F487154

General Info

Members Datasets Scaffolds Average Seq Length
972 504 1944 166

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10291420|Ga0265339_102914202
Length 166
Sequence MVAVAHDDTELRQRAWNAAATVVDPEIPVLTIADLGVLRDVKVSDGHVEVAITPTYSGCPAMNMIALEIELALERAGIERPKINTVLAPAWTTEWMSEDGRRKLREYGIAPPASHSRRALFGEQRVACPRCGSGDTEVLSEFGSTSCKALWRCRSCREPFDYFKCH

Samples

Sample ID Description Type Environment
1 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
80 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
81 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
100 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
244 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
245 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
408 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
409 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
410 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
411 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
414 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
423 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
424 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
433 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
437 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
438 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
439 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
440 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
441 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
442 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
443 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
444 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
445 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
446 2643221651 Afipia sp. Root123D2 Isolate Unclassified
447 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
448 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
449 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
450 2791355199
451 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
452 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
453 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
454 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
455 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
456 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
457 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
458 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
459 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
460 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
461 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
462 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
463 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
464 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
465 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
466 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
467 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
468 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
469 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
470 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
471 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
472 2904699407
473 2906610324
474 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
475 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
476 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
477 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
478 2922425934
479 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
480 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
481 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
482 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
483 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
484 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
485 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
486 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
487 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
488 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
489 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
490 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
491 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
492 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
493 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
494 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
495 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
496 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
497 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
498 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
499 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
500 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
501 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
502 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
503 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
504 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0.31
Isolates 6.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.49
Nodule 5.35
Rhizoplane 7.51
Rhizosphere 67.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265339_10291420 3300031249 Bacteria 780
2 JGI25153J46596_10005183 3300003215 Bacteria 6862
3 JGI25153J46596_10009625 3300003215 Bacteria 4459
4 JGI25160J50197_1024252 3300003354 Bacteria 1725
5 JGI25404J52841_10020436 3300003659 Bacteria 1434
6 JGI25404J52841_10025485 3300003659 Bacteria 1274
7 Ga0055526_1024889 3300003771 Bacteria 1939
8 Ga0065165_1001202 3300005262 Bacteria 29912
9 Ga0070658_10008337 3300005327 Bacteria 8336
10 Ga0070658_10111237 3300005327 Bacteria 2269
11 Ga0070676_10345369 3300005328 Bacteria 1022
12 Ga0070683_100045280 3300005329 Bacteria 4060
13 Ga0070683_100693147 3300005329 Bacteria 975
14 Ga0070670_100246178 3300005331 Bacteria 1557
15 Ga0070670_101247743 3300005331 Bacteria 680
16 Ga0068869_100231131 3300005334 Bacteria 1469
17 Ga0068869_100333104 3300005334 Bacteria 1234
18 Ga0070666_10302331 3300005335 Bacteria 1139
19 Ga0070666_10724916 3300005335 Bacteria 730
20 Ga0070666_10907284 3300005335 Bacteria 652
21 Ga0070680_100011788 3300005336 Bacteria 6780
22 Ga0070680_100023435 3300005336 Bacteria 4923
23 Ga0070680_100077214 3300005336 Bacteria 2743
24 Ga0070680_100173751 3300005336 Bacteria 1814
25 Ga0070680_100385408 3300005336 Bacteria 1194
26 Ga0068868_100144837 3300005338 Bacteria 1953
27 Ga0070660_100075675 3300005339 Bacteria 2636
28 Ga0070687_100096388 3300005343 Bacteria 1647
29 Ga0070661_100376860 3300005344 Bacteria 1118
30 Ga0070668_100022289 3300005347 Bacteria 4787
31 Ga0070668_100252095 3300005347 Bacteria 1465
32 Ga0070668_100763719 3300005347 Bacteria 856
33 Ga0070668_101061988 3300005347 Bacteria 730
34 Ga0070669_100365132 3300005353 Bacteria 1175
35 Ga0070669_101386957 3300005353 Bacteria 610
36 Ga0070674_100046094 3300005356 Bacteria 2981
37 Ga0070674_100232794 3300005356 Bacteria 1439
38 Ga0070674_100328961 3300005356 Bacteria 1228
39 Ga0070673_100137688 3300005364 Bacteria 2057
40 Ga0070688_100346145 3300005365 Bacteria 1087
41 Ga0070659_100200941 3300005366 Bacteria 1641
42 Ga0070667_100152984 3300005367 Bacteria 2027
43 Ga0070667_100318728 3300005367 Bacteria 1402
44 Ga0070667_101530291 3300005367 Bacteria 627
45 Ga0070709_10006994 3300005434 Bacteria 6165
46 Ga0070709_10017477 3300005434 Bacteria 4115
47 Ga0070709_10618229 3300005434 Bacteria 836
48 Ga0070714_101026931 3300005435 Bacteria 803
49 Ga0070713_100041670 3300005436 Bacteria 3742
50 Ga0070713_100078828 3300005436 Bacteria 2805
51 Ga0070710_10043234 3300005437 Bacteria 2494
52 Ga0070710_10097384 3300005437 Bacteria 1745
53 Ga0070710_10350795 3300005437 Bacteria 977
54 Ga0070710_10468605 3300005437 Bacteria 857
55 Ga0070711_100024755 3300005439 Bacteria 3920
56 Ga0070711_100205186 3300005439 Bacteria 1523
57 Ga0070700_100183027 3300005441 Bacteria 1460
58 Ga0070694_100282062 3300005444 Bacteria 1267
59 Ga0070663_100007024 3300005455 Bacteria 6822
60 Ga0070663_100075171 3300005455 Bacteria 2468
61 Ga0070663_100112292 3300005455 Bacteria 2049
62 Ga0070663_100488303 3300005455 Bacteria 1021
63 Ga0070678_101053014 3300005456 Bacteria 749
64 Ga0070662_100141579 3300005457 Bacteria 1864
65 Ga0070681_10000756 3300005458 Bacteria 26836
66 Ga0070681_10008357 3300005458 Bacteria 10139
67 Ga0070681_10041893 3300005458 Bacteria 4590
68 Ga0070681_10054611 3300005458 Bacteria 3981
69 Ga0070681_10171913 3300005458 Bacteria 2089
70 Ga0070681_10852437 3300005458 Bacteria 829
71 Ga0070706_100569866 3300005467 Bacteria 1053
72 Ga0070707_100348850 3300005468 Bacteria 1437
73 Ga0070698_100795263 3300005471 Bacteria 890
74 Ga0070679_100012531 3300005530 Bacteria 8109
75 Ga0070679_100030670 3300005530 Bacteria 5310
76 Ga0070679_100114454 3300005530 Bacteria 2683
77 Ga0070679_100439223 3300005530 Bacteria 1250
78 Ga0070679_100801962 3300005530 Bacteria 885
79 Ga0070684_100026065 3300005535 Bacteria 4920
80 Ga0070684_100050418 3300005535 Bacteria 3615
81 Ga0070684_100592902 3300005535 Bacteria 1030
82 Ga0068853_100177402 3300005539 Bacteria 1931
83 Ga0068853_100600748 3300005539 Bacteria 1045
84 Ga0068853_100807061 3300005539 Bacteria 899
85 Ga0070695_100265649 3300005545 Bacteria 1255
86 Ga0070696_100319848 3300005546 Bacteria 1194
87 Ga0070665_100027464 3300005548 Bacteria 5733
88 Ga0070665_100062865 3300005548 Bacteria 3722
