F487109

General Info

Members Datasets Scaffolds Average Seq Length
970 516 883 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946072368|2946074891
Length 326
Sequence LWPWSALEASEPGKKTGRRGEITPLYASLGLRPQPDPLRELLLWGARSGRHRLVRMSLKSLALIDNWPVPSAAAGVVRADGTVLGTHGPAGRRFPLASVTKPLAAYAALVAYEEGAVELDEPAGPAGSTVRHLLAHTSGLAFDEHRTTAAPGERRLYSNAGFEQLGDHIAKAADIPFAEYLRQAVLEPLGMTQTSLEGSPAKDGVSTVTDLLRFAAELQAPRLLDPRTVAAAMTVQYPGTKGVLPGYGHQNPNDWGLGFEIRDSKSPHWTGSSSSPRTFGHFGQSGTFLWVDPEAAVAAVALTDRAFGPWAVEAWPPFTDAVLAEV

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221670 Streptomyces sp. Root431 Isolate Unclassified
11 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
14 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
15 2643221714 Streptomyces sp. Root264 Isolate Unclassified
16 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
17 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
18 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
19 2773857759 Microbacterium sp. 1294 Isolate Unclassified
20 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
21 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
22 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
27 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
28 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
29 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
30 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
31 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
32 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
33 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
34 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
35 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
36 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
37 2862574272 Streptomyces sp. AcE210 Isolate Nodule
38 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
41 2867428634 Streptomyces sp. RP5T Isolate Unclassified
42 2867475112 Streptomyces sp. TM32 Isolate Unclassified
43 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
44 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
45 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
46 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
47 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
48 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
49 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
50 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
51 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
52 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
53 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
54 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
55 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
56 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
57 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
58 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
59 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
60 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
61 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
62 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
63 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
64 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
65 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
66 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
67 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
68 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
69 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
70 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
71 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
72 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
73 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
74 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
75 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
76 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
77 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
78 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
79 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
80 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
81 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
82 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
83 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
88 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
89 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
97 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
109 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
110 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
111 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
112 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
113 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
114 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
115 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
116 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
117 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
124 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
125 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
126 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
127 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
130 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
131 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
132 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
133 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
134 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
135 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
136 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
137 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
158 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
159 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
160 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
161 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
166 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
167 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
168 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
169 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
170 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
171 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
172 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
173 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
174 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
175 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
176 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
182 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
183 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
184 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
185 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
186 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
189 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
190 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
191 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
192 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
193 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
194 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
195 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
196 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
197 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
198 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
199 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
200 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
201 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
202 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
203 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
204 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
207 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
208 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
269 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
270 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
289 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
290 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
291 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
293 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
299 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
300 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
301 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
319 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
320 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
321 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
322 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
323 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
324 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
325 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
326 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
327 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
328 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
329 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
330 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
331 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
332 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
349 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
355 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
372 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
377 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
380 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
381 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
386 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
387 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
399 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
400 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
401 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
406 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
407 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
408 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
414 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
415 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
416 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
417 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
425 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
426 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
427 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
428 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
429 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
430 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
433 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
450 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
464 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
465 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
470 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
477 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
478 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
479 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
480 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
481 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
482 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
485 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
486 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
487 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
488 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
489 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
490 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
491 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
494 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
495 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
498 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
499 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
500 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
501 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
502 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
503 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
504 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
505 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
506 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
507 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
508 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
509 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
510 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
511 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
512 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
513 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
514 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
515 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
516 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 0.52
Isolates 9.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0.31
Rhizoplane 4.64
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000054 3300002077 Bacteria 13437
2 JGI24744J21845_10003102 3300002077 Bacteria 3407
3 JGI24742J22300_10000699 3300002244 Bacteria 5068
4 rootH1_10033851 3300003316 Bacteria 2529
5 rootH1_10033851 3300003323 Bacteria 2311
6 rootL2_10002639 3300003322 Bacteria 9703
7 rootL2_10031424 3300003322 Bacteria 1557
8 rootL2_10237235 3300003322 Bacteria 1096
9 rootH1_10007618 3300003323 Bacteria 8200
10 Ga0006562J51391_1052003 3300003578 Bacteria 3860
11 Ga0006562J51391_1052005 3300003578 Bacteria 3180
12 Ga0006562J51391_1098872 3300003578 Bacteria 1240
13 JGI25404J52841_10000681 3300003659 Bacteria 5215
14 Ga0070658_10065148 3300005327 Bacteria 2973
15 Ga0070676_10056316 3300005328 Bacteria 2323
16 Ga0070676_10166136 3300005328 Bacteria 1424
17 Ga0070683_100088869 3300005329 Bacteria 2899
18 Ga0070690_100012537 3300005330 Bacteria 4989
19 Ga0070690_100095578 3300005330 Bacteria 1962
20 Ga0068869_100010144 3300005334 Bacteria 6131
21 Ga0068869_100056050 3300005334 Bacteria 2873
22 Ga0070666_10082505 3300005335 Bacteria 2199
23 Ga0070682_100046630 3300005337 Bacteria 2690
24 Ga0070682_100149627 3300005337 Bacteria 1600
25 Ga0070682_100367501 3300005337 Bacteria 1077
26 Ga0068868_100000692 3300005338 Bacteria 22636
27 Ga0068868_100114618 3300005338 Bacteria 2193
28 Ga0070660_100114617 3300005339 Bacteria 2147
29 Ga0070689_100098080 3300005340 Bacteria 2317
