_100006737 260
892 3300025294 Ga0209025_1011109 Ga0209025_10111093 260
893 3300025297 Ga0209758_1012306 Ga0209758_10123063 260
894 3300050516 nmdc:mga0sz30_172352_c1 nmdc:mga0sz30_172352_c1_99_932 260
895 iso_pu_bacteria 2718217997 2719665237 260
896 iso_pu_bacteria 2718218199 2720491657 260
897 iso_pu_bacteria 2718218232 2720612911 260
898 iso_pu_bacteria 2718218233 2720619770 260
899 iso_pu_bacteria 2718218235 2720631201 260
900 iso_pu_bacteria 2718218269 2720774928 260
901 iso_pu_bacteria 2721755556 2723026565 260
902 iso_pu_bacteria 2721755684 2723560169 260
903 iso_pu_bacteria 2721755685 2723566748 260
904 iso_pu_bacteria 2721755819 2724089535 260
905 iso_pu_bacteria 2721755822 2724104013 260
906 iso_pu_bacteria 2721755823 2724109829 260
907 iso_pu_bacteria 2728369352 2730107501 260
908 iso_pu_bacteria 2791355256 2793297161 260
909 iso_pu_bacteria 2802429605 2805927592 260
910 iso_pu_bacteria 2802429606 2805936067 260
911 iso_pu_bacteria 2838016132 2838018765 260
912 iso_pu_bacteria 2838048938 2838052163 260
913 iso_pu_bacteria 2838061910 2838067921 260
914 iso_pu_bacteria 2838068647 2838071332 260
915 iso_pu_bacteria 2838668709 2838670034 260
916 iso_pu_bacteria 2838701080 2838702406 260
917 iso_pu_bacteria 2841864319 2841864952 260
918 iso_pu_bacteria 2842146304 2842147049 260
919 iso_pu_bacteria 2842192696 2842197046 260
920 iso_pu_bacteria 2842250916 2842252114 260
921 iso_pu_bacteria 2842264693 2842267562 260
922 iso_pu_bacteria 2842285085 2842287535 260
923 iso_pu_bacteria 2842311132 2842315389 260
924 iso_pu_bacteria 2842317721 2842318295 260
925 iso_pu_bacteria 2842341865 2842346944 260
926 iso_pu_bacteria 2842402390 2842404936 260
927 iso_pu_bacteria 2842409023 2842411518 260
928 iso_pu_bacteria 2842415677 2842418031 260
929 iso_pu_bacteria 2842422224 2842425011 260
930 iso_pu_bacteria 2842428310 2842431860 260
931 iso_pu_bacteria 2842434925 2842437973 260
932 iso_pu_bacteria 2842441272 2842444787 260
933 iso_pu_bacteria 2842447887 2842451704 260
934 iso_pu_bacteria 2842462802 2842465836 260
935 iso_pu_bacteria 2842469257 2842472590 260
936 iso_pu_bacteria 2842489311 2842492724 260
937 iso_pu_bacteria 2842495871 2842496566 260
938 iso_pu_bacteria 2933599457 2933602131 260
939 iso_pu_bacteria 8005282627 8005288248 260
940 iso_pu_bacteria 8005289223 8005294771 260
941 iso_pu_bacteria 8005430974 8005436136 260
942 iso_pu_bacteria 8005497431 8005499870 260
943 iso_pu_bacteria 8005619151 8005621238 260
944 iso_pu_bacteria 8005626139 8005631462 260
945 iso_pu_bacteria 8005668836 8005671288 260
946 iso_pu_bacteria 8024501048 8024505188 260
947 iso_pu_bacteria 2513237144 2513909764 261
948 iso_pu_bacteria 2513237146 2513926534 261
949 iso_pu_bacteria 2599185170 2599418035 261
950 iso_pu_bacteria 2838035591 2838040973 261
951 iso_pu_bacteria 2838661181 2838666182 261
952 iso_pu_bacteria 2933016740 2933017553 261
953 iso_pu_bacteria 3005409236 3005409675 261
954 iso_pu_bacteria 2775507049 2776913266 263
955 iso_pu_bacteria 2899803654 2899807550 263
956 iso_pu_bacteria 2929138655 2929139930 263
957 3300041413 Ga0439465_0002663 Ga0439465_0002663_2848_3684 265
958 3300042007 Ga0439449_0039829 Ga0439449_0039829_422_1258 265
959 3300002704 JGI25155J39150_1000011 JGI25155J39150_100001195 267
960 3300002705 JGI25156J39149_1000027 JGI25156J39149_100002795 267
961 3300002705 JGI25156J39149_1000030 JGI25156J39149_10000309 267
962 3300002737 JGI25162J39368_1002279 JGI25162J39368_10022796 267
963 3300002738 JGI25154J39366_1000057 JGI25154J39366_100005722 267
964 3300002741 JGI25157J39369_1000010 JGI25157J39369_1000010116 267
965 3300003214 JGI25165J46597_1001792 JGI25165J46597_10017926 267
966 3300025206 Ga0209435_100022 Ga0209435_100022115 267
967 3300025233 Ga0209437_100310 Ga0209437_10031068 267
968 3300025246 Ga0209646_1000078 Ga0209646_1000078115 267
969 3300025250 Ga0209026_1000065 Ga0209026_1000065115 267
970 3300025256 Ga0209759_1000055 Ga0209759_1000055115 267
971 3300025261 Ga0209233_1000594 Ga0209233_10005946 267
972 3300053133 Ga0500655_003338 Ga0500655_003338_825_1661 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

30

278

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7694 12 249
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7317 16 248
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7077 12 249
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.6713 121 245
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.6589 16 248
ID Description Score Start End Superfamily
af_A0A1D6LI10_12_134_1.20.120.610 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase 0.3505 20 121 1.20.120.610
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3334 72 267 1.10.357.20
af_Q9VHP1_6_149_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.332 114 257 1.10.1760.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.329 72 267 1.10.357.20
af_Q9VHP1_6_149_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3155 114 257 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A5C7SA61-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9809 131 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A5C7SA61-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.967 131 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A7W5NDI3-F1-model_v4 deleted 0.9653 1 267
AF-A0A257Y219-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9632 108 265 GO:0004605
GO:0005886
GO:0016024
AF-A0A8A3K5P8-F1-model_v4 deleted 0.9618 1 267

Feature Viewer

pLDDT pTM Quality
87.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map