F487167

General Info

Members Datasets Scaffolds Average Seq Length
972 439 1944 352

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0009673|Ga0500616_0009673_177_1319
Length 380
Sequence LLTIRFLPVGSGPESAEDVLGWEARFLSFLQLARLTKRYGDATVVDHIDLDIPKGNLVCLLGPSGCGKTTTLRLIAGFVEPNEGEIRVGGRVISSAGHSEPPERRRMSMIFQSYALWPHMTVRENIAYGLTLRKMGRAEIGQLVDRILGVTRLEPYADRYPAELSGGQQQRVSLARALVVEPETLLLDEPLSNLDANLREEMRFEIRRLHDRYRYTTVYVTHDQAEAMTTADQIVVMNQGIIEQAGSPEDIYERPQSEFVARFIGGTNIFKGKRLGADTLDCGPMTLRCGNGQLPAGDSGSVSVRHHHIRLAQESGSEGTVNAAPGTVVRQVYLGSHRDYLVELQNGETVRTVAPAKVAIEKGQPVWLHFPVEHCRALAR

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
409 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
410 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
415 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
418 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
419 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
420 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
424 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
425 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
426 2773857925 Microvirga vignae BR3299 Isolate Unclassified
427 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
428 2791355199
429 2855730933 Achromobacter sp. HZ28 Isolate Nodule
430 2855767633 Achromobacter sp. HZ34 Isolate Nodule
431 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
432 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
433 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
434 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
435 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
436 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
437 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
438 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
439 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0.1
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0.93
Rhizoplane 5.97
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0009673 3300053153 Bacteria 5837
2 JGI24744J21845_10000923 3300002077 Bacteria 5568
3 JGI24033J26618_1003474 3300002155 Bacteria 1664
4 JGI25406J46586_10000028 3300003203 Bacteria 70247
5 JGI25160J50197_1000095 3300003354 Bacteria 88326
6 JGI25161J50226_1000071 3300003374 Bacteria 88326
7 JGI25404J52841_10004986 3300003659 Bacteria 2726
8 Ga0055543_1000206 3300004625 Bacteria 47744
9 Ga0065165_1000408 3300005262 Bacteria 68789
10 Ga0070658_10010675 3300005327 Bacteria 7358
11 Ga0070676_10129731 3300005328 Bacteria 1593
12 Ga0070683_100027066 3300005329 Bacteria 5169
13 Ga0070690_100010109 3300005330 Bacteria 5481
14 Ga0070670_100036282 3300005331 Bacteria 4242
15 Ga0070670_100046453 3300005331 Bacteria 3734
16 Ga0068869_100042587 3300005334 Bacteria 3256
17 Ga0070666_10033182 3300005335 Bacteria 3415
18 Ga0070680_100003476 3300005336 Bacteria 11759
19 Ga0070680_100007187 3300005336 Bacteria 8485
20 Ga0070680_100013175 3300005336 Bacteria 6437
21 Ga0070680_100046954 3300005336 Bacteria 3515
22 Ga0068868_100028246 3300005338 Bacteria 4287
23 Ga0070660_100025143 3300005339 Bacteria 4424
24 Ga0070689_100081818 3300005340 Bacteria 2535
25 Ga0070691_10001323 3300005341 Bacteria 10537
26 Ga0070661_100034257 3300005344 Bacteria 3683
27 Ga0070661_100149989 3300005344 Bacteria 1762
28 Ga0070692_10061899 3300005345 Bacteria 1974
29 Ga0070668_100094992 3300005347 Bacteria 2354
30 Ga0070669_100004982 3300005353 Bacteria 9597
31 Ga0070669_100017838 3300005353 Bacteria 5067
32 Ga0070669_100128050 3300005353 Bacteria 1945
33 Ga0070673_100014774 3300005364 Bacteria 5457
34 Ga0070688_100019330 3300005365 Bacteria 3944
35 Ga0070688_100198625 3300005365 Bacteria 1402
36 Ga0070659_100109588 3300005366 Bacteria 2228
37 Ga0070659_100205342 3300005366 Bacteria 1623
38 Ga0070667_100023872 3300005367 Bacteria 5078
39 Ga0070703_10001774 3300005406 Bacteria 6394
40 Ga0070709_10009430 3300005434 Bacteria 5386
41 Ga0070709_10044828 3300005434 Bacteria 2741
42 Ga0070709_10146986 3300005434 Bacteria 1625
43 Ga0070714_100003399 3300005435 Bacteria 11860
44 Ga0070714_100199988 3300005435 Bacteria 1827
45 Ga0070713_100003592 3300005436 Bacteria 10250
46 Ga0070713_100327192 3300005436 Bacteria 1417
47 Ga0070710_10001178 3300005437 Bacteria 12346
48 Ga0070710_10048329 3300005437 Bacteria 2376
49 Ga0070710_10066017 3300005437 Bacteria 2074
50 Ga0070701_10018203 3300005438 Bacteria 3298
51 Ga0070701_10038414 3300005438 Bacteria 2423
52 Ga0070711_100016060 3300005439 Bacteria 4747
53 Ga0070711_100035255 3300005439 Bacteria 3344
54 Ga0070711_100203604 3300005439 Bacteria 1529
55 Ga0070705_100002136 3300005440 Bacteria 10059
56 Ga0070700_100038308 3300005441 Bacteria 2921
57 Ga0070700_100063440 3300005441 Bacteria 2337
58 Ga0070700_100089522 3300005441 Bacteria 2005
59 Ga0070708_100005485 3300005445 Bacteria 10057
60 Ga0070663_100008923 3300005455 Bacteria 6193
61 Ga0070663_100112035 3300005455 Bacteria 2051
62 Ga0070663_100136782 3300005455 Bacteria 1866
63 Ga0070678_100019792 3300005456 Bacteria 4399
64 Ga0070678_100100375 3300005456 Bacteria 2242
65 Ga0070662_100023188 3300005457 Bacteria 4261
66 Ga0070681_10003470 3300005458 Bacteria 14772
67 Ga0070681_10004105 3300005458 Bacteria 13761
68 Ga0070681_10015832 3300005458 Bacteria 7517
69 Ga0070681_10087004 3300005458 Bacteria 3078
70 Ga0070681_10159856 3300005458 Bacteria 2176
71 Ga0070681_10253655 3300005458 Bacteria 1671
72 Ga0068867_100061438 3300005459 Bacteria 2789
73 Ga0068867_100214551 3300005459 Bacteria 1548
74 Ga0070685_10013498 3300005466 Bacteria 4309
75 Ga0070706_100000058 3300005467 Bacteria 133347
76 Ga0070706_100146353 3300005467 Bacteria 2206
77 Ga0070706_100188269 3300005467 Bacteria 1929
78 Ga0070698_100000825 3300005471 Bacteria 33892
79 Ga0070699_100005255 3300005518 Bacteria 11370
80 Ga0070699_100152170 3300005518 Bacteria 2047
81 Ga0070679_100036294 3300005530 Bacteria 4892
82 Ga0070679_100105809 3300005530 Bacteria 2799
83 Ga0070679_100123488 3300005530 Bacteria 2572
84 Ga0070679_100160671 3300005530 Bacteria 2221
85 Ga0070679_100294384 3300005530 Bacteria 1574
86 Ga0070684_100047842 3300005535 Bacteria 3708
87 Ga0070684_100170035 3300005535 Bacteria 1979
88 Ga0070697_100002460 3300005536 Bacteria 14255
89 Ga0070697_100002564 3300005536 Bacteria 13978
90 Ga0070697_100006247 3300005536 Bacteria 9223
91 Ga0070697_100007169 3300005536 Bacteria 8673
92 Ga0070697_100007965 3300005536 Bacteria 8260
93 Ga0070697_100016894 3300005536 Bacteria 5737
94 Ga0068853_100015257 3300005539 Bacteria 6315
95 Ga0068853_100026126 3300005539 Bacteria 4902
96 Ga0068853_100069092 3300005539 Bacteria 3072
97 Ga0070672_100064032 3300005543 Bacteria 2904
98 Ga0070672_100165275 3300005543 Bacteria 1838
99 Ga0070695_100005766 3300005545 Bacteria 7295
100 Ga0070696_100000887 3300005546 Bacteria 19396
101 Ga0070696_100004630 3300005546 Bacteria 9185
102 Ga0070696_100063608 3300005546 Bacteria 2584
103 Ga0070693_100045863 3300005547 Bacteria 2480
104 Ga0070693_100099541 3300005547 Bacteria 1768
105 Ga0070665_100130569 3300005548 Bacteria 2514
106 Ga0070665_100192702 3300005548 Bacteria 2039
107 Ga0070704_100014059 3300005549 Bacteria 4989
108 Ga0070704_100183329 3300005549 Bacteria 1676
109 Ga0068855_100008088 3300005563 Bacteria 12708
110 Ga0068855_100125606 3300005563 Bacteria 2934
111 Ga0068855_100174599 3300005563 Bacteria 2432
112 Ga0068855_100194279 3300005563 Bacteria 2287
113 Ga0070664_100071163 3300005564 Bacteria 2980
114 Ga0068857_100003412 3300005577 Bacteria 13243
115 Ga0068857_100138473 3300005577 Bacteria 2199
116 Ga0068856_100049808 3300005614 Bacteria 4129
117 Ga0068856_100094060 3300005614 Bacteria 2984
118 Ga0068852_100010751 3300005616 Bacteria 6855
119 Ga0068852_100011681 3300005616 Bacteria 6623
120 Ga0068852_100025909 3300005616 Bacteria 4759
121 Ga0068852_100071010 3300005616 Bacteria 3056
122 Ga0068852_100096988 3300005616 Bacteria 2651
123 Ga0068859_100013735 3300005617 Bacteria 8119
124 Ga0068859_100019924 3300005617 Bacteria 6734
125 Ga0068859_100090535 3300005617 Bacteria 3110
126 Ga0068864_100033297 3300005618 Bacteria 4381
127 Ga0068864_100360597 3300005618 Bacteria 1373
128 Ga0068861_100040369 3300005719 Bacteria 3490
129 Ga0068861_100065319 3300005719 Bacteria 2802
130 Ga0068851_10021478 3300005834 Bacteria 3135
131 Ga0068870_10003649 3300005840 Bacteria 6536
132 Ga0068863_100017877 3300005841 Bacteria 6785
133 Ga0068858_100064336 3300005842 Bacteria 3394
134 Ga0068860_100000577 3300005843 Bacteria 44036
135 Ga0068860_100018913 3300005843 Bacteria 6694
136 Ga0068860_100092343 3300005843 Bacteria 2884
137 Ga0068862_100148148 3300005844 Bacteria 2087
138 Ga0068862_100326621 3300005844 Bacteria 1417
139 Ga0081455_10000226 3300005937 Bacteria 72690
140 Ga0081455_10011459 3300005937 Bacteria 8907
141 Ga0081455_10012534 3300005937 Bacteria 8458
142 Ga0081455_10025643 3300005937 Bacteria 5437
143 Ga0081455_10035259 3300005937 Bacteria 4474
144 Ga0081538_10001703 3300005981 Bacteria 22414
145 Ga0081540_1003162 3300005983 Bacteria 13139
146 Ga0081540_1003755 3300005983 Bacteria 11903
147 Ga0081540_1009897 3300005983 Bacteria 6508
148 Ga0081540_1011694 3300005983 Bacteria 5844