30 Ga0070689_100132048 3300005340 Bacteria 2003
31 Ga0070689_100163672 3300005340 Bacteria 1800
32 Ga0070691_10034133 3300005341 Bacteria 2394
33 Ga0070687_100064508 3300005343 Bacteria 1946
34 Ga0070661_100088132 3300005344 Bacteria 2296
35 Ga0070668_100106344 3300005347 Bacteria 2229
36 Ga0070668_100373774 3300005347 Bacteria 1211
37 Ga0070669_100002285 3300005353 Bacteria 13896
38 Ga0070669_100010546 3300005353 Bacteria 6561
39 Ga0070669_100219553 3300005353 Bacteria 1502
40 Ga0070675_100023116 3300005354 Bacteria 4968
41 Ga0070671_100034440 3300005355 Bacteria 4192
42 Ga0070671_100248661 3300005355 Bacteria 1510
43 Ga0070674_100007386 3300005356 Bacteria 6482
44 Ga0070674_100009109 3300005356 Bacteria 5938
45 Ga0070674_100106983 3300005356 Bacteria 2047
46 Ga0070673_100014484 3300005364 Bacteria 5496
47 Ga0070673_100264147 3300005364 Bacteria 1504
48 Ga0070688_100223667 3300005365 Bacteria 1328
49 Ga0070659_100037404 3300005366 Bacteria 3783
50 Ga0070659_100066605 3300005366 Bacteria 2854
51 Ga0070667_100021512 3300005367 Bacteria 5354
52 Ga0070667_100035601 3300005367 Bacteria 4172
53 Ga0070703_10037765 3300005406 Bacteria 1490
54 Ga0070709_10094127 3300005434 Bacteria 1982
55 Ga0070714_100060167 3300005435 Bacteria 3259
56 Ga0070714_100252295 3300005435 Bacteria 1632
57 Ga0070714_100295956 3300005435 Bacteria 1507
58 Ga0070713_100030313 3300005436 Bacteria 4295
59 Ga0070713_100126557 3300005436 Bacteria 2248
60 Ga0070713_100150225 3300005436 Bacteria 2071
61 Ga0070710_10000486 3300005437 Bacteria 18675
62 Ga0070710_10005873 3300005437 Bacteria 5860
63 Ga0070701_10003037 3300005438 Bacteria 6574
64 Ga0070701_10040702 3300005438 Bacteria 2364
65 Ga0070711_100005689 3300005439 Bacteria 7472
66 Ga0070711_100007574 3300005439 Bacteria 6606
67 Ga0070711_100007962 3300005439 Bacteria 6464
68 Ga0070705_100002283 3300005440 Bacteria 9691
69 Ga0070705_100079337 3300005440 Bacteria 2010
70 Ga0070700_100072979 3300005441 Bacteria 2196
71 Ga0070700_100149276 3300005441 Bacteria 1597
72 Ga0070700_100439957 3300005441 Bacteria 989
73 Ga0070708_100002561 3300005445 Bacteria 14062
74 Ga0070708_100158001 3300005445 Bacteria 2111
75 Ga0070663_100024895 3300005455 Bacteria 4035
76 Ga0070663_100028008 3300005455 Bacteria 3831
77 Ga0070663_100143210 3300005455 Bacteria 1827
78 Ga0070678_100000230 3300005456 Bacteria 25423
79 Ga0070678_100119865 3300005456 Bacteria 2073
80 Ga0070678_100187397 3300005456 Bacteria 1698
81 Ga0070678_100704122 3300005456 Bacteria 910
82 Ga0070662_100003258 3300005457 Bacteria 10098
83 Ga0070662_100413515 3300005457 Bacteria 1115
84 Ga0070681_10142039 3300005458 Bacteria 2330
85 Ga0068867_100018661 3300005459 Bacteria 4931
86 Ga0068867_100131119 3300005459 Bacteria 1948
87 Ga0070685_10023279 3300005466 Bacteria 3390
88 Ga0070706_100017699 3300005467 Bacteria 6576
89 Ga0070706_100229854 3300005467 Bacteria 1731
90 Ga0070707_100003017 3300005468 Bacteria 15966
91 Ga0070707_100044510 3300005468 Bacteria 4250
92 Ga0070707_100246731 3300005468 Bacteria 1738
93 Ga0070698_100018642 3300005471 Bacteria 7306
94 Ga0070698_100117027 3300005471 Bacteria 2628
95 Ga0070698_100167332 3300005471 Bacteria 2140
96 Ga0070698_100493464 3300005471 Bacteria 1162
97 Ga0070699_100002168 3300005518 Bacteria 17764
98 Ga0070679_100062937 3300005530 Bacteria 3698
99 Ga0070697_100002896 3300005536 Bacteria 13193
100 Ga0068853_100030665 3300005539 Bacteria 4543
101 Ga0068853_100138644 3300005539 Bacteria 2182
102 Ga0070672_100063933 3300005543 Bacteria 2906
103 Ga0070672_100426217 3300005543 Bacteria 1140
104 Ga0070686_100127980 3300005544 Bacteria 1753
105 Ga0070686_100185225 3300005544 Bacteria 1482
106 Ga0070695_100092461 3300005545 Bacteria 2022
107 Ga0070695_100306947 3300005545 Bacteria 1175
108 Ga0070696_100002631 3300005546 Bacteria 11911
109 Ga0070696_100084313 3300005546 Bacteria 2254
110 Ga0070696_100495013 3300005546 Bacteria 971
111 Ga0070693_100059203 3300005547 Bacteria 2219
112 Ga0070693_100140106 3300005547 Bacteria 1521
113 Ga0070665_100013254 3300005548 Bacteria 8303
114 Ga0070665_100047390 3300005548 Bacteria 4314
115 Ga0070665_100269768 3300005548 Bacteria 1703
116 Ga0070665_100304090 3300005548 Bacteria 1598
117 Ga0070704_100091132 3300005549 Bacteria 2272
118 Ga0070704_100113556 3300005549 Bacteria 2065
119 Ga0068855_100108036 3300005563 Bacteria 3196
120 Ga0068855_100128954 3300005563 Bacteria 2890
121 Ga0068857_100022331 3300005577 Bacteria 5566
122 Ga0068857_100440695 3300005577 Bacteria 1217
123 Ga0068854_100000723 3300005578 Bacteria 19529
124 Ga0068854_100019373 3300005578 Bacteria 4584
125 Ga0068856_100022196 3300005614 Bacteria 6171
126 Ga0070702_100000434 3300005615 Bacteria 14892
127 Ga0070702_100014334 3300005615 Bacteria 4020
128 Ga0068852_100016014 3300005616 Bacteria 5837
129 Ga0068852_100085602 3300005616 Bacteria 2808
130 Ga0068859_100016786 3300005617 Bacteria 7351
131 Ga0068859_100018510 3300005617 Bacteria 6999
132 Ga0068859_100203724 3300005617 Bacteria 2063
133 Ga0068864_100053513 3300005618 Bacteria 3482
134 Ga0068866_10000072 3300005718 Bacteria 40253
135 Ga0068861_100064345 3300005719 Bacteria 2821
136 Ga0068851_10085036 3300005834 Bacteria 1657
137 Ga0068863_100000193 3300005841 Bacteria 64832
138 Ga0068863_100108884 3300005841 Bacteria 2637
139 Ga0068863_100254038 3300005841 Bacteria 1698
140 Ga0068858_100005187 3300005842 Bacteria 12762
141 Ga0068858_100007410 3300005842 Bacteria 10614
142 Ga0068860_100000166 3300005843 Bacteria 108310
143 Ga0068860_100014460 3300005843 Bacteria 7727
144 Ga0068862_100000205 3300005844 Bacteria 65575
145 Ga0081455_10021015 3300005937 Bacteria 6131
146 Ga0081455_10031663 3300005937 Bacteria 4779
147 Ga0081455_10175698 3300005937 Bacteria 1626
148 Ga0081540_1001213 3300005983 Bacteria 22516
149 Ga0070717_10172559 3300006028 Bacteria 1881
150 Ga0075365_10082479 3300006038 Bacteria 2180
151 Ga0075363_100004182 3300006048 Bacteria 6271
152 Ga0075363_100295787 3300006048 Bacteria 939
153 Ga0075364_10000380 3300006051 Bacteria 21980
154 Ga0075364_10023367 3300006051 Bacteria 3915
155 Ga0070715_10003467 3300006163 Bacteria 5023
156 Ga0070715_10006317 3300006163 Bacteria 4021
157 Ga0070715_10081780 3300006163 Bacteria 1468
158 Ga0070716_100108399 3300006173 Bacteria 1716
159 Ga0070716_100140692 3300006173 Bacteria 1538
160 Ga0070716_100198791 3300006173 Bacteria 1331
161 Ga0070712_100006609 3300006175 Bacteria 7206
162 Ga0070712_100010841 3300006175 Bacteria 5764
163 Ga0075367_10000748 3300006178 Bacteria 12646
164 Ga0075369_10001022 3300006186 Bacteria 9338
165 Ga0075369_10012963 3300006186 Bacteria 3298
166 Ga0075369_10019986 3300006186 Bacteria 2739
167 Ga0097621_100212751 3300006237 Bacteria 1682
168 Ga0097621_100303199 3300006237 Bacteria 1411
169 Ga0075370_10059193 3300006353 Bacteria 2179
170 Ga0075370_10090635 3300006353 Bacteria 1763
171 Ga0068871_100038895 3300006358 Bacteria 3803
172 Ga0068871_100039535 3300006358 Bacteria 3775
173 Ga0068871_100380069 3300006358 Bacteria 1254
174 Ga0075434_100506644 3300006871 Bacteria 1228
175 Ga0068865_100005962 3300006881 Bacteria 7423
176 Ga0075436_100204877 3300006914 Bacteria 1398
177 Ga0097620_100016787 3300006931 Bacteria 7351
178 Ga0097620_100018511 3300006931 Bacteria 6999
179 Ga0097620_100203715 3300006931 Bacteria 2063
180 Ga0075435_100171091 3300007076 Bacteria 1832
181 Ga0099795_10005256 3300007788 Bacteria 3426
182 Ga0105251_10044368 3300009011 Bacteria 2148
183 Ga0105240_10072016 3300009093 Bacteria 4272
184 Ga0105245_10000751 3300009098 Bacteria 29290
185 Ga0105245_10362887 3300009098 Bacteria 1438
186 Ga0105245_10612080 3300009098 Bacteria 1117
187 Ga0105245_10876666 3300009098 Bacteria 938
188 Ga0105247_10000082 3300009101 Bacteria 106460
189 Ga0105247_10068074 3300009101 Bacteria 2219
190 Ga0105243_10058847 3300009148 Bacteria 3064
191 Ga0105243_10097497 3300009148 Bacteria 2433
192 Ga0105241_10018048 3300009174 Bacteria 5186
193 Ga0105241_10324144 3300009174 Bacteria 1329
194 Ga0105242_10001294 3300009176 Bacteria 19789
195 Ga0105242_10013381 3300009176 Bacteria 6338
196 Ga0105248_10000576 3300009177 Bacteria 41774
197 Ga0105248_10018392 3300009177 Bacteria 7721
198 Ga0105248_10020738 3300009177 Bacteria 7281
199 Ga0105248_10390632 3300009177 Bacteria 1567
200 Ga0105237_10090102 3300009545 Bacteria 3057
201 Ga0105238_10113718 3300009551 Bacteria 2686
202 Ga0105238_10166966 3300009551 Bacteria 2177
203 Ga0105249_10000008 3300009553 Bacteria 341271
204 Ga0105249_10000326 3300009553 Bacteria 48114
205 Ga0105249_10069767 3300009553 Bacteria 3244
206 Ga0105249_10326518 3300009553 Bacteria 1547
207 Ga0105239_10009518 3300010375 Bacteria 10936
208 Ga0105239_10149564 3300010375 Bacteria 2606
209 Ga0105239_10187638 3300010375 Bacteria 2314
210 Ga0105246_10228948 3300011119 Bacteria 1462
211 Ga0157373_10083034 3300013100 Bacteria 2258
212 Ga0157371_10028027 3300013102 Bacteria 4081
213 Ga0157370_10084492 3300013104 Bacteria 2984
214 Ga0157369_10096605 3300013105 Bacteria 3152
215 Ga0157369_10147148 3300013105 Bacteria 2490
216 Ga0157374_10158360 3300013296 Bacteria 2205
217 Ga0157374_10213401 3300013296 Bacteria 1893
218 Ga0157378_10001214 3300013297 Bacteria 23353
219 Ga0157378_10162432 3300013297 Bacteria 2090
220 Ga0157378_10193811 3300013297 Bacteria 1918
221 Ga0163162_10013482 3300013306 Bacteria 7980
222 Ga0163162_10061514 3300013306 Bacteria 3792
223 Ga0163162_10256801 3300013306 Bacteria 1879
224 Ga0163162_10375185 3300013306 Bacteria 1555
225 Ga0157372_10015740 3300013307 Bacteria 8111
226 Ga0157375_10000173 3300013308 Bacteria 59878
227 Ga0157375_10366826 3300013308 Bacteria 1606
228 Ga0157380_10004546 3300014326 Bacteria 9629
229 Ga0182008_10001369 3300014497 Bacteria 16527
230 Ga0157377_10040504 3300014745 Bacteria 2580
231 Ga0157377_10046778 3300014745 Bacteria 2422
232 Ga0157379_10188007 3300014968 Bacteria 1867
233 Ga0157376_10239439 3300014969 Bacteria 1690
234 Ga0182007_10000387 3300015262 Bacteria 27336
235 Ga0182005_1034250 3300015265 Bacteria 1382
236 Ga0183367_1009 3300015688 Bacteria 484598
237 Ga0163161_10041092 3300017792 Bacteria 3322
238 Ga0163161_10176534 3300017792 Bacteria 1636
239 Ga0163161_10424100 3300017792 Bacteria 1071
240 Ga0206356_11555668 3300020070 Bacteria 2402
241 Ga0206354_10656253 3300020081 Bacteria 1745
242 Ga0213876_10003411 3300021384 Bacteria 9093
243 Ga0213876_10044364 3300021384 Bacteria 2350
244 Ga0213875_10006612 3300021388 Bacteria 6061
245 Ga0213875_10024498 3300021388 Bacteria 2878
246 Ga0224572_1022509 3300024225 Bacteria 1211
247 Ga0209758_1004639 3300025297 Bacteria 11260
248 Ga0207426_1002223 3300025302 Bacteria 12988
249 Ga0207426_1002227 3300025302 Bacteria 12958
250 Ga0207426_1013368 3300025302 Bacteria 3045
251 Ga0207653_10004753 3300025885 Bacteria 4246
252 Ga0207692_10039640 3300025898 Bacteria 2319
253 Ga0207692_10044179 3300025898 Bacteria 2222
254 Ga0207692_10045102 3300025898 Bacteria 2203
255 Ga0207642_10000120 3300025899 Bacteria 21378
256 Ga0207642_10046615 3300025899 Bacteria 1933
257 Ga0207710_10000263 3300025900 Bacteria 43581
258 Ga0207710_10002806 3300025900 Bacteria 7952
259 Ga0207710_10055556 3300025900 Bacteria 1785
260 Ga0207688_10000732 3300025901 Bacteria 16293
261 Ga0207688_10046896 3300025901 Bacteria 2413
262 Ga0207688_10082062 3300025901 Bacteria 1842
263 Ga0207647_10130744 3300025904 Bacteria 1475
264 Ga0207647_10246791 3300025904 Bacteria 1025
265 Ga0207685_10009137 3300025905 Bacteria 2865
266 Ga0207699_10034060 3300025906 Bacteria 2885
267 Ga0207699_10038104 3300025906 Bacteria 2752
268 Ga0207699_10064108 3300025906 Bacteria 2222
269 Ga0207699_10347996 3300025906 Bacteria 1045
270 Ga0207645_10043499 3300025907 Bacteria 2875
271 Ga0207645_10124439 3300025907 Bacteria 1675
272 Ga0207643_10135512 3300025908 Bacteria 1468
273 Ga0207684_10009418 3300025910 Bacteria 8625
274 Ga0207684_10029123 3300025910 Bacteria 4704
275 Ga0207707_10070296 3300025912 Bacteria 3050
276 Ga0207695_10327826 3300025913 Bacteria 1420
277 Ga0207693_10000869 3300025915 Bacteria 27002
278 Ga0207693_10035223 3300025915 Bacteria 3947
279 Ga0207693_10092258 3300025915 Bacteria 2373
280 Ga0207693_10130844 3300025915 Bacteria 1973
281 Ga0207663_10000449 3300025916 Bacteria 17905
282 Ga0207663_10022742 3300025916 Bacteria 3588
283 Ga0207663_10288709 3300025916 Bacteria 1221
284 Ga0207662_10008318 3300025918 Bacteria 5680
285 Ga0207657_10003385 3300025919 Bacteria 17051
286 Ga0207657_10061917 3300025919 Bacteria 3205
287 Ga0207649_10069790 3300025920 Bacteria 2239
288 Ga0207646_10015635 3300025922 Bacteria 7157
289 Ga0207646_10022756 3300025922 Bacteria 5764
290 Ga0207681_10007046 3300025923 Bacteria 6900
291 Ga0207681_10050190 3300025923 Bacteria 2823
292 Ga0207687_10004955 3300025927 Bacteria 8835
293 Ga0207700_10019441 3300025928 Bacteria 4588
294 Ga0207700_10194581 3300025928 Bacteria 1706
295 Ga0207700_10312693 3300025928 Bacteria 1359
296 Ga0207664_10003887 3300025929 Bacteria 10037
297 Ga0207664_10085348 3300025929 Bacteria 2576
298 Ga0207644_10074968 3300025931 Bacteria 2485
299 Ga0207644_10170712 3300025931 Bacteria 1697
300 Ga0207706_10004443 3300025933 Bacteria 13180
301 Ga0207706_10160044 3300025933 Bacteria 1979
302 Ga0207709_10003286 3300025935 Bacteria 9701
303 Ga0207709_10445611 3300025935 Bacteria 1000
304 Ga0207670_10039639 3300025936 Bacteria 3086
305 Ga0207670_10043558 3300025936 Bacteria 2965
306 Ga0207669_10143260 3300025937 Bacteria 1662
307 Ga0207669_10239551 3300025937 Bacteria 1344
308 Ga0207704_10000222 3300025938 Bacteria 28514
309 Ga0207665_10002166 3300025939 Bacteria 13277
310 Ga0207665_10014313 3300025939 Bacteria 5224
311 Ga0207665_10014887 3300025939 Bacteria 5111
312 Ga0207665_10016902 3300025939 Bacteria 4790
313 Ga0207665_10030075 3300025939 Bacteria 3590
314 Ga0207691_10015953 3300025940 Bacteria 7136
315 Ga0207691_10157225 3300025940 Bacteria 1996
316 Ga0207711_10000948 3300025941 Bacteria 27856
317 Ga0207711_10307229 3300025941 Bacteria 1464
318 Ga0207689_10005067 3300025942 Bacteria 11873
319 Ga0207689_10010628 3300025942 Bacteria 7923
320 Ga0207651_10125360 3300025960 Bacteria 1956
321 Ga0207651_10324974 3300025960 Bacteria 1287
322 Ga0207712_10000011 3300025961 Bacteria 412321
323 Ga0207712_10239872 3300025961 Bacteria 1460
324 Ga0207668_10016610 3300025972 Bacteria 4596
325 Ga0207668_10171862 3300025972 Bacteria 1700
326 Ga0207668_10277776 3300025972 Bacteria 1372
