F487167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 439 | 1944 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0009673|Ga0500616_0009673_177_1319 |
| Length | 380 |
| Sequence | LLTIRFLPVGSGPESAEDVLGWEARFLSFLQLARLTKRYGDATVVDHIDLDIPKGNLVCLLGPSGCGKTTTLRLIAGFVEPNEGEIRVGGRVISSAGHSEPPERRRMSMIFQSYALWPHMTVRENIAYGLTLRKMGRAEIGQLVDRILGVTRLEPYADRYPAELSGGQQQRVSLARALVVEPETLLLDEPLSNLDANLREEMRFEIRRLHDRYRYTTVYVTHDQAEAMTTADQIVVMNQGIIEQAGSPEDIYERPQSEFVARFIGGTNIFKGKRLGADTLDCGPMTLRCGNGQLPAGDSGSVSVRHHHIRLAQESGSEGTVNAAPGTVVRQVYLGSHRDYLVELQNGETVRTVAPAKVAIEKGQPVWLHFPVEHCRALAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 410 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 420 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 424 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 425 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 426 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 427 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 428 | 2791355199 | |||
| 429 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 430 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 431 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 432 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 433 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 434 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 435 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 436 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 437 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 438 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 439 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 0.1 |
| Isolates | 1.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7 |
| Nodule | 0.93 |
| Rhizoplane | 5.97 |
| Rhizosphere | 81.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500616_0009673 | 3300053153 | Bacteria | 5837 |
| 2 | JGI24744J21845_10000923 | 3300002077 | Bacteria | 5568 |
| 3 | JGI24033J26618_1003474 | 3300002155 | Bacteria | 1664 |
| 4 | JGI25406J46586_10000028 | 3300003203 | Bacteria | 70247 |
| 5 | JGI25160J50197_1000095 | 3300003354 | Bacteria | 88326 |
| 6 | JGI25161J50226_1000071 | 3300003374 | Bacteria | 88326 |
| 7 | JGI25404J52841_10004986 | 3300003659 | Bacteria | 2726 |
| 8 | Ga0055543_1000206 | 3300004625 | Bacteria | 47744 |
| 9 | Ga0065165_1000408 | 3300005262 | Bacteria | 68789 |
| 10 | Ga0070658_10010675 | 3300005327 | Bacteria | 7358 |
| 11 | Ga0070676_10129731 | 3300005328 | Bacteria | 1593 |
| 12 | Ga0070683_100027066 | 3300005329 | Bacteria | 5169 |
| 13 | Ga0070690_100010109 | 3300005330 | Bacteria | 5481 |
| 14 | Ga0070670_100036282 | 3300005331 | Bacteria | 4242 |
| 15 | Ga0070670_100046453 | 3300005331 | Bacteria | 3734 |
| 16 | Ga0068869_100042587 | 3300005334 | Bacteria | 3256 |
| 17 | Ga0070666_10033182 | 3300005335 | Bacteria | 3415 |
| 18 | Ga0070680_100003476 | 3300005336 | Bacteria | 11759 |
| 19 | Ga0070680_100007187 | 3300005336 | Bacteria | 8485 |
| 20 | Ga0070680_100013175 | 3300005336 | Bacteria | 6437 |
| 21 | Ga0070680_100046954 | 3300005336 | Bacteria | 3515 |
| 22 | Ga0068868_100028246 | 3300005338 | Bacteria | 4287 |
| 23 | Ga0070660_100025143 | 3300005339 | Bacteria | 4424 |
| 24 | Ga0070689_100081818 | 3300005340 | Bacteria | 2535 |
| 25 | Ga0070691_10001323 | 3300005341 | Bacteria | 10537 |
| 26 | Ga0070661_100034257 | 3300005344 | Bacteria | 3683 |
| 27 | Ga0070661_100149989 | 3300005344 | Bacteria | 1762 |
| 28 | Ga0070692_10061899 | 3300005345 | Bacteria | 1974 |
| 29 | Ga0070668_100094992 | 3300005347 | Bacteria | 2354 |
| 30 | Ga0070669_100004982 | 3300005353 | Bacteria | 9597 |
| 31 | Ga0070669_100017838 | 3300005353 | Bacteria | 5067 |
| 32 | Ga0070669_100128050 | 3300005353 | Bacteria | 1945 |
| 33 | Ga0070673_100014774 | 3300005364 | Bacteria | 5457 |
| 34 | Ga0070688_100019330 | 3300005365 | Bacteria | 3944 |
| 35 | Ga0070688_100198625 | 3300005365 | Bacteria | 1402 |
| 36 | Ga0070659_100109588 | 3300005366 | Bacteria | 2228 |
| 37 | Ga0070659_100205342 | 3300005366 | Bacteria | 1623 |
| 38 | Ga0070667_100023872 | 3300005367 | Bacteria | 5078 |
| 39 | Ga0070703_10001774 | 3300005406 | Bacteria | 6394 |
| 40 | Ga0070709_10009430 | 3300005434 | Bacteria | 5386 |
| 41 | Ga0070709_10044828 | 3300005434 | Bacteria | 2741 |
| 42 | Ga0070709_10146986 | 3300005434 | Bacteria | 1625 |
| 43 | Ga0070714_100003399 | 3300005435 | Bacteria | 11860 |
| 44 | Ga0070714_100199988 | 3300005435 | Bacteria | 1827 |
| 45 | Ga0070713_100003592 | 3300005436 | Bacteria | 10250 |
| 46 | Ga0070713_100327192 | 3300005436 | Bacteria | 1417 |
| 47 | Ga0070710_10001178 | 3300005437 | Bacteria | 12346 |
| 48 | Ga0070710_10048329 | 3300005437 | Bacteria | 2376 |
| 49 | Ga0070710_10066017 | 3300005437 | Bacteria | 2074 |
| 50 | Ga0070701_10018203 | 3300005438 | Bacteria | 3298 |
| 51 | Ga0070701_10038414 | 3300005438 | Bacteria | 2423 |
| 52 | Ga0070711_100016060 | 3300005439 | Bacteria | 4747 |
| 53 | Ga0070711_100035255 | 3300005439 | Bacteria | 3344 |
| 54 | Ga0070711_100203604 | 3300005439 | Bacteria | 1529 |
| 55 | Ga0070705_100002136 | 3300005440 | Bacteria | 10059 |
| 56 | Ga0070700_100038308 | 3300005441 | Bacteria | 2921 |
| 57 | Ga0070700_100063440 | 3300005441 | Bacteria | 2337 |
| 58 | Ga0070700_100089522 | 3300005441 | Bacteria | 2005 |
| 59 | Ga0070708_100005485 | 3300005445 | Bacteria | 10057 |
| 60 | Ga0070663_100008923 | 3300005455 | Bacteria | 6193 |
| 61 | Ga0070663_100112035 | 3300005455 | Bacteria | 2051 |
| 62 | Ga0070663_100136782 | 3300005455 | Bacteria | 1866 |
| 63 | Ga0070678_100019792 | 3300005456 | Bacteria | 4399 |
| 64 | Ga0070678_100100375 | 3300005456 | Bacteria | 2242 |
| 65 | Ga0070662_100023188 | 3300005457 | Bacteria | 4261 |
| 66 | Ga0070681_10003470 | 3300005458 | Bacteria | 14772 |
| 67 | Ga0070681_10004105 | 3300005458 | Bacteria | 13761 |
| 68 | Ga0070681_10015832 | 3300005458 | Bacteria | 7517 |
| 69 | Ga0070681_10087004 | 3300005458 | Bacteria | 3078 |
| 70 | Ga0070681_10159856 | 3300005458 | Bacteria | 2176 |
| 71 | Ga0070681_10253655 | 3300005458 | Bacteria | 1671 |
| 72 | Ga0068867_100061438 | 3300005459 | Bacteria | 2789 |
| 73 | Ga0068867_100214551 | 3300005459 | Bacteria | 1548 |
| 74 | Ga0070685_10013498 | 3300005466 | Bacteria | 4309 |
| 75 | Ga0070706_100000058 | 3300005467 | Bacteria | 133347 |
| 76 | Ga0070706_100146353 | 3300005467 | Bacteria | 2206 |
| 77 | Ga0070706_100188269 | 3300005467 | Bacteria | 1929 |
| 78 | Ga0070698_100000825 | 3300005471 | Bacteria | 33892 |
| 79 | Ga0070699_100005255 | 3300005518 | Bacteria | 11370 |
| 80 | Ga0070699_100152170 | 3300005518 | Bacteria | 2047 |
| 81 | Ga0070679_100036294 | 3300005530 | Bacteria | 4892 |
| 82 | Ga0070679_100105809 | 3300005530 | Bacteria | 2799 |
| 83 | Ga0070679_100123488 | 3300005530 | Bacteria | 2572 |
| 84 | Ga0070679_100160671 | 3300005530 | Bacteria | 2221 |
| 85 | Ga0070679_100294384 | 3300005530 | Bacteria | 1574 |
| 86 | Ga0070684_100047842 | 3300005535 | Bacteria | 3708 |
| 87 | Ga0070684_100170035 | 3300005535 | Bacteria | 1979 |
| 88 | Ga0070697_100002460 | 3300005536 | Bacteria | 14255 |
| 89 | Ga0070697_100002564 | 3300005536 | Bacteria | 13978 |
| 90 | Ga0070697_100006247 | 3300005536 | Bacteria | 9223 |
| 91 | Ga0070697_100007169 | 3300005536 | Bacteria | 8673 |
| 92 | Ga0070697_100007965 | 3300005536 | Bacteria | 8260 |
| 93 | Ga0070697_100016894 | 3300005536 | Bacteria | 5737 |
| 94 | Ga0068853_100015257 | 3300005539 | Bacteria | 6315 |
| 95 | Ga0068853_100026126 | 3300005539 | Bacteria | 4902 |
| 96 | Ga0068853_100069092 | 3300005539 | Bacteria | 3072 |
| 97 | Ga0070672_100064032 | 3300005543 | Bacteria | 2904 |
| 98 | Ga0070672_100165275 | 3300005543 | Bacteria | 1838 |
| 99 | Ga0070695_100005766 | 3300005545 | Bacteria | 7295 |
| 100 | Ga0070696_100000887 | 3300005546 | Bacteria | 19396 |
| 101 | Ga0070696_100004630 | 3300005546 | Bacteria | 9185 |
| 102 | Ga0070696_100063608 | 3300005546 | Bacteria | 2584 |
| 103 | Ga0070693_100045863 | 3300005547 | Bacteria | 2480 |
| 104 | Ga0070693_100099541 | 3300005547 | Bacteria | 1768 |
| 105 | Ga0070665_100130569 | 3300005548 | Bacteria | 2514 |
| 106 | Ga0070665_100192702 | 3300005548 | Bacteria | 2039 |
| 107 | Ga0070704_100014059 | 3300005549 | Bacteria | 4989 |
| 108 | Ga0070704_100183329 | 3300005549 | Bacteria | 1676 |
| 109 | Ga0068855_100008088 | 3300005563 | Bacteria | 12708 |
| 110 | Ga0068855_100125606 | 3300005563 | Bacteria | 2934 |
| 111 | Ga0068855_100174599 | 3300005563 | Bacteria | 2432 |
| 112 | Ga0068855_100194279 | 3300005563 | Bacteria | 2287 |
| 113 | Ga0070664_100071163 | 3300005564 | Bacteria | 2980 |
| 114 | Ga0068857_100003412 | 3300005577 | Bacteria | 13243 |
| 115 | Ga0068857_100138473 | 3300005577 | Bacteria | 2199 |
| 116 | Ga0068856_100049808 | 3300005614 | Bacteria | 4129 |
| 117 | Ga0068856_100094060 | 3300005614 | Bacteria | 2984 |
| 118 | Ga0068852_100010751 | 3300005616 | Bacteria | 6855 |
| 119 | Ga0068852_100011681 | 3300005616 | Bacteria | 6623 |
| 120 | Ga0068852_100025909 | 3300005616 | Bacteria | 4759 |
| 121 | Ga0068852_100071010 | 3300005616 | Bacteria | 3056 |
| 122 | Ga0068852_100096988 | 3300005616 | Bacteria | 2651 |
| 123 | Ga0068859_100013735 | 3300005617 | Bacteria | 8119 |
| 124 | Ga0068859_100019924 | 3300005617 | Bacteria | 6734 |
| 125 | Ga0068859_100090535 | 3300005617 | Bacteria | 3110 |
| 126 | Ga0068864_100033297 | 3300005618 | Bacteria | 4381 |
| 127 | Ga0068864_100360597 | 3300005618 | Bacteria | 1373 |
| 128 | Ga0068861_100040369 | 3300005719 | Bacteria | 3490 |
| 129 | Ga0068861_100065319 | 3300005719 | Bacteria | 2802 |
| 130 | Ga0068851_10021478 | 3300005834 | Bacteria | 3135 |
| 131 | Ga0068870_10003649 | 3300005840 | Bacteria | 6536 |
| 132 | Ga0068863_100017877 | 3300005841 | Bacteria | 6785 |
| 133 | Ga0068858_100064336 | 3300005842 | Bacteria | 3394 |
| 134 | Ga0068860_100000577 | 3300005843 | Bacteria | 44036 |
| 135 | Ga0068860_100018913 | 3300005843 | Bacteria | 6694 |
| 136 | Ga0068860_100092343 | 3300005843 | Bacteria | 2884 |
| 137 | Ga0068862_100148148 | 3300005844 | Bacteria | 2087 |
| 138 | Ga0068862_100326621 | 3300005844 | Bacteria | 1417 |
| 139 | Ga0081455_10000226 | 3300005937 | Bacteria | 72690 |
| 140 | Ga0081455_10011459 | 3300005937 | Bacteria | 8907 |
| 141 | Ga0081455_10012534 | 3300005937 | Bacteria | 8458 |
| 142 | Ga0081455_10025643 | 3300005937 | Bacteria | 5437 |
| 143 | Ga0081455_10035259 | 3300005937 | Bacteria | 4474 |
| 144 | Ga0081538_10001703 | 3300005981 | Bacteria | 22414 |
| 145 | Ga0081540_1003162 | 3300005983 | Bacteria | 13139 |
| 146 | Ga0081540_1003755 | 3300005983 | Bacteria | 11903 |
| 147 | Ga0081540_1009897 | 3300005983 | Bacteria | 6508 |
| 148 | Ga0081540_1011694 | 3300005983 | Bacteria | 5844 |
| 149 | Ga0081540_1017229 | 3300005983 | Bacteria | 4479 |
| 150 | Ga0081540_1026005 | 3300005983 | Bacteria | 3352 |
| 151 | Ga0081540_1037654 | 3300005983 | Bacteria | 2560 |
| 152 | Ga0081540_1042934 | 3300005983 | Bacteria | 2326 |
| 153 | Ga0081540_1059105 | 3300005983 | Bacteria | 1842 |
| 154 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 155 | Ga0081539_10000576 | 3300005985 | Bacteria | 75490 |
| 156 | Ga0081539_10036771 | 3300005985 | Bacteria | 2925 |
| 157 | Ga0081539_10071654 | 3300005985 | Bacteria | 1855 |
| 158 | Ga0070717_10000634 | 3300006028 | Bacteria | 22593 |
| 159 | Ga0070717_10051186 | 3300006028 | Bacteria | 3398 |
| 160 | Ga0070717_10059267 | 3300006028 | Bacteria | 3167 |
| 161 | Ga0070717_10146806 | 3300006028 | Bacteria | 2038 |
| 162 | Ga0075365_10088316 | 3300006038 | Bacteria | 2109 |
| 163 | Ga0075365_10102464 | 3300006038 | Bacteria | 1961 |
| 164 | Ga0075368_10001658 | 3300006042 | Bacteria | 7147 |
| 165 | Ga0075368_10088642 | 3300006042 | Bacteria | 1264 |
| 166 | Ga0075363_100035403 | 3300006048 | Bacteria | 2612 |