149 Ga0081540_1017229 3300005983 Bacteria 4479
150 Ga0081540_1026005 3300005983 Bacteria 3352
151 Ga0081540_1037654 3300005983 Bacteria 2560
152 Ga0081540_1042934 3300005983 Bacteria 2326
153 Ga0081540_1059105 3300005983 Bacteria 1842
154 Ga0081539_10000048 3300005985 Bacteria 272906
155 Ga0081539_10000576 3300005985 Bacteria 75490
156 Ga0081539_10036771 3300005985 Bacteria 2925
157 Ga0081539_10071654 3300005985 Bacteria 1855
158 Ga0070717_10000634 3300006028 Bacteria 22593
159 Ga0070717_10051186 3300006028 Bacteria 3398
160 Ga0070717_10059267 3300006028 Bacteria 3167
161 Ga0070717_10146806 3300006028 Bacteria 2038
162 Ga0075365_10088316 3300006038 Bacteria 2109
163 Ga0075365_10102464 3300006038 Bacteria 1961
164 Ga0075368_10001658 3300006042 Bacteria 7147
165 Ga0075368_10088642 3300006042 Bacteria 1264
166 Ga0075363_100035403 3300006048 Bacteria 2612
167 Ga0075363_100052241 3300006048 Bacteria 2181
168 Ga0075364_10061523 3300006051 Bacteria 2463
169 Ga0075364_10071135 3300006051 Bacteria 2291
170 Ga0075364_10132838 3300006051 Bacteria 1671
171 Ga0075364_10145892 3300006051 Bacteria 1593
172 Ga0075432_10051536 3300006058 Bacteria 1453
173 Ga0070715_10029300 3300006163 Bacteria 2216
174 Ga0070715_10055329 3300006163 Bacteria 1722
175 Ga0070716_100004081 3300006173 Bacteria 6925
176 Ga0070716_100060169 3300006173 Bacteria 2193
177 Ga0070712_100015951 3300006175 Bacteria 4845
178 Ga0070712_100022594 3300006175 Bacteria 4145
179 Ga0070712_100346614 3300006175 Bacteria 1214
180 Ga0075367_10001614 3300006178 Bacteria 9787
181 Ga0075369_10028353 3300006186 Bacteria 2346
182 Ga0075369_10045625 3300006186 Bacteria 1885
183 Ga0075366_10002111 3300006195 Bacteria 10115
184 Ga0075366_10143949 3300006195 Bacteria 1442
185 Ga0097621_100020528 3300006237 Bacteria 5090
186 Ga0097621_100034122 3300006237 Bacteria 4057
187 Ga0075370_10033632 3300006353 Bacteria 2871
188 Ga0068871_100074458 3300006358 Bacteria 2801
189 Ga0075428_100005533 3300006844 Bacteria 14053
190 Ga0075428_100011315 3300006844 Bacteria 9928
191 Ga0075428_100206695 3300006844 Bacteria 2122
192 Ga0075428_100210506 3300006844 Bacteria 2101
193 Ga0075428_100383918 3300006844 Bacteria 1506
194 Ga0075430_100000222 3300006846 Bacteria 39248
195 Ga0075430_100012924 3300006846 Bacteria 7115
196 Ga0075430_100031383 3300006846 Bacteria 4508
197 Ga0075430_100139010 3300006846 Bacteria 2023
198 Ga0075430_100248002 3300006846 Bacteria 1475
199 Ga0075431_100001099 3300006847 Bacteria 24234
200 Ga0075431_100015511 3300006847 Bacteria 7721
201 Ga0075433_10031299 3300006852 Bacteria 4548
202 Ga0075434_100240347 3300006871 Bacteria 1831
203 Ga0075429_100024988 3300006880 Bacteria 5187
204 Ga0068865_100018423 3300006881 Bacteria 4504
205 Ga0075436_100004698 3300006914 Bacteria 9369
206 Ga0097620_100013735 3300006931 Bacteria 8119
207 Ga0097620_100019924 3300006931 Bacteria 6734
208 Ga0097620_100090527 3300006931 Bacteria 3110
209 Ga0075435_100116205 3300007076 Bacteria 2228
210 Ga0105244_10028351 3300009036 Bacteria 3005
211 Ga0105250_10037420 3300009092 Bacteria 1947
212 Ga0105240_10008969 3300009093 Bacteria 14218
213 Ga0105240_10030708 3300009093 Bacteria 6979
214 Ga0105240_10070434 3300009093 Bacteria 4326
215 Ga0105240_10121613 3300009093 Bacteria 3143
216 Ga0111539_10002503 3300009094 Bacteria 24346
217 Ga0111539_10032995 3300009094 Bacteria 6286
218 Ga0111539_10064813 3300009094 Bacteria 4321
219 Ga0111539_10143122 3300009094 Bacteria 2799
220 Ga0105247_10007788 3300009101 Bacteria 6552
221 Ga0105247_10224458 3300009101 Bacteria 1273
222 Ga0114129_10003943 3300009147 Bacteria 20965
223 Ga0114129_10014705 3300009147 Bacteria 11149
224 Ga0114129_10017278 3300009147 Bacteria 10275
225 Ga0114129_10023078 3300009147 Bacteria 8826
226 Ga0114129_10097181 3300009147 Bacteria 4077
227 Ga0105243_10008030 3300009148 Bacteria 8102
228 Ga0105243_10102502 3300009148 Bacteria 2378
229 Ga0105241_10108329 3300009174 Bacteria 2221
230 Ga0105242_10021859 3300009176 Bacteria 5027
231 Ga0105248_10033223 3300009177 Bacteria 5762
232 Ga0105248_10037197 3300009177 Bacteria 5445
233 Ga0105248_10136859 3300009177 Bacteria 2763
234 Ga0105237_10137192 3300009545 Bacteria 2440
235 Ga0105237_10183269 3300009545 Bacteria 2094
236 Ga0105238_10034676 3300009551 Bacteria 5134
237 Ga0105238_10087987 3300009551 Bacteria 3093
238 Ga0105238_10105822 3300009551 Bacteria 2795
239 Ga0105249_10033545 3300009553 Bacteria 4648
240 Ga0105249_10378644 3300009553 Bacteria 1441
241 Ga0099796_10049914 3300010159 Bacteria 1448
242 Ga0105239_10017528 3300010375 Bacteria 7921
243 Ga0105239_10047388 3300010375 Bacteria 4710
244 Ga0105239_10112338 3300010375 Bacteria 3021
245 Ga0105239_10136977 3300010375 Bacteria 2726
246 Ga0157370_10085558 3300013104 Bacteria 2962
247 Ga0157370_10233664 3300013104 Bacteria 1701
248 Ga0157369_10211574 3300013105 Bacteria 2032
249 Ga0157374_10010302 3300013296 Bacteria 8039
250 Ga0157374_10054750 3300013296 Bacteria 3722
251 Ga0157374_10198980 3300013296 Bacteria 1962
252 Ga0163162_10076230 3300013306 Bacteria 3415
253 Ga0163162_10105667 3300013306 Bacteria 2910
254 Ga0157372_10319259 3300013307 Bacteria 1808
255 Ga0157375_10217358 3300013308 Bacteria 2069
256 Ga0157375_10228532 3300013308 Bacteria 2019
257 Ga0163163_10016636 3300014325 Bacteria 6838
258 Ga0163163_10045809 3300014325 Bacteria 4295
259 Ga0157380_10072897 3300014326 Bacteria 2783
260 Ga0157380_10242407 3300014326 Bacteria 1626
261 Ga0157379_10019972 3300014968 Bacteria 5920
262 Ga0157376_10176005 3300014969 Bacteria 1952
263 Ga0157376_10179408 3300014969 Bacteria 1934
264 Ga0163161_10008859 3300017792 Bacteria 6957
265 Ga0163161_10065481 3300017792 Bacteria 2652
266 Ga0206353_10589863 3300020082 Bacteria 1927
267 Ga0213873_10011822 3300021358 Bacteria 1879
268 Ga0213876_10002856 3300021384 Bacteria 10039
269 Ga0213875_10000556 3300021388 Bacteria 30532
270 Ga0213875_10001253 3300021388 Bacteria 17124
271 Ga0213875_10026948 3300021388 Bacteria 2734
272 Ga0209130_1000180 3300025284 Bacteria 89520
273 Ga0209130_1000318 3300025284 Bacteria 56545
274 Ga0209758_1008580 3300025297 Bacteria 6576
275 Ga0209758_1045312 3300025297 Bacteria 1598
276 Ga0207426_1000017 3300025302 Bacteria 577913
277 Ga0207426_1000512 3300025302 Bacteria 56516
278 Ga0207426_1011406 3300025302 Bacteria 3387
279 Ga0207697_10016118 3300025315 Bacteria 3082
280 Ga0207697_10074176 3300025315 Bacteria 1429
281 Ga0207656_10014562 3300025321 Bacteria 3033
282 Ga0207653_10000916 3300025885 Bacteria 9775
283 Ga0207692_10001575 3300025898 Bacteria 8582
284 Ga0207692_10003295 3300025898 Bacteria 6293
285 Ga0207692_10003780 3300025898 Bacteria 5946
286 Ga0207642_10034708 3300025899 Bacteria 2148
287 Ga0207710_10031969 3300025900 Bacteria 2304
288 Ga0207710_10042622 3300025900 Bacteria 2016
289 Ga0207688_10000135 3300025901 Bacteria 31221
290 Ga0207688_10156493 3300025901 Bacteria 1349
291 Ga0207685_10000528 3300025905 Bacteria 6575
292 Ga0207685_10003382 3300025905 Bacteria 3871
293 Ga0207685_10059682 3300025905 Bacteria 1505
294 Ga0207699_10000525 3300025906 Bacteria 18974
295 Ga0207699_10006599 3300025906 Bacteria 5632
296 Ga0207699_10010546 3300025906 Bacteria 4642
297 Ga0207699_10057527 3300025906 Bacteria 2322
298 Ga0207699_10197176 3300025906 Bacteria 1362
299 Ga0207645_10032939 3300025907 Bacteria 3331
300 Ga0207643_10002474 3300025908 Bacteria 9978
301 Ga0207705_10067552 3300025909 Bacteria 2587
302 Ga0207705_10087950 3300025909 Bacteria 2272
303 Ga0207684_10000066 3300025910 Bacteria 193406
304 Ga0207684_10083785 3300025910 Bacteria 2715
305 Ga0207684_10107273 3300025910 Bacteria 2389
306 Ga0207707_10001534 3300025912 Bacteria 21320
307 Ga0207707_10003664 3300025912 Bacteria 13630
308 Ga0207707_10056618 3300025912 Bacteria 3411
309 Ga0207707_10097420 3300025912 Bacteria 2570
310 Ga0207695_10089205 3300025913 Bacteria 3101
311 Ga0207695_10128805 3300025913 Bacteria 2490
312 Ga0207671_10034908 3300025914 Bacteria 3735
313 Ga0207671_10136713 3300025914 Bacteria 1885
314 Ga0207671_10244280 3300025914 Bacteria 1411
315 Ga0207693_10003105 3300025915 Bacteria 14304
316 Ga0207693_10003253 3300025915 Bacteria 13934
317 Ga0207693_10006237 3300025915 Bacteria 9890
318 Ga0207693_10033042 3300025915 Bacteria 4083
319 Ga0207693_10118323 3300025915 Bacteria 2080
320 Ga0207663_10003674 3300025916 Bacteria 7543
321 Ga0207663_10045172 3300025916 Bacteria 2708
322 Ga0207663_10113493 3300025916 Bacteria 1843
323 Ga0207663_10160136 3300025916 Bacteria 1588
324 Ga0207660_10002434 3300025917 Bacteria 12226
325 Ga0207660_10003557 3300025917 Bacteria 10145
326 Ga0207660_10007716 3300025917 Bacteria 6964
327 Ga0207660_10103669 3300025917 Bacteria 2128
328 Ga0207660_10233652 3300025917 Bacteria 1446
329 Ga0207660_10251393 3300025917 Bacteria 1395
330 Ga0207657_10003813 3300025919 Bacteria 16023
331 Ga0207657_10020183 3300025919 Bacteria 6304
332 Ga0207657_10021304 3300025919 Bacteria 6104
333 Ga0207652_10012569 3300025921 Bacteria 6842
334 Ga0207652_10024211 3300025921 Bacteria 5035
335 Ga0207652_10048955 3300025921 Bacteria 3615
336 Ga0207652_10060640 3300025921 Bacteria 3264
337 Ga0207652_10137828 3300025921 Bacteria 2180
338 Ga0207652_10163710 3300025921 Bacteria 1994