89 Ga0070665_100129523 3300005548 Bacteria 2525
90 Ga0070665_100978000 3300005548 Bacteria 859
91 Ga0070704_100602397 3300005549 Bacteria 966
92 Ga0068855_100048449 3300005563 Bacteria 5014
93 Ga0068855_100315677 3300005563 Bacteria 1728
94 Ga0068855_101109349 3300005563 Bacteria 827
95 Ga0068855_101232556 3300005563 Bacteria 777
96 Ga0070664_101149414 3300005564 Bacteria 732
97 Ga0068857_100662426 3300005577 Bacteria 990
98 Ga0068857_100778429 3300005577 Bacteria 913
99 Ga0068857_100901516 3300005577 Bacteria 848
100 Ga0068854_100074179 3300005578 Bacteria 2495
101 Ga0068854_100411915 3300005578 Bacteria 1121
102 Ga0068856_100000340 3300005614 Bacteria 51206
103 Ga0068856_100075874 3300005614 Bacteria 3330
104 Ga0068856_100261192 3300005614 Bacteria 1747
105 Ga0068852_100100234 3300005616 Bacteria 2613
106 Ga0068852_100936855 3300005616 Bacteria 884
107 Ga0068852_100966378 3300005616 Bacteria 870
108 Ga0068859_100199852 3300005617 Bacteria 2083
109 Ga0068866_10091382 3300005718 Bacteria 1658
110 Ga0068861_100045875 3300005719 Bacteria 3293
111 Ga0068861_100096824 3300005719 Bacteria 2339
112 Ga0068861_100197064 3300005719 Bacteria 1688
113 Ga0068863_101029569 3300005841 Bacteria 827
114 Ga0068858_100188098 3300005842 Bacteria 1951
115 Ga0068858_100217735 3300005842 Bacteria 1808
116 Ga0068860_100263084 3300005843 Bacteria 1682
117 Ga0068860_100450568 3300005843 Bacteria 1279
118 Ga0068860_100877223 3300005843 Bacteria 913
119 Ga0068862_100054213 3300005844 Bacteria 3433
120 Ga0068862_100085542 3300005844 Bacteria 2740
121 Ga0068862_100383466 3300005844 Bacteria 1311
122 Ga0068862_101259724 3300005844 Bacteria 740
123 Ga0081455_10013421 3300005937 Bacteria 8099
124 Ga0081455_10045584 3300005937 Bacteria 3814
125 Ga0081455_10052827 3300005937 Bacteria 3476
126 Ga0081455_10062518 3300005937 Bacteria 3129
127 Ga0081455_10103597 3300005937 Bacteria 2278
128 Ga0081455_10201735 3300005937 Bacteria 1489
129 Ga0081540_1000884 3300005983 Bacteria 27058
130 Ga0081540_1002354 3300005983 Bacteria 15445
131 Ga0081540_1002428 3300005983 Bacteria 15177
132 Ga0081540_1008459 3300005983 Bacteria 7186
133 Ga0081540_1009606 3300005983 Bacteria 6653
134 Ga0081540_1010360 3300005983 Bacteria 6322
135 Ga0081540_1010807 3300005983 Bacteria 6137
136 Ga0081540_1014134 3300005983 Bacteria 5137
137 Ga0081540_1040050 3300005983 Bacteria 2448
138 Ga0081540_1081225 3300005983 Bacteria 1459
139 Ga0081540_1120430 3300005983 Bacteria 1090
140 Ga0081539_10000542 3300005985 Bacteria 78012
141 Ga0081539_10032961 3300005985 Bacteria 3163
142 Ga0070717_10088462 3300006028 Bacteria 2611
143 Ga0070717_10128746 3300006028 Bacteria 2175
144 Ga0075365_10008590 3300006038 Bacteria 5814
145 Ga0075365_10031972 3300006038 Bacteria 3379
146 Ga0075368_10060749 3300006042 Bacteria 1513
147 Ga0075363_100026745 3300006048 Bacteria 2953
148 Ga0075363_100040702 3300006048 Bacteria 2450
149 Ga0075363_100438250 3300006048 Bacteria 771
150 Ga0075364_10119202 3300006051 Bacteria 1765
151 Ga0075364_10236749 3300006051 Bacteria 1240
152 Ga0075364_10475062 3300006051 Bacteria 854
153 Ga0070716_100094260 3300006173 Bacteria 1819
154 Ga0070716_100952438 3300006173 Bacteria 676
155 Ga0070712_100006504 3300006175 Bacteria 7252
156 Ga0075362_10074419 3300006177 Bacteria 1556
157 Ga0075362_10127185 3300006177 Bacteria 1209
158 Ga0075367_10019514 3300006178 Bacteria 3761
159 Ga0075367_10383223 3300006178 Bacteria 888
160 Ga0075369_10077140 3300006186 Bacteria 1474
161 Ga0075366_10268078 3300006195 Bacteria 1043
162 Ga0097621_100377390 3300006237 Bacteria 1266
163 Ga0075370_10134575 3300006353 Bacteria 1443
164 Ga0075428_100096364 3300006844 Bacteria 3224
165 Ga0075428_100658563 3300006844 Bacteria 1116
166 Ga0075434_100005333 3300006871 Bacteria 11699
167 Ga0075434_100343846 3300006871 Bacteria 1513
168 Ga0068865_100144261 3300006881 Bacteria 1799
169 Ga0068865_100323818 3300006881 Bacteria 1241
170 Ga0068865_100628154 3300006881 Bacteria 911
171 Ga0097620_100199858 3300006931 Bacteria 2083
172 Ga0099825_1051714 3300006941 Bacteria 863
173 Ga0099824_1006123 3300006942 Bacteria 16665
174 Ga0099822_1000072 3300006943 Bacteria 55118
175 Ga0075435_100071016 3300007076 Bacteria 2843
176 Ga0099795_10178689 3300007788 Bacteria 885
177 Ga0099795_10187035 3300007788 Bacteria 868
178 Ga0105244_10344465 3300009036 Bacteria 687
179 Ga0105240_11405071 3300009093 Bacteria 734
180 Ga0111539_11012516 3300009094 Bacteria 966
181 Ga0105245_10086519 3300009098 Bacteria 2875
182 Ga0105245_10290768 3300009098 Bacteria 1600
183 Ga0105245_11014220 3300009098 Bacteria 875
184 Ga0105247_10304654 3300009101 Bacteria 1106
185 Ga0105247_10480483 3300009101 Bacteria 901
186 Ga0114129_10162673 3300009147 Bacteria 3047
187 Ga0105243_10584271 3300009148 Bacteria 1073
188 Ga0105243_10790202 3300009148 Bacteria 934
189 Ga0105243_11286766 3300009148 Bacteria 748
190 Ga0105241_10472277 3300009174 Bacteria 1113
191 Ga0105241_10967677 3300009174 Bacteria 794
192 Ga0105248_10709692 3300009177 Bacteria 1135
193 Ga0105248_10817744 3300009177 Bacteria 1052
194 Ga0105248_11845474 3300009177 Bacteria 686
195 Ga0105237_10295820 3300009545 Bacteria 1622
196 Ga0105237_10634281 3300009545 Bacteria 1075
197 Ga0105237_10797225 3300009545 Bacteria 951
198 Ga0105237_10862328 3300009545 Bacteria 912
199 Ga0105238_10562351 3300009551 Bacteria 1146
200 Ga0105238_10637045 3300009551 Bacteria 1075
201 Ga0105238_11248809 3300009551 Bacteria 768
202 Ga0105238_11307733 3300009551 Bacteria 751
203 Ga0105238_12316978 3300009551 Bacteria 572
204 Ga0105249_10211077 3300009553 Bacteria 1905
205 Ga0099796_10225702 3300010159 Bacteria 769
206 Ga0105239_10450157 3300010375 Bacteria 1461
207 Ga0105239_11399262 3300010375 Bacteria 807
208 Ga0105239_11806874 3300010375 Bacteria 708
209 Ga0105246_10213760 3300011119 Bacteria 1507
210 Ga0157337_1011660 3300012483 Bacteria 698
211 Ga0157338_1030019 3300012515 Bacteria 688
212 Ga0157371_10269106 3300013102 Bacteria 1229
213 Ga0157370_10362219 3300013104 Bacteria 1336
214 Ga0157369_10013821 3300013105 Bacteria 9125
215 Ga0157369_10016472 3300013105 Bacteria 8313
216 Ga0157369_10338476 3300013105 Bacteria 1563
217 Ga0157374_10090035 3300013296 Bacteria 2924
218 Ga0157374_10721285 3300013296 Bacteria 1011
219 Ga0157378_10015018 3300013297 Bacteria 6779
220 Ga0157378_10510073 3300013297 Bacteria 1203
221 Ga0163162_10317102 3300013306 Bacteria 1692
222 Ga0163162_10631226 3300013306 Bacteria 1196
223 Ga0163162_11201585 3300013306 Bacteria 860
224 Ga0163162_12025339 3300013306 Bacteria 660
225 Ga0157372_10082303 3300013307 Bacteria 3644
226 Ga0157375_10240297 3300013308 Bacteria 1971
227 Ga0157375_10333255 3300013308 Bacteria 1682
228 Ga0157375_11388948 3300013308 Bacteria 827
229 Ga0163163_10061861 3300014325 Bacteria 3709
230 Ga0163163_10403465 3300014325 Bacteria 1425
231 Ga0157380_10022165 3300014326 Bacteria 4776
232 Ga0157380_10229774 3300014326 Bacteria 1665
233 Ga0157377_10685790 3300014745 Bacteria 742
234 Ga0157379_10299796 3300014968 Bacteria 1465
235 Ga0157379_10404680 3300014968 Bacteria 1255
236 Ga0163161_10186599 3300017792 Bacteria 1592
237 Ga0163161_10373352 3300017792 Bacteria 1138
238 Ga0163161_10528388 3300017792 Bacteria 964
239 Ga0206356_10178820 3300020070 Bacteria 915
240 Ga0206354_10650453 3300020081 Bacteria 968
241 Ga0213873_10023488 3300021358 Bacteria 1470
242 Ga0224712_10123360 3300022467 Bacteria 1124
243 Ga0207425_1032559 3300025245 Bacteria 1031
244 Ga0209233_1015403 3300025261 Bacteria 2129
245 Ga0209233_1047667 3300025261 Bacteria 889
246 Ga0209233_1062482 3300025261 Bacteria 714
247 Ga0209455_1030573 3300025272 Bacteria 916
248 Ga0209673_1031606 3300025273 Bacteria 1644
249 Ga0209564_1005446 3300025295 Bacteria 7272
250 Ga0209758_1000133 3300025297 Bacteria 182442
251 Ga0209758_1002089 3300025297 Bacteria 21240
252 Ga0209758_1004997 3300025297 Bacteria 10594
253 Ga0209758_1008659 3300025297 Bacteria 6529
254 Ga0209758_1013980 3300025297 Bacteria 4317
255 Ga0209758_1029337 3300025297 Bacteria 2303
256 Ga0207426_1000800 3300025302 Bacteria 34038
257 Ga0207697_10141637 3300025315 Bacteria 1043
258 Ga0207682_10348884 3300025893 Bacteria 697
259 Ga0207692_10024398 3300025898 Bacteria 2811
260 Ga0207692_10296443 3300025898 Bacteria 983
261 Ga0207642_10008960 3300025899 Bacteria 3460
262 Ga0207642_10110775 3300025899 Bacteria 1397
263 Ga0207688_10019453 3300025901 Bacteria 3701
264 Ga0207680_10069136 3300025903 Bacteria 2181
265 Ga0207680_10190647 3300025903 Bacteria 1391
266 Ga0207647_10077264 3300025904 Bacteria 2001
267 Ga0207699_10199413 3300025906 Bacteria 1355
268 Ga0207699_10255167 3300025906 Bacteria 1210
269 Ga0207645_10068423 3300025907 Bacteria 2271
270 Ga0207645_10201091 3300025907 Bacteria 1311
271 Ga0207645_10416611 3300025907 Bacteria 904
272 Ga0207643_10108489 3300025908 Bacteria 1633
273 Ga0207705_10013516 3300025909 Bacteria 5891
274 Ga0207705_10407743 3300025909 Bacteria 1051
275 Ga0207705_10669407 3300025909 Bacteria 807
276 Ga0207684_10040661 3300025910 Bacteria 3941
277 Ga0207707_10000605 3300025912 Bacteria 36107
278 Ga0207707_10081043 3300025912 Bacteria 2833
279 Ga0207707_10087270 3300025912 Bacteria 2726
280 Ga0207707_10155189 3300025912 Bacteria 2002
281 Ga0207707_10486645 3300025912 Bacteria 1053
282 Ga0207695_10065613 3300025913 Bacteria 3732
283 Ga0207695_10082341 3300025913 Bacteria 3254