| 167 | Ga0075363_100052241 | 3300006048 | Bacteria | 2181 |
| 168 | Ga0075364_10061523 | 3300006051 | Bacteria | 2463 |
| 169 | Ga0075364_10071135 | 3300006051 | Bacteria | 2291 |
| 170 | Ga0075364_10132838 | 3300006051 | Bacteria | 1671 |
| 171 | Ga0075364_10145892 | 3300006051 | Bacteria | 1593 |
| 172 | Ga0075432_10051536 | 3300006058 | Bacteria | 1453 |
| 173 | Ga0070715_10029300 | 3300006163 | Bacteria | 2216 |
| 174 | Ga0070715_10055329 | 3300006163 | Bacteria | 1722 |
| 175 | Ga0070716_100004081 | 3300006173 | Bacteria | 6925 |
| 176 | Ga0070716_100060169 | 3300006173 | Bacteria | 2193 |
| 177 | Ga0070712_100015951 | 3300006175 | Bacteria | 4845 |
| 178 | Ga0070712_100022594 | 3300006175 | Bacteria | 4145 |
| 179 | Ga0070712_100346614 | 3300006175 | Bacteria | 1214 |
| 180 | Ga0075367_10001614 | 3300006178 | Bacteria | 9787 |
| 181 | Ga0075369_10028353 | 3300006186 | Bacteria | 2346 |
| 182 | Ga0075369_10045625 | 3300006186 | Bacteria | 1885 |
| 183 | Ga0075366_10002111 | 3300006195 | Bacteria | 10115 |
| 184 | Ga0075366_10143949 | 3300006195 | Bacteria | 1442 |
| 185 | Ga0097621_100020528 | 3300006237 | Bacteria | 5090 |
| 186 | Ga0097621_100034122 | 3300006237 | Bacteria | 4057 |
| 187 | Ga0075370_10033632 | 3300006353 | Bacteria | 2871 |
| 188 | Ga0068871_100074458 | 3300006358 | Bacteria | 2801 |
| 189 | Ga0075428_100005533 | 3300006844 | Bacteria | 14053 |
| 190 | Ga0075428_100011315 | 3300006844 | Bacteria | 9928 |
| 191 | Ga0075428_100206695 | 3300006844 | Bacteria | 2122 |
| 192 | Ga0075428_100210506 | 3300006844 | Bacteria | 2101 |
| 193 | Ga0075428_100383918 | 3300006844 | Bacteria | 1506 |
| 194 | Ga0075430_100000222 | 3300006846 | Bacteria | 39248 |
| 195 | Ga0075430_100012924 | 3300006846 | Bacteria | 7115 |
| 196 | Ga0075430_100031383 | 3300006846 | Bacteria | 4508 |
| 197 | Ga0075430_100139010 | 3300006846 | Bacteria | 2023 |
| 198 | Ga0075430_100248002 | 3300006846 | Bacteria | 1475 |
| 199 | Ga0075431_100001099 | 3300006847 | Bacteria | 24234 |
| 200 | Ga0075431_100015511 | 3300006847 | Bacteria | 7721 |
| 201 | Ga0075433_10031299 | 3300006852 | Bacteria | 4548 |
| 202 | Ga0075434_100240347 | 3300006871 | Bacteria | 1831 |
| 203 | Ga0075429_100024988 | 3300006880 | Bacteria | 5187 |
| 204 | Ga0068865_100018423 | 3300006881 | Bacteria | 4504 |
| 205 | Ga0075436_100004698 | 3300006914 | Bacteria | 9369 |
| 206 | Ga0097620_100013735 | 3300006931 | Bacteria | 8119 |
| 207 | Ga0097620_100019924 | 3300006931 | Bacteria | 6734 |
| 208 | Ga0097620_100090527 | 3300006931 | Bacteria | 3110 |
| 209 | Ga0075435_100116205 | 3300007076 | Bacteria | 2228 |
| 210 | Ga0105244_10028351 | 3300009036 | Bacteria | 3005 |
| 211 | Ga0105250_10037420 | 3300009092 | Bacteria | 1947 |
| 212 | Ga0105240_10008969 | 3300009093 | Bacteria | 14218 |
| 213 | Ga0105240_10030708 | 3300009093 | Bacteria | 6979 |
| 214 | Ga0105240_10070434 | 3300009093 | Bacteria | 4326 |
| 215 | Ga0105240_10121613 | 3300009093 | Bacteria | 3143 |
| 216 | Ga0111539_10002503 | 3300009094 | Bacteria | 24346 |
| 217 | Ga0111539_10032995 | 3300009094 | Bacteria | 6286 |
| 218 | Ga0111539_10064813 | 3300009094 | Bacteria | 4321 |
| 219 | Ga0111539_10143122 | 3300009094 | Bacteria | 2799 |
| 220 | Ga0105247_10007788 | 3300009101 | Bacteria | 6552 |
| 221 | Ga0105247_10224458 | 3300009101 | Bacteria | 1273 |
| 222 | Ga0114129_10003943 | 3300009147 | Bacteria | 20965 |
| 223 | Ga0114129_10014705 | 3300009147 | Bacteria | 11149 |
| 224 | Ga0114129_10017278 | 3300009147 | Bacteria | 10275 |
| 225 | Ga0114129_10023078 | 3300009147 | Bacteria | 8826 |
| 226 | Ga0114129_10097181 | 3300009147 | Bacteria | 4077 |
| 227 | Ga0105243_10008030 | 3300009148 | Bacteria | 8102 |
| 228 | Ga0105243_10102502 | 3300009148 | Bacteria | 2378 |
| 229 | Ga0105241_10108329 | 3300009174 | Bacteria | 2221 |
| 230 | Ga0105242_10021859 | 3300009176 | Bacteria | 5027 |
| 231 | Ga0105248_10033223 | 3300009177 | Bacteria | 5762 |
| 232 | Ga0105248_10037197 | 3300009177 | Bacteria | 5445 |
| 233 | Ga0105248_10136859 | 3300009177 | Bacteria | 2763 |
| 234 | Ga0105237_10137192 | 3300009545 | Bacteria | 2440 |
| 235 | Ga0105237_10183269 | 3300009545 | Bacteria | 2094 |
| 236 | Ga0105238_10034676 | 3300009551 | Bacteria | 5134 |
| 237 | Ga0105238_10087987 | 3300009551 | Bacteria | 3093 |
| 238 | Ga0105238_10105822 | 3300009551 | Bacteria | 2795 |
| 239 | Ga0105249_10033545 | 3300009553 | Bacteria | 4648 |
| 240 | Ga0105249_10378644 | 3300009553 | Bacteria | 1441 |
| 241 | Ga0099796_10049914 | 3300010159 | Bacteria | 1448 |
| 242 | Ga0105239_10017528 | 3300010375 | Bacteria | 7921 |
| 243 | Ga0105239_10047388 | 3300010375 | Bacteria | 4710 |
| 244 | Ga0105239_10112338 | 3300010375 | Bacteria | 3021 |
| 245 | Ga0105239_10136977 | 3300010375 | Bacteria | 2726 |
| 246 | Ga0157370_10085558 | 3300013104 | Bacteria | 2962 |
| 247 | Ga0157370_10233664 | 3300013104 | Bacteria | 1701 |
| 248 | Ga0157369_10211574 | 3300013105 | Bacteria | 2032 |
| 249 | Ga0157374_10010302 | 3300013296 | Bacteria | 8039 |
| 250 | Ga0157374_10054750 | 3300013296 | Bacteria | 3722 |
| 251 | Ga0157374_10198980 | 3300013296 | Bacteria | 1962 |
| 252 | Ga0163162_10076230 | 3300013306 | Bacteria | 3415 |
| 253 | Ga0163162_10105667 | 3300013306 | Bacteria | 2910 |
| 254 | Ga0157372_10319259 | 3300013307 | Bacteria | 1808 |
| 255 | Ga0157375_10217358 | 3300013308 | Bacteria | 2069 |
| 256 | Ga0157375_10228532 | 3300013308 | Bacteria | 2019 |
| 257 | Ga0163163_10016636 | 3300014325 | Bacteria | 6838 |
| 258 | Ga0163163_10045809 | 3300014325 | Bacteria | 4295 |
| 259 | Ga0157380_10072897 | 3300014326 | Bacteria | 2783 |
| 260 | Ga0157380_10242407 | 3300014326 | Bacteria | 1626 |
| 261 | Ga0157379_10019972 | 3300014968 | Bacteria | 5920 |
| 262 | Ga0157376_10176005 | 3300014969 | Bacteria | 1952 |
| 263 | Ga0157376_10179408 | 3300014969 | Bacteria | 1934 |
| 264 | Ga0163161_10008859 | 3300017792 | Bacteria | 6957 |
| 265 | Ga0163161_10065481 | 3300017792 | Bacteria | 2652 |
| 266 | Ga0206353_10589863 | 3300020082 | Bacteria | 1927 |
| 267 | Ga0213873_10011822 | 3300021358 | Bacteria | 1879 |
| 268 | Ga0213876_10002856 | 3300021384 | Bacteria | 10039 |
| 269 | Ga0213875_10000556 | 3300021388 | Bacteria | 30532 |
| 270 | Ga0213875_10001253 | 3300021388 | Bacteria | 17124 |
| 271 | Ga0213875_10026948 | 3300021388 | Bacteria | 2734 |
| 272 | Ga0209130_1000180 | 3300025284 | Bacteria | 89520 |
| 273 | Ga0209130_1000318 | 3300025284 | Bacteria | 56545 |
| 274 | Ga0209758_1008580 | 3300025297 | Bacteria | 6576 |
| 275 | Ga0209758_1045312 | 3300025297 | Bacteria | 1598 |
| 276 | Ga0207426_1000017 | 3300025302 | Bacteria | 577913 |
| 277 | Ga0207426_1000512 | 3300025302 | Bacteria | 56516 |
| 278 | Ga0207426_1011406 | 3300025302 | Bacteria | 3387 |
| 279 | Ga0207697_10016118 | 3300025315 | Bacteria | 3082 |
| 280 | Ga0207697_10074176 | 3300025315 | Bacteria | 1429 |
| 281 | Ga0207656_10014562 | 3300025321 | Bacteria | 3033 |
| 282 | Ga0207653_10000916 | 3300025885 | Bacteria | 9775 |
| 283 | Ga0207692_10001575 | 3300025898 | Bacteria | 8582 |
| 284 | Ga0207692_10003295 | 3300025898 | Bacteria | 6293 |
| 285 | Ga0207692_10003780 | 3300025898 | Bacteria | 5946 |
| 286 | Ga0207642_10034708 | 3300025899 | Bacteria | 2148 |
| 287 | Ga0207710_10031969 | 3300025900 | Bacteria | 2304 |
| 288 | Ga0207710_10042622 | 3300025900 | Bacteria | 2016 |
| 289 | Ga0207688_10000135 | 3300025901 | Bacteria | 31221 |
| 290 | Ga0207688_10156493 | 3300025901 | Bacteria | 1349 |
| 291 | Ga0207685_10000528 | 3300025905 | Bacteria | 6575 |
| 292 | Ga0207685_10003382 | 3300025905 | Bacteria | 3871 |
| 293 | Ga0207685_10059682 | 3300025905 | Bacteria | 1505 |
| 294 | Ga0207699_10000525 | 3300025906 | Bacteria | 18974 |
| 295 | Ga0207699_10006599 | 3300025906 | Bacteria | 5632 |
| 296 | Ga0207699_10010546 | 3300025906 | Bacteria | 4642 |
| 297 | Ga0207699_10057527 | 3300025906 | Bacteria | 2322 |
| 298 | Ga0207699_10197176 | 3300025906 | Bacteria | 1362 |
| 299 | Ga0207645_10032939 | 3300025907 | Bacteria | 3331 |
| 300 | Ga0207643_10002474 | 3300025908 | Bacteria | 9978 |
| 301 | Ga0207705_10067552 | 3300025909 | Bacteria | 2587 |
| 302 | Ga0207705_10087950 | 3300025909 | Bacteria | 2272 |
| 303 | Ga0207684_10000066 | 3300025910 | Bacteria | 193406 |
| 304 | Ga0207684_10083785 | 3300025910 | Bacteria | 2715 |
| 305 | Ga0207684_10107273 | 3300025910 | Bacteria | 2389 |
| 306 | Ga0207707_10001534 | 3300025912 | Bacteria | 21320 |
| 307 | Ga0207707_10003664 | 3300025912 | Bacteria | 13630 |
| 308 | Ga0207707_10056618 | 3300025912 | Bacteria | 3411 |
| 309 | Ga0207707_10097420 | 3300025912 | Bacteria | 2570 |
| 310 | Ga0207695_10089205 | 3300025913 | Bacteria | 3101 |
| 311 | Ga0207695_10128805 | 3300025913 | Bacteria | 2490 |
| 312 | Ga0207671_10034908 | 3300025914 | Bacteria | 3735 |
| 313 | Ga0207671_10136713 | 3300025914 | Bacteria | 1885 |
| 314 | Ga0207671_10244280 | 3300025914 | Bacteria | 1411 |
| 315 | Ga0207693_10003105 | 3300025915 | Bacteria | 14304 |
| 316 | Ga0207693_10003253 | 3300025915 | Bacteria | 13934 |
| 317 | Ga0207693_10006237 | 3300025915 | Bacteria | 9890 |
| 318 | Ga0207693_10033042 | 3300025915 | Bacteria | 4083 |
| 319 | Ga0207693_10118323 | 3300025915 | Bacteria | 2080 |
| 320 | Ga0207663_10003674 | 3300025916 | Bacteria | 7543 |
| 321 | Ga0207663_10045172 | 3300025916 | Bacteria | 2708 |
| 322 | Ga0207663_10113493 | 3300025916 | Bacteria | 1843 |
| 323 | Ga0207663_10160136 | 3300025916 | Bacteria | 1588 |
| 324 | Ga0207660_10002434 | 3300025917 | Bacteria | 12226 |
| 325 | Ga0207660_10003557 | 3300025917 | Bacteria | 10145 |
| 326 | Ga0207660_10007716 | 3300025917 | Bacteria | 6964 |
| 327 | Ga0207660_10103669 | 3300025917 | Bacteria | 2128 |
| 328 | Ga0207660_10233652 | 3300025917 | Bacteria | 1446 |
| 329 | Ga0207660_10251393 | 3300025917 | Bacteria | 1395 |
| 330 | Ga0207657_10003813 | 3300025919 | Bacteria | 16023 |
| 331 | Ga0207657_10020183 | 3300025919 | Bacteria | 6304 |
| 332 | Ga0207657_10021304 | 3300025919 | Bacteria | 6104 |
| 333 | Ga0207652_10012569 | 3300025921 | Bacteria | 6842 |
| 334 | Ga0207652_10024211 | 3300025921 | Bacteria | 5035 |
| 335 | Ga0207652_10048955 | 3300025921 | Bacteria | 3615 |
| 336 | Ga0207652_10060640 | 3300025921 | Bacteria | 3264 |
| 337 | Ga0207652_10137828 | 3300025921 | Bacteria | 2180 |
| 338 | Ga0207652_10163710 | 3300025921 | Bacteria | 1994 |
| 339 | Ga0207652_10240457 | 3300025921 | Bacteria | 1632 |
| 340 | Ga0207681_10092806 | 3300025923 | Bacteria | 2159 |
| 341 | Ga0207694_10032265 | 3300025924 | Bacteria | 4007 |
| 342 | Ga0207694_10032282 | 3300025924 | Bacteria | 4006 |
| 343 | Ga0207694_10147766 | 3300025924 | Bacteria | 1893 |
| 344 | Ga0207694_10198132 | 3300025924 | Bacteria | 1633 |
| 345 | Ga0207650_10040008 | 3300025925 | Bacteria | 3428 |
| 346 | Ga0207659_10006550 | 3300025926 | Bacteria | 7147 |
| 347 | Ga0207687_10076635 | 3300025927 | Bacteria | 2403 |
| 348 | Ga0207700_10025747 | 3300025928 | Bacteria | 4091 |
| 349 | Ga0207664_10010948 | 3300025929 | Bacteria | 6424 |
| 350 | Ga0207664_10215543 | 3300025929 | Bacteria | 1663 |
| 351 | Ga0207690_10234488 | 3300025932 | Bacteria | 1411 |
| 352 | Ga0207706_10014097 | 3300025933 | Bacteria | 7248 |
| 353 | Ga0207706_10081723 | 3300025933 | Bacteria | 2839 |
| 354 | Ga0207706_10110428 | 3300025933 | Bacteria | 2419 |
| 355 | Ga0207709_10004810 | 3300025935 | Bacteria | 7740 |
| 356 | Ga0207670_10120195 | 3300025936 | Bacteria | 1908 |
| 357 | Ga0207704_10015710 | 3300025938 | Bacteria | 3867 |
| 358 | Ga0207665_10001379 | 3300025939 | Bacteria | 16369 |
| 359 | Ga0207665_10006797 | 3300025939 | Bacteria | 7580 |
| 360 | Ga0207665_10080816 | 3300025939 | Bacteria | 2236 |
| 361 | Ga0207691_10007793 | 3300025940 | Bacteria | 10312 |
| 362 | Ga0207691_10086637 | 3300025940 | Bacteria | 2810 |