339 Ga0207652_10240457 3300025921 Bacteria 1632
340 Ga0207681_10092806 3300025923 Bacteria 2159
341 Ga0207694_10032265 3300025924 Bacteria 4007
342 Ga0207694_10032282 3300025924 Bacteria 4006
343 Ga0207694_10147766 3300025924 Bacteria 1893
344 Ga0207694_10198132 3300025924 Bacteria 1633
345 Ga0207650_10040008 3300025925 Bacteria 3428
346 Ga0207659_10006550 3300025926 Bacteria 7147
347 Ga0207687_10076635 3300025927 Bacteria 2403
348 Ga0207700_10025747 3300025928 Bacteria 4091
349 Ga0207664_10010948 3300025929 Bacteria 6424
350 Ga0207664_10215543 3300025929 Bacteria 1663
351 Ga0207690_10234488 3300025932 Bacteria 1411
352 Ga0207706_10014097 3300025933 Bacteria 7248
353 Ga0207706_10081723 3300025933 Bacteria 2839
354 Ga0207706_10110428 3300025933 Bacteria 2419
355 Ga0207709_10004810 3300025935 Bacteria 7740
356 Ga0207670_10120195 3300025936 Bacteria 1908
357 Ga0207704_10015710 3300025938 Bacteria 3867
358 Ga0207665_10001379 3300025939 Bacteria 16369
359 Ga0207665_10006797 3300025939 Bacteria 7580
360 Ga0207665_10080816 3300025939 Bacteria 2236
361 Ga0207691_10007793 3300025940 Bacteria 10312
362 Ga0207691_10086637 3300025940 Bacteria 2810
363 Ga0207711_10289548 3300025941 Bacteria 1509
364 Ga0207689_10043759 3300025942 Bacteria 3701
365 Ga0207661_10098304 3300025944 Bacteria 2452
366 Ga0207661_10274129 3300025944 Bacteria 1506
367 Ga0207679_10101101 3300025945 Bacteria 2255
368 Ga0207679_10125857 3300025945 Bacteria 2048
369 Ga0207679_10212648 3300025945 Bacteria 1622
370 Ga0207667_10036315 3300025949 Bacteria 5282
371 Ga0207667_10057441 3300025949 Bacteria 4085
372 Ga0207667_10062456 3300025949 Bacteria 3895
373 Ga0207667_10094914 3300025949 Bacteria 3079
374 Ga0207667_10113316 3300025949 Bacteria 2796
375 Ga0207667_10128671 3300025949 Bacteria 2608
376 Ga0207712_10010027 3300025961 Bacteria 6005
377 Ga0207712_10028076 3300025961 Bacteria 3762
378 Ga0207712_10096465 3300025961 Bacteria 2188
379 Ga0207712_10260985 3300025961 Bacteria 1405
380 Ga0207668_10119013 3300025972 Bacteria 1996
381 Ga0207658_10066558 3300025986 Bacteria 2710
382 Ga0207677_10027585 3300026023 Bacteria 3579
383 Ga0207703_10026751 3300026035 Bacteria 4544
384 Ga0207639_10198553 3300026041 Bacteria 1718
385 Ga0207678_10001748 3300026067 Bacteria 19890
386 Ga0207678_10004326 3300026067 Bacteria 12747
387 Ga0207678_10450051 3300026067 Bacteria 1119
388 Ga0207708_10000891 3300026075 Bacteria 22428
389 Ga0207708_10008517 3300026075 Bacteria 7593
390 Ga0207702_10001426 3300026078 Bacteria 23867
391 Ga0207702_10068643 3300026078 Bacteria 3046
392 Ga0207702_10117046 3300026078 Bacteria 2379
393 Ga0207702_10282552 3300026078 Bacteria 1570
394 Ga0207641_10032726 3300026088 Bacteria 4318
395 Ga0207641_10134147 3300026088 Bacteria 2227
396 Ga0207648_10013388 3300026089 Bacteria 7633
397 Ga0207648_10025242 3300026089 Bacteria 5295
398 Ga0207676_10005030 3300026095 Bacteria 9357
399 Ga0207674_10002799 3300026116 Bacteria 21723
400 Ga0207674_10056281 3300026116 Bacteria 3995
401 Ga0207674_10141659 3300026116 Bacteria 2363
402 Ga0207675_100011814 3300026118 Bacteria 8162
403 Ga0207683_10011627 3300026121 Bacteria 7513
404 Ga0207683_10027340 3300026121 Bacteria 4929
405 Ga0207683_10030887 3300026121 Bacteria 4646
406 Ga0207683_10133824 3300026121 Bacteria 2231
407 Ga0207698_10012063 3300026142 Bacteria 5635
408 Ga0207698_10091321 3300026142 Bacteria 2492
409 Ga0207698_10179573 3300026142 Bacteria 1873
410 Ga0209179_1001152 3300027512 Bacteria 3101
411 Ga0209998_10004639 3300027717 Bacteria 2910
412 Ga0209813_10006636 3300027866 Bacteria 2864
413 Ga0209813_10041609 3300027866 Bacteria 1401
414 Ga0207428_10000847 3300027907 Bacteria 34454
415 Ga0268266_10027351 3300028379 Bacteria 4850
416 Ga0268266_10042894 3300028379 Bacteria 3865
417 Ga0268266_10061518 3300028379 Bacteria 3238
418 Ga0268265_10008198 3300028380 Bacteria 7058
419 Ga0268265_10210568 3300028380 Bacteria 1693
420 Ga0268265_10290729 3300028380 Bacteria 1467
421 Ga0268264_10000107 3300028381 Bacteria 209105
422 Ga0268264_10001838 3300028381 Bacteria 19352
423 Ga0268264_10013465 3300028381 Bacteria 6734
424 Ga0307517_10001121 3300028786 Bacteria 45217
425 Ga0307511_10053453 3300030521 Bacteria 3201
426 Ga0265330_10033527 3300031235 Bacteria 2296
427 Ga0265320_10012283 3300031240 Bacteria 4994
428 Ga0265325_10000097 3300031241 Bacteria 61606
429 Ga0265325_10060157 3300031241 Bacteria 1930
430 Ga0265329_10015531 3300031242 Bacteria 2658
431 Ga0265339_10006887 3300031249 Bacteria 7407
432 Ga0265327_10003002 3300031251 Bacteria 16746
433 Ga0307509_10021381 3300031507 Bacteria 7315
434 Ga0265313_10000072 3300031595 Bacteria 98635
435 Ga0265313_10009985 3300031595 Bacteria 6081
436 Ga0265313_10016697 3300031595 Bacteria 4209
437 Ga0265313_10017909 3300031595 Bacteria 4000
438 Ga0265313_10100502 3300031595 Bacteria 1284
439 Ga0307508_10000154 3300031616 Bacteria 82824
440 Ga0307508_10042714 3300031616 Bacteria 4065
441 Ga0307508_10236946 3300031616 Bacteria 1423
442 Ga0265314_10005615 3300031711 Bacteria 11266
443 Ga0265314_10017130 3300031711 Bacteria 5696
444 Ga0265342_10001205 3300031712 Bacteria 24521
445 Ga0265342_10006418 3300031712 Bacteria 8762
446 Ga0265342_10017314 3300031712 Bacteria 4691
447 Ga0307516_10030519 3300031730 Bacteria 5438
448 Ga0307412_10144495 3300031911 Bacteria 1747
449 Ga0307409_100120740 3300031995 Bacteria 2219
450 Ga0307416_100075083 3300032002 Bacteria 2828
451 Ga0307510_10111799 3300033180 Bacteria 2471
452 Ga0373926_0002679 3300035083 Bacteria 5672
453 Ga0373934_0014385 3300035086 Bacteria 2999
454 Ga0373951_0015077 3300035091 Bacteria 1740
455 Ga0373952_0051365 3300035092 Bacteria 984
456 Ga0373923_0000498 3300035111 Bacteria 9464
457 Ga0373923_0025209 3300035111 Bacteria 2355
458 Ga0373936_0000333 3300035113 Bacteria 15986
459 Ga0373936_0003709 3300035113 Bacteria 5737
460 Ga0373953_0001092 3300035117 Bacteria 7676
461 Ga0373953_0017556 3300035117 Bacteria 2633
462 Ga0373954_0002334 3300035118 Bacteria 7919
463 Ga0373956_0005989 3300035119 Bacteria 4865
464 Ga0373957_0000374 3300035120 Bacteria 11335
465 Ga0373960_0025760 3300035121 Bacteria 1602
466 Ga0373943_0002984 3300035170 Bacteria 7682
467 Ga0373943_0003531 3300035170 Bacteria 7118
468 Ga0373943_0003831 3300035170 Bacteria 6836
469 Ga0373943_0041937 3300035170 Bacteria 2215
470 Ga0373946_0000838 3300035171 Bacteria 10525
471 Ga0373946_0003512 3300035171 Bacteria 5563
472 Ga0373946_0005437 3300035171 Bacteria 4593
473 Ga0373955_0000191 3300035172 Bacteria 25296
474 Ga0373955_0000716 3300035172 Bacteria 14261
475 Ga0373955_0009267 3300035172 Bacteria 4609
476 Ga0373962_0033521 3300035242 Bacteria 1418
477 Ga0373924_0000239 3300035410 Bacteria 16754
478 Ga0373924_0009491 3300035410 Bacteria 3566
479 Ga0373924_0097082 3300035410 Bacteria 1265
480 Ga0373931_0009482 3300035691 Bacteria 4656
481 Ga0373931_0010233 3300035691 Bacteria 4505
482 Ga0373935_0022035 3300035692 Bacteria 3902
483 Ga0373927_0000961 3300035695 Bacteria 21989
484 Ga0373927_0005223 3300035695 Bacteria 8984
485 Ga0373927_0007611 3300035695 Bacteria 7336
486 Ga0373927_0111645 3300035695 Bacteria 1781
487 Ga0373927_0118997 3300035695 Bacteria 1723
488 Ga0373933_0000874 3300035724 Bacteria 18425
489 Ga0373933_0001100 3300035724 Bacteria 16117
490 Ga0373933_0004649 3300035724 Bacteria 7517
491 Ga0373933_0080638 3300035724 Bacteria 1995
492 Ga0373947_0022629 3300035725 Bacteria 3646
493 Ga0373947_0028230 3300035725 Bacteria 3287
494 Ga0373947_0038959 3300035725 Bacteria 2826
495 Ga0373937_0000030 3300036401 Bacteria 122176
496 Ga0373937_0023092 3300036401 Bacteria 5596
497 Ga0373937_0064217 3300036401 Bacteria 3377
498 Ga0373937_0131701 3300036401 Bacteria 2335
499 Ga0373937_0135738 3300036401 Bacteria 2300
500 Ga0373925_0000501 3300037068 Bacteria 39530
501 Ga0373925_0017101 3300037068 Bacteria 5250
502 Ga0373925_0029160 3300037068 Bacteria 4048
503 Ga0373925_0039020 3300037068 Bacteria 3513
504 Ga0373925_0065512 3300037068 Bacteria 2736
505 Ga0373925_0151271 3300037068 Bacteria 1823
506 Ga0395899_0027304 3300037312 Bacteria 4304
507 Ga0395899_0030402 3300037312 Bacteria 4062
508 Ga0395899_0033115 3300037312 Bacteria 3882
509 Ga0395900_0001215 3300037418 Bacteria 31847
510 Ga0395900_0032923 3300037418 Bacteria 5333
511 Ga0395900_0051359 3300037418 Bacteria 4247
512 Ga0395900_0057410 3300037418 Bacteria 4007
513 Ga0395898_0001841 3300037466 Bacteria 27267
514 Ga0395898_0052786 3300037466 Bacteria 3971
515 Ga0395898_0082532 3300037466 Bacteria 3098
516 Ga0395898_0094485 3300037466 Bacteria 2873
517 Ga0395898_0128830 3300037466 Bacteria 2424
518 Ga0395905_0255484 3300037471 Bacteria 1637
519 Ga0436364_0327304 3300037853 Bacteria 4191
520 Ga0436364_0483132 3300037853 Bacteria 4019
521 Ga0436364_0508608 3300037853 Bacteria 35332
522 Ga0436364_0585229 3300037853 Bacteria 25011
523 Ga0436364_1519102 3300037853 Bacteria 52157
524 Ga0395901_0034367 3300038443 Bacteria 5235
525 Ga0395901_0040086 3300038443 Bacteria 4849
526 Ga0395901_0058280 3300038443 Bacteria 4017
527 Ga0395901_0106881 3300038443 Bacteria 2937
528 Ga0395901_0186293 3300038443 Bacteria 2177
529 Ga0436365_0010333 3300039437 Bacteria 1354