327 Ga0207640_10099426 3300025981 Bacteria 2036
328 Ga0207658_10002041 3300025986 Bacteria 15073
329 Ga0207658_10069132 3300025986 Bacteria 2667
330 Ga0207658_10078702 3300025986 Bacteria 2520
331 Ga0207677_10002154 3300026023 Bacteria 10350
332 Ga0207677_10025118 3300026023 Bacteria 3712
333 Ga0207677_10086010 3300026023 Bacteria 2271
334 Ga0207703_10008863 3300026035 Bacteria 7928
335 Ga0207703_10246164 3300026035 Bacteria 1609
336 Ga0207639_10020409 3300026041 Bacteria 4742
337 Ga0207639_10072442 3300026041 Bacteria 2697
338 Ga0207678_10000171 3300026067 Bacteria 54729
339 Ga0207678_10008674 3300026067 Bacteria 8954
340 Ga0207678_10035214 3300026067 Bacteria 4359
341 Ga0207678_10083619 3300026067 Bacteria 2730
342 Ga0207708_10004352 3300026075 Bacteria 10434
343 Ga0207708_10027234 3300026075 Bacteria 4328
344 Ga0207702_10094441 3300026078 Bacteria 2625
345 Ga0207641_10000437 3300026088 Bacteria 47860
346 Ga0207648_10038065 3300026089 Bacteria 4234
347 Ga0207648_10162153 3300026089 Bacteria 1974
348 Ga0207648_10269034 3300026089 Bacteria 1522
349 Ga0207676_10202388 3300026095 Bacteria 1755
350 Ga0207674_10010179 3300026116 Bacteria 10683
351 Ga0207675_100000056 3300026118 Bacteria 82104
352 Ga0207675_100014809 3300026118 Bacteria 7278
353 Ga0207675_100022234 3300026118 Bacteria 5905
354 Ga0207675_100248140 3300026118 Bacteria 1722
355 Ga0207683_10000442 3300026121 Bacteria 38332
356 Ga0207683_10115916 3300026121 Bacteria 2401
357 Ga0207683_10186521 3300026121 Bacteria 1882
358 Ga0207683_10307765 3300026121 Bacteria 1450
359 Ga0207698_10207423 3300026142 Bacteria 1760
360 Ga0209371_1012600 3300027312 Bacteria 2432
361 Ga0268266_10011643 3300028379 Bacteria 7636
362 Ga0268266_10210812 3300028379 Bacteria 1781
363 Ga0268266_10230336 3300028379 Bacteria 1706
364 Ga0268265_10000007 3300028380 Bacteria 431817
365 Ga0268265_10020264 3300028380 Bacteria 4640
366 Ga0268265_10179166 3300028380 Bacteria 1819
367 Ga0268264_10000007 3300028381 Bacteria 815790
368 Ga0268264_10220857 3300028381 Bacteria 1744
369 Ga0307517_10001523 3300028786 Bacteria 38580
370 Ga0307515_10000262 3300028794 Bacteria 130525
371 Ga0307515_10170563 3300028794 Bacteria 2171
372 Ga0268256_1013761 3300030500 Bacteria 2432
373 Ga0307511_10001166 3300030521 Bacteria 27969
374 Ga0307511_10039103 3300030521 Bacteria 4059
375 Ga0307511_10072373 3300030521 Bacteria 2504
376 Ga0307512_10003287 3300030522 Bacteria 19019
377 Ga0307512_10021656 3300030522 Bacteria 5789
378 Ga0307512_10098573 3300030522 Bacteria 1994
379 Ga0307513_10101479 3300031456 Bacteria 2899
380 Ga0307513_10157218 3300031456 Bacteria 2171
381 Ga0307509_10022428 3300031507 Bacteria 7117
382 Ga0307509_10038476 3300031507 Bacteria 5217
383 Ga0307509_10192381 3300031507 Bacteria 1889
384 Ga0307508_10011423 3300031616 Bacteria 8119
385 Ga0307508_10024355 3300031616 Bacteria 5493
386 Ga0307508_10097627 3300031616 Bacteria 2530
387 Ga0307508_10385336 3300031616 Bacteria 993
388 Ga0307514_10004230 3300031649 Bacteria 13290
389 Ga0307514_10083805 3300031649 Bacteria 2348
390 Ga0307514_10105230 3300031649 Bacteria 2016
391 Ga0307516_10007840 3300031730 Bacteria 12175
392 Ga0307516_10034680 3300031730 Bacteria 5069
393 Ga0307516_10104985 3300031730 Bacteria 2637
394 Ga0307518_10012292 3300031838 Bacteria 6120
395 Ga0307518_10043316 3300031838 Bacteria 3276
396 Ga0307410_10202267 3300031852 Bacteria 1517
397 Ga0307409_100366644 3300031995 Bacteria 1364
398 Ga0307416_100370142 3300032002 Bacteria 1459
399 Ga0307414_10422459 3300032004 Bacteria 1163
400 Ga0307415_100036094 3300032126 Bacteria 3236
401 Ga0307507_10050253 3300033179 Bacteria 4028
402 Ga0307510_10035955 3300033180 Bacteria 5521
403 Ga0307510_10104532 3300033180 Bacteria 2604
404 Ga0307510_10259218 3300033180 Bacteria 1221
405 Ga0373930_0004186 3300034816 Bacteria 2334
406 Ga0373926_0002751 3300035083 Bacteria 5601
407 Ga0373934_0012900 3300035086 Bacteria 3158
408 Ga0373940_0045890 3300035088 Bacteria 1214
409 Ga0373944_0000937 3300035089 Bacteria 7236
410 Ga0373944_0005705 3300035089 Bacteria 3284
411 Ga0373951_0013166 3300035091 Bacteria 1860
412 Ga0373952_0009709 3300035092 Bacteria 1849
413 Ga0373923_0011003 3300035111 Bacteria 3308
414 Ga0373932_0018425 3300035112 Bacteria 1805
415 Ga0373932_0034040 3300035112 Bacteria 1434
416 Ga0373936_0012017 3300035113 Bacteria 3286
417 Ga0373936_0016608 3300035113 Bacteria 2832
418 Ga0373939_0011694 3300035114 Bacteria 2222
419 Ga0373939_0057105 3300035114 Bacteria 1231
420 Ga0373945_0001360 3300035116 Bacteria 7435
421 Ga0373945_0015958 3300035116 Bacteria 2531
422 Ga0373953_0008491 3300035117 Bacteria 3492
423 Ga0373956_0071848 3300035119 Bacteria 1579
424 Ga0373956_0199692 3300035119 Bacteria 948
425 Ga0373943_0000277 3300035170 Bacteria 21155
426 Ga0373946_0000047 3300035171 Bacteria 31827
427 Ga0373946_0003357 3300035171 Bacteria 5677
428 Ga0373955_0103351 3300035172 Bacteria 1638
429 Ga0373955_0217078 3300035172 Bacteria 1141
430 Ga0373961_0025039 3300035241 Bacteria 1619
431 Ga0373924_0004348 3300035410 Bacteria 4945
432 Ga0373931_0058770 3300035691 Bacteria 2066
433 Ga0373935_0002314 3300035692 Bacteria 10875
434 Ga0373927_0000128 3300035695 Bacteria 58077
435 Ga0373927_0033574 3300035695 Bacteria 3340
436 Ga0373933_0012826 3300035724 Bacteria 4634
437 Ga0373933_0117879 3300035724 Bacteria 1660
438 Ga0373933_0270959 3300035724 Bacteria 1096
439 Ga0373947_0000327 3300035725 Bacteria 26912
440 Ga0373937_0164920 3300036401 Bacteria 2077
441 Ga0373937_0943483 3300036401 Bacteria 811
442 Ga0373925_0001723 3300037068 Bacteria 18387
443 Ga0395898_0004836 3300037466 Bacteria 14644
444 Ga0395898_0005281 3300037466 Bacteria 13965
445 Ga0395898_0525145 3300037466 Bacteria 1125
446 Ga0395905_0040820 3300037471 Bacteria 4354
447 Ga0436364_0208258 3300037853 Bacteria 3615
448 Ga0436364_0395198 3300037853 Bacteria 6107
449 Ga0436364_0517842 3300037853 Bacteria 7013
450 Ga0436364_0817251 3300037853 Bacteria 2356
451 Ga0400483_166410 3300039062 Bacteria 32354
452 Ga0436365_0470798 3300039437 Bacteria 31097
453 Ga0436365_0967944 3300039437 Bacteria 29438
454 Ga0436365_1677319 3300039437 Bacteria 958
455 Ga0436360_1088767 3300039438 Bacteria 1213
456 Ga0436363_0684294 3300039450 Bacteria 1291
457 Ga0436362_1127991 3300039453 Bacteria 988
458 Ga0439436_0001293 3300041404 Bacteria 7160
459 Ga0439439_0001590 3300041406 Bacteria 4580
460 Ga0439465_0008579 3300041413 Bacteria 3225
461 Ga0439465_0057507 3300041413 Bacteria 1283
462 Ga0451837_0441292 3300041494 Bacteria 6692
463 Ga0439433_0006462 3300041999 Bacteria 2522
464 Ga0439433_0017868 3300041999 Bacteria 1576
465 Ga0439432_034153 3300042006 Bacteria 1634
466 Ga0439449_0020539 3300042007 Bacteria 2474
467 Ga0439449_0089172 3300042007 Bacteria 1138
468 Ga0439455_0014033 3300042012 Bacteria 1824
469 Ga0439457_000381 3300042014 Bacteria 12512
470 Ga0439457_003517 3300042014 Bacteria 4253
471 Ga0439457_005534 3300042014 Bacteria 3171
472 Ga0450894_002527 3300042131 Bacteria 2452
473 Ga0450898_000804 3300042134 Bacteria 3873
474 Ga0450899_000387 3300042135 Bacteria 4890
475 Ga0450903_000036 3300042138 Bacteria 26817
476 Ga0450906_000131 3300042145 Bacteria 13303
477 Ga0439458_0004847 3300042157 Bacteria 3054
478 Ga0466969_0086897 3300044656 Bacteria 1485
479 Ga0466972_0004743 3300044658 Bacteria 6806
480 Ga0466972_0014843 3300044658 Bacteria 3898
481 Ga0466972_0035207 3300044658 Bacteria 2450
482 Ga0466972_0035479 3300044658 Bacteria 2440
483 Ga0466972_0050303 3300044658 Bacteria 2012
484 Ga0466972_0061881 3300044658 Bacteria 1794
485 Ga0466972_0082680 3300044658 Bacteria 1528
486 Ga0466965_0013546 3300044683 Bacteria 3849
487 Ga0466966_0006730 3300044684 Bacteria 7611
488 Ga0466966_0008986 3300044684 Bacteria 6622
489 Ga0466961_0017828 3300044693 Bacteria 4563
490 Ga0466961_0046233 3300044693 Bacteria 2784
491 Ga0466961_0098382 3300044693 Bacteria 1844
492 Ga0466961_0145283 3300044693 Bacteria 1483
493 Ga0466961_0194769 3300044693 Bacteria 1255
494 Ga0466963_0000196 3300044694 Bacteria 25509
495 Ga0466963_0002936 3300044694 Bacteria 9633
496 Ga0466963_0213735 3300044694 Bacteria 1350
497 Ga0466963_0311262 3300044694 Bacteria 1108
498 Ga0466963_0320350 3300044694 Bacteria 1091
499 Ga0466964_0215056 3300044706 Bacteria 930
500 Ga0466971_0016234 3300044719 Bacteria 3282
501 Ga0466971_0024068 3300044719 Bacteria 2716
502 Ga0466971_0035566 3300044719 Bacteria 2234
503 Ga0466968_0007978 3300044735 Bacteria 4044
504 Ga0466968_0030780 3300044735 Bacteria 2224
505 Ga0466970_0003680 3300044765 Bacteria 7483
506 Ga0466970_0004702 3300044765 Bacteria 6743
507 Ga0466957_0020111 3300044842 Bacteria 3929
508 Ga0466957_0085738 3300044842 Bacteria 1967
509 Ga0466960_0000965 3300044901 Bacteria 10200
510 Ga0466960_0029308 3300044901 Bacteria 2525
511 Ga0466960_0107471 3300044901 Bacteria 1445
512 Ga0466960_0116373 3300044901 Bacteria 1395
513 Ga0466960_0274319 3300044901 Bacteria 943
514 Ga0466959_0083606 3300045049 Bacteria 2298
515 Ga0466959_0187050 3300045049 Bacteria 1446
516 Ga0466958_0002583 3300045836 Bacteria 9143
517 Ga0466967_0012779 3300045976 Bacteria 6449
518 Ga0466967_0050586 3300045976 Bacteria 3639
519 Ga0466967_0070420 3300045976 Bacteria 3129
520 Ga0466967_0092774 3300045976 Bacteria 2746
521 Ga0466967_0252530 3300045976 Bacteria 1685
522 Ga0466967_0296825 3300045976 Bacteria 1554
523 Ga0466967_0359330 3300045976 Bacteria 1411
524 Ga0466967_0375460 3300045976 Bacteria 1380
525 Ga0466967_0419386 3300045976 Bacteria 1304
526 Ga0495617_027607 3300046452 Bacteria 1909
527 Ga0495627_043249 3300046453 Bacteria 1378
528 Ga0495592_0004397 3300046454 Bacteria 10307
529 Ga0495603_0001858 3300046455 Bacteria 12437
530 Ga0495603_0002751 3300046455 Bacteria 10361
531 Ga0495603_0003617 3300046455 Bacteria 9190
532 Ga0495603_0003796 3300046455 Bacteria 8994
533 Ga0495603_0028037 3300046455 Bacteria 3396
534 Ga0495603_0041056 3300046455 Bacteria 2767
535 Ga0495590_0113503 3300046457 Bacteria 968
536 Ga0495629_0006991 3300046459 Bacteria 8314
537 Ga0495629_0009757 3300046459 Bacteria 7006
538 Ga0495629_0019173 3300046459 Bacteria 4889
539 Ga0495629_0041423 3300046459 Bacteria 3240
540 Ga0495629_0044450 3300046459 Bacteria 3117
541 Ga0495629_0063842 3300046459 Bacteria 2571
542 Ga0495629_0095786 3300046459 Bacteria 2070
543 Ga0495629_0294667 3300046459 Bacteria 1111
544 Ga0495638_0008299 3300046460 Bacteria 7375
545 Ga0495638_0016209 3300046460 Bacteria 4995
546 Ga0495638_0018353 3300046460 Bacteria 4646
547 Ga0495638_0023834 3300046460 Bacteria 3998
548 Ga0495641_0080463 3300046461 Bacteria 1460
549 Ga0495641_0203902 3300046461 Bacteria 886
550 Ga0495651_0003483 3300046462 Bacteria 12065
551 Ga0495651_0068437 3300046462 Bacteria 2706
552 Ga0495651_0126494 3300046462 Bacteria 1871
553 Ga0495651_0155399 3300046462 Bacteria 1644
554 Ga0495653_0005693 3300046463 Bacteria 10181
555 Ga0495653_0029215 3300046463 Bacteria 4404
556 Ga0495653_0207761 3300046463 Bacteria 1324
557 Ga0495580_0152366 3300046472 Bacteria 1601
558 Ga0495582_0015241 3300046473 Bacteria 4226
559 Ga0495582_0025537 3300046473 Bacteria 3236
560 Ga0495605_0017534 3300046474 Bacteria 3851
561 Ga0495639_0008710 3300046475 Bacteria 4350
562 Ga0495662_0001859 3300046476 Bacteria 10571
563 Ga0495662_0005451 3300046476 Bacteria 6369
564 Ga0495662_0010695 3300046476 Bacteria 4487
565 Ga0495662_0021273 3300046476 Bacteria 3135
566 Ga0495662_0027853 3300046476 Bacteria 2729
567 Ga0495664_0000355 3300046477 Bacteria 22087
568 Ga0495664_0006519 3300046477 Bacteria 6452
569 Ga0495664_0057721 3300046477 Bacteria 2309
570 Ga0495664_0062536 3300046477 Bacteria 2217
571 Ga0495585_0033955 3300046492 Bacteria 2885
572 Ga0495585_0041242 3300046492 Bacteria 2589
573 Ga0495594_0000244 3300046499 Bacteria 26387
574 Ga0495594_0008294 3300046499 Bacteria 5348
575 Ga0495594_0022825 3300046499 Bacteria 3350
576 Ga0495594_0026897 3300046499 Bacteria 3098
577 Ga0495607_0072554 3300046501 Bacteria 1916
578 Ga0495583_0067536 3300046506 Bacteria 1579
579 Ga0495606_0023291 3300046507 Bacteria 4491
580 Ga0495608_0035702 3300046511 Bacteria 3351
581 Ga0495608_0096471 3300046511 Bacteria 1910
582 Ga0495616_0031733 3300046513 Bacteria 2764
583 Ga0495618_0019675 3300046514 Bacteria 4154
584 Ga0495618_0050115 3300046514 Bacteria 2637
585 Ga0495618_0087109 3300046514 Bacteria 1997
586 Ga0495618_0112689 3300046514 Bacteria 1741
587 Ga0495620_0004961 3300046515 Bacteria 7462
588 Ga0495620_0010780 3300046515 Bacteria 4806
589 Ga0495628_0020376 3300046516 Bacteria 5471
590 Ga0495628_0030094 3300046516 Bacteria 4397
591 Ga0495628_0062151 3300046516 Bacteria 2928
592 Ga0495628_0102837 3300046516 Bacteria 2203
593 Ga0495630_0002641 3300046517 Bacteria 12417
594 Ga0495630_0109868 3300046517 Bacteria 2088
595 Ga0495631_0030629 3300046518 Bacteria 2439
596 Ga0495643_0001406 3300046522 Bacteria 22332
597 Ga0495643_0002819 3300046522 Bacteria 13260
598 Ga0495666_0178764 3300046526 Bacteria 980
599 Ga0495652_0045401 3300046529 Bacteria 3778
600 Ga0495652_0051890 3300046529 Bacteria 3500
601 Ga0495652_0057169 3300046529 Bacteria 3309
602 Ga0495652_0197683 3300046529 Bacteria 1528
603 Ga0495652_0262346 3300046529 Bacteria 1274
604 Ga0495654_0159482 3300046530 Bacteria 991
605 Ga0495665_0000881 3300046531 Bacteria 15706
606 Ga0495665_0024190 3300046531 Bacteria 3263
607 Ga0495640_0008927 3300046533 Bacteria 7828
608 Ga0495640_0016406 3300046533 Bacteria 5541
609 Ga0495640_0032961 3300046533 Bacteria 3685
610 Ga0495640_0073049 3300046533 Bacteria 2297
611 Ga0495640_0138852 3300046533 Bacteria 1567
612 Ga0495587_0001034 3300046536 Bacteria 18306
613 Ga0495587_0174832 3300046536 Bacteria 1219
614 Ga0495587_0212372 3300046536 Bacteria 1092
615 Ga0495597_0034798 3300046542 Bacteria 2275
616 Ga0495645_0008885 3300046543 Bacteria 7019
617 Ga0495645_0017893 3300046543 Bacteria 5085
618 Ga0495645_0189859 3300046543 Bacteria 1401
619 Ga0495622_0002073 3300046557 Bacteria 9794
620 Ga0495622_0007613 3300046557 Bacteria 5028
621 Ga0495622_0072386 3300046557 Bacteria 1590
622 Ga0495633_0035129 3300046558 Bacteria 2408
623 Ga0495667_0045895 3300046559 Bacteria 2890
624 Ga0495668_0036891 3300046616 Bacteria 2737
625 Ga0495668_0055969 3300046616 Bacteria 2178
626 Ga0495634_0042766 3300046642 Bacteria 3072
627 Ga0495634_0054527 3300046642 Bacteria 2675
628 Ga0495634_0070018 3300046642 Bacteria 2313
629 Ga0495634_0169106 3300046642 Bacteria 1374
630 Ga0495611_0010852 3300046648 Bacteria 3858