| 363 | Ga0207711_10289548 | 3300025941 | Bacteria | 1509 |
| 364 | Ga0207689_10043759 | 3300025942 | Bacteria | 3701 |
| 365 | Ga0207661_10098304 | 3300025944 | Bacteria | 2452 |
| 366 | Ga0207661_10274129 | 3300025944 | Bacteria | 1506 |
| 367 | Ga0207679_10101101 | 3300025945 | Bacteria | 2255 |
| 368 | Ga0207679_10125857 | 3300025945 | Bacteria | 2048 |
| 369 | Ga0207679_10212648 | 3300025945 | Bacteria | 1622 |
| 370 | Ga0207667_10036315 | 3300025949 | Bacteria | 5282 |
| 371 | Ga0207667_10057441 | 3300025949 | Bacteria | 4085 |
| 372 | Ga0207667_10062456 | 3300025949 | Bacteria | 3895 |
| 373 | Ga0207667_10094914 | 3300025949 | Bacteria | 3079 |
| 374 | Ga0207667_10113316 | 3300025949 | Bacteria | 2796 |
| 375 | Ga0207667_10128671 | 3300025949 | Bacteria | 2608 |
| 376 | Ga0207712_10010027 | 3300025961 | Bacteria | 6005 |
| 377 | Ga0207712_10028076 | 3300025961 | Bacteria | 3762 |
| 378 | Ga0207712_10096465 | 3300025961 | Bacteria | 2188 |
| 379 | Ga0207712_10260985 | 3300025961 | Bacteria | 1405 |
| 380 | Ga0207668_10119013 | 3300025972 | Bacteria | 1996 |
| 381 | Ga0207658_10066558 | 3300025986 | Bacteria | 2710 |
| 382 | Ga0207677_10027585 | 3300026023 | Bacteria | 3579 |
| 383 | Ga0207703_10026751 | 3300026035 | Bacteria | 4544 |
| 384 | Ga0207639_10198553 | 3300026041 | Bacteria | 1718 |
| 385 | Ga0207678_10001748 | 3300026067 | Bacteria | 19890 |
| 386 | Ga0207678_10004326 | 3300026067 | Bacteria | 12747 |
| 387 | Ga0207678_10450051 | 3300026067 | Bacteria | 1119 |
| 388 | Ga0207708_10000891 | 3300026075 | Bacteria | 22428 |
| 389 | Ga0207708_10008517 | 3300026075 | Bacteria | 7593 |
| 390 | Ga0207702_10001426 | 3300026078 | Bacteria | 23867 |
| 391 | Ga0207702_10068643 | 3300026078 | Bacteria | 3046 |
| 392 | Ga0207702_10117046 | 3300026078 | Bacteria | 2379 |
| 393 | Ga0207702_10282552 | 3300026078 | Bacteria | 1570 |
| 394 | Ga0207641_10032726 | 3300026088 | Bacteria | 4318 |
| 395 | Ga0207641_10134147 | 3300026088 | Bacteria | 2227 |
| 396 | Ga0207648_10013388 | 3300026089 | Bacteria | 7633 |
| 397 | Ga0207648_10025242 | 3300026089 | Bacteria | 5295 |
| 398 | Ga0207676_10005030 | 3300026095 | Bacteria | 9357 |
| 399 | Ga0207674_10002799 | 3300026116 | Bacteria | 21723 |
| 400 | Ga0207674_10056281 | 3300026116 | Bacteria | 3995 |
| 401 | Ga0207674_10141659 | 3300026116 | Bacteria | 2363 |
| 402 | Ga0207675_100011814 | 3300026118 | Bacteria | 8162 |
| 403 | Ga0207683_10011627 | 3300026121 | Bacteria | 7513 |
| 404 | Ga0207683_10027340 | 3300026121 | Bacteria | 4929 |
| 405 | Ga0207683_10030887 | 3300026121 | Bacteria | 4646 |
| 406 | Ga0207683_10133824 | 3300026121 | Bacteria | 2231 |
| 407 | Ga0207698_10012063 | 3300026142 | Bacteria | 5635 |
| 408 | Ga0207698_10091321 | 3300026142 | Bacteria | 2492 |
| 409 | Ga0207698_10179573 | 3300026142 | Bacteria | 1873 |
| 410 | Ga0209179_1001152 | 3300027512 | Bacteria | 3101 |
| 411 | Ga0209998_10004639 | 3300027717 | Bacteria | 2910 |
| 412 | Ga0209813_10006636 | 3300027866 | Bacteria | 2864 |
| 413 | Ga0209813_10041609 | 3300027866 | Bacteria | 1401 |
| 414 | Ga0207428_10000847 | 3300027907 | Bacteria | 34454 |
| 415 | Ga0268266_10027351 | 3300028379 | Bacteria | 4850 |
| 416 | Ga0268266_10042894 | 3300028379 | Bacteria | 3865 |
| 417 | Ga0268266_10061518 | 3300028379 | Bacteria | 3238 |
| 418 | Ga0268265_10008198 | 3300028380 | Bacteria | 7058 |
| 419 | Ga0268265_10210568 | 3300028380 | Bacteria | 1693 |
| 420 | Ga0268265_10290729 | 3300028380 | Bacteria | 1467 |
| 421 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 422 | Ga0268264_10001838 | 3300028381 | Bacteria | 19352 |
| 423 | Ga0268264_10013465 | 3300028381 | Bacteria | 6734 |
| 424 | Ga0307517_10001121 | 3300028786 | Bacteria | 45217 |
| 425 | Ga0307511_10053453 | 3300030521 | Bacteria | 3201 |
| 426 | Ga0265330_10033527 | 3300031235 | Bacteria | 2296 |
| 427 | Ga0265320_10012283 | 3300031240 | Bacteria | 4994 |
| 428 | Ga0265325_10000097 | 3300031241 | Bacteria | 61606 |
| 429 | Ga0265325_10060157 | 3300031241 | Bacteria | 1930 |
| 430 | Ga0265329_10015531 | 3300031242 | Bacteria | 2658 |
| 431 | Ga0265339_10006887 | 3300031249 | Bacteria | 7407 |
| 432 | Ga0265327_10003002 | 3300031251 | Bacteria | 16746 |
| 433 | Ga0307509_10021381 | 3300031507 | Bacteria | 7315 |
| 434 | Ga0265313_10000072 | 3300031595 | Bacteria | 98635 |
| 435 | Ga0265313_10009985 | 3300031595 | Bacteria | 6081 |
| 436 | Ga0265313_10016697 | 3300031595 | Bacteria | 4209 |
| 437 | Ga0265313_10017909 | 3300031595 | Bacteria | 4000 |
| 438 | Ga0265313_10100502 | 3300031595 | Bacteria | 1284 |
| 439 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 440 | Ga0307508_10042714 | 3300031616 | Bacteria | 4065 |
| 441 | Ga0307508_10236946 | 3300031616 | Bacteria | 1423 |
| 442 | Ga0265314_10005615 | 3300031711 | Bacteria | 11266 |
| 443 | Ga0265314_10017130 | 3300031711 | Bacteria | 5696 |
| 444 | Ga0265342_10001205 | 3300031712 | Bacteria | 24521 |
| 445 | Ga0265342_10006418 | 3300031712 | Bacteria | 8762 |
| 446 | Ga0265342_10017314 | 3300031712 | Bacteria | 4691 |
| 447 | Ga0307516_10030519 | 3300031730 | Bacteria | 5438 |
| 448 | Ga0307412_10144495 | 3300031911 | Bacteria | 1747 |
| 449 | Ga0307409_100120740 | 3300031995 | Bacteria | 2219 |
| 450 | Ga0307416_100075083 | 3300032002 | Bacteria | 2828 |
| 451 | Ga0307510_10111799 | 3300033180 | Bacteria | 2471 |
| 452 | Ga0373926_0002679 | 3300035083 | Bacteria | 5672 |
| 453 | Ga0373934_0014385 | 3300035086 | Bacteria | 2999 |
| 454 | Ga0373951_0015077 | 3300035091 | Bacteria | 1740 |
| 455 | Ga0373952_0051365 | 3300035092 | Bacteria | 984 |
| 456 | Ga0373923_0000498 | 3300035111 | Bacteria | 9464 |
| 457 | Ga0373923_0025209 | 3300035111 | Bacteria | 2355 |
| 458 | Ga0373936_0000333 | 3300035113 | Bacteria | 15986 |
| 459 | Ga0373936_0003709 | 3300035113 | Bacteria | 5737 |
| 460 | Ga0373953_0001092 | 3300035117 | Bacteria | 7676 |
| 461 | Ga0373953_0017556 | 3300035117 | Bacteria | 2633 |
| 462 | Ga0373954_0002334 | 3300035118 | Bacteria | 7919 |
| 463 | Ga0373956_0005989 | 3300035119 | Bacteria | 4865 |
| 464 | Ga0373957_0000374 | 3300035120 | Bacteria | 11335 |
| 465 | Ga0373960_0025760 | 3300035121 | Bacteria | 1602 |
| 466 | Ga0373943_0002984 | 3300035170 | Bacteria | 7682 |
| 467 | Ga0373943_0003531 | 3300035170 | Bacteria | 7118 |
| 468 | Ga0373943_0003831 | 3300035170 | Bacteria | 6836 |
| 469 | Ga0373943_0041937 | 3300035170 | Bacteria | 2215 |
| 470 | Ga0373946_0000838 | 3300035171 | Bacteria | 10525 |
| 471 | Ga0373946_0003512 | 3300035171 | Bacteria | 5563 |
| 472 | Ga0373946_0005437 | 3300035171 | Bacteria | 4593 |
| 473 | Ga0373955_0000191 | 3300035172 | Bacteria | 25296 |
| 474 | Ga0373955_0000716 | 3300035172 | Bacteria | 14261 |
| 475 | Ga0373955_0009267 | 3300035172 | Bacteria | 4609 |
| 476 | Ga0373962_0033521 | 3300035242 | Bacteria | 1418 |
| 477 | Ga0373924_0000239 | 3300035410 | Bacteria | 16754 |
| 478 | Ga0373924_0009491 | 3300035410 | Bacteria | 3566 |
| 479 | Ga0373924_0097082 | 3300035410 | Bacteria | 1265 |
| 480 | Ga0373931_0009482 | 3300035691 | Bacteria | 4656 |
| 481 | Ga0373931_0010233 | 3300035691 | Bacteria | 4505 |
| 482 | Ga0373935_0022035 | 3300035692 | Bacteria | 3902 |
| 483 | Ga0373927_0000961 | 3300035695 | Bacteria | 21989 |
| 484 | Ga0373927_0005223 | 3300035695 | Bacteria | 8984 |
| 485 | Ga0373927_0007611 | 3300035695 | Bacteria | 7336 |
| 486 | Ga0373927_0111645 | 3300035695 | Bacteria | 1781 |
| 487 | Ga0373927_0118997 | 3300035695 | Bacteria | 1723 |
| 488 | Ga0373933_0000874 | 3300035724 | Bacteria | 18425 |
| 489 | Ga0373933_0001100 | 3300035724 | Bacteria | 16117 |
| 490 | Ga0373933_0004649 | 3300035724 | Bacteria | 7517 |
| 491 | Ga0373933_0080638 | 3300035724 | Bacteria | 1995 |
| 492 | Ga0373947_0022629 | 3300035725 | Bacteria | 3646 |
| 493 | Ga0373947_0028230 | 3300035725 | Bacteria | 3287 |
| 494 | Ga0373947_0038959 | 3300035725 | Bacteria | 2826 |
| 495 | Ga0373937_0000030 | 3300036401 | Bacteria | 122176 |
| 496 | Ga0373937_0023092 | 3300036401 | Bacteria | 5596 |
| 497 | Ga0373937_0064217 | 3300036401 | Bacteria | 3377 |
| 498 | Ga0373937_0131701 | 3300036401 | Bacteria | 2335 |
| 499 | Ga0373937_0135738 | 3300036401 | Bacteria | 2300 |
| 500 | Ga0373925_0000501 | 3300037068 | Bacteria | 39530 |
| 501 | Ga0373925_0017101 | 3300037068 | Bacteria | 5250 |
| 502 | Ga0373925_0029160 | 3300037068 | Bacteria | 4048 |
| 503 | Ga0373925_0039020 | 3300037068 | Bacteria | 3513 |
| 504 | Ga0373925_0065512 | 3300037068 | Bacteria | 2736 |
| 505 | Ga0373925_0151271 | 3300037068 | Bacteria | 1823 |
| 506 | Ga0395899_0027304 | 3300037312 | Bacteria | 4304 |
| 507 | Ga0395899_0030402 | 3300037312 | Bacteria | 4062 |
| 508 | Ga0395899_0033115 | 3300037312 | Bacteria | 3882 |
| 509 | Ga0395900_0001215 | 3300037418 | Bacteria | 31847 |
| 510 | Ga0395900_0032923 | 3300037418 | Bacteria | 5333 |
| 511 | Ga0395900_0051359 | 3300037418 | Bacteria | 4247 |
| 512 | Ga0395900_0057410 | 3300037418 | Bacteria | 4007 |
| 513 | Ga0395898_0001841 | 3300037466 | Bacteria | 27267 |
| 514 | Ga0395898_0052786 | 3300037466 | Bacteria | 3971 |
| 515 | Ga0395898_0082532 | 3300037466 | Bacteria | 3098 |
| 516 | Ga0395898_0094485 | 3300037466 | Bacteria | 2873 |
| 517 | Ga0395898_0128830 | 3300037466 | Bacteria | 2424 |
| 518 | Ga0395905_0255484 | 3300037471 | Bacteria | 1637 |
| 519 | Ga0436364_0327304 | 3300037853 | Bacteria | 4191 |
| 520 | Ga0436364_0483132 | 3300037853 | Bacteria | 4019 |
| 521 | Ga0436364_0508608 | 3300037853 | Bacteria | 35332 |
| 522 | Ga0436364_0585229 | 3300037853 | Bacteria | 25011 |
| 523 | Ga0436364_1519102 | 3300037853 | Bacteria | 52157 |
| 524 | Ga0395901_0034367 | 3300038443 | Bacteria | 5235 |
| 525 | Ga0395901_0040086 | 3300038443 | Bacteria | 4849 |
| 526 | Ga0395901_0058280 | 3300038443 | Bacteria | 4017 |
| 527 | Ga0395901_0106881 | 3300038443 | Bacteria | 2937 |
| 528 | Ga0395901_0186293 | 3300038443 | Bacteria | 2177 |
| 529 | Ga0436365_0010333 | 3300039437 | Bacteria | 1354 |
| 530 | Ga0436365_1147194 | 3300039437 | Bacteria | 9578 |
| 531 | Ga0436365_1224398 | 3300039437 | Bacteria | 2562 |
| 532 | Ga0436365_1829993 | 3300039437 | Bacteria | 1394 |
| 533 | Ga0436360_0070398 | 3300039438 | Bacteria | 1496 |
| 534 | Ga0436360_0132510 | 3300039438 | Bacteria | 4773 |
| 535 | Ga0436360_0196017 | 3300039438 | Bacteria | 6047 |
| 536 | Ga0436360_1370935 | 3300039438 | Bacteria | 1211 |
| 537 | Ga0436361_0865062 | 3300039447 | Bacteria | 12533 |
| 538 | Ga0436361_0910383 | 3300039447 | Bacteria | 1691 |
| 539 | Ga0436363_1570094 | 3300039450 | Bacteria | 1852 |
| 540 | Ga0436362_0258613 | 3300039453 | Bacteria | 3715 |
| 541 | Ga0436362_0656211 | 3300039453 | Bacteria | 1612 |
| 542 | Ga0439463_008199 | 3300042016 | Bacteria | 2575 |
| 543 | Ga0439460_0021337 | 3300042461 | Bacteria | 1769 |
| 544 | Ga0451577_0132998 | 3300042876 | Bacteria | 2232 |
| 545 | Ga0466963_0056391 | 3300044694 | Bacteria | 2614 |
| 546 | Ga0466963_0115435 | 3300044694 | Bacteria | 1845 |
| 547 | Ga0466963_0128051 | 3300044694 | Bacteria | 1751 |
| 548 | Ga0466957_0023560 | 3300044842 | Bacteria | 3640 |
| 549 | Ga0466957_0034957 | 3300044842 | Bacteria | 3015 |
| 550 | Ga0466957_0053748 | 3300044842 | Bacteria | 2456 |
| 551 | Ga0466960_0174488 | 3300044901 | Bacteria | 1162 |
| 552 | Ga0466959_0066537 | 3300045049 | Bacteria | 2614 |
| 553 | Ga0451576_0053197 | 3300045051 | Bacteria | 4242 |
| 554 | Ga0466958_0011616 | 3300045836 | Bacteria | 4963 |
| 555 | Ga0466967_0000135 | 3300045976 | Bacteria | 28276 |
| 556 | Ga0466967_0110918 | 3300045976 | Bacteria | 2520 |
| 557 | Ga0495592_0000046 | 3300046454 | Bacteria | 117345 |
| 558 | Ga0495592_0001601 | 3300046454 | Bacteria | 15847 |
| 559 | Ga0495592_0072397 | 3300046454 | Bacteria | 2507 |
| 560 | Ga0495603_0000182 | 3300046455 | Bacteria | 32426 |