530 Ga0436365_1147194 3300039437 Bacteria 9578
531 Ga0436365_1224398 3300039437 Bacteria 2562
532 Ga0436365_1829993 3300039437 Bacteria 1394
533 Ga0436360_0070398 3300039438 Bacteria 1496
534 Ga0436360_0132510 3300039438 Bacteria 4773
535 Ga0436360_0196017 3300039438 Bacteria 6047
536 Ga0436360_1370935 3300039438 Bacteria 1211
537 Ga0436361_0865062 3300039447 Bacteria 12533
538 Ga0436361_0910383 3300039447 Bacteria 1691
539 Ga0436363_1570094 3300039450 Bacteria 1852
540 Ga0436362_0258613 3300039453 Bacteria 3715
541 Ga0436362_0656211 3300039453 Bacteria 1612
542 Ga0439463_008199 3300042016 Bacteria 2575
543 Ga0439460_0021337 3300042461 Bacteria 1769
544 Ga0451577_0132998 3300042876 Bacteria 2232
545 Ga0466963_0056391 3300044694 Bacteria 2614
546 Ga0466963_0115435 3300044694 Bacteria 1845
547 Ga0466963_0128051 3300044694 Bacteria 1751
548 Ga0466957_0023560 3300044842 Bacteria 3640
549 Ga0466957_0034957 3300044842 Bacteria 3015
550 Ga0466957_0053748 3300044842 Bacteria 2456
551 Ga0466960_0174488 3300044901 Bacteria 1162
552 Ga0466959_0066537 3300045049 Bacteria 2614
553 Ga0451576_0053197 3300045051 Bacteria 4242
554 Ga0466958_0011616 3300045836 Bacteria 4963
555 Ga0466967_0000135 3300045976 Bacteria 28276
556 Ga0466967_0110918 3300045976 Bacteria 2520
557 Ga0495592_0000046 3300046454 Bacteria 117345
558 Ga0495592_0001601 3300046454 Bacteria 15847
559 Ga0495592_0072397 3300046454 Bacteria 2507
560 Ga0495603_0000182 3300046455 Bacteria 32426
561 Ga0495603_0005564 3300046455 Bacteria 7523
562 Ga0495603_0009732 3300046455 Bacteria 5815
563 Ga0495603_0047693 3300046455 Bacteria 2550
564 Ga0495603_0053963 3300046455 Bacteria 2384
565 Ga0495603_0057775 3300046455 Bacteria 2295
566 Ga0495629_0000529 3300046459 Bacteria 31881
567 Ga0495629_0002383 3300046459 Bacteria 14468
568 Ga0495629_0006187 3300046459 Bacteria 8887
569 Ga0495641_0008493 3300046461 Bacteria 6250
570 Ga0495641_0065127 3300046461 Bacteria 1640
571 Ga0495651_0001433 3300046462 Bacteria 18463
572 Ga0495651_0006457 3300046462 Bacteria 8971
573 Ga0495651_0038602 3300046462 Bacteria 3719
574 Ga0495651_0086312 3300046462 Bacteria 2361
575 Ga0495653_0000036 3300046463 Bacteria 129776
576 Ga0495653_0090070 3300046463 Bacteria 2246
577 Ga0495580_0012568 3300046472 Bacteria 6488
578 Ga0495580_0013345 3300046472 Bacteria 6276
579 Ga0495582_0000597 3300046473 Bacteria 19925
580 Ga0495582_0005147 3300046473 Bacteria 7321
581 Ga0495582_0015425 3300046473 Bacteria 4196
582 Ga0495639_0000235 3300046475 Bacteria 27682
583 Ga0495639_0000957 3300046475 Bacteria 13017
584 Ga0495662_0004751 3300046476 Bacteria 6807
585 Ga0495662_0005695 3300046476 Bacteria 6228
586 Ga0495664_0000002 3300046477 Bacteria 625183
587 Ga0495664_0054316 3300046477 Bacteria 2382
588 Ga0495584_0014375 3300046491 Bacteria 4032
589 Ga0495584_0042137 3300046491 Bacteria 2304
590 Ga0495585_0003645 3300046492 Bacteria 10301
591 Ga0495594_0000302 3300046499 Bacteria 24227
592 Ga0495606_0001566 3300046507 Bacteria 29975
593 Ga0495606_0005874 3300046507 Bacteria 11555
594 Ga0495606_0052129 3300046507 Bacteria 2663
595 Ga0495608_0000006 3300046511 Bacteria 324334
596 Ga0495608_0008113 3300046511 Bacteria 7381
597 Ga0495608_0014581 3300046511 Bacteria 5453
598 Ga0495618_0000034 3300046514 Bacteria 104335
599 Ga0495618_0182438 3300046514 Bacteria 1333
600 Ga0495620_0041544 3300046515 Bacteria 2016
601 Ga0495628_0000077 3300046516 Bacteria 77338
602 Ga0495628_0007597 3300046516 Bacteria 9371
603 Ga0495628_0016559 3300046516 Bacteria 6147
604 Ga0495630_0000516 3300046517 Bacteria 28537
605 Ga0495630_0049773 3300046517 Bacteria 3136
606 Ga0495630_0215309 3300046517 Bacteria 1466
607 Ga0495643_0057387 3300046522 Bacteria 2075
608 Ga0495644_0020446 3300046523 Bacteria 2526
609 Ga0495644_0048833 3300046523 Bacteria 1589
610 Ga0495644_0048915 3300046523 Bacteria 1588
611 Ga0495666_0015118 3300046526 Bacteria 3843
612 Ga0495652_0000824 3300046529 Bacteria 35711
613 Ga0495652_0016637 3300046529 Bacteria 6574
614 Ga0495652_0018118 3300046529 Bacteria 6284
615 Ga0495652_0049061 3300046529 Bacteria 3615
616 Ga0495652_0215137 3300046529 Bacteria 1448
617 Ga0495665_0001688 3300046531 Bacteria 11856
618 Ga0495665_0007725 3300046531 Bacteria 5819
619 Ga0495665_0042438 3300046531 Bacteria 2421
620 Ga0495640_0000007 3300046533 Bacteria 265481
621 Ga0495640_0013882 3300046533 Bacteria 6114
622 Ga0495640_0048280 3300046533 Bacteria 2943
623 Ga0495640_0070564 3300046533 Bacteria 2347
624 Ga0495640_0139043 3300046533 Bacteria 1566
625 Ga0495640_0215481 3300046533 Bacteria 1212
626 Ga0495587_0001165 3300046536 Bacteria 17314
627 Ga0495587_0005654 3300046536 Bacteria 8150
628 Ga0495587_0046279 3300046536 Bacteria 2583
629 Ga0495587_0052159 3300046536 Bacteria 2414
630 Ga0495587_0110691 3300046536 Bacteria 1578
631 Ga0495598_0048953 3300046537 Bacteria 1265
632 Ga0495609_0078946 3300046538 Bacteria 1440
633 Ga0495645_0003118 3300046543 Bacteria 11234
634 Ga0495645_0007210 3300046543 Bacteria 7737
635 Ga0495645_0040759 3300046543 Bacteria 3386
636 Ga0495622_0001112 3300046557 Bacteria 14065
637 Ga0495622_0001942 3300046557 Bacteria 10165
638 Ga0495633_0000718 3300046558 Bacteria 30059
639 Ga0495667_0000129 3300046559 Bacteria 54274
640 Ga0495667_0003563 3300046559 Bacteria 10468
641 Ga0495667_0009644 3300046559 Bacteria 6545
642 Ga0495667_0023948 3300046559 Bacteria 4112
643 Ga0495667_0024999 3300046559 Bacteria 4025
644 Ga0495656_0000167 3300046615 Bacteria 23487
645 Ga0495656_0042204 3300046615 Bacteria 1909
646 Ga0495668_0047014 3300046616 Bacteria 2396
647 Ga0495668_0075065 3300046616 Bacteria 1857
648 Ga0495634_0004321 3300046642 Bacteria 11195
649 Ga0495634_0005741 3300046642 Bacteria 9480
650 Ga0495634_0058858 3300046642 Bacteria 2560
651 Ga0495611_0080629 3300046648 Bacteria 1496
652 Ga0495625_0029579 3300046660 Bacteria 4095
653 Ga0495625_0286699 3300046660 Bacteria 1058
654 Ga0495635_0000021 3300046663 Bacteria 164643
655 Ga0495635_0000429 3300046663 Bacteria 26634
656 Ga0495635_0002913 3300046663 Bacteria 11759
657 Ga0495635_0018820 3300046663 Bacteria 4819
658 Ga0495588_0002630 3300046674 Bacteria 7691
659 Ga0495588_0074439 3300046674 Bacteria 1768
660 Ga0495657_0000521 3300046675 Bacteria 35776
661 Ga0495657_0010262 3300046675 Bacteria 7049
662 Ga0495657_0021154 3300046675 Bacteria 4669
663 Ga0495657_0085887 3300046675 Bacteria 2028
664 Ga0495599_0000001 3300046678 Bacteria 537563
665 Ga0495599_0177842 3300046678 Bacteria 1312
666 Ga0495623_0000237 3300046679 Bacteria 35677
667 Ga0495623_0007655 3300046679 Bacteria 7019
668 Ga0495623_0208046 3300046679 Bacteria 1121
669 Ga0495646_0000007 3300046680 Bacteria 236764
670 Ga0495646_0001304 3300046680 Bacteria 14717
671 Ga0495646_0005359 3300046680 Bacteria 8093
672 Ga0495647_0003732 3300046681 Bacteria 4891
673 Ga0495647_0010229 3300046681 Bacteria 3192
674 Ga0495658_0001435 3300046683 Bacteria 12539
675 Ga0495658_0010855 3300046683 Bacteria 4563
676 Ga0495658_0025057 3300046683 Bacteria 3185
677 Ga0495669_0007906 3300046684 Bacteria 4465
678 Ga0495613_0001510 3300046689 Bacteria 17710
679 Ga0495613_0004994 3300046689 Bacteria 9964
680 Ga0495613_0169863 3300046689 Bacteria 1548
681 Ga0495624_0000810 3300046690 Bacteria 24701
682 Ga0495624_0084013 3300046690 Bacteria 1968
683 Ga0495670_0000842 3300046691 Bacteria 14850
684 Ga0495649_0072338 3300046694 Bacteria 1848
685 Ga0495600_0000190 3300046809 Bacteria 35746
686 Ga0495600_0007171 3300046809 Bacteria 6807
687 Ga0495600_0014546 3300046809 Bacteria 4959
688 Ga0495600_0085233 3300046809 Bacteria 2061
689 Ga0495581_0001119 3300047315 Bacteria 14674
690 Ga0495581_0086397 3300047315 Bacteria 1819
691 Ga0495604_0005361 3300047317 Bacteria 10166
692 Ga0495604_0010023 3300047317 Bacteria 7501
693 Ga0495604_0018683 3300047317 Bacteria 5552
694 Ga0495674_0000014 3300047319 Bacteria 241211
695 Ga0495674_0004558 3300047319 Bacteria 13335
696 Ga0495674_0082394 3300047319 Bacteria 2758
697 Ga0495672_0003454 3300047320 Bacteria 13522
698 Ga0495672_0008480 3300047320 Bacteria 7576
699 Ga0495676_0019892 3300047321 Bacteria 5900
700 Ga0495676_0026009 3300047321 Bacteria 5043
701 Ga0495676_0074858 3300047321 Bacteria 2591
702 Ga0495676_0081095 3300047321 Bacteria 2460
703 Ga0495680_0004506 3300047322 Bacteria 13324
704 Ga0495680_0006513 3300047322 Bacteria 10837
705 Ga0495680_0006824 3300047322 Bacteria 10544
706 Ga0495680_0040769 3300047322 Bacteria 3697
707 Ga0495675_0001883 3300047444 Bacteria 12503
708 Ga0495679_020418 3300047446 Bacteria 2307
709 Ga0495685_039295 3300047447 Bacteria 1620
710 Ga0495684_0000390 3300047471 Bacteria 35768
711 Ga0495684_0000497 3300047471 Bacteria 32091
712 Ga0495684_0010904 3300047471 Bacteria 7027
713 Ga0495686_0000594 3300047472 Bacteria 50426
714 Ga0495686_0012069 3300047472 Bacteria 6068
715 Ga0495593_0000370 3300047673 Bacteria 24754
716 Ga0495593_0014868 3300047673 Bacteria 4421
717 Ga0495593_0023490 3300047673 Bacteria 3427
718 Ga0495602_0000211 3300048088 Bacteria 54539
719 Ga0495602_0106400 3300048088 Bacteria 2290
720 Ga0495614_0006439 3300048089 Bacteria 5273
721 Ga0495614_0009598 3300048089 Bacteria 4276
722 Ga0495626_0045337 3300048091 Bacteria 2053