284 Ga0207671_10069159 3300025914 Bacteria 2632
285 Ga0207671_10956327 3300025914 Bacteria 676
286 Ga0207693_10310930 3300025915 Bacteria 1234
287 Ga0207663_10006759 3300025916 Bacteria 5901
288 Ga0207660_10010489 3300025917 Bacteria 6017
289 Ga0207660_10102184 3300025917 Bacteria 2142
290 Ga0207660_10463027 3300025917 Bacteria 1026
291 Ga0207662_10352034 3300025918 Bacteria 989
292 Ga0207657_10095073 3300025919 Bacteria 2480
293 Ga0207657_10140293 3300025919 Bacteria 1975
294 Ga0207649_10682743 3300025920 Bacteria 795
295 Ga0207652_10036652 3300025921 Bacteria 4146
296 Ga0207652_10059776 3300025921 Bacteria 3286
297 Ga0207652_10323803 3300025921 Bacteria 1391
298 Ga0207652_10387829 3300025921 Bacteria 1260
299 Ga0207646_10246797 3300025922 Bacteria 1613
300 Ga0207646_10509791 3300025922 Bacteria 1083
301 Ga0207681_10274260 3300025923 Bacteria 1325
302 Ga0207681_11092498 3300025923 Bacteria 670
303 Ga0207694_10392228 3300025924 Bacteria 1154
304 Ga0207694_10607480 3300025924 Bacteria 920
305 Ga0207659_10177983 3300025926 Bacteria 1683
306 Ga0207687_10061601 3300025927 Bacteria 2650
307 Ga0207700_10007806 3300025928 Bacteria 6575
308 Ga0207700_10217760 3300025928 Bacteria 1617
309 Ga0207644_10362680 3300025931 Bacteria 1179
310 Ga0207706_10127675 3300025933 Bacteria 2236
311 Ga0207686_10235539 3300025934 Bacteria 1330
312 Ga0207709_10271138 3300025935 Bacteria 1249
313 Ga0207709_10633507 3300025935 Bacteria 850
314 Ga0207669_10023150 3300025937 Bacteria 3313
315 Ga0207669_10032232 3300025937 Bacteria 2940
316 Ga0207704_10150524 3300025938 Bacteria 1641
317 Ga0207704_10184217 3300025938 Bacteria 1512
318 Ga0207704_10205850 3300025938 Bacteria 1444
319 Ga0207665_10116100 3300025939 Bacteria 1886
320 Ga0207665_10496128 3300025939 Bacteria 943
321 Ga0207665_10498111 3300025939 Bacteria 941
322 Ga0207691_10091123 3300025940 Bacteria 2732
323 Ga0207711_10292008 3300025941 Bacteria 1503
324 Ga0207711_10330050 3300025941 Bacteria 1411
325 Ga0207689_10231672 3300025942 Bacteria 1526
326 Ga0207661_10004990 3300025944 Bacteria 9302
327 Ga0207661_10037907 3300025944 Bacteria 3774
328 Ga0207679_10574181 3300025945 Bacteria 1014
329 Ga0207679_10959770 3300025945 Bacteria 783
330 Ga0207667_10113814 3300025949 Bacteria 2789
331 Ga0207667_10116497 3300025949 Bacteria 2753
332 Ga0207667_11055924 3300025949 Bacteria 797
333 Ga0207651_10051453 3300025960 Bacteria 2803
334 Ga0207712_10106836 3300025961 Bacteria 2091
335 Ga0207712_10300978 3300025961 Bacteria 1316
336 Ga0207668_10003848 3300025972 Bacteria 8846
337 Ga0207668_10037005 3300025972 Bacteria 3262
338 Ga0207668_10045552 3300025972 Bacteria 2992
339 Ga0207668_10473888 3300025972 Bacteria 1072
340 Ga0207668_10839230 3300025972 Bacteria 815
341 Ga0207640_10070366 3300025981 Bacteria 2353
342 Ga0207640_10125456 3300025981 Bacteria 1847
343 Ga0207640_10354144 3300025981 Bacteria 1180
344 Ga0207658_10139401 3300025986 Bacteria 1960
345 Ga0207658_10157811 3300025986 Bacteria 1856
346 Ga0207677_10667613 3300026023 Bacteria 919
347 Ga0207703_10065651 3300026035 Bacteria 2983
348 Ga0207703_10228312 3300026035 Bacteria 1668
349 Ga0207639_10182851 3300026041 Bacteria 1784
350 Ga0207639_10349227 3300026041 Bacteria 1321
351 Ga0207639_10423695 3300026041 Bacteria 1204
352 Ga0207678_10006578 3300026067 Bacteria 10303
353 Ga0207678_10037538 3300026067 Bacteria 4213
354 Ga0207678_10127300 3300026067 Bacteria 2172
355 Ga0207678_10227500 3300026067 Bacteria 1597
356 Ga0207678_10695245 3300026067 Bacteria 895
357 Ga0207678_11475339 3300026067 Bacteria 601
358 Ga0207708_10223638 3300026075 Bacteria 1509
359 Ga0207702_10000371 3300026078 Bacteria 51217
360 Ga0207702_10071916 3300026078 Bacteria 2980
361 Ga0207702_10221755 3300026078 Bacteria 1762
362 Ga0207702_10931416 3300026078 Bacteria 861
363 Ga0207648_10059458 3300026089 Bacteria 3333
364 Ga0207676_11442411 3300026095 Bacteria 685
365 Ga0207674_10172594 3300026116 Bacteria 2115
366 Ga0207674_10269595 3300026116 Bacteria 1650
367 Ga0207674_10896771 3300026116 Bacteria 855
368 Ga0207675_100113487 3300026118 Bacteria 2558
369 Ga0207675_100514492 3300026118 Bacteria 1193
370 Ga0207683_10161821 3300026121 Bacteria 2024
371 Ga0207683_10320301 3300026121 Bacteria 1420
372 Ga0207698_10272486 3300026142 Bacteria 1561
373 Ga0207698_10678789 3300026142 Bacteria 1023
374 Ga0207698_10838021 3300026142 Bacteria 924
375 Ga0209389_1000001 3300027296 Bacteria 463799
376 Ga0209589_1000011 3300027357 Bacteria 236981
377 Ga0209489_100012 3300027361 Bacteria 236981
378 Ga0209489_102213 3300027361 Bacteria 39761
379 Ga0209700_100007 3300027363 Bacteria 454608
380 Ga0209700_100019 3300027363 Bacteria 236981
381 Ga0268266_10003223 3300028379 Bacteria 16485
382 Ga0268266_10101828 3300028379 Bacteria 2532
383 Ga0268266_10954550 3300028379 Bacteria 829
384 Ga0268265_10011347 3300028380 Bacteria 6026
385 Ga0268265_10070790 3300028380 Bacteria 2713
386 Ga0268265_10187607 3300028380 Bacteria 1782
387 Ga0268265_10543790 3300028380 Bacteria 1101
388 Ga0265334_10038099 3300028573 Bacteria 1893
389 Ga0307517_10060218 3300028786 Bacteria 3619
390 Ga0307517_10202145 3300028786 Bacteria 1240
391 Ga0307517_10313498 3300028786 Bacteria 872
392 Ga0307515_10025133 3300028794 Bacteria 10327
393 Ga0265330_10014164 3300031235 Bacteria 3701
394 Ga0265330_10049498 3300031235 Bacteria 1845
395 Ga0265332_10012435 3300031238 Bacteria 3777
396 Ga0265325_10104256 3300031241 Bacteria 1385
397 Ga0265339_10003547 3300031249 Bacteria 10912
398 Ga0265316_10252334 3300031344 Bacteria 1295
399 Ga0307513_10053911 3300031456 Bacteria 4317
400 Ga0307513_10079920 3300031456 Bacteria 3375
401 Ga0307513_10304471 3300031456 Bacteria 1359
402 Ga0307513_10816974 3300031456 Bacteria 638
403 Ga0307509_10103359 3300031507 Bacteria 2877
404 Ga0307509_10672933 3300031507 Bacteria 702
405 Ga0265313_10009997 3300031595 Bacteria 6076
406 Ga0307508_10000015 3300031616 Bacteria 210182
407 Ga0307508_10087802 3300031616 Bacteria 2694
408 Ga0307508_10328318 3300031616 Bacteria 1121
409 Ga0265314_10003429 3300031711 Bacteria 15321
410 Ga0265314_10148518 3300031711 Bacteria 1440
411 Ga0265314_10300632 3300031711 Bacteria 900
412 Ga0265342_10000319 3300031712 Bacteria 54575
413 Ga0265342_10036572 3300031712 Bacteria 2999
414 Ga0265342_10126917 3300031712 Bacteria 1432
415 Ga0265342_10306417 3300031712 Bacteria 835
416 Ga0307516_10049202 3300031730 Bacteria 4144
417 Ga0307516_10061224 3300031730 Bacteria 3653
418 Ga0307516_10174024 3300031730 Bacteria 1891
419 Ga0307516_10175363 3300031730 Bacteria 1881
420 Ga0307516_10492988 3300031730 Bacteria 880
421 Ga0307516_10631316 3300031730 Bacteria 726
422 Ga0307407_10035514 3300031903 Bacteria 2739
423 Ga0307412_10945872 3300031911 Bacteria 758
424 Ga0307412_11356431 3300031911 Bacteria 642
425 Ga0307409_100384398 3300031995 Bacteria 1335
426 Ga0307416_101292562 3300032002 Bacteria 835
427 Ga0307411_10036600 3300032005 Bacteria 3077
428 Ga0307415_100453831 3300032126 Bacteria 1109
429 Ga0307507_10006824 3300033179 Bacteria 17074
430 Ga0307510_10213041 3300033180 Bacteria 1452
431 Ga0307510_10228048 3300033180 Bacteria 1368
432 Ga0315911_1000002 3300033442 Bacteria 926833
433 Ga0373934_0042367 3300035086 Bacteria 1798
434 Ga0373934_0115022 3300035086 Bacteria 1093
435 Ga0373934_0171816 3300035086 Bacteria 890
436 Ga0373940_0297773 3300035088 Bacteria 555
437 Ga0373944_0041574 3300035089 Bacteria 1423
438 Ga0373923_0022049 3300035111 Bacteria 2493
439 Ga0373936_0075635 3300035113 Bacteria 1394
440 Ga0373941_0064900 3300035115 Bacteria 1197
441 Ga0373953_0001226 3300035117 Bacteria 7311
442 Ga0373953_0118560 3300035117 Bacteria 1123
443 Ga0373954_0000106 3300035118 Bacteria 28189
444 Ga0373954_0251289 3300035118 Bacteria 870
445 Ga0373956_0002664 3300035119 Bacteria 7219
446 Ga0373957_0002275 3300035120 Bacteria 5447
447 Ga0373957_0037135 3300035120 Bacteria 1819
448 Ga0373943_0011391 3300035170 Bacteria 4002
449 Ga0373943_0031042 3300035170 Bacteria 2533
450 Ga0373946_0086970 3300035171 Bacteria 1379
451 Ga0373946_0166095 3300035171 Bacteria 1039
452 Ga0373955_0006932 3300035172 Bacteria 5183
453 Ga0373955_0031168 3300035172 Bacteria 2792
454 Ga0373955_0573532 3300035172 Bacteria 690
455 Ga0373924_0003477 3300035410 Bacteria 5423
456 Ga0373924_0061593 3300035410 Bacteria 1570
457 Ga0373931_0051799 3300035691 Bacteria 2187
458 Ga0373927_0040990 3300035695 Bacteria 3003
459 Ga0373927_0045539 3300035695 Bacteria 2837
460 Ga0373927_0066740 3300035695 Bacteria 2327
461 Ga0373927_0085046 3300035695 Bacteria 2052
462 Ga0373927_0161175 3300035695 Bacteria 1469
463 Ga0373927_0385372 3300035695 Bacteria 924
464 Ga0373927_0692165 3300035695 Bacteria 673
465 Ga0373933_0000296 3300035724 Bacteria 32065
466 Ga0373933_0012615 3300035724 Bacteria 4669
467 Ga0373933_0085632 3300035724 Bacteria 1938
468 Ga0373933_0140333 3300035724 Bacteria 1525
469 Ga0373947_0083894 3300035725 Bacteria 1976
470 Ga0373947_0086831 3300035725 Bacteria 1945
471 Ga0373937_0001389 3300036401 Bacteria 20240
472 Ga0373937_0092562 3300036401 Bacteria 2802
473 Ga0373937_0192322 3300036401 Bacteria 1917
474 Ga0373937_0257071 3300036401 Bacteria 1647
475 Ga0373925_0033668 3300037068 Bacteria 3775
476 Ga0373925_0248168 3300037068 Bacteria 1427
477 Ga0395899_0048670 3300037312 Bacteria 3154
478 Ga0395900_0000939 3300037418 Bacteria 38089
479 Ga0395900_0029520 3300037418 Bacteria 5625
480 Ga0395900_1685868 3300037418 Bacteria 545
481 Ga0395898_0002686 3300037466 Bacteria 20580
482 Ga0395898_0335996 3300037466 Bacteria 1441
483 Ga0395905_0010169 3300037471 Bacteria 9169
484 Ga0395905_0202241 3300037471 Bacteria 1862
485 Ga0436364_1366806 3300037853 Bacteria 1610
486 Ga0395901_0044498 3300038443 Bacteria 4605
487 Ga0436365_0028668 3300039437 Bacteria 1863
488 Ga0436365_1566393 3300039437 Bacteria 980
489 Ga0436360_0342181 3300039438 Bacteria 1820
490 Ga0436360_1072877 3300039438 Bacteria 1167
491 Ga0436361_0063806 3300039447 Bacteria 800
492 Ga0436361_0837187 3300039447 Bacteria 1415
493 Ga0436363_1490078 3300039450 Bacteria 1708
494 Ga0436362_0725727 3300039453 Bacteria 3298
495 Ga0451787_436946 3300041441 Bacteria 843
496 Ga0451791_0028560 3300041451 Bacteria 688
497 Ga0451855_0756595 3300041511 Bacteria 657
498 Ga0451853_0048154 3300041512 Bacteria 1201
499 Ga0451853_3470012 3300041512 Bacteria 765
500 Ga0439448_0062898 3300042005 Bacteria 1229
501 Ga0466972_0000134 3300044658 Bacteria 61802
502 Ga0466972_0410932 3300044658 Bacteria 634
503 Ga0466965_0053959 3300044683 Bacteria 1998
504 Ga0466965_0533291 3300044683 Bacteria 661
505 Ga0466966_0120988 3300044684 Bacteria 1608
506 Ga0466966_0516628 3300044684 Bacteria 718
507 Ga0466961_0052077 3300044693 Bacteria 2612
508 Ga0466961_0327348 3300044693 Bacteria 934
509 Ga0466963_0232543 3300044694 Bacteria 1292
510 Ga0466971_0010102 3300044719 Bacteria 4123
511 Ga0466968_0220349 3300044735 Bacteria 893
512 Ga0466957_0247160 3300044842 Bacteria 1185
513 Ga0466960_0378078 3300044901 Bacteria 812
514 Ga0466959_0080111 3300045049 Bacteria 2354
515 Ga0466959_0170929 3300045049 Bacteria 1524
516 Ga0466959_0177795 3300045049 Bacteria 1490
517 Ga0466967_0606677 3300045976 Bacteria 1080
518 Ga0466967_1743064 3300045976 Bacteria 620
519 Ga0495617_006364 3300046452 Bacteria 4145
520 Ga0495617_123912 3300046452 Bacteria 831
521 Ga0495617_141912 3300046452 Bacteria 767
522 Ga0495627_134012 3300046453 Bacteria 696
523 Ga0495592_0003196 3300046454 Bacteria 11749
524 Ga0495592_0023651 3300046454 Bacteria 4673
525 Ga0495603_0073709 3300046455 Bacteria 2005
526 Ga0495603_0076788 3300046455 Bacteria 1960
527 Ga0495603_0199449 3300046455 Bacteria 1156
528 Ga0495603_0225681 3300046455 Bacteria 1080
529 Ga0495603_0247083 3300046455 Bacteria 1027
530 Ga0495603_0445608 3300046455 Bacteria 741
531 Ga0495590_0083921 3300046457 Bacteria 1123
532 Ga0495629_0000077 3300046459 Bacteria 85931
533 Ga0495629_0123763 3300046459 Bacteria 1801
534 Ga0495638_0018836 3300046460 Bacteria 4578
535 Ga0495638_0253823 3300046460 Bacteria 968
536 Ga0495641_0380938 3300046461 Bacteria 639
537 Ga0495651_0021594 3300046462 Bacteria 5003
538 Ga0495653_0004859 3300046463 Bacteria 10901
539 Ga0495653_0251735 3300046463 Bacteria 1172
540 Ga0495650_0056266 3300046471 Bacteria 1597
541 Ga0495580_0009466 3300046472 Bacteria 7663
542 Ga0495580_0411902 3300046472 Bacteria 910
543 Ga0495580_0710920 3300046472 Bacteria 657
544 Ga0495639_0010989 3300046475 Bacteria 3899
545 Ga0495639_0165812 3300046475 Bacteria 1071
546 Ga0495639_0182078 3300046475 Bacteria 1023
547 Ga0495639_0195824 3300046475 Bacteria 988
548 Ga0495639_0208008 3300046475 Bacteria 959
549 Ga0495662_0027255 3300046476 Bacteria 2761
550 Ga0495664_0008516 3300046477 Bacteria 5718
551 Ga0495664_0009652 3300046477 Bacteria 5403
552 Ga0495664_0508199 3300046477 Bacteria 719
553 Ga0495664_0658198 3300046477 Bacteria 620
554 Ga0495584_0104681 3300046491 Bacteria 1430
555 Ga0495584_0213509 3300046491 Bacteria 981
556 Ga0495584_0219126 3300046491 Bacteria 967
557 Ga0495584_0223646 3300046491 Bacteria 957
558 Ga0495585_0243280 3300046492 Bacteria 900
559 Ga0495585_0247139 3300046492 Bacteria 891
560 Ga0495594_0031029 3300046499 Bacteria 2896
561 Ga0495594_0115702 3300046499 Bacteria 1514
562 Ga0495594_0269314 3300046499 Bacteria 970
563 Ga0495594_0283643 3300046499 Bacteria 944
564 Ga0495596_0052914 3300046500 Bacteria 1589
565 Ga0495607_0068039 3300046501 Bacteria 1999
566 Ga0495606_0004894 3300046507 Bacteria 13113
567 Ga0495606_0547702 3300046507 Bacteria 576
568 Ga0495608_0009124 3300046511 Bacteria 6934
569 Ga0495610_0039285 3300046512 Bacteria 2395
570 Ga0495616_0302592 3300046513 Bacteria 675
571 Ga0495616_0409139 3300046513 Bacteria 556
572 Ga0495618_0516630 3300046514 Bacteria 718
573 Ga0495620_0069462 3300046515 Bacteria 1445
574 Ga0495628_0078173 3300046516 Bacteria 2573
575 Ga0495628_0150353 3300046516 Bacteria 1774
576 Ga0495631_0010598 3300046518 Bacteria 4558
577 Ga0495631_0036603 3300046518 Bacteria 2191
578 Ga0495631_0176042 3300046518 Bacteria 917
579 Ga0495631_0328292 3300046518 Bacteria 651
580 Ga0495632_0037402 3300046519 Bacteria 2463
581 Ga0495632_0069465 3300046519 Bacteria 1696
582 Ga0495632_0095100 3300046519 Bacteria 1408
583 Ga0495632_0148048 3300046519 Bacteria 1086
584 Ga0495643_0161565 3300046522 Bacteria 1102
585 Ga0495643_0198286 3300046522 Bacteria 965
586 Ga0495643_0437522 3300046522 Bacteria 571
587 Ga0495644_0017733 3300046523 Bacteria 2720
588 Ga0495644_0339709 3300046523 Bacteria 590
589 Ga0495648_0138666 3300046524 Bacteria 1283
590 Ga0495648_0270423 3300046524 Bacteria 811
591 Ga0495666_0002143 3300046526 Bacteria 9803
592 Ga0495642_0107728 3300046528 Bacteria 1190
593 Ga0495652_0005699 3300046529 Bacteria 11663
594 Ga0495652_0031849 3300046529 Bacteria 4616
595 Ga0495652_0217006 3300046529 Bacteria 1440
596 Ga0495665_0128054 3300046531 Bacteria 1329
597 Ga0495640_0014952 3300046533 Bacteria 5853
598 Ga0495587_0049035 3300046536 Bacteria 2500
599 Ga0495598_0029468 3300046537 Bacteria 1530
600 Ga0495598_0049063 3300046537 Bacteria 1264
601 Ga0495598_0206448 3300046537 Bacteria 712
602 Ga0495645_0027086 3300046543 Bacteria 4163
603 Ga0495645_0052053 3300046543 Bacteria 2979
604 Ga0495645_0389921 3300046543 Bacteria 889
605 Ga0495622_0048648 3300046557 Bacteria 1969
606 Ga0495622_0090689 3300046557 Bacteria 1404
607 Ga0495622_0106987 3300046557 Bacteria 1281
608 Ga0495622_0372452 3300046557 Bacteria 617
609 Ga0495633_0299009 3300046558 Bacteria 731
610 Ga0495667_0003413 3300046559 Bacteria 10646
611 Ga0495667_0604941 3300046559 Bacteria 683
612 Ga0495656_0019632 3300046615 Bacteria 2611
613 Ga0495656_0036690 3300046615 Bacteria 2020
614 Ga0495656_0037229 3300046615 Bacteria 2008
615 Ga0495668_0042242 3300046616 Bacteria 2538
616 Ga0495634_0009258 3300046642 Bacteria 7270
617 Ga0495611_0159157 3300046648 Bacteria 1055
618 Ga0495625_0068462 3300046660 Bacteria 2495
619 Ga0495635_0000196 3300046663 Bacteria 38194
620 Ga0495635_0028688 3300046663 Bacteria 3868
621 Ga0495588_0025135 3300046674 Bacteria 2965
622 Ga0495657_0001933 3300046675 Bacteria 17662
623 Ga0495657_0173648 3300046675 Bacteria 1326
624 Ga0495599_0003155 3300046678 Bacteria 9598
625 Ga0495599_0045804 3300046678 Bacteria 2743
626 Ga0495599_0505690 3300046678 Bacteria 711
627 Ga0495623_0032653 3300046679 Bacteria 3344
628 Ga0495623_0279105 3300046679 Bacteria 930
629 Ga0495646_0003641 3300046680 Bacteria 9611
630 Ga0495647_0407597 3300046681 Bacteria 625
631 Ga0495658_0015458 3300046683 Bacteria 3916
632 Ga0495669_0004250 3300046684 Bacteria 5901
633 Ga0495669_0067723 3300046684 Bacteria 1623
634 Ga0495669_0077421 3300046684 Bacteria 1523
635 Ga0495669_0207684 3300046684 Bacteria 937
636 Ga0495613_0327061 3300046689 Bacteria 1057
637 Ga0495624_0257281 3300046690 Bacteria 1055
638 Ga0495624_0509377 3300046690 Bacteria 720
639 Ga0495670_0062688 3300046691 Bacteria 1871
640 Ga0495671_0117217 3300046692 Bacteria 1300
641 Ga0495671_0207181 3300046692 Bacteria 950
642 Ga0495649_0141961 3300046694 Bacteria 1264
643 Ga0495589_0134907 3300046794 Bacteria 1184
644 Ga0495589_0186570 3300046794 Bacteria 982
645 Ga0495600_0000323 3300046809 Bacteria 25342
646 Ga0495600_0030517 3300046809 Bacteria 3492
647 Ga0495581_0160163 3300047315 Bacteria 1316
648 Ga0495581_0175010 3300047315 Bacteria 1255
649 Ga0495581_0317752 3300047315 Bacteria 910
650 Ga0495581_0416885 3300047315 Bacteria 783
651 Ga0495604_0004601 3300047317 Bacteria 10931
652 Ga0495604_0322852 3300047317 Bacteria 1031
653 Ga0495604_0832524 3300047317 Bacteria 580
654 Ga0495636_0020511 3300047318 Bacteria 2663
655 Ga0495674_0025082 3300047319 Bacteria 5472
656 Ga0495674_0030968 3300047319 Bacteria 4861
657 Ga0495674_0528806 3300047319 Bacteria 941
658 Ga0495674_0724980 3300047319 Bacteria 778
659 Ga0495672_0160248 3300047320 Bacteria 1158
660 Ga0495672_0209137 3300047320 Bacteria 970
661 Ga0495676_0302698 3300047321 Bacteria 1078
662 Ga0495676_0373660 3300047321 Bacteria 949
663 Ga0495680_0002305 3300047322 Bacteria 19603
664 Ga0495683_0084693 3300047323 Bacteria 1542
665 Ga0495675_0004235 3300047444 Bacteria 8672
666 Ga0495677_0223117 3300047445 Bacteria 734
667 Ga0495673_0066767 3300047469 Bacteria 1524
668 Ga0495681_0048010 3300047470 Bacteria 2027
669 Ga0495684_0000068 3300047471 Bacteria 70808
670 Ga0495684_0007928 3300047471 Bacteria 8213
671 Ga0495686_0143080 3300047472 Bacteria 1410
672 Ga0495686_0328852 3300047472 Bacteria 836
673 Ga0495686_0385173 3300047472 Bacteria 756
674 Ga0495593_0000215 3300047673 Bacteria 30493
675 Ga0495593_0074457 3300047673 Bacteria 1761
676 Ga0495602_0031066 3300048088 Bacteria 5055
677 Ga0495615_0095779 3300048090 Bacteria 833
678 Ga0496100_0015171 3300048903 Bacteria 4495