| 561 | Ga0495603_0005564 | 3300046455 | Bacteria | 7523 |
| 562 | Ga0495603_0009732 | 3300046455 | Bacteria | 5815 |
| 563 | Ga0495603_0047693 | 3300046455 | Bacteria | 2550 |
| 564 | Ga0495603_0053963 | 3300046455 | Bacteria | 2384 |
| 565 | Ga0495603_0057775 | 3300046455 | Bacteria | 2295 |
| 566 | Ga0495629_0000529 | 3300046459 | Bacteria | 31881 |
| 567 | Ga0495629_0002383 | 3300046459 | Bacteria | 14468 |
| 568 | Ga0495629_0006187 | 3300046459 | Bacteria | 8887 |
| 569 | Ga0495641_0008493 | 3300046461 | Bacteria | 6250 |
| 570 | Ga0495641_0065127 | 3300046461 | Bacteria | 1640 |
| 571 | Ga0495651_0001433 | 3300046462 | Bacteria | 18463 |
| 572 | Ga0495651_0006457 | 3300046462 | Bacteria | 8971 |
| 573 | Ga0495651_0038602 | 3300046462 | Bacteria | 3719 |
| 574 | Ga0495651_0086312 | 3300046462 | Bacteria | 2361 |
| 575 | Ga0495653_0000036 | 3300046463 | Bacteria | 129776 |
| 576 | Ga0495653_0090070 | 3300046463 | Bacteria | 2246 |
| 577 | Ga0495580_0012568 | 3300046472 | Bacteria | 6488 |
| 578 | Ga0495580_0013345 | 3300046472 | Bacteria | 6276 |
| 579 | Ga0495582_0000597 | 3300046473 | Bacteria | 19925 |
| 580 | Ga0495582_0005147 | 3300046473 | Bacteria | 7321 |
| 581 | Ga0495582_0015425 | 3300046473 | Bacteria | 4196 |
| 582 | Ga0495639_0000235 | 3300046475 | Bacteria | 27682 |
| 583 | Ga0495639_0000957 | 3300046475 | Bacteria | 13017 |
| 584 | Ga0495662_0004751 | 3300046476 | Bacteria | 6807 |
| 585 | Ga0495662_0005695 | 3300046476 | Bacteria | 6228 |
| 586 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 587 | Ga0495664_0054316 | 3300046477 | Bacteria | 2382 |
| 588 | Ga0495584_0014375 | 3300046491 | Bacteria | 4032 |
| 589 | Ga0495584_0042137 | 3300046491 | Bacteria | 2304 |
| 590 | Ga0495585_0003645 | 3300046492 | Bacteria | 10301 |
| 591 | Ga0495594_0000302 | 3300046499 | Bacteria | 24227 |
| 592 | Ga0495606_0001566 | 3300046507 | Bacteria | 29975 |
| 593 | Ga0495606_0005874 | 3300046507 | Bacteria | 11555 |
| 594 | Ga0495606_0052129 | 3300046507 | Bacteria | 2663 |
| 595 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 596 | Ga0495608_0008113 | 3300046511 | Bacteria | 7381 |
| 597 | Ga0495608_0014581 | 3300046511 | Bacteria | 5453 |
| 598 | Ga0495618_0000034 | 3300046514 | Bacteria | 104335 |
| 599 | Ga0495618_0182438 | 3300046514 | Bacteria | 1333 |
| 600 | Ga0495620_0041544 | 3300046515 | Bacteria | 2016 |
| 601 | Ga0495628_0000077 | 3300046516 | Bacteria | 77338 |
| 602 | Ga0495628_0007597 | 3300046516 | Bacteria | 9371 |
| 603 | Ga0495628_0016559 | 3300046516 | Bacteria | 6147 |
| 604 | Ga0495630_0000516 | 3300046517 | Bacteria | 28537 |
| 605 | Ga0495630_0049773 | 3300046517 | Bacteria | 3136 |
| 606 | Ga0495630_0215309 | 3300046517 | Bacteria | 1466 |
| 607 | Ga0495643_0057387 | 3300046522 | Bacteria | 2075 |
| 608 | Ga0495644_0020446 | 3300046523 | Bacteria | 2526 |
| 609 | Ga0495644_0048833 | 3300046523 | Bacteria | 1589 |
| 610 | Ga0495644_0048915 | 3300046523 | Bacteria | 1588 |
| 611 | Ga0495666_0015118 | 3300046526 | Bacteria | 3843 |
| 612 | Ga0495652_0000824 | 3300046529 | Bacteria | 35711 |
| 613 | Ga0495652_0016637 | 3300046529 | Bacteria | 6574 |
| 614 | Ga0495652_0018118 | 3300046529 | Bacteria | 6284 |
| 615 | Ga0495652_0049061 | 3300046529 | Bacteria | 3615 |
| 616 | Ga0495652_0215137 | 3300046529 | Bacteria | 1448 |
| 617 | Ga0495665_0001688 | 3300046531 | Bacteria | 11856 |
| 618 | Ga0495665_0007725 | 3300046531 | Bacteria | 5819 |
| 619 | Ga0495665_0042438 | 3300046531 | Bacteria | 2421 |
| 620 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 621 | Ga0495640_0013882 | 3300046533 | Bacteria | 6114 |
| 622 | Ga0495640_0048280 | 3300046533 | Bacteria | 2943 |
| 623 | Ga0495640_0070564 | 3300046533 | Bacteria | 2347 |
| 624 | Ga0495640_0139043 | 3300046533 | Bacteria | 1566 |
| 625 | Ga0495640_0215481 | 3300046533 | Bacteria | 1212 |
| 626 | Ga0495587_0001165 | 3300046536 | Bacteria | 17314 |
| 627 | Ga0495587_0005654 | 3300046536 | Bacteria | 8150 |
| 628 | Ga0495587_0046279 | 3300046536 | Bacteria | 2583 |
| 629 | Ga0495587_0052159 | 3300046536 | Bacteria | 2414 |
| 630 | Ga0495587_0110691 | 3300046536 | Bacteria | 1578 |
| 631 | Ga0495598_0048953 | 3300046537 | Bacteria | 1265 |
| 632 | Ga0495609_0078946 | 3300046538 | Bacteria | 1440 |
| 633 | Ga0495645_0003118 | 3300046543 | Bacteria | 11234 |
| 634 | Ga0495645_0007210 | 3300046543 | Bacteria | 7737 |
| 635 | Ga0495645_0040759 | 3300046543 | Bacteria | 3386 |
| 636 | Ga0495622_0001112 | 3300046557 | Bacteria | 14065 |
| 637 | Ga0495622_0001942 | 3300046557 | Bacteria | 10165 |
| 638 | Ga0495633_0000718 | 3300046558 | Bacteria | 30059 |
| 639 | Ga0495667_0000129 | 3300046559 | Bacteria | 54274 |
| 640 | Ga0495667_0003563 | 3300046559 | Bacteria | 10468 |
| 641 | Ga0495667_0009644 | 3300046559 | Bacteria | 6545 |
| 642 | Ga0495667_0023948 | 3300046559 | Bacteria | 4112 |
| 643 | Ga0495667_0024999 | 3300046559 | Bacteria | 4025 |
| 644 | Ga0495656_0000167 | 3300046615 | Bacteria | 23487 |
| 645 | Ga0495656_0042204 | 3300046615 | Bacteria | 1909 |
| 646 | Ga0495668_0047014 | 3300046616 | Bacteria | 2396 |
| 647 | Ga0495668_0075065 | 3300046616 | Bacteria | 1857 |
| 648 | Ga0495634_0004321 | 3300046642 | Bacteria | 11195 |
| 649 | Ga0495634_0005741 | 3300046642 | Bacteria | 9480 |
| 650 | Ga0495634_0058858 | 3300046642 | Bacteria | 2560 |
| 651 | Ga0495611_0080629 | 3300046648 | Bacteria | 1496 |
| 652 | Ga0495625_0029579 | 3300046660 | Bacteria | 4095 |
| 653 | Ga0495625_0286699 | 3300046660 | Bacteria | 1058 |
| 654 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 655 | Ga0495635_0000429 | 3300046663 | Bacteria | 26634 |
| 656 | Ga0495635_0002913 | 3300046663 | Bacteria | 11759 |
| 657 | Ga0495635_0018820 | 3300046663 | Bacteria | 4819 |
| 658 | Ga0495588_0002630 | 3300046674 | Bacteria | 7691 |
| 659 | Ga0495588_0074439 | 3300046674 | Bacteria | 1768 |
| 660 | Ga0495657_0000521 | 3300046675 | Bacteria | 35776 |
| 661 | Ga0495657_0010262 | 3300046675 | Bacteria | 7049 |
| 662 | Ga0495657_0021154 | 3300046675 | Bacteria | 4669 |
| 663 | Ga0495657_0085887 | 3300046675 | Bacteria | 2028 |
| 664 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 665 | Ga0495599_0177842 | 3300046678 | Bacteria | 1312 |
| 666 | Ga0495623_0000237 | 3300046679 | Bacteria | 35677 |
| 667 | Ga0495623_0007655 | 3300046679 | Bacteria | 7019 |
| 668 | Ga0495623_0208046 | 3300046679 | Bacteria | 1121 |
| 669 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 670 | Ga0495646_0001304 | 3300046680 | Bacteria | 14717 |
| 671 | Ga0495646_0005359 | 3300046680 | Bacteria | 8093 |
| 672 | Ga0495647_0003732 | 3300046681 | Bacteria | 4891 |
| 673 | Ga0495647_0010229 | 3300046681 | Bacteria | 3192 |
| 674 | Ga0495658_0001435 | 3300046683 | Bacteria | 12539 |
| 675 | Ga0495658_0010855 | 3300046683 | Bacteria | 4563 |
| 676 | Ga0495658_0025057 | 3300046683 | Bacteria | 3185 |
| 677 | Ga0495669_0007906 | 3300046684 | Bacteria | 4465 |
| 678 | Ga0495613_0001510 | 3300046689 | Bacteria | 17710 |
| 679 | Ga0495613_0004994 | 3300046689 | Bacteria | 9964 |
| 680 | Ga0495613_0169863 | 3300046689 | Bacteria | 1548 |
| 681 | Ga0495624_0000810 | 3300046690 | Bacteria | 24701 |
| 682 | Ga0495624_0084013 | 3300046690 | Bacteria | 1968 |
| 683 | Ga0495670_0000842 | 3300046691 | Bacteria | 14850 |
| 684 | Ga0495649_0072338 | 3300046694 | Bacteria | 1848 |
| 685 | Ga0495600_0000190 | 3300046809 | Bacteria | 35746 |
| 686 | Ga0495600_0007171 | 3300046809 | Bacteria | 6807 |
| 687 | Ga0495600_0014546 | 3300046809 | Bacteria | 4959 |
| 688 | Ga0495600_0085233 | 3300046809 | Bacteria | 2061 |
| 689 | Ga0495581_0001119 | 3300047315 | Bacteria | 14674 |
| 690 | Ga0495581_0086397 | 3300047315 | Bacteria | 1819 |
| 691 | Ga0495604_0005361 | 3300047317 | Bacteria | 10166 |
| 692 | Ga0495604_0010023 | 3300047317 | Bacteria | 7501 |
| 693 | Ga0495604_0018683 | 3300047317 | Bacteria | 5552 |
| 694 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 695 | Ga0495674_0004558 | 3300047319 | Bacteria | 13335 |
| 696 | Ga0495674_0082394 | 3300047319 | Bacteria | 2758 |
| 697 | Ga0495672_0003454 | 3300047320 | Bacteria | 13522 |
| 698 | Ga0495672_0008480 | 3300047320 | Bacteria | 7576 |
| 699 | Ga0495676_0019892 | 3300047321 | Bacteria | 5900 |
| 700 | Ga0495676_0026009 | 3300047321 | Bacteria | 5043 |
| 701 | Ga0495676_0074858 | 3300047321 | Bacteria | 2591 |
| 702 | Ga0495676_0081095 | 3300047321 | Bacteria | 2460 |
| 703 | Ga0495680_0004506 | 3300047322 | Bacteria | 13324 |
| 704 | Ga0495680_0006513 | 3300047322 | Bacteria | 10837 |
| 705 | Ga0495680_0006824 | 3300047322 | Bacteria | 10544 |
| 706 | Ga0495680_0040769 | 3300047322 | Bacteria | 3697 |
| 707 | Ga0495675_0001883 | 3300047444 | Bacteria | 12503 |
| 708 | Ga0495679_020418 | 3300047446 | Bacteria | 2307 |
| 709 | Ga0495685_039295 | 3300047447 | Bacteria | 1620 |
| 710 | Ga0495684_0000390 | 3300047471 | Bacteria | 35768 |
| 711 | Ga0495684_0000497 | 3300047471 | Bacteria | 32091 |
| 712 | Ga0495684_0010904 | 3300047471 | Bacteria | 7027 |
| 713 | Ga0495686_0000594 | 3300047472 | Bacteria | 50426 |
| 714 | Ga0495686_0012069 | 3300047472 | Bacteria | 6068 |
| 715 | Ga0495593_0000370 | 3300047673 | Bacteria | 24754 |
| 716 | Ga0495593_0014868 | 3300047673 | Bacteria | 4421 |
| 717 | Ga0495593_0023490 | 3300047673 | Bacteria | 3427 |
| 718 | Ga0495602_0000211 | 3300048088 | Bacteria | 54539 |
| 719 | Ga0495602_0106400 | 3300048088 | Bacteria | 2290 |
| 720 | Ga0495614_0006439 | 3300048089 | Bacteria | 5273 |
| 721 | Ga0495614_0009598 | 3300048089 | Bacteria | 4276 |
| 722 | Ga0495626_0045337 | 3300048091 | Bacteria | 2053 |
| 723 | Ga0496100_0085353 | 3300048903 | Bacteria | 2142 |
| 724 | Ga0496101_0002598 | 3300048904 | Bacteria | 11096 |
| 725 | Ga0496101_0052904 | 3300048904 | Bacteria | 2928 |
| 726 | Ga0496101_0066250 | 3300048904 | Bacteria | 2634 |
| 727 | Ga0496101_0076120 | 3300048904 | Bacteria | 2472 |
| 728 | Ga0496102_0005580 | 3300048905 | Bacteria | 10687 |
| 729 | Ga0496102_0010961 | 3300048905 | Bacteria | 7810 |
| 730 | Ga0496102_0080609 | 3300048905 | Bacteria | 2999 |
| 731 | Ga0496102_0081296 | 3300048905 | Bacteria | 2987 |
| 732 | Ga0496103_0003333 | 3300048906 | Bacteria | 9825 |
| 733 | Ga0496103_0016121 | 3300048906 | Bacteria | 4459 |
| 734 | Ga0496103_0068711 | 3300048906 | Bacteria | 2214 |
| 735 | Ga0496104_0000351 | 3300048907 | Bacteria | 41200 |
| 736 | Ga0496104_0001036 | 3300048907 | Bacteria | 23773 |
| 737 | Ga0496104_0002273 | 3300048907 | Bacteria | 16565 |
| 738 | Ga0496104_0014542 | 3300048907 | Bacteria | 7108 |
| 739 | Ga0496104_0027519 | 3300048907 | Bacteria | 5262 |
| 740 | Ga0496104_0036781 | 3300048907 | Bacteria | 4577 |
| 741 | Ga0496104_0064476 | 3300048907 | Bacteria | 3475 |
| 742 | Ga0496104_0141127 | 3300048907 | Bacteria | 2314 |
| 743 | Ga0496105_0001783 | 3300048908 | Bacteria | 15381 |
| 744 | Ga0496105_0006479 | 3300048908 | Bacteria | 8999 |
| 745 | Ga0496105_0017163 | 3300048908 | Bacteria | 5797 |
| 746 | Ga0496106_0000788 | 3300048909 | Bacteria | 22899 |
| 747 | Ga0496106_0010763 | 3300048909 | Bacteria | 6759 |
| 748 | Ga0496106_0028407 | 3300048909 | Bacteria | 4166 |
| 749 | Ga0496106_0088273 | 3300048909 | Bacteria | 2390 |
| 750 | Ga0496107_0003552 | 3300048910 | Bacteria | 10445 |
| 751 | Ga0496107_0004819 | 3300048910 | Bacteria | 9159 |
| 752 | Ga0496107_0013855 | 3300048910 | Bacteria | 5635 |
| 753 | Ga0496107_0065572 | 3300048910 | Bacteria | 2633 |
| 754 | Ga0496107_0180590 | 3300048910 | Bacteria | 1567 |
| 755 | Ga0496108_0008220 | 3300048911 | Bacteria | 8468 |
| 756 | Ga0496108_0017871 | 3300048911 | Bacteria | 5800 |
| 757 | Ga0496109_0004783 | 3300048912 | Bacteria | 11304 |
| 758 | Ga0496109_0016169 | 3300048912 | Bacteria | 6521 |
| 759 | Ga0496109_0043085 | 3300048912 | Bacteria | 4091 |