631 Ga0495611_0014161 3300046648 Bacteria 3403
632 Ga0495625_0007730 3300046660 Bacteria 9297
633 Ga0495625_0014809 3300046660 Bacteria 6207
634 Ga0495625_0100161 3300046660 Bacteria 1992
635 Ga0495625_0324724 3300046660 Bacteria 979
636 Ga0495635_0000563 3300046663 Bacteria 23671
637 Ga0495635_0006569 3300046663 Bacteria 8114
638 Ga0495588_0002826 3300046674 Bacteria 7465
639 Ga0495588_0007253 3300046674 Bacteria 5034
640 Ga0495588_0007542 3300046674 Bacteria 4956
641 Ga0495588_0220846 3300046674 Bacteria 1000
642 Ga0495588_0268768 3300046674 Bacteria 898
643 Ga0495657_0004129 3300046675 Bacteria 11629
644 Ga0495657_0005323 3300046675 Bacteria 10182
645 Ga0495657_0037987 3300046675 Bacteria 3315
646 Ga0495657_0045198 3300046675 Bacteria 2989
647 Ga0495657_0059729 3300046675 Bacteria 2528
648 Ga0495599_0050336 3300046678 Bacteria 2610
649 Ga0495599_0055249 3300046678 Bacteria 2487
650 Ga0495599_0096137 3300046678 Bacteria 1847
651 Ga0495623_0008756 3300046679 Bacteria 6571
652 Ga0495646_0020434 3300046680 Bacteria 4190
653 Ga0495646_0080930 3300046680 Bacteria 1893
654 Ga0495646_0196749 3300046680 Bacteria 1099
655 Ga0495613_0000689 3300046689 Bacteria 26707
656 Ga0495613_0012437 3300046689 Bacteria 6324
657 Ga0495613_0062646 3300046689 Bacteria 2721
658 Ga0495624_0000942 3300046690 Bacteria 22948
659 Ga0495624_0032904 3300046690 Bacteria 3359
660 Ga0495624_0177540 3300046690 Bacteria 1298
661 Ga0495670_0004493 3300046691 Bacteria 6836
662 Ga0495670_0139317 3300046691 Bacteria 1268
663 Ga0495671_0004121 3300046692 Bacteria 8764
664 Ga0495649_0019128 3300046694 Bacteria 3848
665 Ga0495589_0008402 3300046794 Bacteria 5396
666 Ga0495589_0032763 3300046794 Bacteria 2612
667 Ga0495589_0147436 3300046794 Bacteria 1124
668 Ga0495600_0043021 3300046809 Bacteria 2944
669 Ga0495600_0202277 3300046809 Bacteria 1275
670 Ga0495660_0015012 3300046810 Bacteria 4477
671 Ga0495660_0064945 3300046810 Bacteria 1949
672 Ga0495660_0159007 3300046810 Bacteria 1109
673 Ga0495581_0005923 3300047315 Bacteria 7088
674 Ga0495581_0008559 3300047315 Bacteria 5929
675 Ga0495581_0034431 3300047315 Bacteria 2931
676 Ga0495581_0038805 3300047315 Bacteria 2757
677 Ga0495581_0048903 3300047315 Bacteria 2442
678 Ga0495581_0222785 3300047315 Bacteria 1103
679 Ga0495604_0000177 3300047317 Bacteria 56559
680 Ga0495604_0070900 3300047317 Bacteria 2637
681 Ga0495636_0001903 3300047318 Bacteria 7979
682 Ga0495636_0054307 3300047318 Bacteria 1683
683 Ga0495636_0168546 3300047318 Bacteria 989
684 Ga0495674_0001655 3300047319 Bacteria 21912
685 Ga0495674_0046357 3300047319 Bacteria 3858
686 Ga0495674_0047600 3300047319 Bacteria 3801
687 Ga0495674_0244977 3300047319 Bacteria 1476
688 Ga0495672_0054676 3300047320 Bacteria 2332
689 Ga0495676_0002684 3300047321 Bacteria 15938
690 Ga0495676_0002844 3300047321 Bacteria 15596
691 Ga0495676_0031274 3300047321 Bacteria 4503
692 Ga0495676_0065143 3300047321 Bacteria 2829
693 Ga0495680_0015042 3300047322 Bacteria 6683
694 Ga0495680_0060263 3300047322 Bacteria 2926
695 Ga0495680_0173223 3300047322 Bacteria 1561
696 Ga0495683_0009058 3300047323 Bacteria 5305
697 Ga0495683_0020547 3300047323 Bacteria 3405
698 Ga0495683_0065278 3300047323 Bacteria 1796
699 Ga0495687_011361 3300047443 Bacteria 4797
700 Ga0495675_0010024 3300047444 Bacteria 5910
701 Ga0495675_0015663 3300047444 Bacteria 4793
702 Ga0495675_0018918 3300047444 Bacteria 4376
703 Ga0495675_0077824 3300047444 Bacteria 2089
704 Ga0495675_0184571 3300047444 Bacteria 1276
705 Ga0495679_013057 3300047446 Bacteria 3134
706 Ga0495685_000162 3300047447 Bacteria 22500
707 Ga0495685_005084 3300047447 Bacteria 4283
708 Ga0495685_012571 3300047447 Bacteria 2868
709 Ga0495685_020329 3300047447 Bacteria 2281
710 Ga0495685_027732 3300047447 Bacteria 1948
711 Ga0495685_093467 3300047447 Bacteria 995
712 Ga0495681_0000665 3300047470 Bacteria 26108
713 Ga0495681_0004558 3300047470 Bacteria 9443
714 Ga0495684_0004089 3300047471 Bacteria 11392
715 Ga0495684_0016370 3300047471 Bacteria 5710
716 Ga0495684_0031322 3300047471 Bacteria 4083
717 Ga0495684_0036554 3300047471 Bacteria 3764
718 Ga0495684_0213823 3300047471 Bacteria 1416
719 Ga0495686_0044087 3300047472 Bacteria 2824
720 Ga0495593_0000803 3300047673 Bacteria 18157
721 Ga0495593_0063670 3300047673 Bacteria 1925
722 Ga0495593_0125196 3300047673 Bacteria 1306
723 Ga0495602_0069887 3300048088 Bacteria 3008
724 Ga0495602_0147797 3300048088 Bacteria 1851
725 Ga0495614_0000585 3300048089 Bacteria 15189
726 Ga0495614_0003178 3300048089 Bacteria 7336
727 Ga0495614_0004622 3300048089 Bacteria 6199
728 Ga0495614_0049198 3300048089 Bacteria 1807
729 Ga0495614_0062271 3300048089 Bacteria 1603
730 Ga0495626_0031833 3300048091 Bacteria 2535
731 Ga0496100_0052514 3300048903 Bacteria 2650
732 Ga0496100_0331658 3300048903 Bacteria 1145
733 Ga0496101_0000252 3300048904 Bacteria 38425
734 Ga0496101_0001313 3300048904 Bacteria 14862
735 Ga0496101_0004785 3300048904 Bacteria 8584
736 Ga0496101_0147959 3300048904 Bacteria 1794
737 Ga0496102_0000277 3300048905 Bacteria 65492
738 Ga0496102_0000868 3300048905 Bacteria 28888
739 Ga0496102_0136274 3300048905 Bacteria 2300
740 Ga0496102_0153296 3300048905 Bacteria 2166
741 Ga0496103_0001078 3300048906 Bacteria 19063
742 Ga0496103_0049367 3300048906 Bacteria 2602
743 Ga0496103_0078199 3300048906 Bacteria 2077
744 Ga0496103_0163234 3300048906 Bacteria 1429
745 Ga0496104_0001573 3300048907 Bacteria 19634
746 Ga0496105_0071906 3300048908 Bacteria 2859
747 Ga0496105_0100421 3300048908 Bacteria 2389
748 Ga0496106_0001380 3300048909 Bacteria 18204
749 Ga0496106_0068337 3300048909 Bacteria 2710
750 Ga0496106_0077490 3300048909 Bacteria 2549
751 Ga0496106_0144231 3300048909 Bacteria 1874
752 Ga0496106_0206178 3300048909 Bacteria 1565
753 Ga0496107_0000829 3300048910 Bacteria 18033
754 Ga0496107_0000879 3300048910 Bacteria 17697
755 Ga0496107_0020468 3300048910 Bacteria 4673
756 Ga0496107_0113584 3300048910 Bacteria 1992
757 Ga0496107_0226112 3300048910 Bacteria 1392
758 Ga0496108_0013057 3300048911 Bacteria 6769
759 Ga0496108_0067612 3300048911 Bacteria 3014
760 Ga0496109_0004360 3300048912 Bacteria 11826
761 Ga0496109_0013710 3300048912 Bacteria 7041
762 Ga0496109_0015110 3300048912 Bacteria 6719
763 Ga0496109_0033398 3300048912 Bacteria 4629
764 Ga0496109_0281083 3300048912 Bacteria 1568
765 Ga0496110_0042530 3300048913 Bacteria 3965
766 Ga0496111_0016904 3300048914 Bacteria 5036
767 Ga0496112_0014095 3300048915 Bacteria 7402
768 Ga0496112_0036501 3300048915 Bacteria 4795
769 Ga0496113_0106327 3300048916 Bacteria 2179
770 Ga0496114_0000514 3300048917 Bacteria 28427
771 Ga0496114_0003450 3300048917 Bacteria 12126
772 Ga0496114_0170668 3300048917 Bacteria 1895
773 Ga0496115_0000799 3300048918 Bacteria 23089
774 Ga0496115_0017268 3300048918 Bacteria 5510
775 Ga0496115_0123144 3300048918 Bacteria 2134
776 Ga0496116_0013362 3300048919 Bacteria 6626
777 Ga0496117_0000760 3300048920 Bacteria 50798
778 Ga0496118_0000225 3300048921 Bacteria 98639
779 Ga0496119_0004423 3300048922 Bacteria 14003
780 Ga0496120_0005250 3300048923 Bacteria 10408
781 Ga0496121_0002455 3300048924 Bacteria 28318
782 Ga0496124_0043494 3300048927 Bacteria 3861
783 Ga0496125_0046539 3300048928 Bacteria 3638
784 Ga0496126_0025517 3300048929 Bacteria 5683
785 Ga0495678_021792 3300049459 Bacteria 2815
786 Ga0495678_044356 3300049459 Bacteria 1759
787 Ga0501032_0022832 3300049569 Bacteria 4333
788 Ga0501033_0000315 3300049570 Bacteria 45917
789 Ga0501033_0047859 3300049570 Bacteria 3178
790 Ga0501033_0060032 3300049570 Bacteria 2806
791 Ga0501033_0085241 3300049570 Bacteria 2314
792 Ga0501034_0006261 3300049571 Bacteria 12805
793 Ga0501034_0051993 3300049571 Bacteria 4130
794 Ga0501034_0055411 3300049571 Bacteria 3990
795 Ga0501034_0068916 3300049571 Bacteria 3548
796 Ga0501034_0133382 3300049571 Bacteria 2466
797 Ga0501036_0008190 3300049572 Bacteria 8567
798 Ga0501036_0043493 3300049572 Bacteria 3804
799 Ga0501037_0003381 3300049573 Bacteria 11596
800 Ga0501038_0016541 3300049574 Bacteria 6686
801 Ga0501038_0037143 3300049574 Bacteria 4273
802 Ga0501038_0039741 3300049574 Bacteria 4114
803 Ga0501039_0052942 3300049575 Bacteria 3140
804 Ga0501042_0068751 3300049578 Bacteria 2533
805 Ga0501043_0082017 3300049579 Bacteria 2534
806 Ga0501046_0073534 3300049580 Bacteria 2652
807 Ga0501046_0094212 3300049580 Bacteria 2301
808 Ga0501047_0024286 3300049581 Bacteria 5819
809 Ga0501047_0038824 3300049581 Bacteria 4606
810 Ga0501047_0051334 3300049581 Bacteria 3984
811 Ga0501047_0161347 3300049581 Bacteria 2113
812 Ga0501047_0172013 3300049581 Bacteria 2034
813 Ga0501048_0008440 3300049582 Bacteria 7790
814 Ga0501067_0249764 3300049583 Bacteria 987
815 Ga0501069_0064005 3300049585 Bacteria 2055
816 Ga0501070_0000283 3300049586 Bacteria 47512
817 Ga0501070_0149850 3300049586 Bacteria 1925
818 Ga0501070_0203699 3300049586 Bacteria 1625
819 Ga0501074_0000299 3300049590 Bacteria 28549
820 Ga0501035_0001215 3300049822 Bacteria 26839
821 Ga0501035_0001623 3300049822 Bacteria 22760
822 Ga0501035_0036288 3300049822 Bacteria 4468
823 Ga0501035_0109730 3300049822 Bacteria 2418
824 Ga0501044_0004709 3300049823 Bacteria 15252
825 Ga0501044_0006702 3300049823 Bacteria 12702
826 Ga0501044_0021565 3300049823 Bacteria 6869
827 Ga0501044_0033696 3300049823 Bacteria 5379
828 Ga0501044_0089490 3300049823 Bacteria 3107
829 Ga0501044_0097855 3300049823 Bacteria 2954
830 Ga0501044_0252062 3300049823 Bacteria 1706
831 Ga0501044_0361696 3300049823 Bacteria 1369
832 nmdc:mga03n38_102260_c1 3300050490 Bacteria 1383
833 nmdc:mga03n38_56077_c1 3300050490 Bacteria 1777
834 nmdc:mga00v17_1073_c1 3300050491 Bacteria 14396
835 nmdc:mga00v17_14428_c1 3300050491 Bacteria 4409
836 nmdc:mga00v17_28849_c1 3300050491 Bacteria 3253
837 nmdc:mga0yw44_447519_c1 3300050492 Bacteria 875
838 nmdc:mga0yw44_89134_c1 3300050492 Bacteria 1946
839 nmdc:mga06z11_107896_c1 3300050494 Bacteria 1537
840 nmdc:mga06z11_14231_c1 3300050494 Bacteria 3519
841 nmdc:mga0rr50_221664_c2 3300050513 Bacteria 1154
842 nmdc:mga08x19_172417_c1 3300050514 Bacteria 1474
843 nmdc:mga08x19_407920_c1 3300050514 Bacteria 954
844 nmdc:mga0sz30_2757_c1 3300050516 Bacteria 6268
845 nmdc:mga0sz30_30654_c1 3300050516 Bacteria 2223
846 nmdc:mga0sz30_8083_c1 3300050516 Bacteria 2580
847 Ga0495601_0181391 3300053077 Bacteria 1376
848 Ga0495612_0004919 3300053078 Bacteria 5526
849 Ga0495655_0012498 3300053083 Bacteria 1732
850 Ga0495595_0003924 3300053084 Bacteria 5938
851 Ga0495595_0028454 3300053084 Bacteria 2496
852 Ga0500578_0004838 3300053086 Bacteria 9328
853 Ga0500578_0178206 3300053086 Bacteria 1311
854 Ga0500643_023061 3300053087 Bacteria 1993
855 Ga0500646_0013121 3300053090 Bacteria 2145
856 Ga0500566_0084045 3300053094 Bacteria 1767
857 Ga0500640_006774 3300053095 Bacteria 4404
858 Ga0500641_0023160 3300053096 Bacteria 2386
859 Ga0500660_128514 3300053100 Bacteria 1036
860 Ga0500560_000466 3300053107 Bacteria 5636
861 Ga0500572_002226 3300053111 Bacteria 4735
862 Ga0500580_027725 3300053113 Bacteria 2393
863 Ga0500614_047686 3300053123 Bacteria 1113
864 Ga0500628_003906 3300053129 Bacteria 2460
865 Ga0500642_0089978 3300053130 Bacteria 1418
866 Ga0500652_012499 3300053131 Bacteria 2981
867 Ga0500658_0014891 3300053134 Bacteria 2882
868 Ga0500573_0015931 3300053140 Bacteria 4264
869 Ga0500573_0227879 3300053140 Bacteria 973
870 Ga0500577_0176845 3300053142 Bacteria 915
871 Ga0500579_061224 3300053143 Bacteria 2233
872 Ga0500600_0007862 3300053149 Bacteria 6421
873 Ga0500616_0004760 3300053153 Bacteria 9533
874 Ga0500616_0012651 3300053153 Bacteria 4933
875 Ga0500624_001614 3300053157 Bacteria 3423
876 Ga0500627_0026268 3300053158 Bacteria 2402
877 Ga0500633_0004692 3300053160 Bacteria 3168
878 Ga0500634_0000287 3300053161 Bacteria 16181
879 Ga0500645_077408 3300053730 Bacteria 950
880 Ga0500587_000669 3300053739 Bacteria 4356
881 Ga0466962_0008848 3300061719 Bacteria 4825
882 Ga0466962_0010393 3300061719 Bacteria 4473
883 Ga0466962_0121386 3300061719 Bacteria 1261

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0012900 Ga0373934_0012900_2443_3135 230
2 3300046455 Ga0495603_0003617 Ga0495603_0003617_8488_9180 230
3 3300046461 Ga0495641_0203902 Ga0495641_0203902_174_866 230
4 3300046462 Ga0495651_0126494 Ga0495651_0126494_1158_1850 230
5 3300046473 Ga0495582_0025537 Ga0495582_0025537_2523_3215 230
6 3300046536 Ga0495587_0212372 Ga0495587_0212372_390_1082 230
7 3300046674 Ga0495588_0268768 Ga0495588_0268768_193_885 230
8 3300047319 Ga0495674_0244977 Ga0495674_0244977_43_735 230
9 3300044706 Ga0466964_0215056 Ga0466964_0215056_188_892 234
10 3300005434 Ga0070709_10094127 Ga0070709_100941271 245
11 3300005435 Ga0070714_100295956 Ga0070714_1002959561 245
12 3300005436 Ga0070713_100126557 Ga0070713_1001265573 245
13 3300005439 Ga0070711_100007962 Ga0070711_1000079623 245
14 3300005445 Ga0070708_100158001 Ga0070708_1001580012 245
15 3300005468 Ga0070707_100003017 Ga0070707_1000030171 245
16 3300005468 Ga0070707_100246731 Ga0070707_1002467313 245
17 3300005518 Ga0070699_100002168 Ga0070699_1000021682 245
18 3300005536 Ga0070697_100002896 Ga0070697_10000289614 245
19 3300006028 Ga0070717_10172559 Ga0070717_101725592 245
20 3300006163 Ga0070715_10081780 Ga0070715_100817802 245
21 3300006173 Ga0070716_100198791 Ga0070716_1001987911 245
22 3300025898 Ga0207692_10044179 Ga0207692_100441792 245
23 3300025906 Ga0207699_10347996 Ga0207699_103479962 245
24 3300025910 Ga0207684_10029123 Ga0207684_100291232 245
25 3300025922 Ga0207646_10022756 Ga0207646_100227562 245
26 3300025939 Ga0207665_10014887 Ga0207665_100148872 245
27 3300035083 Ga0373926_0002751 Ga0373926_0002751_1731_2468 245
28 3300035088 Ga0373940_0045890 Ga0373940_0045890_131_868 245
29 3300035089 Ga0373944_0000937 Ga0373944_0000937_402_1139 245
30 3300035113 Ga0373936_0012017 Ga0373936_0012017_769_1506 245
31 3300035116 Ga0373945_0015958 Ga0373945_0015958_1435_2172 245
32 3300035119 Ga0373956_0071848 Ga0373956_0071848_45_782 245
33 3300035119 Ga0373956_0199692 Ga0373956_0199692_173_910 245
34 3300035170 Ga0373943_0000277 Ga0373943_0000277_19018_19755 245
35 3300035171 Ga0373946_0000047 Ga0373946_0000047_20076_20813 245
36 3300035172 Ga0373955_0217078 Ga0373955_0217078_262_999 245
37 3300035692 Ga0373935_0002314 Ga0373935_0002314_9242_9979 245
38 3300035695 Ga0373927_0000128 Ga0373927_0000128_37025_37762 245
39 3300035724 Ga0373933_0270959 Ga0373933_0270959_95_832 245