679 Ga0496100_0072359 3300048903 Bacteria 2304
680 Ga0496100_0199815 3300048903 Bacteria 1456
681 Ga0496100_0367700 3300048903 Bacteria 1090
682 Ga0496100_0876638 3300048903 Bacteria 704
683 Ga0496101_0043362 3300048904 Bacteria 3216
684 Ga0496101_0128583 3300048904 Bacteria 1922
685 Ga0496101_0224039 3300048904 Bacteria 1460
686 Ga0496101_0333987 3300048904 Bacteria 1190
687 Ga0496101_0524748 3300048904 Bacteria 936
688 Ga0496102_0089796 3300048905 Bacteria 2843
689 Ga0496102_0225429 3300048905 Bacteria 1767
690 Ga0496102_0517064 3300048905 Bacteria 1116
691 Ga0496103_0081722 3300048906 Bacteria 2033
692 Ga0496103_0195652 3300048906 Bacteria 1300
693 Ga0496103_0296654 3300048906 Bacteria 1040
694 Ga0496103_0438663 3300048906 Bacteria 838
695 Ga0496104_0016366 3300048907 Bacteria 6735
696 Ga0496104_0077101 3300048907 Bacteria 3175
697 Ga0496104_0190447 3300048907 Bacteria 1962
698 Ga0496104_0270396 3300048907 Bacteria 1612
699 Ga0496104_0328930 3300048907 Bacteria 1441
700 Ga0496104_0770829 3300048907 Bacteria 868
701 Ga0496104_1104415 3300048907 Bacteria 697
702 Ga0496105_0068596 3300048908 Bacteria 2930
703 Ga0496105_0136065 3300048908 Bacteria 2024
704 Ga0496105_0169803 3300048908 Bacteria 1788
705 Ga0496105_0486160 3300048908 Bacteria 971
706 Ga0496106_0007508 3300048909 Bacteria 8059
707 Ga0496106_0072406 3300048909 Bacteria 2635
708 Ga0496106_0467361 3300048909 Bacteria 1013
709 Ga0496106_0482677 3300048909 Bacteria 996
710 Ga0496107_0003589 3300048910 Bacteria 10403
711 Ga0496107_0150605 3300048910 Bacteria 1721
712 Ga0496107_0220229 3300048910 Bacteria 1412
713 Ga0496107_0375645 3300048910 Bacteria 1057
714 Ga0496107_0457756 3300048910 Bacteria 947
715 Ga0496108_0077647 3300048911 Bacteria 2809
716 Ga0496108_0109064 3300048911 Bacteria 2365
717 Ga0496108_0127118 3300048911 Bacteria 2189
718 Ga0496108_0178264 3300048911 Bacteria 1840
719 Ga0496109_0000250 3300048912 Bacteria 51687
720 Ga0496109_0096973 3300048912 Bacteria 2732
721 Ga0496109_0112181 3300048912 Bacteria 2536
722 Ga0496109_0202212 3300048912 Bacteria 1868
723 Ga0496109_0253245 3300048912 Bacteria 1658
724 Ga0496109_0312685 3300048912 Bacteria 1482
725 Ga0496110_0011301 3300048913 Bacteria 7300
726 Ga0496110_0099371 3300048913 Bacteria 2609
727 Ga0496110_0195470 3300048913 Bacteria 1837
728 Ga0496110_0301034 3300048913 Bacteria 1461
729 Ga0496110_0730964 3300048913 Bacteria 892
730 Ga0496111_0138498 3300048914 Bacteria 1803
731 Ga0496111_0276453 3300048914 Bacteria 1246
732 Ga0496112_0000044 3300048915 Bacteria 86865
733 Ga0496112_0007524 3300048915 Bacteria 9669
734 Ga0496112_0012690 3300048915 Bacteria 7749
735 Ga0496112_0126302 3300048915 Bacteria 2528
736 Ga0496112_0410678 3300048915 Bacteria 1293
737 Ga0496113_0036053 3300048916 Bacteria 3622
738 Ga0496113_0119499 3300048916 Bacteria 2059
739 Ga0496113_0572040 3300048916 Bacteria 906
740 Ga0496114_0150952 3300048917 Bacteria 2016
741 Ga0496114_0781192 3300048917 Bacteria 833
742 Ga0496114_1012182 3300048917 Bacteria 714
743 Ga0496115_0063529 3300048918 Bacteria 2979
744 Ga0496115_0175301 3300048918 Bacteria 1773
745 Ga0496115_0180705 3300048918 Bacteria 1744
746 Ga0496115_0245768 3300048918 Bacteria 1474
747 Ga0496115_0475482 3300048918 Bacteria 1007
748 Ga0496116_0214206 3300048919 Bacteria 995
749 Ga0496116_0353146 3300048919 Bacteria 672
750 Ga0496117_0033013 3300048920 Bacteria 3920
751 Ga0496119_0038363 3300048922 Bacteria 3097
752 Ga0496119_0181853 3300048922 Bacteria 1102
753 Ga0496120_0062982 3300048923 Bacteria 2065
754 Ga0496120_0194267 3300048923 Bacteria 987
755 Ga0496121_0000643 3300048924 Bacteria 65217
756 Ga0496121_0028955 3300048924 Bacteria 5140
757 Ga0496121_0032744 3300048924 Bacteria 4718
758 Ga0496121_0266021 3300048924 Bacteria 1181
759 Ga0496121_0362718 3300048924 Bacteria 961
760 Ga0496121_0399299 3300048924 Bacteria 901
761 Ga0496121_0567266 3300048924 Bacteria 707
762 Ga0496121_0782723 3300048924 Bacteria 563
763 Ga0496122_0109094 3300048925 Bacteria 1823
764 Ga0496123_0279736 3300048926 Bacteria 807
765 Ga0496124_0112659 3300048927 Bacteria 2187
766 Ga0496124_0176538 3300048927 Bacteria 1648
767 Ga0496124_0232066 3300048927 Bacteria 1379
768 Ga0496125_0151141 3300048928 Bacteria 1594
769 Ga0496125_0330204 3300048928 Bacteria 920
770 Ga0496125_0336467 3300048928 Bacteria 908
771 Ga0496126_0012003 3300048929 Bacteria 8903
772 Ga0496126_0021130 3300048929 Bacteria 6365
773 Ga0496126_0036950 3300048929 Bacteria 4562
774 Ga0496126_0039833 3300048929 Bacteria 4357
775 Ga0496126_0050101 3300048929 Bacteria 3808
776 Ga0496126_0066876 3300048929 Bacteria 3212
777 Ga0496126_0158795 3300048929 Bacteria 1933
778 Ga0496126_0256214 3300048929 Bacteria 1456
779 Ga0496126_0329542 3300048929 Bacteria 1253
780 Ga0496126_0574002 3300048929 Bacteria 892
781 Ga0496126_1324093 3300048929 Bacteria 523
782 Ga0495678_141970 3300049459 Bacteria 785
783 Ga0501032_0748340 3300049569 Bacteria 618
784 Ga0501033_0627699 3300049570 Bacteria 735
785 Ga0501034_0041940 3300049571 Bacteria 4631
786 Ga0501037_0577306 3300049573 Bacteria 757
787 Ga0501038_0400525 3300049574 Bacteria 1062
788 Ga0501039_0460995 3300049575 Bacteria 998
789 Ga0501040_0341207 3300049576 Bacteria 1073
790 Ga0501041_0211394 3300049577 Bacteria 1217
791 Ga0501043_0212686 3300049579 Bacteria 1498
792 Ga0501046_0130234 3300049580 Bacteria 1908
793 Ga0501046_0390407 3300049580 Bacteria 1006
794 Ga0501047_0096339 3300049581 Bacteria 2837
795 Ga0501047_0328358 3300049581 Bacteria 1368
796 Ga0501047_0448643 3300049581 Bacteria 1119
797 Ga0501048_0650439 3300049582 Bacteria 757
798 Ga0501067_0141480 3300049583 Bacteria 1340
799 Ga0501070_0070367 3300049586 Bacteria 2897
800 Ga0501070_0084254 3300049586 Bacteria 2632
801 Ga0501070_0307505 3300049586 Bacteria 1291
802 Ga0501070_0615779 3300049586 Bacteria 864
803 Ga0501071_0333397 3300049587 Bacteria 1153
804 Ga0501071_0776828 3300049587 Bacteria 738
805 Ga0501073_0115648 3300049589 Bacteria 1859
806 Ga0501074_0051846 3300049590 Bacteria 2961
807 Ga0501074_0170878 3300049590 Bacteria 1551
808 Ga0501076_0097690 3300049592 Bacteria 2366
809 Ga0501079_0283813 3300049741 Bacteria 1295
810 Ga0501079_0394954 3300049741 Bacteria 1085
811 Ga0501080_0070810 3300049742 Bacteria 3243
812 Ga0501080_0123145 3300049742 Bacteria 2402
813 Ga0501080_0878477 3300049742 Bacteria 782
814 Ga0501035_0551661 3300049822 Bacteria 944
815 Ga0501044_0056626 3300049823 Bacteria 4025
816 Ga0501044_0144558 3300049823 Bacteria 2365
817 Ga0501044_0289938 3300049823 Bacteria 1568
818 Ga0501045_0292259 3300049824 Bacteria 1213
819 nmdc:mga03683_107881_c1 3300050489 Bacteria 1228
820 nmdc:mga03683_54067_c1 3300050489 Bacteria 1683
821 nmdc:mga03n38_1240_c1 3300050490 Bacteria 7174
822 nmdc:mga03n38_18372_c3 3300050490 Bacteria 2020
823 nmdc:mga03n38_545551_c1 3300050490 Bacteria 655
824 nmdc:mga00v17_126743_c1 3300050491 Bacteria 1629
825 nmdc:mga00v17_55865_c1 3300050491 Bacteria 2412
826 nmdc:mga0yw44_1018250_c1 3300050492 Bacteria 560
827 nmdc:mga0yw44_140884_c1 3300050492 Bacteria 1567
828 nmdc:mga0yw44_16875_c1 3300050492 Bacteria 3956
829 nmdc:mga0yw44_477806_c1 3300050492 Bacteria 845
830 nmdc:mga0yw44_62777_c1 3300050492 Bacteria 2283
831 nmdc:mga0yw44_841429_c1 3300050492 Bacteria 623
832 nmdc:mga0k408_251196_c1 3300050493 Bacteria 1056
833 nmdc:mga0k408_341288_c1 3300050493 Bacteria 893
834 nmdc:mga06z11_221030_c1 3300050494 Bacteria 1107
835 nmdc:mga06z11_898707_c1 3300050494 Bacteria 540
836 nmdc:mga07m45_10503_c1 3300050496 Bacteria 4838
837 nmdc:mga07m45_24533_c1 3300050496 Bacteria 3305
838 nmdc:mga05p37_652437_c1 3300050507 Bacteria 1178
839 nmdc:mga0n895_231040_c1 3300050512 Bacteria 1877
840 nmdc:mga0n895_4334_c1 3300050512 Bacteria 11629
841 nmdc:mga0rr50_109474_c1 3300050513 Bacteria 2184
842 nmdc:mga0rr50_605150_c1 3300050513 Bacteria 934
843 nmdc:mga0sz30_31784_c1 3300050516 Bacteria 2186
844 nmdc:mga0sz30_340635_c1 3300050516 Bacteria 670
845 nmdc:mga0sz30_73459_c1 3300050516 Bacteria 1474
846 Ga0495601_0058736 3300053077 Bacteria 2438
847 Ga0495601_0234922 3300053077 Bacteria 1197
848 Ga0495612_0051262 3300053078 Bacteria 1696
849 Ga0495612_0318416 3300053078 Bacteria 699
850 Ga0495612_0318780 3300053078 Bacteria 699
851 Ga0500635_0041673 3300053080 Bacteria 1536
852 Ga0500635_0060655 3300053080 Bacteria 1319
853 Ga0495655_0055423 3300053083 Bacteria 1064
854 Ga0495595_0000509 3300053084 Bacteria 14797
855 Ga0495595_0005974 3300053084 Bacteria 4942
856 Ga0495619_0000711 3300053085 Bacteria 21704
857 Ga0495619_0073896 3300053085 Bacteria 2285
858 Ga0500643_065288 3300053087 Bacteria 1016
859 Ga0500647_0297691 3300053091 Bacteria 691
860 Ga0500583_0295950 3300053092 Bacteria 793
861 Ga0500651_0031692 3300053093 Bacteria 3329
862 Ga0500651_0390675 3300053093 Bacteria 783
863 Ga0500566_0005056 3300053094 Bacteria 7864
864 Ga0500641_0049733 3300053096 Bacteria 1721
865 Ga0500641_0123639 3300053096 Bacteria 1116
866 Ga0500641_0360569 3300053096 Bacteria 582
867 Ga0500554_165750 3300053102 Bacteria 745
868 Ga0500556_0034475 3300053104 Bacteria 1742
869 Ga0500594_0026180 3300053118 Bacteria 1501
870 Ga0500595_000200 3300053119 Bacteria 40977
871 Ga0500595_000875 3300053119 Bacteria 17178
872 Ga0500595_032213 3300053119 Bacteria 1752
873 Ga0500595_035892 3300053119 Bacteria 1629
874 Ga0500595_041905 3300053119 Bacteria 1468
875 Ga0500642_0003167 3300053130 Bacteria 4936
876 Ga0500642_0170212 3300053130 Bacteria 1020
877 Ga0500652_279853 3300053131 Bacteria 652
878 Ga0500658_0041434 3300053134 Bacteria 1847
879 Ga0500559_0010712 3300053136 Bacteria 3930
880 Ga0500568_0047083 3300053139 Bacteria 1709
881 Ga0500568_0129911 3300053139 Bacteria 937
882 Ga0500573_0063648 3300053140 Bacteria 2110
883 Ga0500577_0154459 3300053142 Bacteria 975
884 Ga0500577_0284356 3300053142 Bacteria 721
885 Ga0500603_000240 3300053150 Bacteria 14346
886 Ga0500603_088612 3300053150 Bacteria 906
887 Ga0500604_0021485 3300053151 Bacteria 1825
888 Ga0500616_0000028 3300053153 Bacteria 435722
889 Ga0500622_0101338 3300053156 Bacteria 1417
890 Ga0500622_0325283 3300053156 Bacteria 646
891 Ga0500627_0084505 3300053158 Bacteria 1417
892 Ga0500627_0200551 3300053158 Bacteria 894
893 Ga0500634_0148912 3300053161 Bacteria 1097
894 Ga0500638_015970 3300053162 Bacteria 3455
895 Ga0500638_151308 3300053162 Bacteria 1032
896 Ga0500636_0000166 3300053177 Bacteria 34574
897 Ga0500636_0031367 3300053177 Bacteria 3146
898 Ga0500637_0000144 3300053178 Bacteria 26094
899 Ga0500637_0371755 3300053178 Bacteria 753
900 Ga0500570_135783 3300053724 Bacteria 920
901 Ga0501084_0000683 3300054114 Bacteria 25896
902 Ga0501084_0352315 3300054114 Bacteria 1244
903 Ga0501082_0954260 3300060353 Bacteria 750
904 2509152994 2508501128 Bacteria 8613869
905 2513593405 2513237087 Bacteria 5817514
906 2513654143 2513237096 Bacteria 8722461
907 2513721237 2513237104 Bacteria 10034502
908 2513856898 2513237137 Bacteria 9558895
909 2513918483 2513237145 Bacteria 8979722
910 2517891283 2517572143 Bacteria 9484767
911 2524468209 2524023210 Bacteria 9029266
912 2524533513 2524023228 Bacteria 10118060
913 2617346853 2617270735 Bacteria 9163226
914 2644291099 2643221651 Bacteria 4798932
915 2671123812 2667528175 Bacteria 7532676
916 2723843637 2721755755 Bacteria 8322773
917 2793066645 2791355197 Bacteria 8420563
918 2793083840
919 2805921347 2802429603 Bacteria 8777136
920 2824605209 2824600985 Bacteria 8488197
921 2824615528 2824609381 Bacteria 8672835
922 2824656416 2824653114 Bacteria 8493680
923 2824666183 2824661429 Bacteria 9877870
924 2824699637 2824696289 Bacteria 8335049
925 2824775070 2824773399 Bacteria 8360218
926 2847937376 2847930680 Bacteria 9342022
927 2847947801 2847939898 Bacteria 8606328
928 2874607150 2874604998 Bacteria 7834745
929 2876768143 2876761206 Bacteria 10111113
930 2876818153 2876808645 Bacteria 8824342
931 2879086676 2879083081 Bacteria 8587928
932 2879114037 2879110137 Bacteria 8907982
933 2885370020 2885366525 Bacteria 8326213
934 2885382540 2885374607 Bacteria 8927485
935 2885388061 2885383462 Bacteria 9473874
936 2888425639 2888419890 Bacteria 7857137
937 2889037959 2889033259 Bacteria 9099371
938 2903757694 2903748898 Bacteria 9972761
939 2904694190 2904690495 Bacteria 9412302
940 2904701205
941 2906616466
942 2906640022 2906635258 Bacteria 8601019
943 2906647347 2906643746 Bacteria 8722424
944 2906662962 2906660503 Bacteria 8595048
945 2922386870 2922386360 Bacteria 7017218
946 2922431518
947 2932795098 2932794094 Bacteria 7915132
948 2932805626 2932801729 Bacteria 7987968
949 2935636179 2935630451 Bacteria 8169952
950 2935690988 2935684952 Bacteria 9590419
951 2935718369 2935713505 Bacteria 9608509
952 2935727651 2935722832 Bacteria 9608746
953 2935736354 2935732158 Bacteria 9706831
954 2935745734 2935741537 Bacteria 9707219
955 2935756115 2935750917 Bacteria 9590372
956 2935884005 2935883170 Bacteria 7964738
957 2935962772 2935959822 Bacteria 7869783
958 2940561910 2940556831 Bacteria 9590747
959 2941512810 2941507105 Bacteria 8166816
960 2941520623 2941515067 Bacteria 8166720
961 2941528637 2941523033 Bacteria 8169134
962 3005481312 3005474847 Bacteria 9259049
963 3005508384 3005506211 Bacteria 6943378
964 8006939398 8006933436 Bacteria 10410654
965 8006968810 8006964411 Bacteria 8966052
966 8006979053 8006973647 Bacteria 10679141
967 8006984489 8006984368 Bacteria 9651211
968 8019565270 8019555841 Bacteria 9642137
969 8019575373 8019565922 Bacteria 9639779
970 8056677472 8056673599 Bacteria 7871253
971 8056684790 8056681323 Bacteria 8472857
972 8056690736 8056689827 Bacteria 6712655
973 Ga0265339_10291420
974 JGI25153J46596_10005183
975 JGI25153J46596_10009625
976 JGI25160J50197_1024252
977 JGI25404J52841_10020436
978 JGI25404J52841_10025485
979 Ga0055526_1024889
980 Ga0065165_1001202
981 Ga0070658_10008337
982 Ga0070658_10111237
983 Ga0070676_10345369
984 Ga0070683_100045280
985 Ga0070683_100693147
986 Ga0070670_100246178
987 Ga0070670_101247743
988 Ga0068869_100231131
989 Ga0068869_100333104
990 Ga0070666_10302331
991 Ga0070666_10724916
992 Ga0070666_10907284
993 Ga0070680_100011788
994 Ga0070680_100023435
995 Ga0070680_100077214
996 Ga0070680_100173751
997 Ga0070680_100385408
998 Ga0068868_100144837
999 Ga0070660_100075675
1000 Ga0070687_100096388
1001 Ga0070661_100376860
1002 Ga0070668_100022289
1003 Ga0070668_100252095
1004 Ga0070668_100763719
1005 Ga0070668_101061988
1006 Ga0070669_100365132
1007 Ga0070669_101386957
1008 Ga0070674_100046094
1009 Ga0070674_100232794
1010 Ga0070674_100328961
1011 Ga0070673_100137688
1012 Ga0070688_100346145
1013 Ga0070659_100200941
1014 Ga0070667_100152984
1015 Ga0070667_100318728
1016 Ga0070667_101530291
1017 Ga0070709_10006994
1018 Ga0070709_10017477
1019 Ga0070709_10618229
1020 Ga0070714_101026931
1021 Ga0070713_100041670
1022 Ga0070713_100078828
1023 Ga0070710_10043234
1024 Ga0070710_10097384
1025 Ga0070710_10350795
1026 Ga0070710_10468605
1027 Ga0070711_100024755
1028 Ga0070711_100205186
1029 Ga0070700_100183027
1030 Ga0070694_100282062
1031 Ga0070663_100007024
1032 Ga0070663_100075171
1033 Ga0070663_100112292
1034 Ga0070663_100488303
1035 Ga0070678_101053014
1036 Ga0070662_100141579
1037 Ga0070681_10000756
1038 Ga0070681_10008357
1039 Ga0070681_10041893
1040 Ga0070681_10054611
1041 Ga0070681_10171913
1042 Ga0070681_10852437
1043 Ga0070706_100569866
1044 Ga0070707_100348850
1045 Ga0070698_100795263
1046 Ga0070679_100012531
1047 Ga0070679_100030670
1048 Ga0070679_100114454
1049 Ga0070679_100439223
1050 Ga0070679_100801962
1051 Ga0070684_100026065
1052 Ga0070684_100050418
1053 Ga0070684_100592902
1054 Ga0068853_100177402
1055 Ga0068853_100600748
1056 Ga0068853_100807061
1057 Ga0070695_100265649
1058 Ga0070696_100319848
1059 Ga0070665_100027464
1060 Ga0070665_100062865
1061 Ga0070665_100129523
1062 Ga0070665_100978000
1063 Ga0070704_100602397
1064 Ga0068855_100048449
1065 Ga0068855_100315677
1066 Ga0068855_101109349
1067 Ga0068855_101232556
1068 Ga0070664_101149414
1069 Ga0068857_100662426
1070 Ga0068857_100778429
1071 Ga0068857_100901516
1072 Ga0068854_100074179
1073 Ga0068854_100411915
1074 Ga0068856_100000340
1075 Ga0068856_100075874
1076 Ga0068856_100261192
1077 Ga0068852_100100234
1078 Ga0068852_100936855
1079 Ga0068852_100966378
1080 Ga0068859_100199852
1081 Ga0068866_10091382
1082 Ga0068861_100045875
1083 Ga0068861_100096824
1084 Ga0068861_100197064
1085 Ga0068863_101029569
1086 Ga0068858_100188098
1087 Ga0068858_100217735
1088 Ga0068860_100263084
1089 Ga0068860_100450568
1090 Ga0068860_100877223
1091 Ga0068862_100054213
1092 Ga0068862_100085542
1093 Ga0068862_100383466
1094 Ga0068862_101259724
1095 Ga0081455_10013421
1096 Ga0081455_10045584
1097 Ga0081455_10052827
1098 Ga0081455_10062518
1099 Ga0081455_10103597
1100 Ga0081455_10201735
1101 Ga0081540_1000884
1102 Ga0081540_1002354
1103 Ga0081540_1002428
1104 Ga0081540_1008459
1105 Ga0081540_1009606
1106 Ga0081540_1010360
1107 Ga0081540_1010807
1108 Ga0081540_1014134
1109 Ga0081540_1040050
1110 Ga0081540_1081225
1111 Ga0081540_1120430
1112 Ga0081539_10000542
1113 Ga0081539_10032961
1114 Ga0070717_10088462
1115 Ga0070717_10128746
1116 Ga0075365_10008590
1117 Ga0075365_10031972
1118 Ga0075368_10060749
1119 Ga0075363_100026745
1120 Ga0075363_100040702
1121 Ga0075363_100438250
1122 Ga0075364_10119202
1123 Ga0075364_10236749
1124 Ga0075364_10475062
1125 Ga0070716_100094260
1126 Ga0070716_100952438
1127 Ga0070712_100006504
1128 Ga0075362_10074419
1129 Ga0075362_10127185
1130 Ga0075367_10019514
1131 Ga0075367_10383223
1132 Ga0075369_10077140
1133 Ga0075366_10268078
1134 Ga0097621_100377390
1135 Ga0075370_10134575
1136 Ga0075428_100096364
1137 Ga0075428_100658563
1138 Ga0075434_100005333
1139 Ga0075434_100343846
1140 Ga0068865_100144261
1141 Ga0068865_100323818
1142 Ga0068865_100628154
1143 Ga0097620_100199858
1144 Ga0099825_1051714
1145 Ga0099824_1006123
1146 Ga0099822_1000072
1147 Ga0075435_100071016
1148 Ga0099795_10178689
1149 Ga0099795_10187035
1150 Ga0105244_10344465
1151 Ga0105240_11405071
1152 Ga0111539_11012516
1153 Ga0105245_10086519
1154 Ga0105245_10290768
1155 Ga0105245_11014220
1156 Ga0105247_10304654
1157 Ga0105247_10480483
1158 Ga0114129_10162673
1159 Ga0105243_10584271
1160 Ga0105243_10790202
1161 Ga0105243_11286766
1162 Ga0105241_10472277
1163 Ga0105241_10967677
1164 Ga0105248_10709692
1165 Ga0105248_10817744
1166 Ga0105248_11845474
1167 Ga0105237_10295820
1168 Ga0105237_10634281
1169 Ga0105237_10797225
1170 Ga0105237_10862328
1171 Ga0105238_10562351
1172 Ga0105238_10637045
1173 Ga0105238_11248809
1174 Ga0105238_11307733
1175 Ga0105238_12316978
1176 Ga0105249_10211077
1177 Ga0099796_10225702
1178 Ga0105239_10450157
1179 Ga0105239_11399262
1180 Ga0105239_11806874
1181 Ga0105246_10213760
1182 Ga0157337_1011660
1183 Ga0157338_1030019