| 760 | Ga0496110_0024050 | 3300048913 | Bacteria | 5190 |
| 761 | Ga0496110_0094582 | 3300048913 | Bacteria | 2675 |
| 762 | Ga0496111_0002946 | 3300048914 | Bacteria | 10413 |
| 763 | Ga0496111_0020031 | 3300048914 | Bacteria | 4654 |
| 764 | Ga0496111_0020392 | 3300048914 | Bacteria | 4614 |
| 765 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 766 | Ga0496112_0030393 | 3300048915 | Bacteria | 5227 |
| 767 | Ga0496112_0035815 | 3300048915 | Bacteria | 4837 |
| 768 | Ga0496112_0053613 | 3300048915 | Bacteria | 3961 |
| 769 | Ga0496112_0190737 | 3300048915 | Bacteria | 2011 |
| 770 | Ga0496113_0001245 | 3300048916 | Bacteria | 14009 |
| 771 | Ga0496113_0187818 | 3300048916 | Bacteria | 1640 |
| 772 | Ga0496113_0277766 | 3300048916 | Bacteria | 1339 |
| 773 | Ga0496114_0094050 | 3300048917 | Bacteria | 2549 |
| 774 | Ga0496114_0182303 | 3300048917 | Bacteria | 1834 |
| 775 | Ga0496115_0004857 | 3300048918 | Bacteria | 9753 |
| 776 | Ga0496115_0008114 | 3300048918 | Bacteria | 7759 |
| 777 | Ga0496115_0019196 | 3300048918 | Bacteria | 5259 |
| 778 | Ga0496115_0050174 | 3300048918 | Bacteria | 3342 |
| 779 | Ga0496115_0196668 | 3300048918 | Bacteria | 1666 |
| 780 | Ga0496115_0210671 | 3300048918 | Bacteria | 1605 |
| 781 | Ga0496117_0007128 | 3300048920 | Bacteria | 11048 |
| 782 | Ga0496118_0003592 | 3300048921 | Bacteria | 19299 |
| 783 | Ga0496119_0016379 | 3300048922 | Bacteria | 5644 |
| 784 | Ga0496121_0000640 | 3300048924 | Bacteria | 65295 |
| 785 | Ga0496121_0002920 | 3300048924 | Bacteria | 25047 |
| 786 | Ga0496121_0046507 | 3300048924 | Bacteria | 3713 |
| 787 | Ga0496121_0080257 | 3300048924 | Bacteria | 2587 |
| 788 | Ga0496124_0000275 | 3300048927 | Bacteria | 98848 |
| 789 | Ga0496124_0002189 | 3300048927 | Bacteria | 26104 |
| 790 | Ga0496125_0085843 | 3300048928 | Bacteria | 2383 |
| 791 | Ga0496125_0108506 | 3300048928 | Bacteria | 2019 |
| 792 | Ga0496126_0016879 | 3300048929 | Bacteria | 7287 |
| 793 | Ga0496126_0018354 | 3300048929 | Bacteria | 6933 |
| 794 | Ga0496126_0043259 | 3300048929 | Bacteria | 4155 |
| 795 | Ga0496126_0251070 | 3300048929 | Bacteria | 1474 |
| 796 | Ga0496126_0254995 | 3300048929 | Bacteria | 1460 |
| 797 | Ga0501032_0024651 | 3300049569 | Bacteria | 4151 |
| 798 | Ga0501033_0028780 | 3300049570 | Bacteria | 4174 |
| 799 | Ga0501033_0148490 | 3300049570 | Bacteria | 1692 |
| 800 | Ga0501034_0001022 | 3300049571 | Bacteria | 40098 |
| 801 | Ga0501034_0014334 | 3300049571 | Bacteria | 8170 |
| 802 | Ga0501034_0038754 | 3300049571 | Bacteria | 4826 |
| 803 | Ga0501034_0178387 | 3300049571 | Bacteria | 2090 |
| 804 | Ga0501034_0222791 | 3300049571 | Bacteria | 1838 |
| 805 | Ga0501036_0027252 | 3300049572 | Bacteria | 4827 |
| 806 | Ga0501036_0354028 | 3300049572 | Bacteria | 1226 |
| 807 | Ga0501037_0009609 | 3300049573 | Bacteria | 7096 |
| 808 | Ga0501038_0019762 | 3300049574 | Bacteria | 6062 |
| 809 | Ga0501039_0242262 | 3300049575 | Bacteria | 1418 |
| 810 | Ga0501040_0055239 | 3300049576 | Bacteria | 2723 |
| 811 | Ga0501040_0097232 | 3300049576 | Bacteria | 2051 |
| 812 | Ga0501042_0279456 | 3300049578 | Bacteria | 1206 |
| 813 | Ga0501043_0025912 | 3300049579 | Bacteria | 4600 |
| 814 | Ga0501043_0047588 | 3300049579 | Bacteria | 3372 |
| 815 | Ga0501046_0020459 | 3300049580 | Bacteria | 5471 |
| 816 | Ga0501046_0054282 | 3300049580 | Bacteria | 3153 |
| 817 | Ga0501046_0154294 | 3300049580 | Bacteria | 1731 |
| 818 | Ga0501047_0006577 | 3300049581 | Bacteria | 10941 |
| 819 | Ga0501047_0030016 | 3300049581 | Bacteria | 5241 |
| 820 | Ga0501047_0045077 | 3300049581 | Bacteria | 4263 |
| 821 | Ga0501047_0147341 | 3300049581 | Bacteria | 2230 |
| 822 | Ga0501047_0404951 | 3300049581 | Bacteria | 1197 |
| 823 | Ga0501048_0020654 | 3300049582 | Bacteria | 4827 |
| 824 | Ga0501067_0073025 | 3300049583 | Bacteria | 1901 |
| 825 | Ga0501068_0004420 | 3300049584 | Bacteria | 7645 |
| 826 | Ga0501068_0009601 | 3300049584 | Bacteria | 5418 |
| 827 | Ga0501069_0048333 | 3300049585 | Bacteria | 2362 |
| 828 | Ga0501069_0217426 | 3300049585 | Bacteria | 1110 |
| 829 | Ga0501069_0234239 | 3300049585 | Bacteria | 1069 |
| 830 | Ga0501070_0000159 | 3300049586 | Bacteria | 62347 |
| 831 | Ga0501070_0040110 | 3300049586 | Bacteria | 3905 |
| 832 | Ga0501070_0065903 | 3300049586 | Bacteria | 2999 |
| 833 | Ga0501070_0110989 | 3300049586 | Bacteria | 2266 |
| 834 | Ga0501071_0002327 | 3300049587 | Bacteria | 11470 |
| 835 | Ga0501071_0156297 | 3300049587 | Bacteria | 1703 |
| 836 | Ga0501072_0003943 | 3300049588 | Bacteria | 11230 |
| 837 | Ga0501073_0014744 | 3300049589 | Bacteria | 5677 |
| 838 | Ga0501074_0037719 | 3300049590 | Bacteria | 3502 |
| 839 | Ga0501074_0070751 | 3300049590 | Bacteria | 2508 |
| 840 | Ga0501075_0099533 | 3300049591 | Bacteria | 2208 |
| 841 | Ga0501075_0191271 | 3300049591 | Bacteria | 1561 |
| 842 | Ga0501076_0014001 | 3300049592 | Bacteria | 6028 |
| 843 | Ga0501077_0043126 | 3300049593 | Bacteria | 2867 |
| 844 | Ga0501077_0045111 | 3300049593 | Bacteria | 2800 |
| 845 | Ga0501077_0068057 | 3300049593 | Bacteria | 2257 |
| 846 | Ga0501079_0018470 | 3300049741 | Bacteria | 5328 |
| 847 | Ga0501079_0043467 | 3300049741 | Bacteria | 3468 |
| 848 | Ga0501080_0018607 | 3300049742 | Bacteria | 6429 |
| 849 | Ga0501080_0028752 | 3300049742 | Bacteria | 5175 |
| 850 | Ga0501080_0048274 | 3300049742 | Bacteria | 3963 |
| 851 | Ga0501081_0014089 | 3300049743 | Bacteria | 5269 |
| 852 | Ga0501081_0249094 | 3300049743 | Bacteria | 1297 |
| 853 | Ga0501083_0054348 | 3300049744 | Bacteria | 2687 |
| 854 | Ga0501083_0092870 | 3300049744 | Bacteria | 1992 |
| 855 | Ga0501035_0014245 | 3300049822 | Bacteria | 7339 |
| 856 | Ga0501035_0028749 | 3300049822 | Bacteria | 5072 |
| 857 | Ga0501044_0015230 | 3300049823 | Bacteria | 8282 |
| 858 | Ga0501044_0017958 | 3300049823 | Bacteria | 7585 |
| 859 | Ga0501044_0019088 | 3300049823 | Bacteria | 7341 |
| 860 | Ga0501044_0262568 | 3300049823 | Bacteria | 1665 |
| 861 | Ga0501045_0029797 | 3300049824 | Bacteria | 3946 |
| 862 | nmdc:mga03n38_36667_c1 | 3300050490 | Bacteria | 2110 |
| 863 | nmdc:mga00v17_29480_c1 | 3300050491 | Bacteria | 3221 |
| 864 | nmdc:mga0yw44_192698_c1 | 3300050492 | Bacteria | 1345 |
| 865 | nmdc:mga0yw44_237105_c1 | 3300050492 | Bacteria | 1212 |
| 866 | nmdc:mga0yw44_9722_c1 | 3300050492 | Bacteria | 2394 |
| 867 | nmdc:mga0k408_137154_c1 | 3300050493 | Bacteria | 1454 |
| 868 | nmdc:mga0k408_2759_c1 | 3300050493 | Bacteria | 9331 |
| 869 | nmdc:mga06z11_35422_c1 | 3300050494 | Bacteria | 2457 |
| 870 | nmdc:mga06z11_46344_c1 | 3300050494 | Bacteria | 2203 |
| 871 | nmdc:mga04h51_12622_c1 | 3300050495 | Bacteria | 2375 |
| 872 | nmdc:mga04h51_31966_c1 | 3300050495 | Bacteria | 1666 |
| 873 | nmdc:mga04h51_5275_c1 | 3300050495 | Bacteria | 3284 |
| 874 | nmdc:mga07m45_63918_c1 | 3300050496 | Bacteria | 2088 |
| 875 | nmdc:mga05p37_10233_c1 | 3300050507 | Bacteria | 11137 |
| 876 | nmdc:mga05p37_14407_c1 | 3300050507 | Bacteria | 9493 |
| 877 | nmdc:mga05p37_35871_c1 | 3300050507 | Bacteria | 6084 |
| 878 | nmdc:mga05p37_613903_c1 | 3300050507 | Bacteria | 1225 |
| 879 | nmdc:mga05p37_8147_c1 | 3300050507 | Bacteria | 12388 |
| 880 | nmdc:mga09592_9750_c1 | 3300050508 | Bacteria | 7803 |
| 881 | nmdc:mga0qj67_106070_c1 | 3300050509 | Bacteria | 2267 |
| 882 | nmdc:mga0qj67_125999_c1 | 3300050509 | Bacteria | 2073 |
| 883 | nmdc:mga0qj67_215_c1 | 3300050509 | Bacteria | 39409 |
| 884 | nmdc:mga0qj67_4314_c1 | 3300050509 | Bacteria | 10307 |
| 885 | nmdc:mga06r32_12515_c1 | 3300050510 | Bacteria | 7657 |
| 886 | nmdc:mga06r32_298941_c1 | 3300050510 | Bacteria | 1596 |
| 887 | nmdc:mga06r32_316_c1 | 3300050510 | Bacteria | 40391 |
| 888 | nmdc:mga06r32_4487_c1 | 3300050510 | Bacteria | 12494 |
| 889 | nmdc:mga06r32_6439_c1 | 3300050510 | Bacteria | 10546 |
| 890 | nmdc:mga08y16_112174_c1 | 3300050511 | Bacteria | 2838 |
| 891 | nmdc:mga08y16_145004_c1 | 3300050511 | Bacteria | 2468 |
| 892 | nmdc:mga08y16_181255_c1 | 3300050511 | Bacteria | 2187 |
| 893 | nmdc:mga08y16_275602_c1 | 3300050511 | Bacteria | 1736 |
| 894 | nmdc:mga08y16_285812_c1 | 3300050511 | Bacteria | 1701 |
| 895 | nmdc:mga08y16_35913_c1 | 3300050511 | Bacteria | 5205 |
| 896 | nmdc:mga08y16_39014_c1 | 3300050511 | Bacteria | 4984 |
| 897 | nmdc:mga08y16_90_c1 | 3300050511 | Bacteria | 76458 |
| 898 | nmdc:mga0n895_107074_c1 | 3300050512 | Bacteria | 2809 |
| 899 | nmdc:mga0n895_132917_c1 | 3300050512 | Bacteria | 2514 |
| 900 | nmdc:mga0n895_289991_c1 | 3300050512 | Bacteria | 1659 |
| 901 | nmdc:mga0n895_416731_c1 | 3300050512 | Bacteria | 1358 |
| 902 | nmdc:mga0n895_48615_c1 | 3300050512 | Bacteria | 4153 |
| 903 | nmdc:mga0rr50_19557_c1 | 3300050513 | Bacteria | 4574 |
| 904 | nmdc:mga08x19_106181_c1 | 3300050514 | Bacteria | 1868 |
| 905 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 906 | nmdc:mga0a205_100278_c1 | 3300050515 | Bacteria | 2794 |
| 907 | nmdc:mga0a205_234517_c1 | 3300050515 | Bacteria | 1717 |
| 908 | nmdc:mga0sz30_11159_c1 | 3300050516 | Bacteria | 3462 |
| 909 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 910 | Ga0495601_0007499 | 3300053077 | Bacteria | 6400 |
| 911 | Ga0495601_0018585 | 3300053077 | Bacteria | 4231 |
| 912 | Ga0495612_0000844 | 3300053078 | Bacteria | 12425 |
| 913 | Ga0495612_0000950 | 3300053078 | Bacteria | 11916 |
| 914 | Ga0495612_0071997 | 3300053078 | Bacteria | 1443 |
| 915 | Ga0500635_0005887 | 3300053080 | Bacteria | 3248 |
| 916 | Ga0495655_0014821 | 3300053083 | Bacteria | 1643 |
| 917 | Ga0495595_0000155 | 3300053084 | Bacteria | 27158 |
| 918 | Ga0495595_0001465 | 3300053084 | Bacteria | 9212 |
| 919 | Ga0495595_0002145 | 3300053084 | Bacteria | 7665 |
| 920 | Ga0495619_0000033 | 3300053085 | Bacteria | 138925 |
| 921 | Ga0495619_0006338 | 3300053085 | Bacteria | 7501 |
| 922 | Ga0495619_0014717 | 3300053085 | Bacteria | 4941 |
| 923 | Ga0495619_0033588 | 3300053085 | Bacteria | 3332 |
| 924 | Ga0500578_0102638 | 3300053086 | Bacteria | 1809 |
| 925 | Ga0500583_0193073 | 3300053092 | Bacteria | 1013 |
| 926 | Ga0500651_0056821 | 3300053093 | Bacteria | 2449 |
| 927 | Ga0500566_0001625 | 3300053094 | Bacteria | 13231 |
| 928 | Ga0500566_0124910 | 3300053094 | Bacteria | 1383 |
| 929 | Ga0500641_0029827 | 3300053096 | Bacteria | 2139 |
| 930 | Ga0500554_000124 | 3300053102 | Bacteria | 15252 |
| 931 | Ga0500592_004822 | 3300053116 | Bacteria | 2144 |
| 932 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 933 | Ga0500595_002960 | 3300053119 | Bacteria | 8090 |
| 934 | Ga0500595_039754 | 3300053119 | Bacteria | 1520 |
| 935 | Ga0500568_0005538 | 3300053139 | Bacteria | 6505 |
| 936 | Ga0500590_002067 | 3300053148 | Bacteria | 8691 |
| 937 | Ga0500603_000738 | 3300053150 | Bacteria | 7969 |
| 938 | Ga0500620_055445 | 3300053155 | Bacteria | 1339 |
| 939 | Ga0500627_0001582 | 3300053158 | Bacteria | 6412 |
| 940 | Ga0500627_0111877 | 3300053158 | Bacteria | 1229 |
| 941 | Ga0500638_006677 | 3300053162 | Bacteria | 4750 |
| 942 | Ga0500636_0002059 | 3300053177 | Bacteria | 11095 |
| 943 | Ga0500636_0008900 | 3300053177 | Bacteria | 5826 |
| 944 | Ga0500637_0000495 | 3300053178 | Bacteria | 15245 |
| 945 | Ga0500637_0001452 | 3300053178 | Bacteria | 10086 |
| 946 | Ga0500609_011430 | 3300053731 | Bacteria | 1199 |
| 947 | Ga0501084_0023932 | 3300054114 | Bacteria | 5095 |
| 948 | Ga0501084_0063910 | 3300054114 | Bacteria | 3082 |
| 949 | Ga0501084_0071273 | 3300054114 | Bacteria | 2910 |
| 950 | Ga0501084_0071724 | 3300054114 | Bacteria | 2901 |
| 951 | Ga0501084_0223415 | 3300054114 | Bacteria | 1589 |
| 952 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 953 | Ga0501082_0010354 | 3300060353 | Bacteria | 8029 |
| 954 | Ga0501082_0255475 | 3300060353 | Bacteria | 1525 |
| 955 | Ga0530510_0150122 | 3300061734 | Bacteria | 1720 |