723 Ga0496100_0085353 3300048903 Bacteria 2142
724 Ga0496101_0002598 3300048904 Bacteria 11096
725 Ga0496101_0052904 3300048904 Bacteria 2928
726 Ga0496101_0066250 3300048904 Bacteria 2634
727 Ga0496101_0076120 3300048904 Bacteria 2472
728 Ga0496102_0005580 3300048905 Bacteria 10687
729 Ga0496102_0010961 3300048905 Bacteria 7810
730 Ga0496102_0080609 3300048905 Bacteria 2999
731 Ga0496102_0081296 3300048905 Bacteria 2987
732 Ga0496103_0003333 3300048906 Bacteria 9825
733 Ga0496103_0016121 3300048906 Bacteria 4459
734 Ga0496103_0068711 3300048906 Bacteria 2214
735 Ga0496104_0000351 3300048907 Bacteria 41200
736 Ga0496104_0001036 3300048907 Bacteria 23773
737 Ga0496104_0002273 3300048907 Bacteria 16565
738 Ga0496104_0014542 3300048907 Bacteria 7108
739 Ga0496104_0027519 3300048907 Bacteria 5262
740 Ga0496104_0036781 3300048907 Bacteria 4577
741 Ga0496104_0064476 3300048907 Bacteria 3475
742 Ga0496104_0141127 3300048907 Bacteria 2314
743 Ga0496105_0001783 3300048908 Bacteria 15381
744 Ga0496105_0006479 3300048908 Bacteria 8999
745 Ga0496105_0017163 3300048908 Bacteria 5797
746 Ga0496106_0000788 3300048909 Bacteria 22899
747 Ga0496106_0010763 3300048909 Bacteria 6759
748 Ga0496106_0028407 3300048909 Bacteria 4166
749 Ga0496106_0088273 3300048909 Bacteria 2390
750 Ga0496107_0003552 3300048910 Bacteria 10445
751 Ga0496107_0004819 3300048910 Bacteria 9159
752 Ga0496107_0013855 3300048910 Bacteria 5635
753 Ga0496107_0065572 3300048910 Bacteria 2633
754 Ga0496107_0180590 3300048910 Bacteria 1567
755 Ga0496108_0008220 3300048911 Bacteria 8468
756 Ga0496108_0017871 3300048911 Bacteria 5800
757 Ga0496109_0004783 3300048912 Bacteria 11304
758 Ga0496109_0016169 3300048912 Bacteria 6521
759 Ga0496109_0043085 3300048912 Bacteria 4091
760 Ga0496110_0024050 3300048913 Bacteria 5190
761 Ga0496110_0094582 3300048913 Bacteria 2675
762 Ga0496111_0002946 3300048914 Bacteria 10413
763 Ga0496111_0020031 3300048914 Bacteria 4654
764 Ga0496111_0020392 3300048914 Bacteria 4614
765 Ga0496112_0000018 3300048915 Bacteria 188820
766 Ga0496112_0030393 3300048915 Bacteria 5227
767 Ga0496112_0035815 3300048915 Bacteria 4837
768 Ga0496112_0053613 3300048915 Bacteria 3961
769 Ga0496112_0190737 3300048915 Bacteria 2011
770 Ga0496113_0001245 3300048916 Bacteria 14009
771 Ga0496113_0187818 3300048916 Bacteria 1640
772 Ga0496113_0277766 3300048916 Bacteria 1339
773 Ga0496114_0094050 3300048917 Bacteria 2549
774 Ga0496114_0182303 3300048917 Bacteria 1834
775 Ga0496115_0004857 3300048918 Bacteria 9753
776 Ga0496115_0008114 3300048918 Bacteria 7759
777 Ga0496115_0019196 3300048918 Bacteria 5259
778 Ga0496115_0050174 3300048918 Bacteria 3342
779 Ga0496115_0196668 3300048918 Bacteria 1666
780 Ga0496115_0210671 3300048918 Bacteria 1605
781 Ga0496117_0007128 3300048920 Bacteria 11048
782 Ga0496118_0003592 3300048921 Bacteria 19299
783 Ga0496119_0016379 3300048922 Bacteria 5644
784 Ga0496121_0000640 3300048924 Bacteria 65295
785 Ga0496121_0002920 3300048924 Bacteria 25047
786 Ga0496121_0046507 3300048924 Bacteria 3713
787 Ga0496121_0080257 3300048924 Bacteria 2587
788 Ga0496124_0000275 3300048927 Bacteria 98848
789 Ga0496124_0002189 3300048927 Bacteria 26104
790 Ga0496125_0085843 3300048928 Bacteria 2383
791 Ga0496125_0108506 3300048928 Bacteria 2019
792 Ga0496126_0016879 3300048929 Bacteria 7287
793 Ga0496126_0018354 3300048929 Bacteria 6933
794 Ga0496126_0043259 3300048929 Bacteria 4155
795 Ga0496126_0251070 3300048929 Bacteria 1474
796 Ga0496126_0254995 3300048929 Bacteria 1460
797 Ga0501032_0024651 3300049569 Bacteria 4151
798 Ga0501033_0028780 3300049570 Bacteria 4174
799 Ga0501033_0148490 3300049570 Bacteria 1692
800 Ga0501034_0001022 3300049571 Bacteria 40098
801 Ga0501034_0014334 3300049571 Bacteria 8170
802 Ga0501034_0038754 3300049571 Bacteria 4826
803 Ga0501034_0178387 3300049571 Bacteria 2090
804 Ga0501034_0222791 3300049571 Bacteria 1838
805 Ga0501036_0027252 3300049572 Bacteria 4827
806 Ga0501036_0354028 3300049572 Bacteria 1226
807 Ga0501037_0009609 3300049573 Bacteria 7096
808 Ga0501038_0019762 3300049574 Bacteria 6062
809 Ga0501039_0242262 3300049575 Bacteria 1418
810 Ga0501040_0055239 3300049576 Bacteria 2723
811 Ga0501040_0097232 3300049576 Bacteria 2051
812 Ga0501042_0279456 3300049578 Bacteria 1206
813 Ga0501043_0025912 3300049579 Bacteria 4600
814 Ga0501043_0047588 3300049579 Bacteria 3372
815 Ga0501046_0020459 3300049580 Bacteria 5471
816 Ga0501046_0054282 3300049580 Bacteria 3153
817 Ga0501046_0154294 3300049580 Bacteria 1731
818 Ga0501047_0006577 3300049581 Bacteria 10941
819 Ga0501047_0030016 3300049581 Bacteria 5241
820 Ga0501047_0045077 3300049581 Bacteria 4263
821 Ga0501047_0147341 3300049581 Bacteria 2230
822 Ga0501047_0404951 3300049581 Bacteria 1197
823 Ga0501048_0020654 3300049582 Bacteria 4827
824 Ga0501067_0073025 3300049583 Bacteria 1901
825 Ga0501068_0004420 3300049584 Bacteria 7645
826 Ga0501068_0009601 3300049584 Bacteria 5418
827 Ga0501069_0048333 3300049585 Bacteria 2362
828 Ga0501069_0217426 3300049585 Bacteria 1110
829 Ga0501069_0234239 3300049585 Bacteria 1069
830 Ga0501070_0000159 3300049586 Bacteria 62347
831 Ga0501070_0040110 3300049586 Bacteria 3905
832 Ga0501070_0065903 3300049586 Bacteria 2999
833 Ga0501070_0110989 3300049586 Bacteria 2266
834 Ga0501071_0002327 3300049587 Bacteria 11470
835 Ga0501071_0156297 3300049587 Bacteria 1703
836 Ga0501072_0003943 3300049588 Bacteria 11230
837 Ga0501073_0014744 3300049589 Bacteria 5677
838 Ga0501074_0037719 3300049590 Bacteria 3502
839 Ga0501074_0070751 3300049590 Bacteria 2508
840 Ga0501075_0099533 3300049591 Bacteria 2208
841 Ga0501075_0191271 3300049591 Bacteria 1561
842 Ga0501076_0014001 3300049592 Bacteria 6028
843 Ga0501077_0043126 3300049593 Bacteria 2867
844 Ga0501077_0045111 3300049593 Bacteria 2800
845 Ga0501077_0068057 3300049593 Bacteria 2257
846 Ga0501079_0018470 3300049741 Bacteria 5328
847 Ga0501079_0043467 3300049741 Bacteria 3468
848 Ga0501080_0018607 3300049742 Bacteria 6429
849 Ga0501080_0028752 3300049742 Bacteria 5175
850 Ga0501080_0048274 3300049742 Bacteria 3963
851 Ga0501081_0014089 3300049743 Bacteria 5269
852 Ga0501081_0249094 3300049743 Bacteria 1297
853 Ga0501083_0054348 3300049744 Bacteria 2687
854 Ga0501083_0092870 3300049744 Bacteria 1992
855 Ga0501035_0014245 3300049822 Bacteria 7339
856 Ga0501035_0028749 3300049822 Bacteria 5072
857 Ga0501044_0015230 3300049823 Bacteria 8282
858 Ga0501044_0017958 3300049823 Bacteria 7585
859 Ga0501044_0019088 3300049823 Bacteria 7341
860 Ga0501044_0262568 3300049823 Bacteria 1665
861 Ga0501045_0029797 3300049824 Bacteria 3946
862 nmdc:mga03n38_36667_c1 3300050490 Bacteria 2110
863 nmdc:mga00v17_29480_c1 3300050491 Bacteria 3221
864 nmdc:mga0yw44_192698_c1 3300050492 Bacteria 1345
865 nmdc:mga0yw44_237105_c1 3300050492 Bacteria 1212
866 nmdc:mga0yw44_9722_c1 3300050492 Bacteria 2394
867 nmdc:mga0k408_137154_c1 3300050493 Bacteria 1454
868 nmdc:mga0k408_2759_c1 3300050493 Bacteria 9331
869 nmdc:mga06z11_35422_c1 3300050494 Bacteria 2457
870 nmdc:mga06z11_46344_c1 3300050494 Bacteria 2203
871 nmdc:mga04h51_12622_c1 3300050495 Bacteria 2375
872 nmdc:mga04h51_31966_c1 3300050495 Bacteria 1666
873 nmdc:mga04h51_5275_c1 3300050495 Bacteria 3284
874 nmdc:mga07m45_63918_c1 3300050496 Bacteria 2088
875 nmdc:mga05p37_10233_c1 3300050507 Bacteria 11137
876 nmdc:mga05p37_14407_c1 3300050507 Bacteria 9493
877 nmdc:mga05p37_35871_c1 3300050507 Bacteria 6084
878 nmdc:mga05p37_613903_c1 3300050507 Bacteria 1225
879 nmdc:mga05p37_8147_c1 3300050507 Bacteria 12388
880 nmdc:mga09592_9750_c1 3300050508 Bacteria 7803
881 nmdc:mga0qj67_106070_c1 3300050509 Bacteria 2267
882 nmdc:mga0qj67_125999_c1 3300050509 Bacteria 2073
883 nmdc:mga0qj67_215_c1 3300050509 Bacteria 39409
884 nmdc:mga0qj67_4314_c1 3300050509 Bacteria 10307
885 nmdc:mga06r32_12515_c1 3300050510 Bacteria 7657
886 nmdc:mga06r32_298941_c1 3300050510 Bacteria 1596
887 nmdc:mga06r32_316_c1 3300050510 Bacteria 40391
888 nmdc:mga06r32_4487_c1 3300050510 Bacteria 12494
889 nmdc:mga06r32_6439_c1 3300050510 Bacteria 10546
890 nmdc:mga08y16_112174_c1 3300050511 Bacteria 2838
891 nmdc:mga08y16_145004_c1 3300050511 Bacteria 2468
892 nmdc:mga08y16_181255_c1 3300050511 Bacteria 2187
893 nmdc:mga08y16_275602_c1 3300050511 Bacteria 1736
894 nmdc:mga08y16_285812_c1 3300050511 Bacteria 1701
895 nmdc:mga08y16_35913_c1 3300050511 Bacteria 5205
896 nmdc:mga08y16_39014_c1 3300050511 Bacteria 4984
897 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
898 nmdc:mga0n895_107074_c1 3300050512 Bacteria 2809
899 nmdc:mga0n895_132917_c1 3300050512 Bacteria 2514
900 nmdc:mga0n895_289991_c1 3300050512 Bacteria 1659
901 nmdc:mga0n895_416731_c1 3300050512 Bacteria 1358
902 nmdc:mga0n895_48615_c1 3300050512 Bacteria 4153
903 nmdc:mga0rr50_19557_c1 3300050513 Bacteria 4574
904 nmdc:mga08x19_106181_c1 3300050514 Bacteria 1868
905 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
906 nmdc:mga0a205_100278_c1 3300050515 Bacteria 2794
907 nmdc:mga0a205_234517_c1 3300050515 Bacteria 1717
908 nmdc:mga0sz30_11159_c1 3300050516 Bacteria 3462
909 Ga0495601_0000008 3300053077 Bacteria 362152
910 Ga0495601_0007499 3300053077 Bacteria 6400