40 3300035725 Ga0373947_0000327 Ga0373947_0000327_18652_19389 245
41 3300036401 Ga0373937_0164920 Ga0373937_0164920_997_1734 245
42 3300036401 Ga0373937_0943483 Ga0373937_0943483_38_775 245
43 3300037068 Ga0373925_0001723 Ga0373925_0001723_7256_7993 245
44 3300046462 Ga0495651_0155399 Ga0495651_0155399_499_1236 245
45 3300046463 Ga0495653_0005693 Ga0495653_0005693_4115_4852 245
46 3300046463 Ga0495653_0207761 Ga0495653_0207761_279_1016 245
47 3300046472 Ga0495580_0152366 Ga0495580_0152366_36_773 245
48 3300046477 Ga0495664_0000355 Ga0495664_0000355_967_1704 245
49 3300046511 Ga0495608_0035702 Ga0495608_0035702_1542_2279 245
50 3300046514 Ga0495618_0050115 Ga0495618_0050115_1566_2303 245
51 3300046516 Ga0495628_0062151 Ga0495628_0062151_970_1707 245
52 3300046516 Ga0495628_0102837 Ga0495628_0102837_632_1369 245
53 3300046529 Ga0495652_0057169 Ga0495652_0057169_839_1576 245
54 3300046529 Ga0495652_0197683 Ga0495652_0197683_113_850 245
55 3300046529 Ga0495652_0262346 Ga0495652_0262346_35_772 245
56 3300046533 Ga0495640_0032961 Ga0495640_0032961_2607_3344 245
57 3300046543 Ga0495645_0189859 Ga0495645_0189859_467_1204 245
58 3300046559 Ga0495667_0045895 Ga0495667_0045895_443_1180 245
59 3300046642 Ga0495634_0054527 Ga0495634_0054527_438_1175 245
60 3300046663 Ga0495635_0006569 Ga0495635_0006569_1635_2372 245
61 3300046675 Ga0495657_0037987 Ga0495657_0037987_1328_2065 245
62 3300046678 Ga0495599_0050336 Ga0495599_0050336_296_1033 245
63 3300046678 Ga0495599_0096137 Ga0495599_0096137_1003_1740 245
64 3300046690 Ga0495624_0000942 Ga0495624_0000942_20614_21351 245
65 3300046809 Ga0495600_0202277 Ga0495600_0202277_292_1029 245
66 3300047315 Ga0495581_0038805 Ga0495581_0038805_1355_2092 245
67 3300047319 Ga0495674_0001655 Ga0495674_0001655_15272_16009 245
68 3300047319 Ga0495674_0047600 Ga0495674_0047600_2092_2829 245
69 3300047322 Ga0495680_0060263 Ga0495680_0060263_1959_2696 245
70 3300047322 Ga0495680_0173223 Ga0495680_0173223_260_997 245
71 3300047444 Ga0495675_0184571 Ga0495675_0184571_279_1016 245
72 3300047471 Ga0495684_0004089 Ga0495684_0004089_7762_8499 245
73 3300047471 Ga0495684_0036554 Ga0495684_0036554_1070_1807 245
74 3300047471 Ga0495684_0213823 Ga0495684_0213823_123_860 245
75 3300047673 Ga0495593_0125196 Ga0495593_0125196_313_1050 245
76 3300048088 Ga0495602_0147797 Ga0495602_0147797_98_835 245
77 3300053084 Ga0495595_0003924 Ga0495595_0003924_2900_3637 245
78 3300021388 Ga0213875_10024498 Ga0213875_100244983 246
79 3300050492 nmdc:mga0yw44_447519_c1 nmdc:mga0yw44_447519_c1_119_865 248
80 3300009098 Ga0105245_10876666 Ga0105245_108766662 250
81 3300044693 Ga0466961_0145283 Ga0466961_0145283_705_1457 250
82 3300048909 Ga0496106_0206178 Ga0496106_0206178_776_1528 250
83 3300049583 Ga0501067_0249764 Ga0501067_0249764_224_976 250
84 3300005617 Ga0068859_100203724 Ga0068859_1002037243 255
85 3300006931 Ga0097620_100203715 Ga0097620_1002037153 255
86 3300013297 Ga0157378_10162432 Ga0157378_101624322 255
87 3300005471 Ga0070698_100117027 Ga0070698_1001170272 257
88 3300013296 Ga0157374_10158360 Ga0157374_101583602 259
89 3300005445 Ga0070708_100002561 Ga0070708_10000256114 260
90 3300005467 Ga0070706_100017699 Ga0070706_1000176995 260
91 3300005468 Ga0070707_100044510 Ga0070707_1000445103 260
92 3300005471 Ga0070698_100018642 Ga0070698_1000186422 260
93 3300025910 Ga0207684_10009418 Ga0207684_100094183 260
94 3300025922 Ga0207646_10015635 Ga0207646_100156354 260
95 iso_pu_bacteria 2891326441 2891331097 262
96 3300037853 Ga0436364_0817251 Ga0436364_0817251_50_847 263
97 3300048912 Ga0496109_0033398 Ga0496109_0033398_1039_1830 263
98 3300003659 JGI25404J52841_10000681 JGI25404J52841_100006813 264
99 3300005983 Ga0081540_1001213 Ga0081540_100121317 264
100 3300025901 Ga0207688_10046896 Ga0207688_100468962 264
101 iso_pu_bacteria 2862574272 2862582601 264
102 3300005436 Ga0070713_100030313 Ga0070713_1000303134 265
103 3300025929 Ga0207664_10003887 Ga0207664_100038877 265
104 3300031995 Ga0307409_100366644 Ga0307409_1003666441 265
105 3300032004 Ga0307414_10422459 Ga0307414_104224591 265
106 iso_pu_bacteria 2643221578 2643897660 265
107 iso_pu_bacteria 2643221673 2644408806 265
108 iso_pu_bacteria 2808606982 2811847953 265
109 iso_pu_bacteria 2946045630 2946051072 265
110 iso_pu_bacteria 2997451912 2997456359 265
111 iso_pu_bacteria 2582581313 2585308396 266
112 iso_pu_bacteria 2582581314 2585313209 266
113 iso_pu_bacteria 2643221647 2644268884 266
114 iso_pu_bacteria 2643221714 2644632034 266
115 iso_pu_bacteria 2767802112 2768647273 266
116 iso_pu_bacteria 2784746768 2785368282 266
117 iso_pu_bacteria 2786546132 2786669280 266
118 iso_pu_bacteria 2808606375 2808919511 266
119 iso_pu_bacteria 2852635781 2852640789 266
120 iso_pu_bacteria 2862281513 2862288393 266
121 iso_pu_bacteria 2862705112 2862705254 266
122 iso_pu_bacteria 2867346516 2867347332 266
123 iso_pu_bacteria 2867428634 2867431506 266
124 iso_pu_bacteria 2875391855 2875393607 266
125 iso_pu_bacteria 2877676314 2877682297 266
126 iso_pu_bacteria 2899359706 2899366825 266
127 iso_pu_bacteria 2917736166 2917741383 266
128 iso_pu_bacteria 2946064051 2946066619 266
129 iso_pu_bacteria 2947224130 2947230574 266
130 iso_pu_bacteria 2954380949 2954387428 266
131 iso_pu_bacteria 2954673503 2954675743 266
132 iso_pu_bacteria 2954682443 2954688521 266
133 iso_pu_bacteria 2954691527 2954698262 266
134 iso_pu_bacteria 2954701450 2954703966 266
135 iso_pu_bacteria 2954711539 2954717283 266
136 iso_pu_bacteria 2954721474 2954727251 266
137 iso_pu_bacteria 2954731030 2954734541 266
138 iso_pu_bacteria 2954740390 2954746157 266
139 iso_pu_bacteria 2954749733 2954753438 266
140 iso_pu_bacteria 2954759201 2954765124 266
141 iso_pu_bacteria 2990044586 2990047748 266
142 iso_pu_bacteria 3006321560 3006322011 266
143 iso_pu_bacteria 3006493962 3006501942 266
144 iso_pu_bacteria 8003314358 8003323956 266
145 iso_pu_bacteria 8025478263 8025480032 266
146 iso_pu_bacteria 8025530807 8025531163 266
147 3300048908 Ga0496105_0071906 Ga0496105_0071906_1111_1914 267
148 3300048912 Ga0496109_0013710 Ga0496109_0013710_3062_3865 267
149 3300048914 Ga0496111_0016904 Ga0496111_0016904_3335_4138 267
150 3300048915 Ga0496112_0036501 Ga0496112_0036501_3898_4701 267
151 iso_pu_bacteria 2585427649 2586062360 267
152 iso_pu_bacteria 2643221548 2643759579 267
153 iso_pu_bacteria 2643221682 2644463005 267
154 iso_pu_bacteria 2751185734 2753069153 267
155 iso_pu_bacteria 2808606448 2809231221 267
156 iso_pu_bacteria 2808606522 2809588467 267
157 iso_pu_bacteria 2818991463 2819693839 267
158 iso_pu_bacteria 2862178590 2862182675 267
159 iso_pu_bacteria 2867475112 2867479616 267
160 iso_pu_bacteria 2870721527 2870728387 267
161 iso_pu_bacteria 2912715099 2912721195 267
162 iso_pu_bacteria 2915768154 2915770385 267
163 iso_pu_bacteria 2966598605 2966603470 267
164 iso_pu_bacteria 2990088156 2990089238 267
165 iso_pu_bacteria 8033684223 8033686189 267
166 iso_pu_bacteria 8056667051 8056673404 267
167 3300003316 rootH1_10033851 rootH1_100338512 268
168 3300003323 rootH1_10007618 rootH1_100076184 268
169 3300006048 Ga0075363_100295787 Ga0075363_1002957871 268
170 3300006353 Ga0075370_10090635 Ga0075370_100906352 268
171 3300024225 Ga0224572_1022509 Ga0224572_10225091 268
172 3300027312 Ga0209371_1012600 Ga0209371_10126002 268
173 3300028786 Ga0307517_10001523 Ga0307517_1000152320 268
174 3300028794 Ga0307515_10000262 Ga0307515_10000262118 268
175 3300030500 Ga0268256_1013761 Ga0268256_10137613 268
176 3300030522 Ga0307512_10021656 Ga0307512_100216562 268
177 3300031507 Ga0307509_10022428 Ga0307509_100224287 268
178 3300031616 Ga0307508_10024355 Ga0307508_100243554 268
179 3300031616 Ga0307508_10097627 Ga0307508_100976273 268
180 3300031649 Ga0307514_10004230 Ga0307514_100042302 268
181 3300031649 Ga0307514_10083805 Ga0307514_100838054 268
182 3300031730 Ga0307516_10007840 Ga0307516_1000784010 268
183 3300031838 Ga0307518_10012292 Ga0307518_100122926 268
184 3300032126 Ga0307415_100036094 Ga0307415_1000360941 268
185 3300033179 Ga0307507_10050253 Ga0307507_100502534 268
186 3300033180 Ga0307510_10035955 Ga0307510_100359555 268
187 3300039453 Ga0436362_1127991 Ga0436362_1127991_140_955 268
188 3300041404 Ga0439436_0001293 Ga0439436_0001293_5257_6072 268
189 3300041999 Ga0439433_0017868 Ga0439433_0017868_602_1417 268
190 3300042007 Ga0439449_0089172 Ga0439449_0089172_257_1072 268
191 3300042012 Ga0439455_0014033 Ga0439455_0014033_696_1511 268
192 3300042014 Ga0439457_000381 Ga0439457_000381_1079_1894 268
193 3300042138 Ga0450903_000036 Ga0450903_000036_7044_7859 268
194 3300042157 Ga0439458_0004847 Ga0439458_0004847_2048_2863 268
195 3300045976 Ga0466967_0092774 Ga0466967_0092774_885_1700 268
196 3300046455 Ga0495603_0041056 Ga0495603_0041056_1001_1810 268
197 3300046459 Ga0495629_0006991 Ga0495629_0006991_3188_4003 268
198 3300046460 Ga0495638_0018353 Ga0495638_0018353_2008_2817 268
199 3300046492 Ga0495585_0041242 Ga0495585_0041242_686_1495 268
200 3300046499 Ga0495594_0022825 Ga0495594_0022825_1815_2630 268
201 3300046499 Ga0495594_0026897 Ga0495594_0026897_1397_2206 268
202 3300046501 Ga0495607_0072554 Ga0495607_0072554_13_822 268
203 3300046616 Ga0495668_0055969 Ga0495668_0055969_490_1299 268
204 3300046660 Ga0495625_0007730 Ga0495625_0007730_2735_3550 268
205 3300046660 Ga0495625_0324724 Ga0495625_0324724_17_832 268
206 3300046674 Ga0495588_0007253 Ga0495588_0007253_3188_4003 268
207 3300046692 Ga0495671_0004121 Ga0495671_0004121_143_958 268
208 3300046794 Ga0495589_0008402 Ga0495589_0008402_2066_2875 268
209 3300047315 Ga0495581_0048903 Ga0495581_0048903_622_1431 268
210 3300047323 Ga0495683_0065278 Ga0495683_0065278_238_1047 268
211 3300047447 Ga0495685_027732 Ga0495685_027732_29_844 268
212 3300047470 Ga0495681_0004558 Ga0495681_0004558_4558_5373 268
213 3300048089 Ga0495614_0004622 Ga0495614_0004622_3458_4273 268
214 3300048089 Ga0495614_0062271 Ga0495614_0062271_30_839 268
215 3300049571 Ga0501034_0051993 Ga0501034_0051993_2287_3102 268
216 3300049580 Ga0501046_0094212 Ga0501046_0094212_71_886 268
217 3300049823 Ga0501044_0021565 Ga0501044_0021565_2166_2981 268
218 3300050490 nmdc:mga03n38_102260_c1 nmdc:mga03n38_102260_c1_103_918 268
219 3300053083 Ga0495655_0012498 Ga0495655_0012498_324_1139 268
220 3300053107 Ga0500560_000466 Ga0500560_000466_777_1592 268
221 iso_pu_bacteria 2547132111 2547407798 268
222 iso_pu_bacteria 2616644814 2616694633 268
223 iso_pu_bacteria 2643221678 2644436103 268
224 iso_pu_bacteria 2808606359 2808840929 268
225 iso_pu_bacteria 2811994917 2812481435 268
226 iso_pu_bacteria 2862507626 2862513984 268
227 iso_pu_bacteria 2946072368 2946074891 268
228 iso_pu_bacteria 2954002825 2954003989 268
229 iso_pu_bacteria 2990059506 2990066715 268
230 iso_pu_bacteria 3006393351 3006397302 268
231 iso_pu_bacteria 8008574985 8008579814 268
232 iso_pu_bacteria 8023623736 8023630420 268
233 iso_pu_bacteria 8048406513 8048407977 268
234 3300005327 Ga0070658_10065148 Ga0070658_100651482 269
235 3300005328 Ga0070676_10056316 Ga0070676_100563162 269
236 3300005329 Ga0070683_100088869 Ga0070683_1000888692 269
237 3300005330 Ga0070690_100095578 Ga0070690_1000955782 269
238 3300005334 Ga0068869_100056050 Ga0068869_1000560502 269
239 3300005335 Ga0070666_10082505 Ga0070666_100825052 269
240 3300005337 Ga0070682_100149627 Ga0070682_1001496272 269
241 3300005338 Ga0068868_100114618 Ga0068868_1001146182 269
242 3300005339 Ga0070660_100114617 Ga0070660_1001146171 269
243 3300005340 Ga0070689_100098080 Ga0070689_1000980801 269
244 3300005341 Ga0070691_10034133 Ga0070691_100341332 269
245 3300005343 Ga0070687_100064508 Ga0070687_1000645082 269
246 3300005344 Ga0070661_100088132 Ga0070661_1000881322 269
247 3300005354 Ga0070675_100023116 Ga0070675_1000231162 269
248 3300005364 Ga0070673_100014484 Ga0070673_1000144842 269
249 3300005366 Ga0070659_100037404 Ga0070659_1000374042 269
250 3300005367 Ga0070667_100035601 Ga0070667_1000356012 269
251 3300005406 Ga0070703_10037765 Ga0070703_100377652 269
252 3300005435 Ga0070714_100060167 Ga0070714_1000601672 269
253 3300005438 Ga0070701_10040702 Ga0070701_100407022 269
254 3300005441 Ga0070700_100072979 Ga0070700_1000729792 269
255 3300005455 Ga0070663_100028008 Ga0070663_1000280082 269
256 3300005456 Ga0070678_100187397 Ga0070678_1001873971 269
257 3300005457 Ga0070662_100413515 Ga0070662_1004135151 269
258 3300005458 Ga0070681_10142039 Ga0070681_101420392 269
259 3300005459 Ga0068867_100131119 Ga0068867_1001311192 269
260 3300005466 Ga0070685_10023279 Ga0070685_100232795 269
261 3300005467 Ga0070706_100229854 Ga0070706_1002298542 269
262 3300005471 Ga0070698_100167332 Ga0070698_1001673322 269
263 3300005471 Ga0070698_100493464 Ga0070698_1004934642 269
264 3300005530 Ga0070679_100062937 Ga0070679_1000629372 269
265 3300005539 Ga0068853_100138644 Ga0068853_1001386442 269
266 3300005543 Ga0070672_100063933 Ga0070672_1000639332 269
267 3300005544 Ga0070686_100127980 Ga0070686_1001279802 269
268 3300005545 Ga0070695_100092461 Ga0070695_1000924612 269
269 3300005546 Ga0070696_100084313 Ga0070696_1000843132 269
270 3300005547 Ga0070693_100140106 Ga0070693_1001401062 269
271 3300005548 Ga0070665_100269768 Ga0070665_1002697682 269
272 3300005549 Ga0070704_100091132 Ga0070704_1000911322 269
273 3300005563 Ga0068855_100108036 Ga0068855_1001080362 269
274 3300005577 Ga0068857_100022331 Ga0068857_1000223312 269
275 3300005578 Ga0068854_100019373 Ga0068854_1000193732 269
276 3300005615 Ga0070702_100014334 Ga0070702_1000143342 269
277 3300005618 Ga0068864_100053513 Ga0068864_1000535132 269
278 3300005834 Ga0068851_10085036 Ga0068851_100850362 269
279 3300005841 Ga0068863_100108884 Ga0068863_1001088842 269
280 3300005841 Ga0068863_100254038 Ga0068863_1002540382 269
281 3300005937 Ga0081455_10175698 Ga0081455_101756982 269
282 3300006163 Ga0070715_10006317 Ga0070715_100063172 269
283 3300006173 Ga0070716_100140692 Ga0070716_1001406922 269
284 3300006178 Ga0075367_10000748 Ga0075367_100007481 269
285 3300006237 Ga0097621_100303199 Ga0097621_1003031991 269
286 3300006358 Ga0068871_100038895 Ga0068871_1000388952 269
287 3300006871 Ga0075434_100506644 Ga0075434_1005066442 269
288 3300006914 Ga0075436_100204877 Ga0075436_1002048772 269
289 3300007076 Ga0075435_100171091 Ga0075435_1001710911 269
290 3300009011 Ga0105251_10044368 Ga0105251_100443682 269
291 3300009093 Ga0105240_10072016 Ga0105240_100720162 269
292 3300009098 Ga0105245_10612080 Ga0105245_106120802 269