| 956 | Ga0530510_0168441 | 3300061734 | Bacteria | 1622 |
| 957 | 2509152562 | 2508501128 | Bacteria | 8613869 |
| 958 | 2513698863 | 2513237101 | Bacteria | 7952346 |
| 959 | 2774868664 | 2773857925 | Bacteria | 6472445 |
| 960 | 2792745559 | 2791355123 | Bacteria | 8049106 |
| 961 | 2793079172 | |||
| 962 | 2855734447 | 2855730933 | Bacteria | 7047938 |
| 963 | 2855770037 | 2855767633 | Bacteria | 7049357 |
| 964 | 2874610507 | 2874604998 | Bacteria | 7834745 |
| 965 | 2876818202 | 2876808645 | Bacteria | 8824342 |
| 966 | 2879115150 | 2879110137 | Bacteria | 8907982 |
| 967 | 2881414278 | 2881412998 | Bacteria | 6492157 |
| 968 | 2889035188 | 2889033259 | Bacteria | 9099371 |
| 969 | 2922363284 | 2922361189 | Bacteria | 7436256 |
| 970 | 8006969408 | 8006964411 | Bacteria | 8966052 |
| 971 | 8006988456 | 8006984368 | Bacteria | 9651211 |
| 972 | 8056678590 | 8056673599 | Bacteria | 7871253 |
| 973 | Ga0500616_0009673 | |||
| 974 | JGI24744J21845_10000923 | |||
| 975 | JGI24033J26618_1003474 | |||
| 976 | JGI25406J46586_10000028 | |||
| 977 | JGI25160J50197_1000095 | |||
| 978 | JGI25161J50226_1000071 | |||
| 979 | JGI25404J52841_10004986 | |||
| 980 | Ga0055543_1000206 | |||
| 981 | Ga0065165_1000408 | |||
| 982 | Ga0070658_10010675 | |||
| 983 | Ga0070676_10129731 | |||
| 984 | Ga0070683_100027066 | |||
| 985 | Ga0070690_100010109 | |||
| 986 | Ga0070670_100036282 | |||
| 987 | Ga0070670_100046453 | |||
| 988 | Ga0068869_100042587 | |||
| 989 | Ga0070666_10033182 | |||
| 990 | Ga0070680_100003476 | |||
| 991 | Ga0070680_100007187 | |||
| 992 | Ga0070680_100013175 | |||
| 993 | Ga0070680_100046954 | |||
| 994 | Ga0068868_100028246 | |||
| 995 | Ga0070660_100025143 | |||
| 996 | Ga0070689_100081818 | |||
| 997 | Ga0070691_10001323 | |||
| 998 | Ga0070661_100034257 | |||
| 999 | Ga0070661_100149989 | |||
| 1000 | Ga0070692_10061899 | |||
| 1001 | Ga0070668_100094992 | |||
| 1002 | Ga0070669_100004982 | |||
| 1003 | Ga0070669_100017838 | |||
| 1004 | Ga0070669_100128050 | |||
| 1005 | Ga0070673_100014774 | |||
| 1006 | Ga0070688_100019330 | |||
| 1007 | Ga0070688_100198625 | |||
| 1008 | Ga0070659_100109588 | |||
| 1009 | Ga0070659_100205342 | |||
| 1010 | Ga0070667_100023872 | |||
| 1011 | Ga0070703_10001774 | |||
| 1012 | Ga0070709_10009430 | |||
| 1013 | Ga0070709_10044828 | |||
| 1014 | Ga0070709_10146986 | |||
| 1015 | Ga0070714_100003399 | |||
| 1016 | Ga0070714_100199988 | |||
| 1017 | Ga0070713_100003592 | |||
| 1018 | Ga0070713_100327192 | |||
| 1019 | Ga0070710_10001178 | |||
| 1020 | Ga0070710_10048329 | |||
| 1021 | Ga0070710_10066017 | |||
| 1022 | Ga0070701_10018203 | |||
| 1023 | Ga0070701_10038414 | |||
| 1024 | Ga0070711_100016060 | |||
| 1025 | Ga0070711_100035255 | |||
| 1026 | Ga0070711_100203604 | |||
| 1027 | Ga0070705_100002136 | |||
| 1028 | Ga0070700_100038308 | |||
| 1029 | Ga0070700_100063440 | |||
| 1030 | Ga0070700_100089522 | |||
| 1031 | Ga0070708_100005485 | |||
| 1032 | Ga0070663_100008923 | |||
| 1033 | Ga0070663_100112035 | |||
| 1034 | Ga0070663_100136782 | |||
| 1035 | Ga0070678_100019792 | |||
| 1036 | Ga0070678_100100375 | |||
| 1037 | Ga0070662_100023188 | |||
| 1038 | Ga0070681_10003470 | |||
| 1039 | Ga0070681_10004105 | |||
| 1040 | Ga0070681_10015832 | |||
| 1041 | Ga0070681_10087004 | |||
| 1042 | Ga0070681_10159856 | |||
| 1043 | Ga0070681_10253655 | |||
| 1044 | Ga0068867_100061438 | |||
| 1045 | Ga0068867_100214551 | |||
| 1046 | Ga0070685_10013498 | |||
| 1047 | Ga0070706_100000058 | |||
| 1048 | Ga0070706_100146353 | |||
| 1049 | Ga0070706_100188269 | |||
| 1050 | Ga0070698_100000825 | |||
| 1051 | Ga0070699_100005255 | |||
| 1052 | Ga0070699_100152170 | |||
| 1053 | Ga0070679_100036294 | |||
| 1054 | Ga0070679_100105809 | |||
| 1055 | Ga0070679_100123488 | |||
| 1056 | Ga0070679_100160671 | |||
| 1057 | Ga0070679_100294384 | |||
| 1058 | Ga0070684_100047842 | |||
| 1059 | Ga0070684_100170035 | |||
| 1060 | Ga0070697_100002460 | |||
| 1061 | Ga0070697_100002564 | |||
| 1062 | Ga0070697_100006247 | |||
| 1063 | Ga0070697_100007169 | |||
| 1064 | Ga0070697_100007965 | |||
| 1065 | Ga0070697_100016894 | |||
| 1066 | Ga0068853_100015257 | |||
| 1067 | Ga0068853_100026126 | |||
| 1068 | Ga0068853_100069092 | |||
| 1069 | Ga0070672_100064032 | |||
| 1070 | Ga0070672_100165275 | |||
| 1071 | Ga0070695_100005766 | |||
| 1072 | Ga0070696_100000887 | |||
| 1073 | Ga0070696_100004630 | |||
| 1074 | Ga0070696_100063608 | |||
| 1075 | Ga0070693_100045863 | |||
| 1076 | Ga0070693_100099541 | |||
| 1077 | Ga0070665_100130569 | |||
| 1078 | Ga0070665_100192702 | |||
| 1079 | Ga0070704_100014059 | |||
| 1080 | Ga0070704_100183329 | |||
| 1081 | Ga0068855_100008088 | |||
| 1082 | Ga0068855_100125606 | |||
| 1083 | Ga0068855_100174599 | |||
| 1084 | Ga0068855_100194279 | |||
| 1085 | Ga0070664_100071163 | |||
| 1086 | Ga0068857_100003412 | |||
| 1087 | Ga0068857_100138473 | |||
| 1088 | Ga0068856_100049808 | |||
| 1089 | Ga0068856_100094060 | |||
| 1090 | Ga0068852_100010751 | |||
| 1091 | Ga0068852_100011681 | |||
| 1092 | Ga0068852_100025909 | |||
| 1093 | Ga0068852_100071010 | |||
| 1094 | Ga0068852_100096988 | |||
| 1095 | Ga0068859_100013735 | |||
| 1096 | Ga0068859_100019924 | |||
| 1097 | Ga0068859_100090535 | |||
| 1098 | Ga0068864_100033297 | |||
| 1099 | Ga0068864_100360597 | |||
| 1100 | Ga0068861_100040369 | |||
| 1101 | Ga0068861_100065319 | |||
| 1102 | Ga0068851_10021478 | |||
| 1103 | Ga0068870_10003649 | |||
| 1104 | Ga0068863_100017877 | |||
| 1105 | Ga0068858_100064336 | |||
| 1106 | Ga0068860_100000577 | |||
| 1107 | Ga0068860_100018913 | |||
| 1108 | Ga0068860_100092343 | |||
| 1109 | Ga0068862_100148148 | |||
| 1110 | Ga0068862_100326621 | |||
| 1111 | Ga0081455_10000226 | |||
| 1112 | Ga0081455_10011459 | |||
| 1113 | Ga0081455_10012534 | |||
| 1114 | Ga0081455_10025643 | |||
| 1115 | Ga0081455_10035259 | |||
| 1116 | Ga0081538_10001703 | |||
| 1117 | Ga0081540_1003162 | |||
| 1118 | Ga0081540_1003755 | |||
| 1119 | Ga0081540_1009897 | |||
| 1120 | Ga0081540_1011694 | |||
| 1121 | Ga0081540_1017229 | |||
| 1122 | Ga0081540_1026005 | |||
| 1123 | Ga0081540_1037654 | |||
| 1124 | Ga0081540_1042934 | |||
| 1125 | Ga0081540_1059105 | |||
| 1126 | Ga0081539_10000048 | |||
| 1127 | Ga0081539_10000576 | |||
| 1128 | Ga0081539_10036771 | |||
| 1129 | Ga0081539_10071654 | |||
| 1130 | Ga0070717_10000634 | |||
| 1131 | Ga0070717_10051186 | |||
| 1132 | Ga0070717_10059267 | |||
| 1133 | Ga0070717_10146806 | |||
| 1134 | Ga0075365_10088316 | |||
| 1135 | Ga0075365_10102464 | |||
| 1136 | Ga0075368_10001658 | |||
| 1137 | Ga0075368_10088642 | |||
| 1138 | Ga0075363_100035403 | |||
| 1139 | Ga0075363_100052241 | |||
| 1140 | Ga0075364_10061523 | |||
| 1141 | Ga0075364_10071135 | |||
| 1142 | Ga0075364_10132838 | |||
| 1143 | Ga0075364_10145892 | |||
| 1144 | Ga0075432_10051536 | |||
| 1145 | Ga0070715_10029300 | |||
| 1146 | Ga0070715_10055329 | |||
| 1147 | Ga0070716_100004081 | |||
| 1148 | Ga0070716_100060169 | |||
| 1149 | Ga0070712_100015951 | |||
| 1150 | Ga0070712_100022594 | |||
| 1151 | Ga0070712_100346614 | |||
| 1152 | Ga0075367_10001614 | |||
| 1153 | Ga0075369_10028353 | |||
| 1154 | Ga0075369_10045625 | |||
| 1155 | Ga0075366_10002111 | |||
| 1156 | Ga0075366_10143949 | |||
| 1157 | Ga0097621_100020528 | |||
| 1158 | Ga0097621_100034122 | |||
| 1159 | Ga0075370_10033632 | |||
| 1160 | Ga0068871_100074458 | |||
| 1161 | Ga0075428_100005533 | |||
| 1162 | Ga0075428_100011315 | |||
| 1163 | Ga0075428_100206695 | |||
| 1164 | Ga0075428_100210506 | |||
| 1165 | Ga0075428_100383918 | |||
| 1166 | Ga0075430_100000222 | |||
| 1167 | Ga0075430_100012924 | |||
| 1168 | Ga0075430_100031383 | |||
| 1169 | Ga0075430_100139010 | |||
| 1170 | Ga0075430_100248002 | |||
| 1171 | Ga0075431_100001099 | |||
| 1172 | Ga0075431_100015511 | |||
| 1173 | Ga0075433_10031299 | |||
| 1174 | Ga0075434_100240347 | |||
| 1175 | Ga0075429_100024988 | |||
| 1176 | Ga0068865_100018423 | |||
| 1177 | Ga0075436_100004698 | |||
| 1178 | Ga0097620_100013735 | |||
| 1179 | Ga0097620_100019924 | |||
| 1180 | Ga0097620_100090527 | |||
| 1181 | Ga0075435_100116205 | |||
| 1182 | Ga0105244_10028351 | |||
| 1183 | Ga0105250_10037420 | |||
| 1184 | Ga0105240_10008969 | |||
| 1185 | Ga0105240_10030708 | |||
| 1186 | Ga0105240_10070434 | |||
| 1187 | Ga0105240_10121613 | |||
| 1188 | Ga0111539_10002503 | |||
| 1189 | Ga0111539_10032995 | |||
| 1190 | Ga0111539_10064813 | |||
| 1191 | Ga0111539_10143122 | |||
| 1192 | Ga0105247_10007788 | |||
| 1193 | Ga0105247_10224458 | |||
| 1194 | Ga0114129_10003943 | |||
| 1195 | Ga0114129_10014705 | |||
| 1196 | Ga0114129_10017278 | |||
| 1197 | Ga0114129_10023078 | |||
| 1198 | Ga0114129_10097181 | |||
| 1199 | Ga0105243_10008030 | |||
| 1200 | Ga0105243_10102502 | |||
| 1201 | Ga0105241_10108329 | |||
| 1202 | Ga0105242_10021859 | |||
| 1203 | Ga0105248_10033223 | |||
| 1204 | Ga0105248_10037197 | |||
| 1205 | Ga0105248_10136859 | |||
| 1206 | Ga0105237_10137192 | |||
| 1207 | Ga0105237_10183269 | |||
| 1208 | Ga0105238_10034676 | |||
| 1209 | Ga0105238_10087987 | |||
| 1210 | Ga0105238_10105822 | |||
| 1211 | Ga0105249_10033545 | |||
| 1212 | Ga0105249_10378644 | |||
| 1213 | Ga0099796_10049914 | |||
| 1214 | Ga0105239_10017528 | |||
| 1215 | Ga0105239_10047388 | |||
| 1216 | Ga0105239_10112338 | |||
| 1217 | Ga0105239_10136977 | |||
| 1218 | Ga0157370_10085558 | |||
| 1219 | Ga0157370_10233664 | |||
| 1220 | Ga0157369_10211574 | |||
| 1221 | Ga0157374_10010302 | |||
| 1222 | Ga0157374_10054750 | |||
| 1223 | Ga0157374_10198980 | |||
| 1224 | Ga0163162_10076230 | |||
| 1225 | Ga0163162_10105667 | |||
| 1226 | Ga0157372_10319259 | |||
| 1227 | Ga0157375_10217358 | |||
| 1228 | Ga0157375_10228532 | |||
| 1229 | Ga0163163_10016636 | |||
| 1230 | Ga0163163_10045809 | |||
| 1231 | Ga0157380_10072897 | |||
| 1232 | Ga0157380_10242407 | |||
| 1233 | Ga0157379_10019972 | |||
| 1234 | Ga0157376_10176005 | |||
| 1235 | Ga0157376_10179408 | |||
| 1236 | Ga0163161_10008859 | |||
| 1237 | Ga0163161_10065481 | |||
| 1238 | Ga0206353_10589863 | |||
| 1239 | Ga0213873_10011822 | |||
| 1240 | Ga0213876_10002856 | |||
| 1241 | Ga0213875_10000556 | |||
| 1242 | Ga0213875_10001253 | |||
| 1243 | Ga0213875_10026948 | |||
| 1244 | Ga0209130_1000180 | |||
| 1245 | Ga0209130_1000318 | |||
| 1246 | Ga0209758_1008580 | |||
| 1247 | Ga0209758_1045312 | |||
| 1248 | Ga0207426_1000017 | |||
| 1249 | Ga0207426_1000512 | |||
| 1250 | Ga0207426_1011406 | |||
| 1251 | Ga0207697_10016118 | |||
| 1252 | Ga0207697_10074176 | |||
| 1253 | Ga0207656_10014562 | |||
| 1254 | Ga0207653_10000916 | |||
| 1255 | Ga0207692_10001575 | |||
| 1256 | Ga0207692_10003295 | |||
| 1257 | Ga0207692_10003780 | |||
| 1258 | Ga0207642_10034708 | |||
| 1259 | Ga0207710_10031969 | |||
| 1260 | Ga0207710_10042622 | |||
| 1261 | Ga0207688_10000135 | |||
| 1262 | Ga0207688_10156493 | |||
| 1263 | Ga0207685_10000528 | |||
| 1264 | Ga0207685_10003382 | |||
| 1265 | Ga0207685_10059682 | |||
| 1266 | Ga0207699_10000525 | |||
| 1267 | Ga0207699_10006599 | |||
| 1268 | Ga0207699_10010546 | |||
| 1269 | Ga0207699_10057527 | |||
| 1270 | Ga0207699_10197176 | |||
| 1271 | Ga0207645_10032939 | |||
| 1272 | Ga0207643_10002474 | |||
| 1273 | Ga0207705_10067552 | |||
| 1274 | Ga0207705_10087950 | |||
| 1275 | Ga0207684_10000066 | |||
| 1276 | Ga0207684_10083785 | |||
| 1277 | Ga0207684_10107273 | |||
| 1278 | Ga0207707_10001534 | |||
| 1279 | Ga0207707_10003664 | |||
| 1280 | Ga0207707_10056618 | |||
| 1281 | Ga0207707_10097420 | |||
| 1282 | Ga0207695_10089205 | |||
| 1283 | Ga0207695_10128805 | |||
| 1284 | Ga0207671_10034908 | |||
| 1285 | Ga0207671_10136713 | |||
| 1286 | Ga0207671_10244280 | |||
| 1287 | Ga0207693_10003105 | |||
| 1288 | Ga0207693_10003253 | |||
| 1289 | Ga0207693_10006237 | |||