1184 Ga0157371_10269106
1185 Ga0157370_10362219
1186 Ga0157369_10013821
1187 Ga0157369_10016472
1188 Ga0157369_10338476
1189 Ga0157374_10090035
1190 Ga0157374_10721285
1191 Ga0157378_10015018
1192 Ga0157378_10510073
1193 Ga0163162_10317102
1194 Ga0163162_10631226
1195 Ga0163162_11201585
1196 Ga0163162_12025339
1197 Ga0157372_10082303
1198 Ga0157375_10240297
1199 Ga0157375_10333255
1200 Ga0157375_11388948
1201 Ga0163163_10061861
1202 Ga0163163_10403465
1203 Ga0157380_10022165
1204 Ga0157380_10229774
1205 Ga0157377_10685790
1206 Ga0157379_10299796
1207 Ga0157379_10404680
1208 Ga0163161_10186599
1209 Ga0163161_10373352
1210 Ga0163161_10528388
1211 Ga0206356_10178820
1212 Ga0206354_10650453
1213 Ga0213873_10023488
1214 Ga0224712_10123360
1215 Ga0207425_1032559
1216 Ga0209233_1015403
1217 Ga0209233_1047667
1218 Ga0209233_1062482
1219 Ga0209455_1030573
1220 Ga0209673_1031606
1221 Ga0209564_1005446
1222 Ga0209758_1000133
1223 Ga0209758_1002089
1224 Ga0209758_1004997
1225 Ga0209758_1008659
1226 Ga0209758_1013980
1227 Ga0209758_1029337
1228 Ga0207426_1000800
1229 Ga0207697_10141637
1230 Ga0207682_10348884
1231 Ga0207692_10024398
1232 Ga0207692_10296443
1233 Ga0207642_10008960
1234 Ga0207642_10110775
1235 Ga0207688_10019453
1236 Ga0207680_10069136
1237 Ga0207680_10190647
1238 Ga0207647_10077264
1239 Ga0207699_10199413
1240 Ga0207699_10255167
1241 Ga0207645_10068423
1242 Ga0207645_10201091
1243 Ga0207645_10416611
1244 Ga0207643_10108489
1245 Ga0207705_10013516
1246 Ga0207705_10407743
1247 Ga0207705_10669407
1248 Ga0207684_10040661
1249 Ga0207707_10000605
1250 Ga0207707_10081043
1251 Ga0207707_10087270
1252 Ga0207707_10155189
1253 Ga0207707_10486645
1254 Ga0207695_10065613
1255 Ga0207695_10082341
1256 Ga0207671_10069159
1257 Ga0207671_10956327
1258 Ga0207693_10310930
1259 Ga0207663_10006759
1260 Ga0207660_10010489
1261 Ga0207660_10102184
1262 Ga0207660_10463027
1263 Ga0207662_10352034
1264 Ga0207657_10095073
1265 Ga0207657_10140293
1266 Ga0207649_10682743
1267 Ga0207652_10036652
1268 Ga0207652_10059776
1269 Ga0207652_10323803
1270 Ga0207652_10387829
1271 Ga0207646_10246797
1272 Ga0207646_10509791
1273 Ga0207681_10274260
1274 Ga0207681_11092498
1275 Ga0207694_10392228
1276 Ga0207694_10607480
1277 Ga0207659_10177983
1278 Ga0207687_10061601
1279 Ga0207700_10007806
1280 Ga0207700_10217760
1281 Ga0207644_10362680
1282 Ga0207706_10127675
1283 Ga0207686_10235539
1284 Ga0207709_10271138
1285 Ga0207709_10633507
1286 Ga0207669_10023150
1287 Ga0207669_10032232
1288 Ga0207704_10150524
1289 Ga0207704_10184217
1290 Ga0207704_10205850
1291 Ga0207665_10116100
1292 Ga0207665_10496128
1293 Ga0207665_10498111
1294 Ga0207691_10091123
1295 Ga0207711_10292008
1296 Ga0207711_10330050
1297 Ga0207689_10231672
1298 Ga0207661_10004990
1299 Ga0207661_10037907
1300 Ga0207679_10574181
1301 Ga0207679_10959770
1302 Ga0207667_10113814
1303 Ga0207667_10116497
1304 Ga0207667_11055924
1305 Ga0207651_10051453
1306 Ga0207712_10106836
1307 Ga0207712_10300978
1308 Ga0207668_10003848
1309 Ga0207668_10037005
1310 Ga0207668_10045552
1311 Ga0207668_10473888
1312 Ga0207668_10839230
1313 Ga0207640_10070366
1314 Ga0207640_10125456
1315 Ga0207640_10354144
1316 Ga0207658_10139401
1317 Ga0207658_10157811
1318 Ga0207677_10667613
1319 Ga0207703_10065651
1320 Ga0207703_10228312
1321 Ga0207639_10182851
1322 Ga0207639_10349227
1323 Ga0207639_10423695
1324 Ga0207678_10006578
1325 Ga0207678_10037538
1326 Ga0207678_10127300
1327 Ga0207678_10227500
1328 Ga0207678_10695245
1329 Ga0207678_11475339
1330 Ga0207708_10223638
1331 Ga0207702_10000371
1332 Ga0207702_10071916
1333 Ga0207702_10221755
1334 Ga0207702_10931416
1335 Ga0207648_10059458
1336 Ga0207676_11442411
1337 Ga0207674_10172594
1338 Ga0207674_10269595
1339 Ga0207674_10896771
1340 Ga0207675_100113487
1341 Ga0207675_100514492
1342 Ga0207683_10161821
1343 Ga0207683_10320301
1344 Ga0207698_10272486
1345 Ga0207698_10678789
1346 Ga0207698_10838021
1347 Ga0209389_1000001
1348 Ga0209589_1000011
1349 Ga0209489_100012
1350 Ga0209489_102213
1351 Ga0209700_100007
1352 Ga0209700_100019
1353 Ga0268266_10003223
1354 Ga0268266_10101828
1355 Ga0268266_10954550
1356 Ga0268265_10011347
1357 Ga0268265_10070790
1358 Ga0268265_10187607
1359 Ga0268265_10543790
1360 Ga0265334_10038099
1361 Ga0307517_10060218
1362 Ga0307517_10202145
1363 Ga0307517_10313498
1364 Ga0307515_10025133
1365 Ga0265330_10014164
1366 Ga0265330_10049498
1367 Ga0265332_10012435
1368 Ga0265325_10104256
1369 Ga0265339_10003547
1370 Ga0265316_10252334
1371 Ga0307513_10053911
1372 Ga0307513_10079920
1373 Ga0307513_10304471
1374 Ga0307513_10816974
1375 Ga0307509_10103359
1376 Ga0307509_10672933
1377 Ga0265313_10009997
1378 Ga0307508_10000015
1379 Ga0307508_10087802
1380 Ga0307508_10328318
1381 Ga0265314_10003429
1382 Ga0265314_10148518
1383 Ga0265314_10300632
1384 Ga0265342_10000319
1385 Ga0265342_10036572
1386 Ga0265342_10126917
1387 Ga0265342_10306417
1388 Ga0307516_10049202
1389 Ga0307516_10061224
1390 Ga0307516_10174024
1391 Ga0307516_10175363
1392 Ga0307516_10492988
1393 Ga0307516_10631316
1394 Ga0307407_10035514
1395 Ga0307412_10945872
1396 Ga0307412_11356431
1397 Ga0307409_100384398
1398 Ga0307416_101292562
1399 Ga0307411_10036600
1400 Ga0307415_100453831
1401 Ga0307507_10006824
1402 Ga0307510_10213041
1403 Ga0307510_10228048
1404 Ga0315911_1000002
1405 Ga0373934_0042367
1406 Ga0373934_0115022
1407 Ga0373934_0171816
1408 Ga0373940_0297773
1409 Ga0373944_0041574
1410 Ga0373923_0022049
1411 Ga0373936_0075635
1412 Ga0373941_0064900
1413 Ga0373953_0001226
1414 Ga0373953_0118560
1415 Ga0373954_0000106
1416 Ga0373954_0251289
1417 Ga0373956_0002664
1418 Ga0373957_0002275
1419 Ga0373957_0037135
1420 Ga0373943_0011391
1421 Ga0373943_0031042
1422 Ga0373946_0086970
1423 Ga0373946_0166095
1424 Ga0373955_0006932
1425 Ga0373955_0031168
1426 Ga0373955_0573532
1427 Ga0373924_0003477
1428 Ga0373924_0061593
1429 Ga0373931_0051799
1430 Ga0373927_0040990
1431 Ga0373927_0045539
1432 Ga0373927_0066740
1433 Ga0373927_0085046
1434 Ga0373927_0161175
1435 Ga0373927_0385372
1436 Ga0373927_0692165
1437 Ga0373933_0000296
1438 Ga0373933_0012615
1439 Ga0373933_0085632
1440 Ga0373933_0140333
1441 Ga0373947_0083894
1442 Ga0373947_0086831
1443 Ga0373937_0001389
1444 Ga0373937_0092562
1445 Ga0373937_0192322
1446 Ga0373937_0257071
1447 Ga0373925_0033668
1448 Ga0373925_0248168
1449 Ga0395899_0048670
1450 Ga0395900_0000939
1451 Ga0395900_0029520
1452 Ga0395900_1685868
1453 Ga0395898_0002686
1454 Ga0395898_0335996
1455 Ga0395905_0010169
1456 Ga0395905_0202241
1457 Ga0436364_1366806
1458 Ga0395901_0044498
1459 Ga0436365_0028668
1460 Ga0436365_1566393
1461 Ga0436360_0342181
1462 Ga0436360_1072877
1463 Ga0436361_0063806
1464 Ga0436361_0837187
1465 Ga0436363_1490078
1466 Ga0436362_0725727
1467 Ga0451787_436946
1468 Ga0451791_0028560
1469 Ga0451855_0756595
1470 Ga0451853_0048154
1471 Ga0451853_3470012
1472 Ga0439448_0062898
1473 Ga0466972_0000134
1474 Ga0466972_0410932
1475 Ga0466965_0053959
1476 Ga0466965_0533291
1477 Ga0466966_0120988
1478 Ga0466966_0516628
1479 Ga0466961_0052077
1480 Ga0466961_0327348
1481 Ga0466963_0232543
1482 Ga0466971_0010102
1483 Ga0466968_0220349
1484 Ga0466957_0247160
1485 Ga0466960_0378078
1486 Ga0466959_0080111
1487 Ga0466959_0170929
1488 Ga0466959_0177795
1489 Ga0466967_0606677
1490 Ga0466967_1743064
1491 Ga0495617_006364
1492 Ga0495617_123912
1493 Ga0495617_141912
1494 Ga0495627_134012
1495 Ga0495592_0003196
1496 Ga0495592_0023651
1497 Ga0495603_0073709
1498 Ga0495603_0076788
1499 Ga0495603_0199449
1500 Ga0495603_0225681
1501 Ga0495603_0247083
1502 Ga0495603_0445608
1503 Ga0495590_0083921
1504 Ga0495629_0000077
1505 Ga0495629_0123763
1506 Ga0495638_0018836
1507 Ga0495638_0253823
1508 Ga0495641_0380938
1509 Ga0495651_0021594
1510 Ga0495653_0004859
1511 Ga0495653_0251735
1512 Ga0495650_0056266
1513 Ga0495580_0009466
1514 Ga0495580_0411902
1515 Ga0495580_0710920
1516 Ga0495639_0010989
1517 Ga0495639_0165812
1518 Ga0495639_0182078
1519 Ga0495639_0195824
1520 Ga0495639_0208008
1521 Ga0495662_0027255
1522 Ga0495664_0008516
1523 Ga0495664_0009652
1524 Ga0495664_0508199
1525 Ga0495664_0658198
1526 Ga0495584_0104681
1527 Ga0495584_0213509
1528 Ga0495584_0219126
1529 Ga0495584_0223646
1530 Ga0495585_0243280
1531 Ga0495585_0247139
1532 Ga0495594_0031029
1533 Ga0495594_0115702
1534 Ga0495594_0269314
1535 Ga0495594_0283643
1536 Ga0495596_0052914
1537 Ga0495607_0068039
1538 Ga0495606_0004894
1539 Ga0495606_0547702
1540 Ga0495608_0009124
1541 Ga0495610_0039285
1542 Ga0495616_0302592
1543 Ga0495616_0409139
1544 Ga0495618_0516630
1545 Ga0495620_0069462
1546 Ga0495628_0078173
1547 Ga0495628_0150353
1548 Ga0495631_0010598
1549 Ga0495631_0036603
1550 Ga0495631_0176042
1551 Ga0495631_0328292
1552 Ga0495632_0037402
1553 Ga0495632_0069465
1554 Ga0495632_0095100
1555 Ga0495632_0148048
1556 Ga0495643_0161565
1557 Ga0495643_0198286
1558 Ga0495643_0437522
1559 Ga0495644_0017733
1560 Ga0495644_0339709
1561 Ga0495648_0138666
1562 Ga0495648_0270423
1563 Ga0495666_0002143
1564 Ga0495642_0107728
1565 Ga0495652_0005699
1566 Ga0495652_0031849
1567 Ga0495652_0217006
1568 Ga0495665_0128054
1569 Ga0495640_0014952
1570 Ga0495587_0049035
1571 Ga0495598_0029468
1572 Ga0495598_0049063
1573 Ga0495598_0206448
1574 Ga0495645_0027086
1575 Ga0495645_0052053
1576 Ga0495645_0389921
1577 Ga0495622_0048648
1578 Ga0495622_0090689
1579 Ga0495622_0106987
1580 Ga0495622_0372452
1581 Ga0495633_0299009
1582 Ga0495667_0003413
1583 Ga0495667_0604941
1584 Ga0495656_0019632
1585 Ga0495656_0036690
1586 Ga0495656_0037229
1587 Ga0495668_0042242
1588 Ga0495634_0009258
1589 Ga0495611_0159157
1590 Ga0495625_0068462
1591 Ga0495635_0000196
1592 Ga0495635_0028688
1593 Ga0495588_0025135
1594 Ga0495657_0001933
1595 Ga0495657_0173648
1596 Ga0495599_0003155
1597 Ga0495599_0045804
1598 Ga0495599_0505690
1599 Ga0495623_0032653
1600 Ga0495623_0279105
1601 Ga0495646_0003641
1602 Ga0495647_0407597
1603 Ga0495658_0015458
1604 Ga0495669_0004250
1605 Ga0495669_0067723
1606 Ga0495669_0077421
1607 Ga0495669_0207684
1608 Ga0495613_0327061
1609 Ga0495624_0257281
1610 Ga0495624_0509377
1611 Ga0495670_0062688
1612 Ga0495671_0117217
1613 Ga0495671_0207181
1614 Ga0495649_0141961
1615 Ga0495589_0134907
1616 Ga0495589_0186570
1617 Ga0495600_0000323
1618 Ga0495600_0030517
1619 Ga0495581_0160163
1620 Ga0495581_0175010
1621 Ga0495581_0317752
1622 Ga0495581_0416885
1623 Ga0495604_0004601
1624 Ga0495604_0322852
1625 Ga0495604_0832524
1626 Ga0495636_0020511
1627 Ga0495674_0025082
1628 Ga0495674_0030968
1629 Ga0495674_0528806
1630 Ga0495674_0724980
1631 Ga0495672_0160248
1632 Ga0495672_0209137
1633 Ga0495676_0302698
1634 Ga0495676_0373660
1635 Ga0495680_0002305
1636 Ga0495683_0084693
1637 Ga0495675_0004235
1638 Ga0495677_0223117
1639 Ga0495673_0066767
1640 Ga0495681_0048010
1641 Ga0495684_0000068
1642 Ga0495684_0007928
1643 Ga0495686_0143080
1644 Ga0495686_0328852
1645 Ga0495686_0385173
1646 Ga0495593_0000215
1647 Ga0495593_0074457
1648 Ga0495602_0031066
1649 Ga0495615_0095779
1650 Ga0496100_0015171
1651 Ga0496100_0072359
1652 Ga0496100_0199815
1653 Ga0496100_0367700
1654 Ga0496100_0876638
1655 Ga0496101_0043362
1656 Ga0496101_0128583
1657 Ga0496101_0224039
1658 Ga0496101_0333987
1659 Ga0496101_0524748
1660 Ga0496102_0089796
1661 Ga0496102_0225429
1662 Ga0496102_0517064
1663 Ga0496103_0081722
1664 Ga0496103_0195652
1665 Ga0496103_0296654
1666 Ga0496103_0438663
1667 Ga0496104_0016366
1668 Ga0496104_0077101
1669 Ga0496104_0190447
1670 Ga0496104_0270396
1671 Ga0496104_0328930
1672 Ga0496104_0770829
1673 Ga0496104_1104415
1674 Ga0496105_0068596
1675 Ga0496105_0136065
1676 Ga0496105_0169803
1677 Ga0496105_0486160
1678 Ga0496106_0007508
1679 Ga0496106_0072406
1680 Ga0496106_0467361
1681 Ga0496106_0482677
1682 Ga0496107_0003589
1683 Ga0496107_0150605
1684 Ga0496107_0220229
1685 Ga0496107_0375645
1686 Ga0496107_0457756
1687 Ga0496108_0077647
1688 Ga0496108_0109064
1689 Ga0496108_0127118
1690 Ga0496108_0178264
1691 Ga0496109_0000250
1692 Ga0496109_0096973
1693 Ga0496109_0112181
1694 Ga0496109_0202212
1695 Ga0496109_0253245
1696 Ga0496109_0312685
1697 Ga0496110_0011301
1698 Ga0496110_0099371
1699 Ga0496110_0195470
1700 Ga0496110_0301034
1701 Ga0496110_0730964
1702 Ga0496111_0138498
1703 Ga0496111_0276453
1704 Ga0496112_0000044
1705 Ga0496112_0007524
1706 Ga0496112_0012690
1707 Ga0496112_0126302
1708 Ga0496112_0410678
1709 Ga0496113_0036053
1710 Ga0496113_0119499
1711 Ga0496113_0572040
1712 Ga0496114_0150952
1713 Ga0496114_0781192
1714 Ga0496114_1012182
1715 Ga0496115_0063529
1716 Ga0496115_0175301
1717 Ga0496115_0180705
1718 Ga0496115_0245768
1719 Ga0496115_0475482
1720 Ga0496116_0214206
1721 Ga0496116_0353146
1722 Ga0496117_0033013
1723 Ga0496119_0038363
1724 Ga0496119_0181853
1725 Ga0496120_0062982
1726 Ga0496120_0194267
1727 Ga0496121_0000643
1728 Ga0496121_0028955
1729 Ga0496121_0032744
1730 Ga0496121_0266021
1731 Ga0496121_0362718
1732 Ga0496121_0399299
1733 Ga0496121_0567266
1734 Ga0496121_0782723
1735 Ga0496122_0109094
1736 Ga0496123_0279736
1737 Ga0496124_0112659
1738 Ga0496124_0176538
1739 Ga0496124_0232066
1740 Ga0496125_0151141
1741 Ga0496125_0330204
1742 Ga0496125_0336467
1743 Ga0496126_0012003
1744 Ga0496126_0021130
1745 Ga0496126_0036950
1746 Ga0496126_0039833
1747 Ga0496126_0050101
1748 Ga0496126_0066876
1749 Ga0496126_0158795
1750 Ga0496126_0256214
1751 Ga0496126_0329542
1752 Ga0496126_0574002
1753 Ga0496126_1324093
1754 Ga0495678_141970
1755 Ga0501032_0748340
1756 Ga0501033_0627699
1757 Ga0501034_0041940
1758 Ga0501037_0577306
1759 Ga0501038_0400525
1760 Ga0501039_0460995
1761 Ga0501040_0341207
1762 Ga0501041_0211394
1763 Ga0501043_0212686
1764 Ga0501046_0130234
1765 Ga0501046_0390407
1766 Ga0501047_0096339
1767 Ga0501047_0328358
1768 Ga0501047_0448643
1769 Ga0501048_0650439
1770 Ga0501067_0141480
1771 Ga0501070_0070367
1772 Ga0501070_0084254
1773 Ga0501070_0307505
1774 Ga0501070_0615779
1775 Ga0501071_0333397
1776 Ga0501071_0776828
1777 Ga0501073_0115648
1778 Ga0501074_0051846
1779 Ga0501074_0170878
1780 Ga0501076_0097690
1781 Ga0501079_0283813
1782 Ga0501079_0394954
1783 Ga0501080_0070810
1784 Ga0501080_0123145
1785 Ga0501080_0878477
1786 Ga0501035_0551661
1787 Ga0501044_0056626
1788 Ga0501044_0144558
1789 Ga0501044_0289938
1790 Ga0501045_0292259
1791 nmdc:mga03683_107881_c1
1792 nmdc:mga03683_54067_c1
1793 nmdc:mga03n38_1240_c1
1794 nmdc:mga03n38_18372_c3
1795 nmdc:mga03n38_545551_c1
1796 nmdc:mga00v17_126743_c1
1797 nmdc:mga00v17_55865_c1
1798 nmdc:mga0yw44_1018250_c1
1799 nmdc:mga0yw44_140884_c1
1800 nmdc:mga0yw44_16875_c1
1801 nmdc:mga0yw44_477806_c1
1802 nmdc:mga0yw44_62777_c1
1803 nmdc:mga0yw44_841429_c1
1804 nmdc:mga0k408_251196_c1
1805 nmdc:mga0k408_341288_c1
1806 nmdc:mga06z11_221030_c1
1807 nmdc:mga06z11_898707_c1
1808 nmdc:mga07m45_10503_c1
1809 nmdc:mga07m45_24533_c1
1810 nmdc:mga05p37_652437_c1
1811 nmdc:mga0n895_231040_c1
1812 nmdc:mga0n895_4334_c1
1813 nmdc:mga0rr50_109474_c1
1814 nmdc:mga0rr50_605150_c1
1815 nmdc:mga0sz30_31784_c1
1816 nmdc:mga0sz30_340635_c1
1817 nmdc:mga0sz30_73459_c1
1818 Ga0495601_0058736
1819 Ga0495601_0234922
1820 Ga0495612_0051262
1821 Ga0495612_0318416
1822 Ga0495612_0318780
1823 Ga0500635_0041673
1824 Ga0500635_0060655
1825 Ga0495655_0055423
1826 Ga0495595_0000509
1827 Ga0495595_0005974
1828 Ga0495619_0000711
1829 Ga0495619_0073896
1830 Ga0500643_065288
1831 Ga0500647_0297691
1832 Ga0500583_0295950
1833 Ga0500651_0031692
1834 Ga0500651_0390675
1835 Ga0500566_0005056
1836 Ga0500641_0049733
1837 Ga0500641_0123639
1838 Ga0500641_0360569
1839 Ga0500554_165750
1840 Ga0500556_0034475
1841 Ga0500594_0026180
1842 Ga0500595_000200
1843 Ga0500595_000875
1844 Ga0500595_032213
1845 Ga0500595_035892
1846 Ga0500595_041905
1847 Ga0500642_0003167
1848 Ga0500642_0170212
1849 Ga0500652_279853
1850 Ga0500658_0041434
1851 Ga0500559_0010712
1852 Ga0500568_0047083
1853 Ga0500568_0129911
1854 Ga0500573_0063648
1855 Ga0500577_0154459
1856 Ga0500577_0284356
1857 Ga0500603_000240
1858 Ga0500603_088612
1859 Ga0500604_0021485
1860 Ga0500616_0000028
1861 Ga0500622_0101338
1862 Ga0500622_0325283
1863 Ga0500627_0084505
1864 Ga0500627_0200551
1865 Ga0500634_0148912
1866 Ga0500638_015970
1867 Ga0500638_151308
1868 Ga0500636_0000166
1869 Ga0500636_0031367
1870 Ga0500637_0000144
1871 Ga0500637_0371755
1872 Ga0500570_135783
1873 Ga0501084_0000683
1874 Ga0501084_0352315
1875 Ga0501082_0954260
1876 2509152994
1877 2513593405
1878 2513654143
1879 2513721237
1880 2513856898
1881 2513918483
1882 2517891283
1883 2524468209
1884 2524533513
1885 2617346853
1886 2644291099
1887 2671123812
1888 2723843637
1889 2793066645
1890 2793083840
1891 2805921347
1892 2824605209
1893 2824615528
1894 2824656416
1895 2824666183
1896 2824699637
1897 2824775070
1898 2847937376
1899 2847947801
1900 2874607150
1901 2876768143
1902 2876818153
1903 2879086676
1904 2879114037
1905 2885370020
1906 2885382540
1907 2885388061
1908 2888425639
1909 2889037959
1910 2903757694
1911 2904694190
1912 2904701205
1913 2906616466
1914 2906640022
1915 2906647347
1916 2906662962
1917 2922386870
1918 2922431518
1919 2932795098
1920 2932805626
1921 2935636179
1922 2935690988
1923 2935718369
1924 2935727651
1925 2935736354
1926 2935745734
1927 2935756115
1928 2935884005
1929 2935962772
1930 2940561910
1931 2941512810
1932 2941520623
1933 2941528637
1934 3005481312
1935 3005508384
1936 8006939398
1937 8006968810
1938 8006979053
1939 8006984489
1940 8019565270
1941 8019575373
1942 8056677472
1943 8056684790
1944 8056690736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23451

112

164

0.93

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

12

86

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8886 7 102
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8562 9 102
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8377 9 97
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8167 9 102
4cy8-assembly1.cif.gz_A 2-hydroxybiphenyl 3-monooxygenase (hbpa) in complex with fad 0.8135 135 165
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9276 10 103 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.909 21 102 3.30.300.130
af_Q1L8U8_722_786_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.9051 135 163 2.30.30.140
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8921 10 103 3.30.300.130
af_Q965Q9_545_604_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8822 135 160 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A0A0D1F0-F1-model_v4 Phenylacetate-CoA oxygenase 0.9614 10 81
AF-A0A2E0SYA7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9562 13 99
AF-A0A558CUW6-F1-model_v4 DUF59 domain-containing protein 0.9505 13 90
AF-A0A7Y1V914-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9446 12 110
AF-A0A430UW45-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.944 8 115

Map