911 Ga0495601_0018585 3300053077 Bacteria 4231
912 Ga0495612_0000844 3300053078 Bacteria 12425
913 Ga0495612_0000950 3300053078 Bacteria 11916
914 Ga0495612_0071997 3300053078 Bacteria 1443
915 Ga0500635_0005887 3300053080 Bacteria 3248
916 Ga0495655_0014821 3300053083 Bacteria 1643
917 Ga0495595_0000155 3300053084 Bacteria 27158
918 Ga0495595_0001465 3300053084 Bacteria 9212
919 Ga0495595_0002145 3300053084 Bacteria 7665
920 Ga0495619_0000033 3300053085 Bacteria 138925
921 Ga0495619_0006338 3300053085 Bacteria 7501
922 Ga0495619_0014717 3300053085 Bacteria 4941
923 Ga0495619_0033588 3300053085 Bacteria 3332
924 Ga0500578_0102638 3300053086 Bacteria 1809
925 Ga0500583_0193073 3300053092 Bacteria 1013
926 Ga0500651_0056821 3300053093 Bacteria 2449
927 Ga0500566_0001625 3300053094 Bacteria 13231
928 Ga0500566_0124910 3300053094 Bacteria 1383
929 Ga0500641_0029827 3300053096 Bacteria 2139
930 Ga0500554_000124 3300053102 Bacteria 15252
931 Ga0500592_004822 3300053116 Bacteria 2144
932 Ga0500595_000095 3300053119 Bacteria 61248
933 Ga0500595_002960 3300053119 Bacteria 8090
934 Ga0500595_039754 3300053119 Bacteria 1520
935 Ga0500568_0005538 3300053139 Bacteria 6505
936 Ga0500590_002067 3300053148 Bacteria 8691
937 Ga0500603_000738 3300053150 Bacteria 7969
938 Ga0500620_055445 3300053155 Bacteria 1339
939 Ga0500627_0001582 3300053158 Bacteria 6412
940 Ga0500627_0111877 3300053158 Bacteria 1229
941 Ga0500638_006677 3300053162 Bacteria 4750
942 Ga0500636_0002059 3300053177 Bacteria 11095
943 Ga0500636_0008900 3300053177 Bacteria 5826
944 Ga0500637_0000495 3300053178 Bacteria 15245
945 Ga0500637_0001452 3300053178 Bacteria 10086
946 Ga0500609_011430 3300053731 Bacteria 1199
947 Ga0501084_0023932 3300054114 Bacteria 5095
948 Ga0501084_0063910 3300054114 Bacteria 3082
949 Ga0501084_0071273 3300054114 Bacteria 2910
950 Ga0501084_0071724 3300054114 Bacteria 2901
951 Ga0501084_0223415 3300054114 Bacteria 1589
952 Ga0501082_0000013 3300060353 Bacteria 119623
953 Ga0501082_0010354 3300060353 Bacteria 8029
954 Ga0501082_0255475 3300060353 Bacteria 1525
955 Ga0530510_0150122 3300061734 Bacteria 1720
956 Ga0530510_0168441 3300061734 Bacteria 1622
957 2509152562 2508501128 Bacteria 8613869
958 2513698863 2513237101 Bacteria 7952346
959 2774868664 2773857925 Bacteria 6472445
960 2792745559 2791355123 Bacteria 8049106
961 2793079172
962 2855734447 2855730933 Bacteria 7047938
963 2855770037 2855767633 Bacteria 7049357
964 2874610507 2874604998 Bacteria 7834745
965 2876818202 2876808645 Bacteria 8824342
966 2879115150 2879110137 Bacteria 8907982
967 2881414278 2881412998 Bacteria 6492157
968 2889035188 2889033259 Bacteria 9099371
969 2922363284 2922361189 Bacteria 7436256
970 8006969408 8006964411 Bacteria 8966052
971 8006988456 8006984368 Bacteria 9651211
972 8056678590 8056673599 Bacteria 7871253
973 Ga0500616_0009673
974 JGI24744J21845_10000923
975 JGI24033J26618_1003474
976 JGI25406J46586_10000028
977 JGI25160J50197_1000095
978 JGI25161J50226_1000071
979 JGI25404J52841_10004986
980 Ga0055543_1000206
981 Ga0065165_1000408
982 Ga0070658_10010675
983 Ga0070676_10129731
984 Ga0070683_100027066
985 Ga0070690_100010109
986 Ga0070670_100036282
987 Ga0070670_100046453
988 Ga0068869_100042587
989 Ga0070666_10033182
990 Ga0070680_100003476
991 Ga0070680_100007187
992 Ga0070680_100013175
993 Ga0070680_100046954
994 Ga0068868_100028246
995 Ga0070660_100025143
996 Ga0070689_100081818
997 Ga0070691_10001323
998 Ga0070661_100034257
999 Ga0070661_100149989
1000 Ga0070692_10061899
1001 Ga0070668_100094992
1002 Ga0070669_100004982
1003 Ga0070669_100017838
1004 Ga0070669_100128050
1005 Ga0070673_100014774
1006 Ga0070688_100019330
1007 Ga0070688_100198625
1008 Ga0070659_100109588
1009 Ga0070659_100205342
1010 Ga0070667_100023872
1011 Ga0070703_10001774
1012 Ga0070709_10009430
1013 Ga0070709_10044828
1014 Ga0070709_10146986
1015 Ga0070714_100003399
1016 Ga0070714_100199988
1017 Ga0070713_100003592
1018 Ga0070713_100327192
1019 Ga0070710_10001178
1020 Ga0070710_10048329
1021 Ga0070710_10066017
1022 Ga0070701_10018203
1023 Ga0070701_10038414
1024 Ga0070711_100016060
1025 Ga0070711_100035255
1026 Ga0070711_100203604
1027 Ga0070705_100002136
1028 Ga0070700_100038308
1029 Ga0070700_100063440
1030 Ga0070700_100089522
1031 Ga0070708_100005485
1032 Ga0070663_100008923
1033 Ga0070663_100112035
1034 Ga0070663_100136782
1035 Ga0070678_100019792
1036 Ga0070678_100100375
1037 Ga0070662_100023188
1038 Ga0070681_10003470
1039 Ga0070681_10004105
1040 Ga0070681_10015832
1041 Ga0070681_10087004
1042 Ga0070681_10159856
1043 Ga0070681_10253655
1044 Ga0068867_100061438
1045 Ga0068867_100214551
1046 Ga0070685_10013498
1047 Ga0070706_100000058
1048 Ga0070706_100146353
1049 Ga0070706_100188269
1050 Ga0070698_100000825
1051 Ga0070699_100005255
1052 Ga0070699_100152170
1053 Ga0070679_100036294
1054 Ga0070679_100105809
1055 Ga0070679_100123488
1056 Ga0070679_100160671
1057 Ga0070679_100294384
1058 Ga0070684_100047842
1059 Ga0070684_100170035
1060 Ga0070697_100002460
1061 Ga0070697_100002564
1062 Ga0070697_100006247
1063 Ga0070697_100007169
1064 Ga0070697_100007965
1065 Ga0070697_100016894
1066 Ga0068853_100015257
1067 Ga0068853_100026126
1068 Ga0068853_100069092
1069 Ga0070672_100064032
1070 Ga0070672_100165275
1071 Ga0070695_100005766
1072 Ga0070696_100000887
1073 Ga0070696_100004630
1074 Ga0070696_100063608
1075 Ga0070693_100045863
1076 Ga0070693_100099541
1077 Ga0070665_100130569
1078 Ga0070665_100192702
1079 Ga0070704_100014059
1080 Ga0070704_100183329
1081 Ga0068855_100008088
1082 Ga0068855_100125606
1083 Ga0068855_100174599
1084 Ga0068855_100194279
1085 Ga0070664_100071163
1086 Ga0068857_100003412
1087 Ga0068857_100138473
1088 Ga0068856_100049808
1089 Ga0068856_100094060
1090 Ga0068852_100010751
1091 Ga0068852_100011681
1092 Ga0068852_100025909
1093 Ga0068852_100071010
1094 Ga0068852_100096988
1095 Ga0068859_100013735
1096 Ga0068859_100019924
1097 Ga0068859_100090535
1098 Ga0068864_100033297
1099 Ga0068864_100360597
1100 Ga0068861_100040369
1101 Ga0068861_100065319
1102 Ga0068851_10021478
1103 Ga0068870_10003649
1104 Ga0068863_100017877
1105 Ga0068858_100064336
1106 Ga0068860_100000577
1107 Ga0068860_100018913
1108 Ga0068860_100092343
1109 Ga0068862_100148148
1110 Ga0068862_100326621
1111 Ga0081455_10000226
1112 Ga0081455_10011459
1113 Ga0081455_10012534
1114 Ga0081455_10025643
1115 Ga0081455_10035259
1116 Ga0081538_10001703
1117 Ga0081540_1003162
1118 Ga0081540_1003755
1119 Ga0081540_1009897
1120 Ga0081540_1011694
1121 Ga0081540_1017229
1122 Ga0081540_1026005
1123 Ga0081540_1037654
1124 Ga0081540_1042934
1125 Ga0081540_1059105
1126 Ga0081539_10000048
1127 Ga0081539_10000576
1128 Ga0081539_10036771
1129 Ga0081539_10071654
1130 Ga0070717_10000634
1131 Ga0070717_10051186
1132 Ga0070717_10059267
1133 Ga0070717_10146806
1134 Ga0075365_10088316
1135 Ga0075365_10102464
1136 Ga0075368_10001658
1137 Ga0075368_10088642
1138 Ga0075363_100035403
1139 Ga0075363_100052241
1140 Ga0075364_10061523
1141 Ga0075364_10071135
1142 Ga0075364_10132838
1143 Ga0075364_10145892
1144 Ga0075432_10051536
1145 Ga0070715_10029300
1146 Ga0070715_10055329
1147 Ga0070716_100004081
1148 Ga0070716_100060169
1149 Ga0070712_100015951
1150 Ga0070712_100022594
1151 Ga0070712_100346614
1152 Ga0075367_10001614
1153 Ga0075369_10028353
1154 Ga0075369_10045625
1155 Ga0075366_10002111
1156 Ga0075366_10143949
1157 Ga0097621_100020528
1158 Ga0097621_100034122
1159 Ga0075370_10033632
1160 Ga0068871_100074458
1161 Ga0075428_100005533
1162 Ga0075428_100011315
1163 Ga0075428_100206695
1164 Ga0075428_100210506
1165 Ga0075428_100383918
1166 Ga0075430_100000222
1167 Ga0075430_100012924
1168 Ga0075430_100031383
1169 Ga0075430_100139010
1170 Ga0075430_100248002
1171 Ga0075431_100001099
1172 Ga0075431_100015511
1173 Ga0075433_10031299
1174 Ga0075434_100240347
1175 Ga0075429_100024988
1176 Ga0068865_100018423
1177 Ga0075436_100004698
1178 Ga0097620_100013735
1179 Ga0097620_100019924
1180 Ga0097620_100090527
1181 Ga0075435_100116205
1182 Ga0105244_10028351
1183 Ga0105250_10037420
1184 Ga0105240_10008969
1185 Ga0105240_10030708
1186 Ga0105240_10070434
1187 Ga0105240_10121613
1188 Ga0111539_10002503
1189 Ga0111539_10032995
1190 Ga0111539_10064813
1191 Ga0111539_10143122
1192 Ga0105247_10007788
1193 Ga0105247_10224458
1194 Ga0114129_10003943
1195 Ga0114129_10014705
1196 Ga0114129_10017278
1197 Ga0114129_10023078
1198 Ga0114129_10097181
1199 Ga0105243_10008030
1200 Ga0105243_10102502
1201 Ga0105241_10108329
1202 Ga0105242_10021859
1203 Ga0105248_10033223
1204 Ga0105248_10037197
1205 Ga0105248_10136859
1206 Ga0105237_10137192
1207 Ga0105237_10183269
1208 Ga0105238_10034676
1209 Ga0105238_10087987
1210 Ga0105238_10105822
1211 Ga0105249_10033545
1212 Ga0105249_10378644
1213 Ga0099796_10049914
1214 Ga0105239_10017528
1215 Ga0105239_10047388
1216 Ga0105239_10112338
1217 Ga0105239_10136977
1218 Ga0157370_10085558
1219 Ga0157370_10233664
1220 Ga0157369_10211574
1221 Ga0157374_10010302
1222 Ga0157374_10054750
1223 Ga0157374_10198980
1224 Ga0163162_10076230
1225 Ga0163162_10105667
1226 Ga0157372_10319259
1227 Ga0157375_10217358
1228 Ga0157375_10228532
1229 Ga0163163_10016636
1230 Ga0163163_10045809
1231 Ga0157380_10072897