293 3300009148 Ga0105243_10058847 Ga0105243_100588472 269
294 3300009174 Ga0105241_10324144 Ga0105241_103241442 269
295 3300009176 Ga0105242_10013381 Ga0105242_100133815 269
296 3300009177 Ga0105248_10390632 Ga0105248_103906322 269
297 3300009551 Ga0105238_10113718 Ga0105238_101137182 269
298 3300009553 Ga0105249_10069767 Ga0105249_100697672 269
299 3300010375 Ga0105239_10187638 Ga0105239_101876382 269
300 3300013100 Ga0157373_10083034 Ga0157373_100830342 269
301 3300013102 Ga0157371_10028027 Ga0157371_100280275 269
302 3300013104 Ga0157370_10084492 Ga0157370_100844922 269
303 3300014497 Ga0182008_10001369 Ga0182008_100013698 269
304 3300014745 Ga0157377_10040504 Ga0157377_100405044 269
305 3300015262 Ga0182007_10000387 Ga0182007_1000038710 269
306 3300015265 Ga0182005_1034250 Ga0182005_10342502 269
307 3300015688 Ga0183367_1009 Ga0183367_1009183 269
308 3300017792 Ga0163161_10041092 Ga0163161_100410924 269
309 3300020070 Ga0206356_11555668 Ga0206356_115556682 269
310 3300020081 Ga0206354_10656253 Ga0206354_106562532 269
311 3300025885 Ga0207653_10004753 Ga0207653_100047535 269
312 3300025898 Ga0207692_10039640 Ga0207692_100396402 269
313 3300025899 Ga0207642_10046615 Ga0207642_100466152 269
314 3300025900 Ga0207710_10055556 Ga0207710_100555562 269
315 3300025906 Ga0207699_10034060 Ga0207699_100340604 269
316 3300025906 Ga0207699_10064108 Ga0207699_100641082 269
317 3300025907 Ga0207645_10124439 Ga0207645_101244392 269
318 3300025912 Ga0207707_10070296 Ga0207707_100702962 269
319 3300025913 Ga0207695_10327826 Ga0207695_103278262 269
320 3300025915 Ga0207693_10035223 Ga0207693_100352232 269
321 3300025915 Ga0207693_10092258 Ga0207693_100922582 269
322 3300025916 Ga0207663_10288709 Ga0207663_102887092 269
323 3300025918 Ga0207662_10008318 Ga0207662_100083184 269
324 3300025919 Ga0207657_10003385 Ga0207657_100033856 269
325 3300025920 Ga0207649_10069790 Ga0207649_100697902 269
326 3300025928 Ga0207700_10019441 Ga0207700_100194413 269
327 3300025928 Ga0207700_10312693 Ga0207700_103126932 269
328 3300025931 Ga0207644_10170712 Ga0207644_101707122 269
329 3300025933 Ga0207706_10160044 Ga0207706_101600442 269
330 3300025936 Ga0207670_10039639 Ga0207670_100396392 269
331 3300025937 Ga0207669_10239551 Ga0207669_102395512 269
332 3300025939 Ga0207665_10014313 Ga0207665_100143136 269
333 3300025939 Ga0207665_10016902 Ga0207665_100169022 269
334 3300025940 Ga0207691_10015953 Ga0207691_100159532 269
335 3300025942 Ga0207689_10005067 Ga0207689_100050672 269
336 3300025960 Ga0207651_10324974 Ga0207651_103249741 269
337 3300026023 Ga0207677_10086010 Ga0207677_100860103 269
338 3300026067 Ga0207678_10035214 Ga0207678_100352145 269
339 3300026075 Ga0207708_10027234 Ga0207708_100272342 269
340 3300026078 Ga0207702_10094441 Ga0207702_100944412 269
341 3300026089 Ga0207648_10162153 Ga0207648_101621532 269
342 3300026095 Ga0207676_10202388 Ga0207676_102023882 269
343 3300026116 Ga0207674_10010179 Ga0207674_1001017910 269
344 3300026118 Ga0207675_100014809 Ga0207675_1000148092 269
345 3300026121 Ga0207683_10186521 Ga0207683_101865212 269
346 3300026142 Ga0207698_10207423 Ga0207698_102074232 269
347 3300028381 Ga0268264_10220857 Ga0268264_102208572 269
348 3300031456 Ga0307513_10101479 Ga0307513_101014793 269
349 3300034816 Ga0373930_0004186 Ga0373930_0004186_830_1642 269
350 3300035089 Ga0373944_0005705 Ga0373944_0005705_849_1661 269
351 3300035091 Ga0373951_0013166 Ga0373951_0013166_512_1324 269
352 3300035092 Ga0373952_0009709 Ga0373952_0009709_960_1772 269
353 3300035111 Ga0373923_0011003 Ga0373923_0011003_813_1625 269
354 3300035112 Ga0373932_0018425 Ga0373932_0018425_301_1113 269
355 3300035113 Ga0373936_0016608 Ga0373936_0016608_829_1641 269
356 3300035114 Ga0373939_0057105 Ga0373939_0057105_22_834 269
357 3300035116 Ga0373945_0001360 Ga0373945_0001360_1891_2703 269
358 3300035117 Ga0373953_0008491 Ga0373953_0008491_2207_3019 269
359 3300035171 Ga0373946_0003357 Ga0373946_0003357_2893_3705 269
360 3300035172 Ga0373955_0103351 Ga0373955_0103351_425_1237 269
361 3300035241 Ga0373961_0025039 Ga0373961_0025039_371_1183 269
362 3300035410 Ga0373924_0004348 Ga0373924_0004348_3356_4168 269
363 3300035691 Ga0373931_0058770 Ga0373931_0058770_563_1375 269
364 3300035695 Ga0373927_0033574 Ga0373927_0033574_1700_2512 269
365 3300035724 Ga0373933_0012826 Ga0373933_0012826_1997_2809 269
366 3300035724 Ga0373933_0117879 Ga0373933_0117879_798_1610 269
367 3300037853 Ga0436364_0517842 Ga0436364_0517842_4654_5472 269
368 3300039437 Ga0436365_1677319 Ga0436365_1677319_22_834 269
369 3300045976 Ga0466967_0012779 Ga0466967_0012779_1146_1958 269
370 3300045976 Ga0466967_0252530 Ga0466967_0252530_118_930 269
371 3300045976 Ga0466967_0419386 Ga0466967_0419386_469_1287 269
372 3300046459 Ga0495629_0009757 Ga0495629_0009757_1320_2132 269
373 3300046462 Ga0495651_0068437 Ga0495651_0068437_161_973 269
374 3300046463 Ga0495653_0029215 Ga0495653_0029215_3502_4314 269
375 3300046475 Ga0495639_0008710 Ga0495639_0008710_2892_3704 269
376 3300046476 Ga0495662_0001859 Ga0495662_0001859_7725_8537 269
377 3300046477 Ga0495664_0057721 Ga0495664_0057721_615_1427 269
378 3300046477 Ga0495664_0062536 Ga0495664_0062536_830_1642 269
379 3300046514 Ga0495618_0019675 Ga0495618_0019675_984_1796 269
380 3300046514 Ga0495618_0087109 Ga0495618_0087109_755_1567 269
381 3300046517 Ga0495630_0109868 Ga0495630_0109868_829_1641 269
382 3300046531 Ga0495665_0000881 Ga0495665_0000881_2786_3598 269
383 3300046533 Ga0495640_0138852 Ga0495640_0138852_253_1065 269
384 3300046543 Ga0495645_0017893 Ga0495645_0017893_1628_2440 269
385 3300046642 Ga0495634_0169106 Ga0495634_0169106_503_1315 269
386 3300046679 Ga0495623_0008756 Ga0495623_0008756_298_1110 269
387 3300046680 Ga0495646_0080930 Ga0495646_0080930_829_1641 269
388 3300046690 Ga0495624_0032904 Ga0495624_0032904_1719_2531 269
389 3300047315 Ga0495581_0005923 Ga0495581_0005923_402_1214 269
390 3300047315 Ga0495581_0034431 Ga0495581_0034431_1814_2626 269
391 3300047317 Ga0495604_0070900 Ga0495604_0070900_1320_2132 269
392 3300047322 Ga0495680_0015042 Ga0495680_0015042_1866_2678 269
393 3300047444 Ga0495675_0077824 Ga0495675_0077824_485_1297 269
394 3300047471 Ga0495684_0016370 Ga0495684_0016370_3214_4026 269
395 3300048089 Ga0495614_0049198 Ga0495614_0049198_193_1005 269
396 3300048904 Ga0496101_0147959 Ga0496101_0147959_295_1107 269
397 3300048905 Ga0496102_0136274 Ga0496102_0136274_966_1778 269
398 3300048906 Ga0496103_0078199 Ga0496103_0078199_548_1360 269
399 3300048908 Ga0496105_0100421 Ga0496105_0100421_682_1494 269
400 3300048910 Ga0496107_0020468 Ga0496107_0020468_319_1131 269
401 3300048912 Ga0496109_0281083 Ga0496109_0281083_208_1020 269
402 3300048913 Ga0496110_0042530 Ga0496110_0042530_1072_1884 269
403 3300048916 Ga0496113_0106327 Ga0496113_0106327_273_1085 269
404 3300048917 Ga0496114_0170668 Ga0496114_0170668_688_1500 269
405 3300048918 Ga0496115_0123144 Ga0496115_0123144_787_1599 269
406 3300049574 Ga0501038_0016541 Ga0501038_0016541_3090_3908 269
407 3300049579 Ga0501043_0082017 Ga0501043_0082017_535_1353 269
408 3300049581 Ga0501047_0161347 Ga0501047_0161347_19_837 269
409 3300049586 Ga0501070_0149850 Ga0501070_0149850_727_1545 269
410 3300049822 Ga0501035_0036288 Ga0501035_0036288_1146_1964 269
411 3300049823 Ga0501044_0006702 Ga0501044_0006702_10007_10825 269
412 3300049823 Ga0501044_0089490 Ga0501044_0089490_1525_2343 269
413 3300049823 Ga0501044_0097855 Ga0501044_0097855_1113_1931 269
414 3300050494 nmdc:mga06z11_14231_c1 nmdc:mga06z11_14231_c1_2520_3338 269
415 3300050513 nmdc:mga0rr50_221664_c2 nmdc:mga0rr50_221664_c2_306_1118 269
416 3300050514 nmdc:mga08x19_172417_c1 nmdc:mga08x19_172417_c1_644_1456 269
417 3300050514 nmdc:mga08x19_407920_c1 nmdc:mga08x19_407920_c1_43_855 269
418 3300053077 Ga0495601_0181391 Ga0495601_0181391_59_871 269
419 3300053078 Ga0495612_0004919 Ga0495612_0004919_2643_3455 269
420 3300053084 Ga0495595_0028454 Ga0495595_0028454_1077_1889 269
421 iso_pu_bacteria 2643221587 2643944875 269
422 iso_pu_bacteria 2643221677 2644431774 269
423 iso_pu_bacteria 2784132148 2784587655 269
424 iso_pu_bacteria 2811994879 2812359265 269
425 iso_pu_bacteria 2818991472 2819743024 269
426 iso_pu_bacteria 2862382967 2862387472 269
427 iso_pu_bacteria 2863404153 2863405882 269
428 iso_pu_bacteria 2912723979 2912725220 269
429 iso_pu_bacteria 2912757875 2912759773 269
430 iso_pu_bacteria 2919468124 2919468415 269
431 iso_pu_bacteria 8008558824 8008559240 269
432 iso_pu_bacteria 8056829672 8056836717 269
433 3300003322 rootL2_10031424 rootL2_100314241 270
434 3300003578 Ga0006562J51391_1052003 Ga0006562J51391_10520034 270
435 3300003578 Ga0006562J51391_1052005 Ga0006562J51391_10520052 270
436 3300003578 Ga0006562J51391_1098872 Ga0006562J51391_10988722 270
437 3300005347 Ga0070668_100373774 Ga0070668_1003737742 270
438 3300005456 Ga0070678_100704122 Ga0070678_1007041221 270
439 3300005577 Ga0068857_100440695 Ga0068857_1004406952 270
440 3300009098 Ga0105245_10362887 Ga0105245_103628872 270
441 3300011119 Ga0105246_10228948 Ga0105246_102289482 270
442 3300013105 Ga0157369_10147148 Ga0157369_101471482 270
443 3300025297 Ga0209758_1004639 Ga0209758_10046397 270
444 3300025302 Ga0207426_1013368 Ga0207426_10133685 270
445 3300025904 Ga0207647_10246791 Ga0207647_102467912 270
446 3300025928 Ga0207700_10194581 Ga0207700_101945811 270
447 3300025972 Ga0207668_10016610 Ga0207668_100166106 270
448 3300026041 Ga0207639_10020409 Ga0207639_100204093 270
449 3300026067 Ga0207678_10000171 Ga0207678_100001719 270
450 3300026121 Ga0207683_10307765 Ga0207683_103077652 270
451 3300028794 Ga0307515_10170563 Ga0307515_101705632 270
452 3300030521 Ga0307511_10039103 Ga0307511_100391034 270
453 3300030521 Ga0307511_10072373 Ga0307511_100723732 270
454 3300030522 Ga0307512_10003287 Ga0307512_1000328710 270
455 3300030522 Ga0307512_10098573 Ga0307512_100985733 270
456 3300031507 Ga0307509_10038476 Ga0307509_100384763 270
457 3300031616 Ga0307508_10011423 Ga0307508_100114231 270
458 3300031616 Ga0307508_10385336 Ga0307508_103853361 270
459 3300033180 Ga0307510_10104532 Ga0307510_101045323 270
460 3300033180 Ga0307510_10259218 Ga0307510_102592182 270
461 3300037466 Ga0395898_0004836 Ga0395898_0004836_6290_7120 270
462 3300037466 Ga0395898_0005281 Ga0395898_0005281_170_991 270
463 3300037466 Ga0395898_0525145 Ga0395898_0525145_139_960 270
464 3300037471 Ga0395905_0040820 Ga0395905_0040820_1662_2492 270
465 3300037853 Ga0436364_0208258 Ga0436364_0208258_500_1324 270
466 3300041406 Ga0439439_0001590 Ga0439439_0001590_1348_2169 270
467 3300041999 Ga0439433_0006462 Ga0439433_0006462_369_1190 270
468 3300042006 Ga0439432_034153 Ga0439432_034153_318_1139 270
469 3300042014 Ga0439457_003517 Ga0439457_003517_1043_1864 270
470 3300042014 Ga0439457_005534 Ga0439457_005534_1192_2013 270
471 3300042131 Ga0450894_002527 Ga0450894_002527_965_1786 270
472 3300042134 Ga0450898_000804 Ga0450898_000804_2823_3644 270
473 3300042135 Ga0450899_000387 Ga0450899_000387_434_1255 270
474 3300042145 Ga0450906_000131 Ga0450906_000131_11927_12748 270
475 3300044658 Ga0466972_0014843 Ga0466972_0014843_175_996 270
476 3300044658 Ga0466972_0035207 Ga0466972_0035207_636_1475 270
477 3300044658 Ga0466972_0035479 Ga0466972_0035479_1254_2069 270
478 3300044684 Ga0466966_0006730 Ga0466966_0006730_3649_4470 270
479 3300044693 Ga0466961_0017828 Ga0466961_0017828_2308_3147 270
480 3300044693 Ga0466961_0194769 Ga0466961_0194769_39_860 270
481 3300044694 Ga0466963_0000196 Ga0466963_0000196_10730_11563 270
482 3300044719 Ga0466971_0035566 Ga0466971_0035566_1319_2140 270
483 3300044765 Ga0466970_0003680 Ga0466970_0003680_5182_6003 270
484 3300044842 Ga0466957_0020111 Ga0466957_0020111_689_1510 270
485 3300044901 Ga0466960_0029308 Ga0466960_0029308_1184_2023 270
486 3300044901 Ga0466960_0116373 Ga0466960_0116373_471_1292 270
487 3300044901 Ga0466960_0274319 Ga0466960_0274319_88_903 270
488 3300045976 Ga0466967_0050586 Ga0466967_0050586_156_977 270
489 3300045976 Ga0466967_0359330 Ga0466967_0359330_549_1370 270
490 3300046452 Ga0495617_027607 Ga0495617_027607_189_1013 270
491 3300046455 Ga0495603_0003796 Ga0495603_0003796_2259_3080 270
492 3300046455 Ga0495603_0028037 Ga0495603_0028037_1731_2552 270
493 3300046459 Ga0495629_0041423 Ga0495629_0041423_2081_2905 270
494 3300046459 Ga0495629_0044450 Ga0495629_0044450_2226_3047 270
495 3300046461 Ga0495641_0080463 Ga0495641_0080463_544_1368 270
496 3300046474 Ga0495605_0017534 Ga0495605_0017534_1284_2108 270
497 3300046476 Ga0495662_0010695 Ga0495662_0010695_1458_2279 270
498 3300046476 Ga0495662_0021273 Ga0495662_0021273_818_1639 270
499 3300046476 Ga0495662_0027853 Ga0495662_0027853_1799_2620 270
500 3300046499 Ga0495594_0008294 Ga0495594_0008294_2724_3545 270
501 3300046506 Ga0495583_0067536 Ga0495583_0067536_205_1026 270
502 3300046507 Ga0495606_0023291 Ga0495606_0023291_285_1109 270
503 3300046511 Ga0495608_0096471 Ga0495608_0096471_114_938 270
504 3300046513 Ga0495616_0031733 Ga0495616_0031733_1762_2586 270
505 3300046514 Ga0495618_0112689 Ga0495618_0112689_452_1276 270
506 3300046515 Ga0495620_0004961 Ga0495620_0004961_2992_3816 270
507 3300046515 Ga0495620_0010780 Ga0495620_0010780_2904_3728 270
508 3300046516 Ga0495628_0030094 Ga0495628_0030094_1525_2349 270
509 3300046518 Ga0495631_0030629 Ga0495631_0030629_1301_2125 270
510 3300046522 Ga0495643_0002819 Ga0495643_0002819_7636_8460 270
511 3300046526 Ga0495666_0178764 Ga0495666_0178764_120_944 270
512 3300046529 Ga0495652_0051890 Ga0495652_0051890_2360_3184 270
513 3300046530 Ga0495654_0159482 Ga0495654_0159482_10_834 270
514 3300046531 Ga0495665_0024190 Ga0495665_0024190_2404_3228 270
515 3300046533 Ga0495640_0008927 Ga0495640_0008927_5982_6806 270
516 3300046536 Ga0495587_0174832 Ga0495587_0174832_281_1102 270
517 3300046542 Ga0495597_0034798 Ga0495597_0034798_297_1121 270
518 3300046557 Ga0495622_0002073 Ga0495622_0002073_321_1145 270
519 3300046616 Ga0495668_0036891 Ga0495668_0036891_1053_1877 270
520 3300046642 Ga0495634_0070018 Ga0495634_0070018_609_1433 270
521 3300046648 Ga0495611_0014161 Ga0495611_0014161_1475_2299 270
522 3300046660 Ga0495625_0100161 Ga0495625_0100161_1028_1852 270
523 3300046674 Ga0495588_0002826 Ga0495588_0002826_1297_2118 270
524 3300046674 Ga0495588_0007542 Ga0495588_0007542_2254_3075 270
525 3300046675 Ga0495657_0005323 Ga0495657_0005323_5861_6682 270
526 3300046675 Ga0495657_0045198 Ga0495657_0045198_537_1361 270
527 3300046675 Ga0495657_0059729 Ga0495657_0059729_836_1660 270
528 3300046680 Ga0495646_0020434 Ga0495646_0020434_579_1403 270
529 3300046689 Ga0495613_0012437 Ga0495613_0012437_3347_4168 270
530 3300046689 Ga0495613_0062646 Ga0495613_0062646_745_1566 270
531 3300046690 Ga0495624_0177540 Ga0495624_0177540_321_1145 270
532 3300046691 Ga0495670_0139317 Ga0495670_0139317_180_1001 270
533 3300046694 Ga0495649_0019128 Ga0495649_0019128_928_1752 270
534 3300046794 Ga0495589_0032763 Ga0495589_0032763_1133_1954 270
535 3300046794 Ga0495589_0147436 Ga0495589_0147436_110_934 270
536 3300046810 Ga0495660_0064945 Ga0495660_0064945_859_1683 270
537 3300046810 Ga0495660_0159007 Ga0495660_0159007_236_1060 270
538 3300047318 Ga0495636_0001903 Ga0495636_0001903_5017_5838 270
539 3300047318 Ga0495636_0054307 Ga0495636_0054307_737_1561 270
540 3300047318 Ga0495636_0168546 Ga0495636_0168546_141_962 270
541 3300047319 Ga0495674_0046357 Ga0495674_0046357_591_1415 270
542 3300047321 Ga0495676_0065143 Ga0495676_0065143_32_856 270
543 3300047323 Ga0495683_0009058 Ga0495683_0009058_3401_4225 270
544 3300047444 Ga0495675_0010024 Ga0495675_0010024_4795_5616 270
545 3300047444 Ga0495675_0015663 Ga0495675_0015663_3880_4704 270
546 3300047447 Ga0495685_005084 Ga0495685_005084_1954_2775 270
547 3300047447 Ga0495685_012571 Ga0495685_012571_103_924 270
548 3300047447 Ga0495685_020329 Ga0495685_020329_1348_2172 270
549 3300047447 Ga0495685_093467 Ga0495685_093467_55_879 270
550 3300047472 Ga0495686_0044087 Ga0495686_0044087_1973_2797 270
551 3300047673 Ga0495593_0063670 Ga0495593_0063670_895_1719 270
552 3300048091 Ga0495626_0031833 Ga0495626_0031833_1551_2375 270
553 3300048911 Ga0496108_0067612 Ga0496108_0067612_967_1788 270
554 3300048912 Ga0496109_0015110 Ga0496109_0015110_1969_2790 270
555 3300049459 Ga0495678_021792 Ga0495678_021792_1411_2235 270
556 3300049459 Ga0495678_044356 Ga0495678_044356_133_957 270
557 3300049569 Ga0501032_0022832 Ga0501032_0022832_1623_2468 270
558 3300049570 Ga0501033_0047859 Ga0501033_0047859_581_1426 270
559 3300049570 Ga0501033_0060032 Ga0501033_0060032_928_1749 270
560 3300049571 Ga0501034_0006261 Ga0501034_0006261_11753_12598 270
561 3300049571 Ga0501034_0068916 Ga0501034_0068916_874_1695 270
562 3300049572 Ga0501036_0043493 Ga0501036_0043493_774_1619 270
563 3300049573 Ga0501037_0003381 Ga0501037_0003381_5742_6587 270
564 3300049574 Ga0501038_0039741 Ga0501038_0039741_3074_3919 270
565 3300049578 Ga0501042_0068751 Ga0501042_0068751_20_865 270
566 3300049580 Ga0501046_0073534 Ga0501046_0073534_1410_2255 270
567 3300049581 Ga0501047_0172013 Ga0501047_0172013_207_1052 270
568 3300049582 Ga0501048_0008440 Ga0501048_0008440_4475_5320 270
569 3300049822 Ga0501035_0109730 Ga0501035_0109730_991_1836 270
570 3300049823 Ga0501044_0033696 Ga0501044_0033696_207_1052 270
571 3300053140 Ga0500573_0015931 Ga0500573_0015931_940_1800 270
572 3300061719 Ga0466962_0121386 Ga0466962_0121386_19_840 270
573 iso_pu_bacteria 2643221670 2644385176 270
574 iso_pu_bacteria 2773857759 2774383643 270
575 iso_pu_bacteria 2902792274 2902796943 270
576 3300003322 rootL2_10002639 rootL2_1000263911 271
577 3300003322 rootL2_10237235 rootL2_102372352 271
578 3300025302 Ga0207426_1002223 Ga0207426_10022235 271
579 3300025302 Ga0207426_1002227 Ga0207426_10022272 271
580 3300030521 Ga0307511_10001166 Ga0307511_1000116617 271
581 3300031456 Ga0307513_10157218 Ga0307513_101572183 271
582 3300031507 Ga0307509_10192381 Ga0307509_101923812 271
583 3300031649 Ga0307514_10105230 Ga0307514_101052302 271
584 3300031730 Ga0307516_10034680 Ga0307516_100346805 271
585 3300031730 Ga0307516_10104985 Ga0307516_101049853 271
586 3300031838 Ga0307518_10043316 Ga0307518_100433162 271
587 3300031852 Ga0307410_10202267 Ga0307410_102022673 271
588 3300032002 Ga0307416_100370142 Ga0307416_1003701422 271
589 3300039062 Ga0400483_166410 Ga0400483_166410_7726_8622 271
590 3300041494 Ga0451837_0441292 Ga0451837_0441292_1562_2386 271
591 3300042007 Ga0439449_0020539 Ga0439449_0020539_570_1391 271
592 3300044658 Ga0466972_0050303 Ga0466972_0050303_350_1177 271
593 3300044693 Ga0466961_0046233 Ga0466961_0046233_1299_2132 271
594 3300044694 Ga0466963_0002936 Ga0466963_0002936_8021_8854 271
595 3300044901 Ga0466960_0107471 Ga0466960_0107471_165_986 271
596 3300045976 Ga0466967_0296825 Ga0466967_0296825_24_848 271
597 3300046453 Ga0495627_043249 Ga0495627_043249_108_926 271
598 3300046454 Ga0495592_0004397 Ga0495592_0004397_1986_2810 271
599 3300046455 Ga0495603_0001858 Ga0495603_0001858_10952_11773 271
600 3300046455 Ga0495603_0002751 Ga0495603_0002751_2715_3539 271
601 3300046457 Ga0495590_0113503 Ga0495590_0113503_28_861 271
602 3300046459 Ga0495629_0019173 Ga0495629_0019173_1507_2331 271
603 3300046459 Ga0495629_0063842 Ga0495629_0063842_582_1403 271
604 3300046459 Ga0495629_0095786 Ga0495629_0095786_483_1307 271
605 3300046459 Ga0495629_0294667 Ga0495629_0294667_246_1079 271
606 3300046460 Ga0495638_0008299 Ga0495638_0008299_120_953 271
607 3300046460 Ga0495638_0023834 Ga0495638_0023834_3131_3955 271
608 3300046462 Ga0495651_0003483 Ga0495651_0003483_9700_10524 271
609 3300046473 Ga0495582_0015241 Ga0495582_0015241_1195_2019 271
610 3300046476 Ga0495662_0005451 Ga0495662_0005451_4159_4983 271
611 3300046477 Ga0495664_0006519 Ga0495664_0006519_4327_5151 271
612 3300046492 Ga0495585_0033955 Ga0495585_0033955_1774_2607 271
613 3300046499 Ga0495594_0000244 Ga0495594_0000244_16106_16930 271
614 3300046516 Ga0495628_0020376 Ga0495628_0020376_879_1703 271
615 3300046517 Ga0495630_0002641 Ga0495630_0002641_10798_11622 271
616 3300046522 Ga0495643_0001406 Ga0495643_0001406_2700_3533 271
617 3300046529 Ga0495652_0045401 Ga0495652_0045401_2905_3729 271
618 3300046533 Ga0495640_0016406 Ga0495640_0016406_3198_4022 271
619 3300046536 Ga0495587_0001034 Ga0495587_0001034_13222_14046 271
620 3300046543 Ga0495645_0008885 Ga0495645_0008885_682_1506 271
621 3300046557 Ga0495622_0007613 Ga0495622_0007613_566_1390 271
622 3300046557 Ga0495622_0072386 Ga0495622_0072386_272_1096 271
623 3300046558 Ga0495633_0035129 Ga0495633_0035129_1289_2122 271
624 3300046642 Ga0495634_0042766 Ga0495634_0042766_157_981 271
625 3300046648 Ga0495611_0010852 Ga0495611_0010852_2687_3511 271
626 3300046660 Ga0495625_0014809 Ga0495625_0014809_914_1741 271
627 3300046663 Ga0495635_0000563 Ga0495635_0000563_14998_15822 271
628 3300046674 Ga0495588_0220846 Ga0495588_0220846_121_945 271
629 3300046675 Ga0495657_0004129 Ga0495657_0004129_1190_2014 271
630 3300046678 Ga0495599_0055249 Ga0495599_0055249_1633_2457 271
631 3300046680 Ga0495646_0196749 Ga0495646_0196749_119_943 271
632 3300046689 Ga0495613_0000689 Ga0495613_0000689_206_1027 271
633 3300046691 Ga0495670_0004493 Ga0495670_0004493_5392_6225 271
634 3300046809 Ga0495600_0043021 Ga0495600_0043021_157_981 271
635 3300046810 Ga0495660_0015012 Ga0495660_0015012_2658_3491 271
636 3300047315 Ga0495581_0008559 Ga0495581_0008559_1603_2427 271
637 3300047315 Ga0495581_0222785 Ga0495581_0222785_150_971 271
638 3300047317 Ga0495604_0000177 Ga0495604_0000177_13388_14212 271
639 3300047321 Ga0495676_0002684 Ga0495676_0002684_1586_2410 271
640 3300047321 Ga0495676_0002844 Ga0495676_0002844_562_1383 271
641 3300047321 Ga0495676_0031274 Ga0495676_0031274_3572_4396 271
642 3300047323 Ga0495683_0020547 Ga0495683_0020547_1687_2520 271
643 3300047443 Ga0495687_011361 Ga0495687_011361_770_1594 271
644 3300047444 Ga0495675_0018918 Ga0495675_0018918_1592_2416 271
645 3300047446 Ga0495679_013057 Ga0495679_013057_1762_2595 271
646 3300047447 Ga0495685_000162 Ga0495685_000162_2877_3710 271
647 3300047470 Ga0495681_0000665 Ga0495681_0000665_6388_7221 271
648 3300047471 Ga0495684_0031322 Ga0495684_0031322_3103_3927 271
649 3300047673 Ga0495593_0000803 Ga0495593_0000803_13323_14147 271
650 3300048088 Ga0495602_0069887 Ga0495602_0069887_1771_2595 271
651 3300048089 Ga0495614_0000585 Ga0495614_0000585_1873_2694 271
652 3300048089 Ga0495614_0003178 Ga0495614_0003178_5526_6350 271
653 3300048909 Ga0496106_0077490 Ga0496106_0077490_965_1786 271
654 3300049570 Ga0501033_0000315 Ga0501033_0000315_41200_42024 271
655 3300049572 Ga0501036_0008190 Ga0501036_0008190_3591_4415 271
656 3300049574 Ga0501038_0037143 Ga0501038_0037143_955_1779 271
657 3300049575 Ga0501039_0052942 Ga0501039_0052942_1790_2614 271
658 3300049581 Ga0501047_0038824 Ga0501047_0038824_467_1291 271
659 3300049586 Ga0501070_0000283 Ga0501070_0000283_6469_7293 271
660 3300049590 Ga0501074_0000299 Ga0501074_0000299_18961_19785 271
661 3300049822 Ga0501035_0001623 Ga0501035_0001623_19762_20586 271
662 3300049823 Ga0501044_0361696 Ga0501044_0361696_409_1233 271
663 3300053086 Ga0500578_0004838 Ga0500578_0004838_2108_2941 271
664 3300053094 Ga0500566_0084045 Ga0500566_0084045_807_1640 271
665 3300053095 Ga0500640_006774 Ga0500640_006774_3314_4138 271
666 3300053100 Ga0500660_128514 Ga0500660_128514_149_982 271
667 3300053111 Ga0500572_002226 Ga0500572_002226_3458_4282 271
668 3300053113 Ga0500580_027725 Ga0500580_027725_1031_1864 271
669 3300053123 Ga0500614_047686 Ga0500614_047686_212_1045 271
670 3300053129 Ga0500628_003906 Ga0500628_003906_1108_1941 271
671 3300053134 Ga0500658_0014891 Ga0500658_0014891_460_1293 271
672 3300053140 Ga0500573_0227879 Ga0500573_0227879_125_955 271
673 3300053142 Ga0500577_0176845 Ga0500577_0176845_67_900 271
674 3300053143 Ga0500579_061224 Ga0500579_061224_362_1195 271
675 3300053149 Ga0500600_0007862 Ga0500600_0007862_5036_5869 271
676 3300053153 Ga0500616_0004760 Ga0500616_0004760_8289_9122 271
677 3300053157 Ga0500624_001614 Ga0500624_001614_1271_2095 271
678 3300053160 Ga0500633_0004692 Ga0500633_0004692_402_1235 271
679 3300053161 Ga0500634_0000287 Ga0500634_0000287_393_1226 271
680 3300053739 Ga0500587_000669 Ga0500587_000669_2712_3545 271
681 3300061719 Ga0466962_0008848 Ga0466962_0008848_902_1735 271
682 iso_pu_bacteria 2738541274 2738703773 271
683 3300005435 Ga0070714_100252295 Ga0070714_1002522952 272
684 3300005937 Ga0081455_10031663 Ga0081455_100316637 272
685 3300039437 Ga0436365_0967944 Ga0436365_0967944_18380_19207 272
686 3300044694 Ga0466963_0311262 Ga0466963_0311262_116_934 272
687 3300044719 Ga0466971_0024068 Ga0466971_0024068_697_1515 272
688 3300049823 Ga0501044_0252062 Ga0501044_0252062_846_1673 272
689 3300053130 Ga0500642_0089978 Ga0500642_0089978_256_1074 272
690 3300006048 Ga0075363_100004182 Ga0075363_1000041824 273
691 3300006353 Ga0075370_10059193 Ga0075370_100591932 273
692 3300021384 Ga0213876_10003411 Ga0213876_100034116 273
693 3300021388 Ga0213875_10006612 Ga0213875_100066122 273
694 3300037853 Ga0436364_0395198 Ga0436364_0395198_524_1345 273
695 3300039437 Ga0436365_0470798 Ga0436365_0470798_23602_24423 273
696 3300039438 Ga0436360_1088767 Ga0436360_1088767_341_1171 273
697 3300044694 Ga0466963_0320350 Ga0466963_0320350_51_872 273
698 3300050491 nmdc:mga00v17_14428_c1 nmdc:mga00v17_14428_c1_1103_1924 273
699 3300002077 JGI24744J21845_10000054 JGI24744J21845_100000547 274
700 3300002077 JGI24744J21845_10003102 JGI24744J21845_100031024 274
701 3300002244 JGI24742J22300_10000699 JGI24742J22300_100006992 274
702 3300005328 Ga0070676_10166136 Ga0070676_101661361 274
703 3300005330 Ga0070690_100012537 Ga0070690_1000125373 274
704 3300005334 Ga0068869_100010144 Ga0068869_1000101446 274
705 3300005337 Ga0070682_100046630 Ga0070682_1000466302 274
706 3300005337 Ga0070682_100367501 Ga0070682_1003675011 274
707 3300005338 Ga0068868_100000692 Ga0068868_1000006929 274
708 3300005340 Ga0070689_100132048 Ga0070689_1001320483 274
709 3300005340 Ga0070689_100163672 Ga0070689_1001636722 274
710 3300005347 Ga0070668_100106344 Ga0070668_1001063442 274
711 3300005353 Ga0070669_100002285 Ga0070669_1000022851 274
712 3300005353 Ga0070669_100010546 Ga0070669_1000105465 274
713 3300005353 Ga0070669_100219553 Ga0070669_1002195532 274
714 3300005355 Ga0070671_100034440 Ga0070671_1000344404 274
715 3300005355 Ga0070671_100248661 Ga0070671_1002486611 274
716 3300005356 Ga0070674_100007386 Ga0070674_1000073863 274
717 3300005356 Ga0070674_100009109 Ga0070674_1000091094 274
718 3300005356 Ga0070674_100106983 Ga0070674_1001069832 274
719 3300005364 Ga0070673_100264147 Ga0070673_1002641472 274
720 3300005365 Ga0070688_100223667 Ga0070688_1002236672 274
721 3300005366 Ga0070659_100066605 Ga0070659_1000666052 274
722 3300005367 Ga0070667_100021512 Ga0070667_1000215126 274
723 3300005436 Ga0070713_100150225 Ga0070713_1001502252 274
724 3300005437 Ga0070710_10000486 Ga0070710_100004865 274
725 3300005437 Ga0070710_10005873 Ga0070710_100058734 274
726 3300005438 Ga0070701_10003037 Ga0070701_100030375 274
727 3300005439 Ga0070711_100005689 Ga0070711_1000056897 274
728 3300005439 Ga0070711_100007574 Ga0070711_1000075743 274
729 3300005440 Ga0070705_100002283 Ga0070705_1000022836 274
730 3300005440 Ga0070705_100079337 Ga0070705_1000793372 274
731 3300005441 Ga0070700_100149276 Ga0070700_1001492762 274
732 3300005441 Ga0070700_100439957 Ga0070700_1004399571 274
733 3300005455 Ga0070663_100024895 Ga0070663_1000248952 274
734 3300005455 Ga0070663_100143210 Ga0070663_1001432102 274
735 3300005456 Ga0070678_100000230 Ga0070678_1000002306 274
736 3300005456 Ga0070678_100119865 Ga0070678_1001198651 274
737 3300005457 Ga0070662_100003258 Ga0070662_1000032588 274
738 3300005459 Ga0068867_100018661 Ga0068867_1000186612 274
739 3300005539 Ga0068853_100030665 Ga0068853_1000306654 274
740 3300005543 Ga0070672_100426217 Ga0070672_1004262172 274
741 3300005544 Ga0070686_100185225 Ga0070686_1001852252 274
742 3300005545 Ga0070695_100306947 Ga0070695_1003069471 274
743 3300005546 Ga0070696_100002631 Ga0070696_1000026312 274
744 3300005546 Ga0070696_100495013 Ga0070696_1004950131 274
745 3300005547 Ga0070693_100059203 Ga0070693_1000592032 274
746 3300005548 Ga0070665_100013254 Ga0070665_1000132542 274
747 3300005548 Ga0070665_100047390 Ga0070665_1000473904 274
748 3300005548 Ga0070665_100304090 Ga0070665_1003040903 274
749 3300005549 Ga0070704_100113556 Ga0070704_1001135561 274
750 3300005563 Ga0068855_100128954 Ga0068855_1001289543 274
751 3300005578 Ga0068854_100000723 Ga0068854_10000072322 274
752 3300005614 Ga0068856_100022196 Ga0068856_1000221964 274
753 3300005615 Ga0070702_100000434 Ga0070702_1000004348 274
754 3300005616 Ga0068852_100016014 Ga0068852_1000160144 274
755 3300005616 Ga0068852_100085602 Ga0068852_1000856022 274
756 3300005617 Ga0068859_100016786 Ga0068859_1000167867 274
757 3300005617 Ga0068859_100018510 Ga0068859_1000185104 274