| 1290 | Ga0207693_10033042 | |||
| 1291 | Ga0207693_10118323 | |||
| 1292 | Ga0207663_10003674 | |||
| 1293 | Ga0207663_10045172 | |||
| 1294 | Ga0207663_10113493 | |||
| 1295 | Ga0207663_10160136 | |||
| 1296 | Ga0207660_10002434 | |||
| 1297 | Ga0207660_10003557 | |||
| 1298 | Ga0207660_10007716 | |||
| 1299 | Ga0207660_10103669 | |||
| 1300 | Ga0207660_10233652 | |||
| 1301 | Ga0207660_10251393 | |||
| 1302 | Ga0207657_10003813 | |||
| 1303 | Ga0207657_10020183 | |||
| 1304 | Ga0207657_10021304 | |||
| 1305 | Ga0207652_10012569 | |||
| 1306 | Ga0207652_10024211 | |||
| 1307 | Ga0207652_10048955 | |||
| 1308 | Ga0207652_10060640 | |||
| 1309 | Ga0207652_10137828 | |||
| 1310 | Ga0207652_10163710 | |||
| 1311 | Ga0207652_10240457 | |||
| 1312 | Ga0207681_10092806 | |||
| 1313 | Ga0207694_10032265 | |||
| 1314 | Ga0207694_10032282 | |||
| 1315 | Ga0207694_10147766 | |||
| 1316 | Ga0207694_10198132 | |||
| 1317 | Ga0207650_10040008 | |||
| 1318 | Ga0207659_10006550 | |||
| 1319 | Ga0207687_10076635 | |||
| 1320 | Ga0207700_10025747 | |||
| 1321 | Ga0207664_10010948 | |||
| 1322 | Ga0207664_10215543 | |||
| 1323 | Ga0207690_10234488 | |||
| 1324 | Ga0207706_10014097 | |||
| 1325 | Ga0207706_10081723 | |||
| 1326 | Ga0207706_10110428 | |||
| 1327 | Ga0207709_10004810 | |||
| 1328 | Ga0207670_10120195 | |||
| 1329 | Ga0207704_10015710 | |||
| 1330 | Ga0207665_10001379 | |||
| 1331 | Ga0207665_10006797 | |||
| 1332 | Ga0207665_10080816 | |||
| 1333 | Ga0207691_10007793 | |||
| 1334 | Ga0207691_10086637 | |||
| 1335 | Ga0207711_10289548 | |||
| 1336 | Ga0207689_10043759 | |||
| 1337 | Ga0207661_10098304 | |||
| 1338 | Ga0207661_10274129 | |||
| 1339 | Ga0207679_10101101 | |||
| 1340 | Ga0207679_10125857 | |||
| 1341 | Ga0207679_10212648 | |||
| 1342 | Ga0207667_10036315 | |||
| 1343 | Ga0207667_10057441 | |||
| 1344 | Ga0207667_10062456 | |||
| 1345 | Ga0207667_10094914 | |||
| 1346 | Ga0207667_10113316 | |||
| 1347 | Ga0207667_10128671 | |||
| 1348 | Ga0207712_10010027 | |||
| 1349 | Ga0207712_10028076 | |||
| 1350 | Ga0207712_10096465 | |||
| 1351 | Ga0207712_10260985 | |||
| 1352 | Ga0207668_10119013 | |||
| 1353 | Ga0207658_10066558 | |||
| 1354 | Ga0207677_10027585 | |||
| 1355 | Ga0207703_10026751 | |||
| 1356 | Ga0207639_10198553 | |||
| 1357 | Ga0207678_10001748 | |||
| 1358 | Ga0207678_10004326 | |||
| 1359 | Ga0207678_10450051 | |||
| 1360 | Ga0207708_10000891 | |||
| 1361 | Ga0207708_10008517 | |||
| 1362 | Ga0207702_10001426 | |||
| 1363 | Ga0207702_10068643 | |||
| 1364 | Ga0207702_10117046 | |||
| 1365 | Ga0207702_10282552 | |||
| 1366 | Ga0207641_10032726 | |||
| 1367 | Ga0207641_10134147 | |||
| 1368 | Ga0207648_10013388 | |||
| 1369 | Ga0207648_10025242 | |||
| 1370 | Ga0207676_10005030 | |||
| 1371 | Ga0207674_10002799 | |||
| 1372 | Ga0207674_10056281 | |||
| 1373 | Ga0207674_10141659 | |||
| 1374 | Ga0207675_100011814 | |||
| 1375 | Ga0207683_10011627 | |||
| 1376 | Ga0207683_10027340 | |||
| 1377 | Ga0207683_10030887 | |||
| 1378 | Ga0207683_10133824 | |||
| 1379 | Ga0207698_10012063 | |||
| 1380 | Ga0207698_10091321 | |||
| 1381 | Ga0207698_10179573 | |||
| 1382 | Ga0209179_1001152 | |||
| 1383 | Ga0209998_10004639 | |||
| 1384 | Ga0209813_10006636 | |||
| 1385 | Ga0209813_10041609 | |||
| 1386 | Ga0207428_10000847 | |||
| 1387 | Ga0268266_10027351 | |||
| 1388 | Ga0268266_10042894 | |||
| 1389 | Ga0268266_10061518 | |||
| 1390 | Ga0268265_10008198 | |||
| 1391 | Ga0268265_10210568 | |||
| 1392 | Ga0268265_10290729 | |||
| 1393 | Ga0268264_10000107 | |||
| 1394 | Ga0268264_10001838 | |||
| 1395 | Ga0268264_10013465 | |||
| 1396 | Ga0307517_10001121 | |||
| 1397 | Ga0307511_10053453 | |||
| 1398 | Ga0265330_10033527 | |||
| 1399 | Ga0265320_10012283 | |||
| 1400 | Ga0265325_10000097 | |||
| 1401 | Ga0265325_10060157 | |||
| 1402 | Ga0265329_10015531 | |||
| 1403 | Ga0265339_10006887 | |||
| 1404 | Ga0265327_10003002 | |||
| 1405 | Ga0307509_10021381 | |||
| 1406 | Ga0265313_10000072 | |||
| 1407 | Ga0265313_10009985 | |||
| 1408 | Ga0265313_10016697 | |||
| 1409 | Ga0265313_10017909 | |||
| 1410 | Ga0265313_10100502 | |||
| 1411 | Ga0307508_10000154 | |||
| 1412 | Ga0307508_10042714 | |||
| 1413 | Ga0307508_10236946 | |||
| 1414 | Ga0265314_10005615 | |||
| 1415 | Ga0265314_10017130 | |||
| 1416 | Ga0265342_10001205 | |||
| 1417 | Ga0265342_10006418 | |||
| 1418 | Ga0265342_10017314 | |||
| 1419 | Ga0307516_10030519 | |||
| 1420 | Ga0307412_10144495 | |||
| 1421 | Ga0307409_100120740 | |||
| 1422 | Ga0307416_100075083 | |||
| 1423 | Ga0307510_10111799 | |||
| 1424 | Ga0373926_0002679 | |||
| 1425 | Ga0373934_0014385 | |||
| 1426 | Ga0373951_0015077 | |||
| 1427 | Ga0373952_0051365 | |||
| 1428 | Ga0373923_0000498 | |||
| 1429 | Ga0373923_0025209 | |||
| 1430 | Ga0373936_0000333 | |||
| 1431 | Ga0373936_0003709 | |||
| 1432 | Ga0373953_0001092 | |||
| 1433 | Ga0373953_0017556 | |||
| 1434 | Ga0373954_0002334 | |||
| 1435 | Ga0373956_0005989 | |||
| 1436 | Ga0373957_0000374 | |||
| 1437 | Ga0373960_0025760 | |||
| 1438 | Ga0373943_0002984 | |||
| 1439 | Ga0373943_0003531 | |||
| 1440 | Ga0373943_0003831 | |||
| 1441 | Ga0373943_0041937 | |||
| 1442 | Ga0373946_0000838 | |||
| 1443 | Ga0373946_0003512 | |||
| 1444 | Ga0373946_0005437 | |||
| 1445 | Ga0373955_0000191 | |||
| 1446 | Ga0373955_0000716 | |||
| 1447 | Ga0373955_0009267 | |||
| 1448 | Ga0373962_0033521 | |||
| 1449 | Ga0373924_0000239 | |||
| 1450 | Ga0373924_0009491 | |||
| 1451 | Ga0373924_0097082 | |||
| 1452 | Ga0373931_0009482 | |||
| 1453 | Ga0373931_0010233 | |||
| 1454 | Ga0373935_0022035 | |||
| 1455 | Ga0373927_0000961 | |||
| 1456 | Ga0373927_0005223 | |||
| 1457 | Ga0373927_0007611 | |||
| 1458 | Ga0373927_0111645 | |||
| 1459 | Ga0373927_0118997 | |||
| 1460 | Ga0373933_0000874 | |||
| 1461 | Ga0373933_0001100 | |||
| 1462 | Ga0373933_0004649 | |||
| 1463 | Ga0373933_0080638 | |||
| 1464 | Ga0373947_0022629 | |||
| 1465 | Ga0373947_0028230 | |||
| 1466 | Ga0373947_0038959 | |||
| 1467 | Ga0373937_0000030 | |||
| 1468 | Ga0373937_0023092 | |||
| 1469 | Ga0373937_0064217 | |||
| 1470 | Ga0373937_0131701 | |||
| 1471 | Ga0373937_0135738 | |||
| 1472 | Ga0373925_0000501 | |||
| 1473 | Ga0373925_0017101 | |||
| 1474 | Ga0373925_0029160 | |||
| 1475 | Ga0373925_0039020 | |||
| 1476 | Ga0373925_0065512 | |||
| 1477 | Ga0373925_0151271 | |||
| 1478 | Ga0395899_0027304 | |||
| 1479 | Ga0395899_0030402 | |||
| 1480 | Ga0395899_0033115 | |||
| 1481 | Ga0395900_0001215 | |||
| 1482 | Ga0395900_0032923 | |||
| 1483 | Ga0395900_0051359 | |||
| 1484 | Ga0395900_0057410 | |||
| 1485 | Ga0395898_0001841 | |||
| 1486 | Ga0395898_0052786 | |||
| 1487 | Ga0395898_0082532 | |||
| 1488 | Ga0395898_0094485 | |||
| 1489 | Ga0395898_0128830 | |||
| 1490 | Ga0395905_0255484 | |||
| 1491 | Ga0436364_0327304 | |||
| 1492 | Ga0436364_0483132 | |||
| 1493 | Ga0436364_0508608 | |||
| 1494 | Ga0436364_0585229 | |||
| 1495 | Ga0436364_1519102 | |||
| 1496 | Ga0395901_0034367 | |||
| 1497 | Ga0395901_0040086 | |||
| 1498 | Ga0395901_0058280 | |||
| 1499 | Ga0395901_0106881 | |||
| 1500 | Ga0395901_0186293 | |||
| 1501 | Ga0436365_0010333 | |||
| 1502 | Ga0436365_1147194 | |||
| 1503 | Ga0436365_1224398 | |||
| 1504 | Ga0436365_1829993 | |||
| 1505 | Ga0436360_0070398 | |||
| 1506 | Ga0436360_0132510 | |||
| 1507 | Ga0436360_0196017 | |||
| 1508 | Ga0436360_1370935 | |||
| 1509 | Ga0436361_0865062 | |||
| 1510 | Ga0436361_0910383 | |||
| 1511 | Ga0436363_1570094 | |||
| 1512 | Ga0436362_0258613 | |||
| 1513 | Ga0436362_0656211 | |||
| 1514 | Ga0439463_008199 | |||
| 1515 | Ga0439460_0021337 | |||
| 1516 | Ga0451577_0132998 | |||
| 1517 | Ga0466963_0056391 | |||
| 1518 | Ga0466963_0115435 | |||
| 1519 | Ga0466963_0128051 | |||
| 1520 | Ga0466957_0023560 | |||
| 1521 | Ga0466957_0034957 | |||
| 1522 | Ga0466957_0053748 | |||
| 1523 | Ga0466960_0174488 | |||
| 1524 | Ga0466959_0066537 | |||
| 1525 | Ga0451576_0053197 | |||
| 1526 | Ga0466958_0011616 | |||
| 1527 | Ga0466967_0000135 | |||
| 1528 | Ga0466967_0110918 | |||
| 1529 | Ga0495592_0000046 | |||
| 1530 | Ga0495592_0001601 | |||
| 1531 | Ga0495592_0072397 | |||
| 1532 | Ga0495603_0000182 | |||
| 1533 | Ga0495603_0005564 | |||
| 1534 | Ga0495603_0009732 | |||
| 1535 | Ga0495603_0047693 | |||
| 1536 | Ga0495603_0053963 | |||
| 1537 | Ga0495603_0057775 | |||
| 1538 | Ga0495629_0000529 | |||
| 1539 | Ga0495629_0002383 | |||
| 1540 | Ga0495629_0006187 | |||
| 1541 | Ga0495641_0008493 | |||
| 1542 | Ga0495641_0065127 | |||
| 1543 | Ga0495651_0001433 | |||
| 1544 | Ga0495651_0006457 | |||
| 1545 | Ga0495651_0038602 | |||
| 1546 | Ga0495651_0086312 | |||
| 1547 | Ga0495653_0000036 | |||
| 1548 | Ga0495653_0090070 | |||
| 1549 | Ga0495580_0012568 | |||
| 1550 | Ga0495580_0013345 | |||
| 1551 | Ga0495582_0000597 | |||
| 1552 | Ga0495582_0005147 | |||
| 1553 | Ga0495582_0015425 | |||
| 1554 | Ga0495639_0000235 | |||
| 1555 | Ga0495639_0000957 | |||
| 1556 | Ga0495662_0004751 | |||
| 1557 | Ga0495662_0005695 | |||
| 1558 | Ga0495664_0000002 | |||
| 1559 | Ga0495664_0054316 | |||
| 1560 | Ga0495584_0014375 | |||
| 1561 | Ga0495584_0042137 | |||
| 1562 | Ga0495585_0003645 | |||
| 1563 | Ga0495594_0000302 | |||
| 1564 | Ga0495606_0001566 | |||
| 1565 | Ga0495606_0005874 | |||
| 1566 | Ga0495606_0052129 | |||
| 1567 | Ga0495608_0000006 | |||
| 1568 | Ga0495608_0008113 | |||
| 1569 | Ga0495608_0014581 | |||
| 1570 | Ga0495618_0000034 | |||
| 1571 | Ga0495618_0182438 | |||
| 1572 | Ga0495620_0041544 | |||
| 1573 | Ga0495628_0000077 | |||
| 1574 | Ga0495628_0007597 | |||
| 1575 | Ga0495628_0016559 | |||
| 1576 | Ga0495630_0000516 | |||
| 1577 | Ga0495630_0049773 | |||
| 1578 | Ga0495630_0215309 | |||
| 1579 | Ga0495643_0057387 | |||
| 1580 | Ga0495644_0020446 | |||
| 1581 | Ga0495644_0048833 | |||
| 1582 | Ga0495644_0048915 | |||
| 1583 | Ga0495666_0015118 | |||
| 1584 | Ga0495652_0000824 | |||
| 1585 | Ga0495652_0016637 | |||
| 1586 | Ga0495652_0018118 | |||
| 1587 | Ga0495652_0049061 | |||
| 1588 | Ga0495652_0215137 | |||
| 1589 | Ga0495665_0001688 | |||
| 1590 | Ga0495665_0007725 | |||
| 1591 | Ga0495665_0042438 | |||
| 1592 | Ga0495640_0000007 | |||
| 1593 | Ga0495640_0013882 | |||
| 1594 | Ga0495640_0048280 | |||
| 1595 | Ga0495640_0070564 | |||
| 1596 | Ga0495640_0139043 | |||
| 1597 | Ga0495640_0215481 | |||
| 1598 | Ga0495587_0001165 | |||
| 1599 | Ga0495587_0005654 | |||
| 1600 | Ga0495587_0046279 | |||
| 1601 | Ga0495587_0052159 | |||
| 1602 | Ga0495587_0110691 | |||
| 1603 | Ga0495598_0048953 | |||
| 1604 | Ga0495609_0078946 | |||
| 1605 | Ga0495645_0003118 | |||
| 1606 | Ga0495645_0007210 | |||
| 1607 | Ga0495645_0040759 | |||
| 1608 | Ga0495622_0001112 | |||
| 1609 | Ga0495622_0001942 | |||
| 1610 | Ga0495633_0000718 | |||
| 1611 | Ga0495667_0000129 | |||
| 1612 | Ga0495667_0003563 | |||
| 1613 | Ga0495667_0009644 | |||
| 1614 | Ga0495667_0023948 | |||
| 1615 | Ga0495667_0024999 | |||
| 1616 | Ga0495656_0000167 | |||
| 1617 | Ga0495656_0042204 | |||
| 1618 | Ga0495668_0047014 | |||
| 1619 | Ga0495668_0075065 | |||
| 1620 | Ga0495634_0004321 | |||
| 1621 | Ga0495634_0005741 | |||
| 1622 | Ga0495634_0058858 | |||
| 1623 | Ga0495611_0080629 | |||
| 1624 | Ga0495625_0029579 | |||
| 1625 | Ga0495625_0286699 | |||
| 1626 | Ga0495635_0000021 | |||
| 1627 | Ga0495635_0000429 | |||
| 1628 | Ga0495635_0002913 | |||
| 1629 | Ga0495635_0018820 | |||
| 1630 | Ga0495588_0002630 | |||
| 1631 | Ga0495588_0074439 | |||
| 1632 | Ga0495657_0000521 | |||
| 1633 | Ga0495657_0010262 | |||
| 1634 | Ga0495657_0021154 | |||
| 1635 | Ga0495657_0085887 | |||
| 1636 | Ga0495599_0000001 | |||
| 1637 | Ga0495599_0177842 | |||
| 1638 | Ga0495623_0000237 | |||
| 1639 | Ga0495623_0007655 | |||
| 1640 | Ga0495623_0208046 | |||
| 1641 | Ga0495646_0000007 | |||
| 1642 | Ga0495646_0001304 | |||