1232 Ga0157380_10242407
1233 Ga0157379_10019972
1234 Ga0157376_10176005
1235 Ga0157376_10179408
1236 Ga0163161_10008859
1237 Ga0163161_10065481
1238 Ga0206353_10589863
1239 Ga0213873_10011822
1240 Ga0213876_10002856
1241 Ga0213875_10000556
1242 Ga0213875_10001253
1243 Ga0213875_10026948
1244 Ga0209130_1000180
1245 Ga0209130_1000318
1246 Ga0209758_1008580
1247 Ga0209758_1045312
1248 Ga0207426_1000017
1249 Ga0207426_1000512
1250 Ga0207426_1011406
1251 Ga0207697_10016118
1252 Ga0207697_10074176
1253 Ga0207656_10014562
1254 Ga0207653_10000916
1255 Ga0207692_10001575
1256 Ga0207692_10003295
1257 Ga0207692_10003780
1258 Ga0207642_10034708
1259 Ga0207710_10031969
1260 Ga0207710_10042622
1261 Ga0207688_10000135
1262 Ga0207688_10156493
1263 Ga0207685_10000528
1264 Ga0207685_10003382
1265 Ga0207685_10059682
1266 Ga0207699_10000525
1267 Ga0207699_10006599
1268 Ga0207699_10010546
1269 Ga0207699_10057527
1270 Ga0207699_10197176
1271 Ga0207645_10032939
1272 Ga0207643_10002474
1273 Ga0207705_10067552
1274 Ga0207705_10087950
1275 Ga0207684_10000066
1276 Ga0207684_10083785
1277 Ga0207684_10107273
1278 Ga0207707_10001534
1279 Ga0207707_10003664
1280 Ga0207707_10056618
1281 Ga0207707_10097420
1282 Ga0207695_10089205
1283 Ga0207695_10128805
1284 Ga0207671_10034908
1285 Ga0207671_10136713
1286 Ga0207671_10244280
1287 Ga0207693_10003105
1288 Ga0207693_10003253
1289 Ga0207693_10006237
1290 Ga0207693_10033042
1291 Ga0207693_10118323
1292 Ga0207663_10003674
1293 Ga0207663_10045172
1294 Ga0207663_10113493
1295 Ga0207663_10160136
1296 Ga0207660_10002434
1297 Ga0207660_10003557
1298 Ga0207660_10007716
1299 Ga0207660_10103669
1300 Ga0207660_10233652
1301 Ga0207660_10251393
1302 Ga0207657_10003813
1303 Ga0207657_10020183
1304 Ga0207657_10021304
1305 Ga0207652_10012569
1306 Ga0207652_10024211
1307 Ga0207652_10048955
1308 Ga0207652_10060640
1309 Ga0207652_10137828
1310 Ga0207652_10163710
1311 Ga0207652_10240457
1312 Ga0207681_10092806
1313 Ga0207694_10032265
1314 Ga0207694_10032282
1315 Ga0207694_10147766
1316 Ga0207694_10198132
1317 Ga0207650_10040008
1318 Ga0207659_10006550
1319 Ga0207687_10076635
1320 Ga0207700_10025747
1321 Ga0207664_10010948
1322 Ga0207664_10215543
1323 Ga0207690_10234488
1324 Ga0207706_10014097
1325 Ga0207706_10081723
1326 Ga0207706_10110428
1327 Ga0207709_10004810
1328 Ga0207670_10120195
1329 Ga0207704_10015710
1330 Ga0207665_10001379
1331 Ga0207665_10006797
1332 Ga0207665_10080816
1333 Ga0207691_10007793
1334 Ga0207691_10086637
1335 Ga0207711_10289548
1336 Ga0207689_10043759
1337 Ga0207661_10098304
1338 Ga0207661_10274129
1339 Ga0207679_10101101
1340 Ga0207679_10125857
1341 Ga0207679_10212648
1342 Ga0207667_10036315
1343 Ga0207667_10057441
1344 Ga0207667_10062456
1345 Ga0207667_10094914
1346 Ga0207667_10113316
1347 Ga0207667_10128671
1348 Ga0207712_10010027
1349 Ga0207712_10028076
1350 Ga0207712_10096465
1351 Ga0207712_10260985
1352 Ga0207668_10119013
1353 Ga0207658_10066558
1354 Ga0207677_10027585
1355 Ga0207703_10026751
1356 Ga0207639_10198553
1357 Ga0207678_10001748
1358 Ga0207678_10004326
1359 Ga0207678_10450051
1360 Ga0207708_10000891
1361 Ga0207708_10008517
1362 Ga0207702_10001426
1363 Ga0207702_10068643
1364 Ga0207702_10117046
1365 Ga0207702_10282552
1366 Ga0207641_10032726
1367 Ga0207641_10134147
1368 Ga0207648_10013388
1369 Ga0207648_10025242
1370 Ga0207676_10005030
1371 Ga0207674_10002799
1372 Ga0207674_10056281
1373 Ga0207674_10141659
1374 Ga0207675_100011814
1375 Ga0207683_10011627
1376 Ga0207683_10027340
1377 Ga0207683_10030887
1378 Ga0207683_10133824
1379 Ga0207698_10012063
1380 Ga0207698_10091321
1381 Ga0207698_10179573
1382 Ga0209179_1001152
1383 Ga0209998_10004639
1384 Ga0209813_10006636
1385 Ga0209813_10041609
1386 Ga0207428_10000847
1387 Ga0268266_10027351
1388 Ga0268266_10042894
1389 Ga0268266_10061518
1390 Ga0268265_10008198
1391 Ga0268265_10210568
1392 Ga0268265_10290729
1393 Ga0268264_10000107
1394 Ga0268264_10001838
1395 Ga0268264_10013465
1396 Ga0307517_10001121
1397 Ga0307511_10053453
1398 Ga0265330_10033527
1399 Ga0265320_10012283
1400 Ga0265325_10000097
1401 Ga0265325_10060157
1402 Ga0265329_10015531
1403 Ga0265339_10006887
1404 Ga0265327_10003002
1405 Ga0307509_10021381
1406 Ga0265313_10000072
1407 Ga0265313_10009985
1408 Ga0265313_10016697
1409 Ga0265313_10017909
1410 Ga0265313_10100502
1411 Ga0307508_10000154
1412 Ga0307508_10042714
1413 Ga0307508_10236946
1414 Ga0265314_10005615
1415 Ga0265314_10017130
1416 Ga0265342_10001205
1417 Ga0265342_10006418
1418 Ga0265342_10017314
1419 Ga0307516_10030519
1420 Ga0307412_10144495
1421 Ga0307409_100120740
1422 Ga0307416_100075083
1423 Ga0307510_10111799
1424 Ga0373926_0002679
1425 Ga0373934_0014385
1426 Ga0373951_0015077
1427 Ga0373952_0051365
1428 Ga0373923_0000498
1429 Ga0373923_0025209
1430 Ga0373936_0000333
1431 Ga0373936_0003709
1432 Ga0373953_0001092
1433 Ga0373953_0017556
1434 Ga0373954_0002334
1435 Ga0373956_0005989
1436 Ga0373957_0000374
1437 Ga0373960_0025760
1438 Ga0373943_0002984
1439 Ga0373943_0003531
1440 Ga0373943_0003831
1441 Ga0373943_0041937
1442 Ga0373946_0000838
1443 Ga0373946_0003512
1444 Ga0373946_0005437
1445 Ga0373955_0000191
1446 Ga0373955_0000716
1447 Ga0373955_0009267
1448 Ga0373962_0033521
1449 Ga0373924_0000239
1450 Ga0373924_0009491
1451 Ga0373924_0097082
1452 Ga0373931_0009482
1453 Ga0373931_0010233
1454 Ga0373935_0022035
1455 Ga0373927_0000961
1456 Ga0373927_0005223
1457 Ga0373927_0007611
1458 Ga0373927_0111645
1459 Ga0373927_0118997
1460 Ga0373933_0000874
1461 Ga0373933_0001100
1462 Ga0373933_0004649
1463 Ga0373933_0080638
1464 Ga0373947_0022629
1465 Ga0373947_0028230
1466 Ga0373947_0038959
1467 Ga0373937_0000030
1468 Ga0373937_0023092
1469 Ga0373937_0064217
1470 Ga0373937_0131701
1471 Ga0373937_0135738
1472 Ga0373925_0000501
1473 Ga0373925_0017101
1474 Ga0373925_0029160
1475 Ga0373925_0039020
1476 Ga0373925_0065512
1477 Ga0373925_0151271
1478 Ga0395899_0027304
1479 Ga0395899_0030402
1480 Ga0395899_0033115
1481 Ga0395900_0001215
1482 Ga0395900_0032923
1483 Ga0395900_0051359
1484 Ga0395900_0057410
1485 Ga0395898_0001841
1486 Ga0395898_0052786
1487 Ga0395898_0082532
1488 Ga0395898_0094485
1489 Ga0395898_0128830
1490 Ga0395905_0255484
1491 Ga0436364_0327304
1492 Ga0436364_0483132
1493 Ga0436364_0508608
1494 Ga0436364_0585229
1495 Ga0436364_1519102
1496 Ga0395901_0034367
1497 Ga0395901_0040086
1498 Ga0395901_0058280
1499 Ga0395901_0106881
1500 Ga0395901_0186293
1501 Ga0436365_0010333
1502 Ga0436365_1147194
1503 Ga0436365_1224398
1504 Ga0436365_1829993
1505 Ga0436360_0070398
1506 Ga0436360_0132510
1507 Ga0436360_0196017
1508 Ga0436360_1370935
1509 Ga0436361_0865062
1510 Ga0436361_0910383
1511 Ga0436363_1570094
1512 Ga0436362_0258613
1513 Ga0436362_0656211
1514 Ga0439463_008199
1515 Ga0439460_0021337
1516 Ga0451577_0132998
1517 Ga0466963_0056391
1518 Ga0466963_0115435
1519 Ga0466963_0128051
1520 Ga0466957_0023560
1521 Ga0466957_0034957
1522 Ga0466957_0053748
1523 Ga0466960_0174488
1524 Ga0466959_0066537
1525 Ga0451576_0053197
1526 Ga0466958_0011616
1527 Ga0466967_0000135
1528 Ga0466967_0110918
1529 Ga0495592_0000046
1530 Ga0495592_0001601
1531 Ga0495592_0072397
1532 Ga0495603_0000182
1533 Ga0495603_0005564
1534 Ga0495603_0009732
1535 Ga0495603_0047693
1536 Ga0495603_0053963
1537 Ga0495603_0057775
1538 Ga0495629_0000529
1539 Ga0495629_0002383
1540 Ga0495629_0006187
1541 Ga0495641_0008493
1542 Ga0495641_0065127
1543 Ga0495651_0001433
1544 Ga0495651_0006457
1545 Ga0495651_0038602
1546 Ga0495651_0086312
1547 Ga0495653_0000036
1548 Ga0495653_0090070
1549 Ga0495580_0012568
1550 Ga0495580_0013345
1551 Ga0495582_0000597
1552 Ga0495582_0005147
1553 Ga0495582_0015425
1554 Ga0495639_0000235
1555 Ga0495639_0000957
1556 Ga0495662_0004751
1557 Ga0495662_0005695
1558 Ga0495664_0000002
1559 Ga0495664_0054316
1560 Ga0495584_0014375
1561 Ga0495584_0042137
1562 Ga0495585_0003645
1563 Ga0495594_0000302
1564 Ga0495606_0001566
1565 Ga0495606_0005874
1566 Ga0495606_0052129
1567 Ga0495608_0000006
1568 Ga0495608_0008113
1569 Ga0495608_0014581
1570 Ga0495618_0000034
1571 Ga0495618_0182438
1572 Ga0495620_0041544
1573 Ga0495628_0000077
1574 Ga0495628_0007597
1575 Ga0495628_0016559
1576 Ga0495630_0000516
1577 Ga0495630_0049773
1578 Ga0495630_0215309
1579 Ga0495643_0057387
1580 Ga0495644_0020446
1581 Ga0495644_0048833
1582 Ga0495644_0048915
1583 Ga0495666_0015118
1584 Ga0495652_0000824
1585 Ga0495652_0016637
1586 Ga0495652_0018118
1587 Ga0495652_0049061
1588 Ga0495652_0215137
1589 Ga0495665_0001688
1590 Ga0495665_0007725
1591 Ga0495665_0042438
1592 Ga0495640_0000007
1593 Ga0495640_0013882
1594 Ga0495640_0048280
1595 Ga0495640_0070564
1596 Ga0495640_0139043
1597 Ga0495640_0215481
1598 Ga0495587_0001165
1599 Ga0495587_0005654
1600 Ga0495587_0046279
1601 Ga0495587_0052159
1602 Ga0495587_0110691
1603 Ga0495598_0048953
1604 Ga0495609_0078946
1605 Ga0495645_0003118
1606 Ga0495645_0007210
1607 Ga0495645_0040759
1608 Ga0495622_0001112
1609 Ga0495622_0001942
1610 Ga0495633_0000718
1611 Ga0495667_0000129
1612 Ga0495667_0003563
1613 Ga0495667_0009644
1614 Ga0495667_0023948
1615 Ga0495667_0024999
1616 Ga0495656_0000167
1617 Ga0495656_0042204
1618 Ga0495668_0047014
1619 Ga0495668_0075065
1620 Ga0495634_0004321
1621 Ga0495634_0005741
1622 Ga0495634_0058858
1623 Ga0495611_0080629
1624 Ga0495625_0029579
1625 Ga0495625_0286699
1626 Ga0495635_0000021
1627 Ga0495635_0000429
1628 Ga0495635_0002913
1629 Ga0495635_0018820
1630 Ga0495588_0002630
1631 Ga0495588_0074439
1632 Ga0495657_0000521
1633 Ga0495657_0010262
1634 Ga0495657_0021154
1635 Ga0495657_0085887
1636 Ga0495599_0000001
1637 Ga0495599_0177842
1638 Ga0495623_0000237
1639 Ga0495623_0007655
1640 Ga0495623_0208046
1641 Ga0495646_0000007
1642 Ga0495646_0001304
1643 Ga0495646_0005359
1644 Ga0495647_0003732
1645 Ga0495647_0010229
1646 Ga0495658_0001435
1647 Ga0495658_0010855
1648 Ga0495658_0025057
1649 Ga0495669_0007906
1650 Ga0495613_0001510
1651 Ga0495613_0004994
1652 Ga0495613_0169863
1653 Ga0495624_0000810
1654 Ga0495624_0084013
1655 Ga0495670_0000842
1656 Ga0495649_0072338
1657 Ga0495600_0000190
1658 Ga0495600_0007171
1659 Ga0495600_0014546
1660 Ga0495600_0085233
1661 Ga0495581_0001119
1662 Ga0495581_0086397
1663 Ga0495604_0005361
1664 Ga0495604_0010023
1665 Ga0495604_0018683
1666 Ga0495674_0000014
1667 Ga0495674_0004558
1668 Ga0495674_0082394
1669 Ga0495672_0003454
1670 Ga0495672_0008480
1671 Ga0495676_0019892
1672 Ga0495676_0026009
1673 Ga0495676_0074858
1674 Ga0495676_0081095
1675 Ga0495680_0004506
1676 Ga0495680_0006513
1677 Ga0495680_0006824
1678 Ga0495680_0040769
1679 Ga0495675_0001883
1680 Ga0495679_020418
1681 Ga0495685_039295
1682 Ga0495684_0000390
1683 Ga0495684_0000497
1684 Ga0495684_0010904
1685 Ga0495686_0000594
1686 Ga0495686_0012069
1687 Ga0495593_0000370
1688 Ga0495593_0014868
1689 Ga0495593_0023490
1690 Ga0495602_0000211
1691 Ga0495602_0106400
1692 Ga0495614_0006439
1693 Ga0495614_0009598
1694 Ga0495626_0045337
1695 Ga0496100_0085353
1696 Ga0496101_0002598
1697 Ga0496101_0052904
1698 Ga0496101_0066250
1699 Ga0496101_0076120
1700 Ga0496102_0005580
1701 Ga0496102_0010961
1702 Ga0496102_0080609
1703 Ga0496102_0081296
1704 Ga0496103_0003333
1705 Ga0496103_0016121
1706 Ga0496103_0068711
1707 Ga0496104_0000351
1708 Ga0496104_0001036
1709 Ga0496104_0002273
1710 Ga0496104_0014542
1711 Ga0496104_0027519
1712 Ga0496104_0036781
1713 Ga0496104_0064476
1714 Ga0496104_0141127
1715 Ga0496105_0001783
1716 Ga0496105_0006479
1717 Ga0496105_0017163
1718 Ga0496106_0000788
1719 Ga0496106_0010763
1720 Ga0496106_0028407
1721 Ga0496106_0088273
1722 Ga0496107_0003552
1723 Ga0496107_0004819
1724 Ga0496107_0013855
1725 Ga0496107_0065572
1726 Ga0496107_0180590
1727 Ga0496108_0008220
1728 Ga0496108_0017871
1729 Ga0496109_0004783
1730 Ga0496109_0016169
1731 Ga0496109_0043085
1732 Ga0496110_0024050
1733 Ga0496110_0094582
1734 Ga0496111_0002946
1735 Ga0496111_0020031
1736 Ga0496111_0020392
1737 Ga0496112_0000018
1738 Ga0496112_0030393
1739 Ga0496112_0035815
1740 Ga0496112_0053613
1741 Ga0496112_0190737
1742 Ga0496113_0001245
1743 Ga0496113_0187818
1744 Ga0496113_0277766
1745 Ga0496114_0094050
1746 Ga0496114_0182303
1747 Ga0496115_0004857
1748 Ga0496115_0008114
1749 Ga0496115_0019196
1750 Ga0496115_0050174
1751 Ga0496115_0196668
1752 Ga0496115_0210671
1753 Ga0496117_0007128
1754 Ga0496118_0003592
1755 Ga0496119_0016379
1756 Ga0496121_0000640
1757 Ga0496121_0002920
1758 Ga0496121_0046507
1759 Ga0496121_0080257
1760 Ga0496124_0000275
1761 Ga0496124_0002189
1762 Ga0496125_0085843
1763 Ga0496125_0108506
1764 Ga0496126_0016879
1765 Ga0496126_0018354
1766 Ga0496126_0043259
1767 Ga0496126_0251070
1768 Ga0496126_0254995
1769 Ga0501032_0024651
1770 Ga0501033_0028780
1771 Ga0501033_0148490
1772 Ga0501034_0001022
1773 Ga0501034_0014334
1774 Ga0501034_0038754
1775 Ga0501034_0178387
1776 Ga0501034_0222791
1777 Ga0501036_0027252
1778 Ga0501036_0354028
1779 Ga0501037_0009609
1780 Ga0501038_0019762
1781 Ga0501039_0242262
1782 Ga0501040_0055239
1783 Ga0501040_0097232
1784 Ga0501042_0279456
1785 Ga0501043_0025912
1786 Ga0501043_0047588
1787 Ga0501046_0020459
1788 Ga0501046_0054282
1789 Ga0501046_0154294
1790 Ga0501047_0006577
1791 Ga0501047_0030016
1792 Ga0501047_0045077
1793 Ga0501047_0147341
1794 Ga0501047_0404951
1795 Ga0501048_0020654
1796 Ga0501067_0073025
1797 Ga0501068_0004420
1798 Ga0501068_0009601
1799 Ga0501069_0048333
1800 Ga0501069_0217426
1801 Ga0501069_0234239
1802 Ga0501070_0000159
1803 Ga0501070_0040110
1804 Ga0501070_0065903
1805 Ga0501070_0110989
1806 Ga0501071_0002327
1807 Ga0501071_0156297
1808 Ga0501072_0003943
1809 Ga0501073_0014744
1810 Ga0501074_0037719
1811 Ga0501074_0070751
1812 Ga0501075_0099533
1813 Ga0501075_0191271
1814 Ga0501076_0014001
1815 Ga0501077_0043126
1816 Ga0501077_0045111
1817 Ga0501077_0068057
1818 Ga0501079_0018470
1819 Ga0501079_0043467
1820 Ga0501080_0018607
1821 Ga0501080_0028752
1822 Ga0501080_0048274
1823 Ga0501081_0014089
1824 Ga0501081_0249094
1825 Ga0501083_0054348
1826 Ga0501083_0092870
1827 Ga0501035_0014245
1828 Ga0501035_0028749
1829 Ga0501044_0015230
1830 Ga0501044_0017958
1831 Ga0501044_0019088
1832 Ga0501044_0262568
1833 Ga0501045_0029797
1834 nmdc:mga03n38_36667_c1
1835 nmdc:mga00v17_29480_c1
1836 nmdc:mga0yw44_192698_c1
1837 nmdc:mga0yw44_237105_c1
1838 nmdc:mga0yw44_9722_c1
1839 nmdc:mga0k408_137154_c1
1840 nmdc:mga0k408_2759_c1
1841 nmdc:mga06z11_35422_c1
1842 nmdc:mga06z11_46344_c1
1843 nmdc:mga04h51_12622_c1
1844 nmdc:mga04h51_31966_c1
1845 nmdc:mga04h51_5275_c1
1846 nmdc:mga07m45_63918_c1
1847 nmdc:mga05p37_10233_c1
1848 nmdc:mga05p37_14407_c1
1849 nmdc:mga05p37_35871_c1
1850 nmdc:mga05p37_613903_c1
1851 nmdc:mga05p37_8147_c1
1852 nmdc:mga09592_9750_c1
1853 nmdc:mga0qj67_106070_c1
1854 nmdc:mga0qj67_125999_c1
1855 nmdc:mga0qj67_215_c1
1856 nmdc:mga0qj67_4314_c1
1857 nmdc:mga06r32_12515_c1
1858 nmdc:mga06r32_298941_c1
1859 nmdc:mga06r32_316_c1
1860 nmdc:mga06r32_4487_c1
1861 nmdc:mga06r32_6439_c1
1862 nmdc:mga08y16_112174_c1
1863 nmdc:mga08y16_145004_c1
1864 nmdc:mga08y16_181255_c1
1865 nmdc:mga08y16_275602_c1
1866 nmdc:mga08y16_285812_c1
1867 nmdc:mga08y16_35913_c1
1868 nmdc:mga08y16_39014_c1
1869 nmdc:mga08y16_90_c1
1870 nmdc:mga0n895_107074_c1
1871 nmdc:mga0n895_132917_c1
1872 nmdc:mga0n895_289991_c1
1873 nmdc:mga0n895_416731_c1
1874 nmdc:mga0n895_48615_c1
1875 nmdc:mga0rr50_19557_c1
1876 nmdc:mga08x19_106181_c1
1877 nmdc:mga08x19_4_c2
1878 nmdc:mga0a205_100278_c1
1879 nmdc:mga0a205_234517_c1
1880 nmdc:mga0sz30_11159_c1
1881 Ga0495601_0000008
1882 Ga0495601_0007499
1883 Ga0495601_0018585
1884 Ga0495612_0000844
1885 Ga0495612_0000950
1886 Ga0495612_0071997
1887 Ga0500635_0005887
1888 Ga0495655_0014821
1889 Ga0495595_0000155
1890 Ga0495595_0001465
1891 Ga0495595_0002145
1892 Ga0495619_0000033
1893 Ga0495619_0006338
1894 Ga0495619_0014717
1895 Ga0495619_0033588
1896 Ga0500578_0102638
1897 Ga0500583_0193073
1898 Ga0500651_0056821
1899 Ga0500566_0001625
1900 Ga0500566_0124910
1901 Ga0500641_0029827
1902 Ga0500554_000124
1903 Ga0500592_004822
1904 Ga0500595_000095
1905 Ga0500595_002960
1906 Ga0500595_039754
1907 Ga0500568_0005538
1908 Ga0500590_002067
1909 Ga0500603_000738
1910 Ga0500620_055445
1911 Ga0500627_0001582
1912 Ga0500627_0111877
1913 Ga0500638_006677
1914 Ga0500636_0002059
1915 Ga0500636_0008900
1916 Ga0500637_0000495
1917 Ga0500637_0001452
1918 Ga0500609_011430
1919 Ga0501084_0023932
1920 Ga0501084_0063910
1921 Ga0501084_0071273
1922 Ga0501084_0071724
1923 Ga0501084_0223415
1924 Ga0501082_0000013
1925 Ga0501082_0010354
1926 Ga0501082_0255475
1927 Ga0530510_0150122
1928 Ga0530510_0168441
1929 2509152562
1930 2513698863
1931 2774868664
1932 2792745559
1933 2793079172
1934 2855734447
1935 2855770037
1936 2874610507
1937 2876818202
1938 2879115150
1939 2881414278
1940 2889035188
1941 2922363284
1942 8006969408
1943 8006988456
1944 8056678590

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

192

0.95

PF08402

TOBE_2

TOBE domain

302

378

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oud-assembly1.cif.gz_AAA crystal structure of a ternary complex of the flavoprotein monooxygenase grho5 with fad and collinone 0.9554 299 328
5g3s-assembly1.cif.gz_A the structure of the l-tryptophan oxidase vioa from chromobacterium violaceum - samarium derivative 0.9376 299 328
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9359 4 237
5zbd-assembly1.cif.gz_B crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum 0.9305 299 328
6esd-assembly1.cif.gz_B crystal structure of l-tryptophan oxidase vioa from chromobacterium violaceum 0.9283 299 328
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9729 2 220 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 2 220 3.40.50.300
2awnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 2 220 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9576 1 221 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 1 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9689 4 163 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.966 49 195 GO:0005524
GO:0016887
GO:0055052
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9644 4 190 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-U3BNP7-F1-model_v4 Putative ABC transporter ATP-binding protein 0.9644 81 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A4Q3TF12-F1-model_v4 ABC transporter ATP-binding protein 0.9587 1 159 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060

Map