758 3300005718 Ga0068866_10000072 Ga0068866_1000007241 274
759 3300005719 Ga0068861_100064345 Ga0068861_1000643452 274
760 3300005841 Ga0068863_100000193 Ga0068863_10000019356 274
761 3300005842 Ga0068858_100005187 Ga0068858_10000518711 274
762 3300005842 Ga0068858_100007410 Ga0068858_10000741010 274
763 3300005843 Ga0068860_100000166 Ga0068860_100000166107 274
764 3300005843 Ga0068860_100014460 Ga0068860_1000144605 274
765 3300005844 Ga0068862_100000205 Ga0068862_10000020526 274
766 3300005937 Ga0081455_10021015 Ga0081455_100210153 274
767 3300006038 Ga0075365_10082479 Ga0075365_100824792 274
768 3300006051 Ga0075364_10000380 Ga0075364_100003805 274
769 3300006051 Ga0075364_10023367 Ga0075364_100233674 274
770 3300006163 Ga0070715_10003467 Ga0070715_100034674 274
771 3300006173 Ga0070716_100108399 Ga0070716_1001083993 274
772 3300006175 Ga0070712_100006609 Ga0070712_1000066095 274
773 3300006175 Ga0070712_100010841 Ga0070712_1000108416 274
774 3300006186 Ga0075369_10001022 Ga0075369_100010228 274
775 3300006186 Ga0075369_10012963 Ga0075369_100129633 274
776 3300006186 Ga0075369_10019986 Ga0075369_100199863 274
777 3300006237 Ga0097621_100212751 Ga0097621_1002127512 274
778 3300006358 Ga0068871_100039535 Ga0068871_1000395353 274
779 3300006358 Ga0068871_100380069 Ga0068871_1003800692 274
780 3300006881 Ga0068865_100005962 Ga0068865_1000059627 274
781 3300006931 Ga0097620_100016787 Ga0097620_1000167877 274
782 3300006931 Ga0097620_100018511 Ga0097620_1000185117 274
783 3300007788 Ga0099795_10005256 Ga0099795_100052563 274
784 3300009098 Ga0105245_10000751 Ga0105245_1000075125 274
785 3300009101 Ga0105247_10000082 Ga0105247_1000008220 274
786 3300009101 Ga0105247_10068074 Ga0105247_100680741 274
787 3300009148 Ga0105243_10097497 Ga0105243_100974972 274
788 3300009174 Ga0105241_10018048 Ga0105241_100180485 274
789 3300009176 Ga0105242_10001294 Ga0105242_100012948 274
790 3300009177 Ga0105248_10000576 Ga0105248_100005767 274
791 3300009177 Ga0105248_10018392 Ga0105248_100183927 274
792 3300009177 Ga0105248_10020738 Ga0105248_100207387 274
793 3300009545 Ga0105237_10090102 Ga0105237_100901024 274
794 3300009551 Ga0105238_10166966 Ga0105238_101669661 274
795 3300009553 Ga0105249_10000008 Ga0105249_100000087 274
796 3300009553 Ga0105249_10000326 Ga0105249_1000032644 274
797 3300009553 Ga0105249_10326518 Ga0105249_103265182 274
798 3300010375 Ga0105239_10009518 Ga0105239_100095184 274
799 3300010375 Ga0105239_10149564 Ga0105239_101495643 274
800 3300013105 Ga0157369_10096605 Ga0157369_100966052 274
801 3300013296 Ga0157374_10213401 Ga0157374_102134013 274
802 3300013297 Ga0157378_10001214 Ga0157378_100012148 274
803 3300013297 Ga0157378_10193811 Ga0157378_101938113 274
804 3300013306 Ga0163162_10013482 Ga0163162_100134827 274
805 3300013306 Ga0163162_10061514 Ga0163162_100615143 274
806 3300013306 Ga0163162_10256801 Ga0163162_102568012 274
807 3300013306 Ga0163162_10375185 Ga0163162_103751852 274
808 3300013307 Ga0157372_10015740 Ga0157372_100157407 274
809 3300013308 Ga0157375_10000173 Ga0157375_100001737 274
810 3300013308 Ga0157375_10366826 Ga0157375_103668262 274
811 3300014326 Ga0157380_10004546 Ga0157380_100045469 274
812 3300014745 Ga0157377_10046778 Ga0157377_100467781 274
813 3300014968 Ga0157379_10188007 Ga0157379_101880072 274
814 3300014969 Ga0157376_10239439 Ga0157376_102394392 274
815 3300017792 Ga0163161_10176534 Ga0163161_101765341 274
816 3300017792 Ga0163161_10424100 Ga0163161_104241002 274
817 3300021384 Ga0213876_10044364 Ga0213876_100443642 274
818 3300025898 Ga0207692_10045102 Ga0207692_100451022 274
819 3300025899 Ga0207642_10000120 Ga0207642_100001204 274
820 3300025900 Ga0207710_10000263 Ga0207710_1000026316 274
821 3300025900 Ga0207710_10002806 Ga0207710_100028066 274
822 3300025901 Ga0207688_10000732 Ga0207688_100007323 274
823 3300025901 Ga0207688_10082062 Ga0207688_100820623 274
824 3300025904 Ga0207647_10130744 Ga0207647_101307442 274
825 3300025905 Ga0207685_10009137 Ga0207685_100091373 274
826 3300025906 Ga0207699_10038104 Ga0207699_100381042 274
827 3300025907 Ga0207645_10043499 Ga0207645_100434994 274
828 3300025908 Ga0207643_10135512 Ga0207643_101355122 274
829 3300025915 Ga0207693_10000869 Ga0207693_1000086923 274
830 3300025915 Ga0207693_10130844 Ga0207693_101308442 274
831 3300025916 Ga0207663_10000449 Ga0207663_100004493 274
832 3300025916 Ga0207663_10022742 Ga0207663_100227424 274
833 3300025919 Ga0207657_10061917 Ga0207657_100619173 274
834 3300025923 Ga0207681_10007046 Ga0207681_100070462 274
835 3300025923 Ga0207681_10050190 Ga0207681_100501902 274
836 3300025927 Ga0207687_10004955 Ga0207687_100049554 274
837 3300025929 Ga0207664_10085348 Ga0207664_100853483 274
838 3300025931 Ga0207644_10074968 Ga0207644_100749682 274
839 3300025933 Ga0207706_10004443 Ga0207706_100044437 274
840 3300025935 Ga0207709_10003286 Ga0207709_100032867 274
841 3300025935 Ga0207709_10445611 Ga0207709_104456111 274
842 3300025936 Ga0207670_10043558 Ga0207670_100435584 274
843 3300025937 Ga0207669_10143260 Ga0207669_101432602 274
844 3300025938 Ga0207704_10000222 Ga0207704_100002227 274
845 3300025939 Ga0207665_10002166 Ga0207665_100021667 274
846 3300025939 Ga0207665_10030075 Ga0207665_100300754 274
847 3300025940 Ga0207691_10157225 Ga0207691_101572252 274
848 3300025941 Ga0207711_10000948 Ga0207711_1000094820 274
849 3300025941 Ga0207711_10307229 Ga0207711_103072292 274
850 3300025942 Ga0207689_10010628 Ga0207689_100106283 274
851 3300025960 Ga0207651_10125360 Ga0207651_101253602 274
852 3300025961 Ga0207712_10000011 Ga0207712_10000011312 274
853 3300025961 Ga0207712_10239872 Ga0207712_102398722 274
854 3300025972 Ga0207668_10171862 Ga0207668_101718622 274
855 3300025972 Ga0207668_10277776 Ga0207668_102777762 274
856 3300025981 Ga0207640_10099426 Ga0207640_100994262 274
857 3300025986 Ga0207658_10002041 Ga0207658_100020417 274
858 3300025986 Ga0207658_10069132 Ga0207658_100691322 274
859 3300025986 Ga0207658_10078702 Ga0207658_100787023 274
860 3300026023 Ga0207677_10002154 Ga0207677_100021549 274
861 3300026023 Ga0207677_10025118 Ga0207677_100251183 274
862 3300026035 Ga0207703_10008863 Ga0207703_100088638 274
863 3300026035 Ga0207703_10246164 Ga0207703_102461642 274
864 3300026041 Ga0207639_10072442 Ga0207639_100724422 274
865 3300026067 Ga0207678_10008674 Ga0207678_100086742 274
866 3300026067 Ga0207678_10083619 Ga0207678_100836192 274
867 3300026075 Ga0207708_10004352 Ga0207708_100043526 274
868 3300026088 Ga0207641_10000437 Ga0207641_1000043714 274
869 3300026089 Ga0207648_10038065 Ga0207648_100380653 274
870 3300026089 Ga0207648_10269034 Ga0207648_102690342 274
871 3300026118 Ga0207675_100000056 Ga0207675_1000000567 274
872 3300026118 Ga0207675_100022234 Ga0207675_1000222345 274
873 3300026118 Ga0207675_100248140 Ga0207675_1002481402 274
874 3300026121 Ga0207683_10000442 Ga0207683_100004427 274
875 3300026121 Ga0207683_10115916 Ga0207683_101159163 274
876 3300028379 Ga0268266_10011643 Ga0268266_100116432 274
877 3300028379 Ga0268266_10210812 Ga0268266_102108122 274
878 3300028379 Ga0268266_10230336 Ga0268266_102303363 274
879 3300028380 Ga0268265_10000007 Ga0268265_10000007324 274
880 3300028380 Ga0268265_10020264 Ga0268265_100202642 274
881 3300028380 Ga0268265_10179166 Ga0268265_101791662 274
882 3300028381 Ga0268264_10000007 Ga0268264_10000007455 274
883 3300035112 Ga0373932_0034040 Ga0373932_0034040_426_1250 274
884 3300035114 Ga0373939_0011694 Ga0373939_0011694_633_1457 274
885 3300039450 Ga0436363_0684294 Ga0436363_0684294_432_1256 274
886 3300041413 Ga0439465_0008579 Ga0439465_0008579_555_1379 274
887 3300041413 Ga0439465_0057507 Ga0439465_0057507_420_1244 274
888 3300044656 Ga0466969_0086897 Ga0466969_0086897_568_1419 274
889 3300044658 Ga0466972_0004743 Ga0466972_0004743_2213_3037 274
890 3300044658 Ga0466972_0061881 Ga0466972_0061881_686_1519 274
891 3300044658 Ga0466972_0082680 Ga0466972_0082680_520_1344 274
892 3300044683 Ga0466965_0013546 Ga0466965_0013546_1542_2366 274
893 3300044684 Ga0466966_0008986 Ga0466966_0008986_5302_6153 274
894 3300044693 Ga0466961_0098382 Ga0466961_0098382_728_1579 274
895 3300044694 Ga0466963_0213735 Ga0466963_0213735_363_1187 274
896 3300044719 Ga0466971_0016234 Ga0466971_0016234_1209_2033 274
897 3300044735 Ga0466968_0007978 Ga0466968_0007978_2938_3789 274
898 3300044735 Ga0466968_0030780 Ga0466968_0030780_58_921 274
899 3300044765 Ga0466970_0004702 Ga0466970_0004702_2243_3067 274
900 3300044842 Ga0466957_0085738 Ga0466957_0085738_437_1288 274
901 3300044901 Ga0466960_0000965 Ga0466960_0000965_3235_4068 274
902 3300045049 Ga0466959_0083606 Ga0466959_0083606_28_852 274
903 3300045049 Ga0466959_0187050 Ga0466959_0187050_355_1206 274
904 3300045836 Ga0466958_0002583 Ga0466958_0002583_8044_8895 274
905 3300045976 Ga0466967_0070420 Ga0466967_0070420_1204_2028 274
906 3300045976 Ga0466967_0375460 Ga0466967_0375460_14_838 274
907 3300046460 Ga0495638_0016209 Ga0495638_0016209_603_1430 274
908 3300046533 Ga0495640_0073049 Ga0495640_0073049_191_1024 274
909 3300047320 Ga0495672_0054676 Ga0495672_0054676_211_1038 274
910 3300048903 Ga0496100_0052514 Ga0496100_0052514_1356_2180 274
911 3300048903 Ga0496100_0331658 Ga0496100_0331658_257_1081 274
912 3300048904 Ga0496101_0000252 Ga0496101_0000252_18261_19085 274
913 3300048904 Ga0496101_0001313 Ga0496101_0001313_12398_13222 274
914 3300048904 Ga0496101_0004785 Ga0496101_0004785_6575_7399 274
915 3300048905 Ga0496102_0000277 Ga0496102_0000277_349_1173 274
916 3300048905 Ga0496102_0000868 Ga0496102_0000868_2375_3199 274
917 3300048905 Ga0496102_0153296 Ga0496102_0153296_544_1368 274
918 3300048906 Ga0496103_0001078 Ga0496103_0001078_5061_5885 274
919 3300048906 Ga0496103_0049367 Ga0496103_0049367_141_965 274
920 3300048906 Ga0496103_0163234 Ga0496103_0163234_472_1296 274
921 3300048907 Ga0496104_0001573 Ga0496104_0001573_11062_11886 274
922 3300048909 Ga0496106_0001380 Ga0496106_0001380_9559_10383 274
923 3300048909 Ga0496106_0068337 Ga0496106_0068337_40_864 274
924 3300048909 Ga0496106_0144231 Ga0496106_0144231_455_1279 274
925 3300048910 Ga0496107_0000829 Ga0496107_0000829_868_1692 274
926 3300048910 Ga0496107_0000879 Ga0496107_0000879_11839_12663 274
927 3300048910 Ga0496107_0113584 Ga0496107_0113584_713_1537 274
928 3300048910 Ga0496107_0226112 Ga0496107_0226112_69_893 274
929 3300048911 Ga0496108_0013057 Ga0496108_0013057_5646_6470 274
930 3300048912 Ga0496109_0004360 Ga0496109_0004360_5355_6179 274
931 3300048915 Ga0496112_0014095 Ga0496112_0014095_5714_6538 274
932 3300048917 Ga0496114_0000514 Ga0496114_0000514_14765_15589 274
933 3300048917 Ga0496114_0003450 Ga0496114_0003450_2898_3722 274
934 3300048918 Ga0496115_0000799 Ga0496115_0000799_6196_7020 274
935 3300048918 Ga0496115_0017268 Ga0496115_0017268_2872_3696 274
936 3300048919 Ga0496116_0013362 Ga0496116_0013362_3196_4020 274
937 3300048920 Ga0496117_0000760 Ga0496117_0000760_45512_46336 274
938 3300048921 Ga0496118_0000225 Ga0496118_0000225_10769_11593 274
939 3300048922 Ga0496119_0004423 Ga0496119_0004423_7449_8273 274
940 3300048923 Ga0496120_0005250 Ga0496120_0005250_1608_2432 274
941 3300048924 Ga0496121_0002455 Ga0496121_0002455_12553_13377 274
942 3300048927 Ga0496124_0043494 Ga0496124_0043494_161_985 274
943 3300048928 Ga0496125_0046539 Ga0496125_0046539_1117_1941 274
944 3300048929 Ga0496126_0025517 Ga0496126_0025517_1161_1985 274
945 3300049570 Ga0501033_0085241 Ga0501033_0085241_515_1348 274
946 3300049571 Ga0501034_0055411 Ga0501034_0055411_623_1456 274
947 3300049571 Ga0501034_0133382 Ga0501034_0133382_768_1592 274
948 3300049581 Ga0501047_0024286 Ga0501047_0024286_1057_1890 274
949 3300049581 Ga0501047_0051334 Ga0501047_0051334_70_903 274
950 3300049585 Ga0501069_0064005 Ga0501069_0064005_998_1831 274
951 3300049586 Ga0501070_0203699 Ga0501070_0203699_710_1543 274
952 3300049822 Ga0501035_0001215 Ga0501035_0001215_11714_12547 274
953 3300049823 Ga0501044_0004709 Ga0501044_0004709_2462_3295 274
954 3300050490 nmdc:mga03n38_56077_c1 nmdc:mga03n38_56077_c1_252_1076 274
955 3300050491 nmdc:mga00v17_1073_c1 nmdc:mga00v17_1073_c1_6397_7221 274
956 3300050491 nmdc:mga00v17_28849_c1 nmdc:mga00v17_28849_c1_1030_1854 274
957 3300050492 nmdc:mga0yw44_89134_c1 nmdc:mga0yw44_89134_c1_644_1468 274
958 3300050494 nmdc:mga06z11_107896_c1 nmdc:mga06z11_107896_c1_14_838 274
959 3300050516 nmdc:mga0sz30_2757_c1 nmdc:mga0sz30_2757_c1_3278_4102 274
960 3300050516 nmdc:mga0sz30_30654_c1 nmdc:mga0sz30_30654_c1_53_877 274
961 3300050516 nmdc:mga0sz30_8083_c1 nmdc:mga0sz30_8083_c1_1337_2161 274
962 3300053086 Ga0500578_0178206 Ga0500578_0178206_160_987 274
963 3300053087 Ga0500643_023061 Ga0500643_023061_845_1672 274
964 3300053090 Ga0500646_0013121 Ga0500646_0013121_1130_1954 274
965 3300053096 Ga0500641_0023160 Ga0500641_0023160_1259_2086 274
966 3300053131 Ga0500652_012499 Ga0500652_012499_1541_2368 274
967 3300053153 Ga0500616_0012651 Ga0500616_0012651_2023_2856 274
968 3300053158 Ga0500627_0026268 Ga0500627_0026268_570_1397 274
969 3300053730 Ga0500645_077408 Ga0500645_077408_47_874 274
970 3300061719 Ga0466962_0010393 Ga0466962_0010393_2405_3229 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

63

324

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9956 2 273
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9919 2 273
6kjr-assembly1.cif.gz_A functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8616 5 274
6kjq-assembly1.cif.gz_A functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8529 5 267
6kjr-assembly1.cif.gz_A functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8468 5 274
ID Description Score Start End Superfamily
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9956 2 273 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9919 2 273 3.40.710.10
af_A0A1D8PKX8_25_403_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8338 11 264 3.40.710.10
af_B0G0Z7_67_432_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8253 4 263 3.40.710.10
af_Q8T2U3_27_449_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8207 5 271 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2S8MJP3-F1-model_v4 deleted 0.9969 125 274
AF-A0A822MN51-F1-model_v4 deleted 0.9968 169 274
AF-V7JI96-F1-model_v4 deleted 0.9962 1 271
AF-V7L4U8-F1-model_v4 deleted 0.9962 57 272
AF-A0A1A2N371-F1-model_v4 Serine hydrolase 0.9962 1 185 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.53 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map