| 1643 | Ga0495646_0005359 | |||
| 1644 | Ga0495647_0003732 | |||
| 1645 | Ga0495647_0010229 | |||
| 1646 | Ga0495658_0001435 | |||
| 1647 | Ga0495658_0010855 | |||
| 1648 | Ga0495658_0025057 | |||
| 1649 | Ga0495669_0007906 | |||
| 1650 | Ga0495613_0001510 | |||
| 1651 | Ga0495613_0004994 | |||
| 1652 | Ga0495613_0169863 | |||
| 1653 | Ga0495624_0000810 | |||
| 1654 | Ga0495624_0084013 | |||
| 1655 | Ga0495670_0000842 | |||
| 1656 | Ga0495649_0072338 | |||
| 1657 | Ga0495600_0000190 | |||
| 1658 | Ga0495600_0007171 | |||
| 1659 | Ga0495600_0014546 | |||
| 1660 | Ga0495600_0085233 | |||
| 1661 | Ga0495581_0001119 | |||
| 1662 | Ga0495581_0086397 | |||
| 1663 | Ga0495604_0005361 | |||
| 1664 | Ga0495604_0010023 | |||
| 1665 | Ga0495604_0018683 | |||
| 1666 | Ga0495674_0000014 | |||
| 1667 | Ga0495674_0004558 | |||
| 1668 | Ga0495674_0082394 | |||
| 1669 | Ga0495672_0003454 | |||
| 1670 | Ga0495672_0008480 | |||
| 1671 | Ga0495676_0019892 | |||
| 1672 | Ga0495676_0026009 | |||
| 1673 | Ga0495676_0074858 | |||
| 1674 | Ga0495676_0081095 | |||
| 1675 | Ga0495680_0004506 | |||
| 1676 | Ga0495680_0006513 | |||
| 1677 | Ga0495680_0006824 | |||
| 1678 | Ga0495680_0040769 | |||
| 1679 | Ga0495675_0001883 | |||
| 1680 | Ga0495679_020418 | |||
| 1681 | Ga0495685_039295 | |||
| 1682 | Ga0495684_0000390 | |||
| 1683 | Ga0495684_0000497 | |||
| 1684 | Ga0495684_0010904 | |||
| 1685 | Ga0495686_0000594 | |||
| 1686 | Ga0495686_0012069 | |||
| 1687 | Ga0495593_0000370 | |||
| 1688 | Ga0495593_0014868 | |||
| 1689 | Ga0495593_0023490 | |||
| 1690 | Ga0495602_0000211 | |||
| 1691 | Ga0495602_0106400 | |||
| 1692 | Ga0495614_0006439 | |||
| 1693 | Ga0495614_0009598 | |||
| 1694 | Ga0495626_0045337 | |||
| 1695 | Ga0496100_0085353 | |||
| 1696 | Ga0496101_0002598 | |||
| 1697 | Ga0496101_0052904 | |||
| 1698 | Ga0496101_0066250 | |||
| 1699 | Ga0496101_0076120 | |||
| 1700 | Ga0496102_0005580 | |||
| 1701 | Ga0496102_0010961 | |||
| 1702 | Ga0496102_0080609 | |||
| 1703 | Ga0496102_0081296 | |||
| 1704 | Ga0496103_0003333 | |||
| 1705 | Ga0496103_0016121 | |||
| 1706 | Ga0496103_0068711 | |||
| 1707 | Ga0496104_0000351 | |||
| 1708 | Ga0496104_0001036 | |||
| 1709 | Ga0496104_0002273 | |||
| 1710 | Ga0496104_0014542 | |||
| 1711 | Ga0496104_0027519 | |||
| 1712 | Ga0496104_0036781 | |||
| 1713 | Ga0496104_0064476 | |||
| 1714 | Ga0496104_0141127 | |||
| 1715 | Ga0496105_0001783 | |||
| 1716 | Ga0496105_0006479 | |||
| 1717 | Ga0496105_0017163 | |||
| 1718 | Ga0496106_0000788 | |||
| 1719 | Ga0496106_0010763 | |||
| 1720 | Ga0496106_0028407 | |||
| 1721 | Ga0496106_0088273 | |||
| 1722 | Ga0496107_0003552 | |||
| 1723 | Ga0496107_0004819 | |||
| 1724 | Ga0496107_0013855 | |||
| 1725 | Ga0496107_0065572 | |||
| 1726 | Ga0496107_0180590 | |||
| 1727 | Ga0496108_0008220 | |||
| 1728 | Ga0496108_0017871 | |||
| 1729 | Ga0496109_0004783 | |||
| 1730 | Ga0496109_0016169 | |||
| 1731 | Ga0496109_0043085 | |||
| 1732 | Ga0496110_0024050 | |||
| 1733 | Ga0496110_0094582 | |||
| 1734 | Ga0496111_0002946 | |||
| 1735 | Ga0496111_0020031 | |||
| 1736 | Ga0496111_0020392 | |||
| 1737 | Ga0496112_0000018 | |||
| 1738 | Ga0496112_0030393 | |||
| 1739 | Ga0496112_0035815 | |||
| 1740 | Ga0496112_0053613 | |||
| 1741 | Ga0496112_0190737 | |||
| 1742 | Ga0496113_0001245 | |||
| 1743 | Ga0496113_0187818 | |||
| 1744 | Ga0496113_0277766 | |||
| 1745 | Ga0496114_0094050 | |||
| 1746 | Ga0496114_0182303 | |||
| 1747 | Ga0496115_0004857 | |||
| 1748 | Ga0496115_0008114 | |||
| 1749 | Ga0496115_0019196 | |||
| 1750 | Ga0496115_0050174 | |||
| 1751 | Ga0496115_0196668 | |||
| 1752 | Ga0496115_0210671 | |||
| 1753 | Ga0496117_0007128 | |||
| 1754 | Ga0496118_0003592 | |||
| 1755 | Ga0496119_0016379 | |||
| 1756 | Ga0496121_0000640 | |||
| 1757 | Ga0496121_0002920 | |||
| 1758 | Ga0496121_0046507 | |||
| 1759 | Ga0496121_0080257 | |||
| 1760 | Ga0496124_0000275 | |||
| 1761 | Ga0496124_0002189 | |||
| 1762 | Ga0496125_0085843 | |||
| 1763 | Ga0496125_0108506 | |||
| 1764 | Ga0496126_0016879 | |||
| 1765 | Ga0496126_0018354 | |||
| 1766 | Ga0496126_0043259 | |||
| 1767 | Ga0496126_0251070 | |||
| 1768 | Ga0496126_0254995 | |||
| 1769 | Ga0501032_0024651 | |||
| 1770 | Ga0501033_0028780 | |||
| 1771 | Ga0501033_0148490 | |||
| 1772 | Ga0501034_0001022 | |||
| 1773 | Ga0501034_0014334 | |||
| 1774 | Ga0501034_0038754 | |||
| 1775 | Ga0501034_0178387 | |||
| 1776 | Ga0501034_0222791 | |||
| 1777 | Ga0501036_0027252 | |||
| 1778 | Ga0501036_0354028 | |||
| 1779 | Ga0501037_0009609 | |||
| 1780 | Ga0501038_0019762 | |||
| 1781 | Ga0501039_0242262 | |||
| 1782 | Ga0501040_0055239 | |||
| 1783 | Ga0501040_0097232 | |||
| 1784 | Ga0501042_0279456 | |||
| 1785 | Ga0501043_0025912 | |||
| 1786 | Ga0501043_0047588 | |||
| 1787 | Ga0501046_0020459 | |||
| 1788 | Ga0501046_0054282 | |||
| 1789 | Ga0501046_0154294 | |||
| 1790 | Ga0501047_0006577 | |||
| 1791 | Ga0501047_0030016 | |||
| 1792 | Ga0501047_0045077 | |||
| 1793 | Ga0501047_0147341 | |||
| 1794 | Ga0501047_0404951 | |||
| 1795 | Ga0501048_0020654 | |||
| 1796 | Ga0501067_0073025 | |||
| 1797 | Ga0501068_0004420 | |||
| 1798 | Ga0501068_0009601 | |||
| 1799 | Ga0501069_0048333 | |||
| 1800 | Ga0501069_0217426 | |||
| 1801 | Ga0501069_0234239 | |||
| 1802 | Ga0501070_0000159 | |||
| 1803 | Ga0501070_0040110 | |||
| 1804 | Ga0501070_0065903 | |||
| 1805 | Ga0501070_0110989 | |||
| 1806 | Ga0501071_0002327 | |||
| 1807 | Ga0501071_0156297 | |||
| 1808 | Ga0501072_0003943 | |||
| 1809 | Ga0501073_0014744 | |||
| 1810 | Ga0501074_0037719 | |||
| 1811 | Ga0501074_0070751 | |||
| 1812 | Ga0501075_0099533 | |||
| 1813 | Ga0501075_0191271 | |||
| 1814 | Ga0501076_0014001 | |||
| 1815 | Ga0501077_0043126 | |||
| 1816 | Ga0501077_0045111 | |||
| 1817 | Ga0501077_0068057 | |||
| 1818 | Ga0501079_0018470 | |||
| 1819 | Ga0501079_0043467 | |||
| 1820 | Ga0501080_0018607 | |||
| 1821 | Ga0501080_0028752 | |||
| 1822 | Ga0501080_0048274 | |||
| 1823 | Ga0501081_0014089 | |||
| 1824 | Ga0501081_0249094 | |||
| 1825 | Ga0501083_0054348 | |||
| 1826 | Ga0501083_0092870 | |||
| 1827 | Ga0501035_0014245 | |||
| 1828 | Ga0501035_0028749 | |||
| 1829 | Ga0501044_0015230 | |||
| 1830 | Ga0501044_0017958 | |||
| 1831 | Ga0501044_0019088 | |||
| 1832 | Ga0501044_0262568 | |||
| 1833 | Ga0501045_0029797 | |||
| 1834 | nmdc:mga03n38_36667_c1 | |||
| 1835 | nmdc:mga00v17_29480_c1 | |||
| 1836 | nmdc:mga0yw44_192698_c1 | |||
| 1837 | nmdc:mga0yw44_237105_c1 | |||
| 1838 | nmdc:mga0yw44_9722_c1 | |||
| 1839 | nmdc:mga0k408_137154_c1 | |||
| 1840 | nmdc:mga0k408_2759_c1 | |||
| 1841 | nmdc:mga06z11_35422_c1 | |||
| 1842 | nmdc:mga06z11_46344_c1 | |||
| 1843 | nmdc:mga04h51_12622_c1 | |||
| 1844 | nmdc:mga04h51_31966_c1 | |||
| 1845 | nmdc:mga04h51_5275_c1 | |||
| 1846 | nmdc:mga07m45_63918_c1 | |||
| 1847 | nmdc:mga05p37_10233_c1 | |||
| 1848 | nmdc:mga05p37_14407_c1 | |||
| 1849 | nmdc:mga05p37_35871_c1 | |||
| 1850 | nmdc:mga05p37_613903_c1 | |||
| 1851 | nmdc:mga05p37_8147_c1 | |||
| 1852 | nmdc:mga09592_9750_c1 | |||
| 1853 | nmdc:mga0qj67_106070_c1 | |||
| 1854 | nmdc:mga0qj67_125999_c1 | |||
| 1855 | nmdc:mga0qj67_215_c1 | |||
| 1856 | nmdc:mga0qj67_4314_c1 | |||
| 1857 | nmdc:mga06r32_12515_c1 | |||
| 1858 | nmdc:mga06r32_298941_c1 | |||
| 1859 | nmdc:mga06r32_316_c1 | |||
| 1860 | nmdc:mga06r32_4487_c1 | |||
| 1861 | nmdc:mga06r32_6439_c1 | |||
| 1862 | nmdc:mga08y16_112174_c1 | |||
| 1863 | nmdc:mga08y16_145004_c1 | |||
| 1864 | nmdc:mga08y16_181255_c1 | |||
| 1865 | nmdc:mga08y16_275602_c1 | |||
| 1866 | nmdc:mga08y16_285812_c1 | |||
| 1867 | nmdc:mga08y16_35913_c1 | |||
| 1868 | nmdc:mga08y16_39014_c1 | |||
| 1869 | nmdc:mga08y16_90_c1 | |||
| 1870 | nmdc:mga0n895_107074_c1 | |||
| 1871 | nmdc:mga0n895_132917_c1 | |||
| 1872 | nmdc:mga0n895_289991_c1 | |||
| 1873 | nmdc:mga0n895_416731_c1 | |||
| 1874 | nmdc:mga0n895_48615_c1 | |||
| 1875 | nmdc:mga0rr50_19557_c1 | |||
| 1876 | nmdc:mga08x19_106181_c1 | |||
| 1877 | nmdc:mga08x19_4_c2 | |||
| 1878 | nmdc:mga0a205_100278_c1 | |||
| 1879 | nmdc:mga0a205_234517_c1 | |||
| 1880 | nmdc:mga0sz30_11159_c1 | |||
| 1881 | Ga0495601_0000008 | |||
| 1882 | Ga0495601_0007499 | |||
| 1883 | Ga0495601_0018585 | |||
| 1884 | Ga0495612_0000844 | |||
| 1885 | Ga0495612_0000950 | |||
| 1886 | Ga0495612_0071997 | |||
| 1887 | Ga0500635_0005887 | |||
| 1888 | Ga0495655_0014821 | |||
| 1889 | Ga0495595_0000155 | |||
| 1890 | Ga0495595_0001465 | |||
| 1891 | Ga0495595_0002145 | |||
| 1892 | Ga0495619_0000033 | |||
| 1893 | Ga0495619_0006338 | |||
| 1894 | Ga0495619_0014717 | |||
| 1895 | Ga0495619_0033588 | |||
| 1896 | Ga0500578_0102638 | |||
| 1897 | Ga0500583_0193073 | |||
| 1898 | Ga0500651_0056821 | |||
| 1899 | Ga0500566_0001625 | |||
| 1900 | Ga0500566_0124910 | |||
| 1901 | Ga0500641_0029827 | |||
| 1902 | Ga0500554_000124 | |||
| 1903 | Ga0500592_004822 | |||
| 1904 | Ga0500595_000095 | |||
| 1905 | Ga0500595_002960 | |||
| 1906 | Ga0500595_039754 | |||
| 1907 | Ga0500568_0005538 | |||
| 1908 | Ga0500590_002067 | |||
| 1909 | Ga0500603_000738 | |||
| 1910 | Ga0500620_055445 | |||
| 1911 | Ga0500627_0001582 | |||
| 1912 | Ga0500627_0111877 | |||
| 1913 | Ga0500638_006677 | |||
| 1914 | Ga0500636_0002059 | |||
| 1915 | Ga0500636_0008900 | |||
| 1916 | Ga0500637_0000495 | |||
| 1917 | Ga0500637_0001452 | |||
| 1918 | Ga0500609_011430 | |||
| 1919 | Ga0501084_0023932 | |||
| 1920 | Ga0501084_0063910 | |||
| 1921 | Ga0501084_0071273 | |||
| 1922 | Ga0501084_0071724 | |||
| 1923 | Ga0501084_0223415 | |||
| 1924 | Ga0501082_0000013 | |||
| 1925 | Ga0501082_0010354 | |||
| 1926 | Ga0501082_0255475 | |||
| 1927 | Ga0530510_0150122 | |||
| 1928 | Ga0530510_0168441 | |||
| 1929 | 2509152562 | |||
| 1930 | 2513698863 | |||
| 1931 | 2774868664 | |||
| 1932 | 2792745559 | |||
| 1933 | 2793079172 | |||
| 1934 | 2855734447 | |||
| 1935 | 2855770037 | |||
| 1936 | 2874610507 | |||
| 1937 | 2876818202 | |||
| 1938 | 2879115150 | |||
| 1939 | 2881414278 | |||
| 1940 | 2889035188 | |||
| 1941 | 2922363284 | |||
| 1942 | 8006969408 | |||
| 1943 | 8006988456 | |||
| 1944 | 8056678590 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oud-assembly1.cif.gz_AAA | crystal structure of a ternary complex of the flavoprotein monooxygenase grho5 with fad and collinone | 0.9554 | 299 | 328 |
| 5g3s-assembly1.cif.gz_A | the structure of the l-tryptophan oxidase vioa from chromobacterium violaceum - samarium derivative | 0.9376 | 299 | 328 |
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9359 | 4 | 237 |
| 5zbd-assembly1.cif.gz_B | crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum | 0.9305 | 299 | 328 |
| 6esd-assembly1.cif.gz_B | crystal structure of l-tryptophan oxidase vioa from chromobacterium violaceum | 0.9283 | 299 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9729 | 2 | 220 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9662 | 2 | 220 | 3.40.50.300 |
| 2awnA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9604 | 2 | 220 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9576 | 1 | 221 | 3.40.50.300 |
| 1oxuA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9572 | 1 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9DFL4-F1-model_v4 | ABC transporter domain-containing protein | 0.9689 | 4 | 163 |
GO:0005524
GO:0016887 |
| AF-A0A382V5S9-F1-model_v4 | ABC transporter domain-containing protein | 0.966 | 49 | 195 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A7X9BG07-F1-model_v4 | ABC transporter ATP-binding protein | 0.9644 | 4 | 190 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-U3BNP7-F1-model_v4 | Putative ABC transporter ATP-binding protein | 0.9644 | 81 | 218 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
| AF-A0A4Q3TF12-F1-model_v4 | ABC transporter ATP-binding protein | 0.9587 | 1 | 159 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |