F487109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 970 | 516 | 883 | 270 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2946072368|2946074891 |
| Length | 326 |
| Sequence | LWPWSALEASEPGKKTGRRGEITPLYASLGLRPQPDPLRELLLWGARSGRHRLVRMSLKSLALIDNWPVPSAAAGVVRADGTVLGTHGPAGRRFPLASVTKPLAAYAALVAYEEGAVELDEPAGPAGSTVRHLLAHTSGLAFDEHRTTAAPGERRLYSNAGFEQLGDHIAKAADIPFAEYLRQAVLEPLGMTQTSLEGSPAKDGVSTVTDLLRFAAELQAPRLLDPRTVAAAMTVQYPGTKGVLPGYGHQNPNDWGLGFEIRDSKSPHWTGSSSSPRTFGHFGQSGTFLWVDPEAAVAAVALTDRAFGPWAVEAWPPFTDAVLAEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 7 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 8 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 9 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 10 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 11 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 12 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 13 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 14 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 15 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 16 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 17 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 18 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 19 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 20 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 21 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 22 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 23 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 24 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 25 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 26 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 27 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 28 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 29 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 30 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 31 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 32 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 33 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 34 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 35 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 36 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 37 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 38 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 39 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 40 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 41 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 42 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 43 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 44 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 45 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 46 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 47 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 48 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 49 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 50 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 51 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 52 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 53 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 54 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 55 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 56 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 57 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 58 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 59 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 60 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 61 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 62 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 63 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 64 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 65 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 66 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 67 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 68 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 69 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 70 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 71 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 72 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 73 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 74 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 75 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 76 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 77 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 78 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 79 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 80 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 81 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 82 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 83 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 84 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 85 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 106 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 123 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 131 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 144 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 145 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 146 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 147 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 148 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 149 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 150 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 153 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 154 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 155 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 157 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 158 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 159 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 163 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 164 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 166 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 167 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 168 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 169 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 170 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 172 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 173 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 197 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 201 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 202 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 203 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 205 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 206 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 207 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 208 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 209 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 269 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 270 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 273 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 274 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 275 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 276 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 295 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 314 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 315 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 319 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 320 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 321 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 322 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 323 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 324 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 325 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 326 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 327 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 328 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 329 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 330 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 331 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 332 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 333 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 341 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 347 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 348 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 428 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 429 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 430 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 446 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 447 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 450 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 473 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 476 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 483 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 487 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 490 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 491 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 498 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 501 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 504 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 505 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 506 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 507 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 508 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 509 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 510 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 511 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 512 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 513 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 514 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 515 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 516 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.41 |
| Metatranscriptomes | 0.52 |
| Isolates | 9.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.77 |
| Nodule | 0.31 |
| Rhizoplane | 4.64 |
| Rhizosphere | 78.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10000054 | 3300002077 | Bacteria | 13437 |
| 2 | JGI24744J21845_10003102 | 3300002077 | Bacteria | 3407 |
| 3 | JGI24742J22300_10000699 | 3300002244 | Bacteria | 5068 |
| 4 | rootH1_10033851 | 3300003316 | Bacteria | 2529 |
| 5 | rootH1_10033851 | 3300003323 | Bacteria | 2311 |
| 6 | rootL2_10002639 | 3300003322 | Bacteria | 9703 |
| 7 | rootL2_10031424 | 3300003322 | Bacteria | 1557 |
| 8 | rootL2_10237235 | 3300003322 | Bacteria | 1096 |
| 9 | rootH1_10007618 | 3300003323 | Bacteria | 8200 |
| 10 | Ga0006562J51391_1052003 | 3300003578 | Bacteria | 3860 |
| 11 | Ga0006562J51391_1052005 | 3300003578 | Bacteria | 3180 |
| 12 | Ga0006562J51391_1098872 | 3300003578 | Bacteria | 1240 |
| 13 | JGI25404J52841_10000681 | 3300003659 | Bacteria | 5215 |
| 14 | Ga0070658_10065148 | 3300005327 | Bacteria | 2973 |
| 15 | Ga0070676_10056316 | 3300005328 | Bacteria | 2323 |
| 16 | Ga0070676_10166136 | 3300005328 | Bacteria | 1424 |
| 17 | Ga0070683_100088869 | 3300005329 | Bacteria | 2899 |
| 18 | Ga0070690_100012537 | 3300005330 | Bacteria | 4989 |
| 19 | Ga0070690_100095578 | 3300005330 | Bacteria | 1962 |
| 20 | Ga0068869_100010144 | 3300005334 | Bacteria | 6131 |
| 21 | Ga0068869_100056050 | 3300005334 | Bacteria | 2873 |
| 22 | Ga0070666_10082505 | 3300005335 | Bacteria | 2199 |
| 23 | Ga0070682_100046630 | 3300005337 | Bacteria | 2690 |
| 24 | Ga0070682_100149627 | 3300005337 | Bacteria | 1600 |
| 25 | Ga0070682_100367501 | 3300005337 | Bacteria | 1077 |
| 26 | Ga0068868_100000692 | 3300005338 | Bacteria | 22636 |
| 27 | Ga0068868_100114618 | 3300005338 | Bacteria | 2193 |
| 28 | Ga0070660_100114617 | 3300005339 | Bacteria | 2147 |
| 29 | Ga0070689_100098080 | 3300005340 | Bacteria | 2317 |
| 30 | Ga0070689_100132048 | 3300005340 | Bacteria | 2003 |
| 31 | Ga0070689_100163672 | 3300005340 | Bacteria | 1800 |
| 32 | Ga0070691_10034133 | 3300005341 | Bacteria | 2394 |
| 33 | Ga0070687_100064508 | 3300005343 | Bacteria | 1946 |
| 34 | Ga0070661_100088132 | 3300005344 | Bacteria | 2296 |
| 35 | Ga0070668_100106344 | 3300005347 | Bacteria | 2229 |
| 36 | Ga0070668_100373774 | 3300005347 | Bacteria | 1211 |
| 37 | Ga0070669_100002285 | 3300005353 | Bacteria | 13896 |
| 38 | Ga0070669_100010546 | 3300005353 | Bacteria | 6561 |
| 39 | Ga0070669_100219553 | 3300005353 | Bacteria | 1502 |
| 40 | Ga0070675_100023116 | 3300005354 | Bacteria | 4968 |
| 41 | Ga0070671_100034440 | 3300005355 | Bacteria | 4192 |
| 42 | Ga0070671_100248661 | 3300005355 | Bacteria | 1510 |
| 43 | Ga0070674_100007386 | 3300005356 | Bacteria | 6482 |
| 44 | Ga0070674_100009109 | 3300005356 | Bacteria | 5938 |
| 45 | Ga0070674_100106983 | 3300005356 | Bacteria | 2047 |
| 46 | Ga0070673_100014484 | 3300005364 | Bacteria | 5496 |
| 47 | Ga0070673_100264147 | 3300005364 | Bacteria | 1504 |
| 48 | Ga0070688_100223667 | 3300005365 | Bacteria | 1328 |
| 49 | Ga0070659_100037404 | 3300005366 | Bacteria | 3783 |
| 50 | Ga0070659_100066605 | 3300005366 | Bacteria | 2854 |
| 51 | Ga0070667_100021512 | 3300005367 | Bacteria | 5354 |
| 52 | Ga0070667_100035601 | 3300005367 | Bacteria | 4172 |
| 53 | Ga0070703_10037765 | 3300005406 | Bacteria | 1490 |
| 54 | Ga0070709_10094127 | 3300005434 | Bacteria | 1982 |
| 55 | Ga0070714_100060167 | 3300005435 | Bacteria | 3259 |
| 56 | Ga0070714_100252295 | 3300005435 | Bacteria | 1632 |
| 57 | Ga0070714_100295956 | 3300005435 | Bacteria | 1507 |
| 58 | Ga0070713_100030313 | 3300005436 | Bacteria | 4295 |
| 59 | Ga0070713_100126557 | 3300005436 | Bacteria | 2248 |
| 60 | Ga0070713_100150225 | 3300005436 | Bacteria | 2071 |
| 61 | Ga0070710_10000486 | 3300005437 | Bacteria | 18675 |
| 62 | Ga0070710_10005873 | 3300005437 | Bacteria | 5860 |
| 63 | Ga0070701_10003037 | 3300005438 | Bacteria | 6574 |
| 64 | Ga0070701_10040702 | 3300005438 | Bacteria | 2364 |
| 65 | Ga0070711_100005689 | 3300005439 | Bacteria | 7472 |
| 66 | Ga0070711_100007574 | 3300005439 | Bacteria | 6606 |
| 67 | Ga0070711_100007962 | 3300005439 | Bacteria | 6464 |
| 68 | Ga0070705_100002283 | 3300005440 | Bacteria | 9691 |
| 69 | Ga0070705_100079337 | 3300005440 | Bacteria | 2010 |
| 70 | Ga0070700_100072979 | 3300005441 | Bacteria | 2196 |
| 71 | Ga0070700_100149276 | 3300005441 | Bacteria | 1597 |
| 72 | Ga0070700_100439957 | 3300005441 | Bacteria | 989 |
| 73 | Ga0070708_100002561 | 3300005445 | Bacteria | 14062 |
| 74 | Ga0070708_100158001 | 3300005445 | Bacteria | 2111 |
| 75 | Ga0070663_100024895 | 3300005455 | Bacteria | 4035 |
| 76 | Ga0070663_100028008 | 3300005455 | Bacteria | 3831 |
| 77 | Ga0070663_100143210 | 3300005455 | Bacteria | 1827 |
| 78 | Ga0070678_100000230 | 3300005456 | Bacteria | 25423 |
| 79 | Ga0070678_100119865 | 3300005456 | Bacteria | 2073 |
| 80 | Ga0070678_100187397 | 3300005456 | Bacteria | 1698 |
| 81 | Ga0070678_100704122 | 3300005456 | Bacteria | 910 |
| 82 | Ga0070662_100003258 | 3300005457 | Bacteria | 10098 |
| 83 | Ga0070662_100413515 | 3300005457 | Bacteria | 1115 |
| 84 | Ga0070681_10142039 | 3300005458 | Bacteria | 2330 |
| 85 | Ga0068867_100018661 | 3300005459 | Bacteria | 4931 |
| 86 | Ga0068867_100131119 | 3300005459 | Bacteria | 1948 |
| 87 | Ga0070685_10023279 | 3300005466 | Bacteria | 3390 |
| 88 | Ga0070706_100017699 | 3300005467 | Bacteria | 6576 |
| 89 | Ga0070706_100229854 | 3300005467 | Bacteria | 1731 |
| 90 | Ga0070707_100003017 | 3300005468 | Bacteria | 15966 |
| 91 | Ga0070707_100044510 | 3300005468 | Bacteria | 4250 |
| 92 | Ga0070707_100246731 | 3300005468 | Bacteria | 1738 |
| 93 | Ga0070698_100018642 | 3300005471 | Bacteria | 7306 |
| 94 | Ga0070698_100117027 | 3300005471 | Bacteria | 2628 |
| 95 | Ga0070698_100167332 | 3300005471 | Bacteria | 2140 |
| 96 | Ga0070698_100493464 | 3300005471 | Bacteria | 1162 |
| 97 | Ga0070699_100002168 | 3300005518 | Bacteria | 17764 |
| 98 | Ga0070679_100062937 | 3300005530 | Bacteria | 3698 |
| 99 | Ga0070697_100002896 | 3300005536 | Bacteria | 13193 |
| 100 | Ga0068853_100030665 | 3300005539 | Bacteria | 4543 |
| 101 | Ga0068853_100138644 | 3300005539 | Bacteria | 2182 |
| 102 | Ga0070672_100063933 | 3300005543 | Bacteria | 2906 |
| 103 | Ga0070672_100426217 | 3300005543 | Bacteria | 1140 |
| 104 | Ga0070686_100127980 | 3300005544 | Bacteria | 1753 |
| 105 | Ga0070686_100185225 | 3300005544 | Bacteria | 1482 |
| 106 | Ga0070695_100092461 | 3300005545 | Bacteria | 2022 |
| 107 | Ga0070695_100306947 | 3300005545 | Bacteria | 1175 |
| 108 | Ga0070696_100002631 | 3300005546 | Bacteria | 11911 |
| 109 | Ga0070696_100084313 | 3300005546 | Bacteria | 2254 |
| 110 | Ga0070696_100495013 | 3300005546 | Bacteria | 971 |
| 111 | Ga0070693_100059203 | 3300005547 | Bacteria | 2219 |
| 112 | Ga0070693_100140106 | 3300005547 | Bacteria | 1521 |
| 113 | Ga0070665_100013254 | 3300005548 | Bacteria | 8303 |
| 114 | Ga0070665_100047390 | 3300005548 | Bacteria | 4314 |
| 115 | Ga0070665_100269768 | 3300005548 | Bacteria | 1703 |
| 116 | Ga0070665_100304090 | 3300005548 | Bacteria | 1598 |
| 117 | Ga0070704_100091132 | 3300005549 | Bacteria | 2272 |
| 118 | Ga0070704_100113556 | 3300005549 | Bacteria | 2065 |
| 119 | Ga0068855_100108036 | 3300005563 | Bacteria | 3196 |
| 120 | Ga0068855_100128954 | 3300005563 | Bacteria | 2890 |
| 121 | Ga0068857_100022331 | 3300005577 | Bacteria | 5566 |
| 122 | Ga0068857_100440695 | 3300005577 | Bacteria | 1217 |
| 123 | Ga0068854_100000723 | 3300005578 | Bacteria | 19529 |
| 124 | Ga0068854_100019373 | 3300005578 | Bacteria | 4584 |
| 125 | Ga0068856_100022196 | 3300005614 | Bacteria | 6171 |
| 126 | Ga0070702_100000434 | 3300005615 | Bacteria | 14892 |
| 127 | Ga0070702_100014334 | 3300005615 | Bacteria | 4020 |
| 128 | Ga0068852_100016014 | 3300005616 | Bacteria | 5837 |
| 129 | Ga0068852_100085602 | 3300005616 | Bacteria | 2808 |
| 130 | Ga0068859_100016786 | 3300005617 | Bacteria | 7351 |
| 131 | Ga0068859_100018510 | 3300005617 | Bacteria | 6999 |
| 132 | Ga0068859_100203724 | 3300005617 | Bacteria | 2063 |
| 133 | Ga0068864_100053513 | 3300005618 | Bacteria | 3482 |
| 134 | Ga0068866_10000072 | 3300005718 | Bacteria | 40253 |
| 135 | Ga0068861_100064345 | 3300005719 | Bacteria | 2821 |
| 136 | Ga0068851_10085036 | 3300005834 | Bacteria | 1657 |
| 137 | Ga0068863_100000193 | 3300005841 | Bacteria | 64832 |
| 138 | Ga0068863_100108884 | 3300005841 | Bacteria | 2637 |
| 139 | Ga0068863_100254038 | 3300005841 | Bacteria | 1698 |
| 140 | Ga0068858_100005187 | 3300005842 | Bacteria | 12762 |
| 141 | Ga0068858_100007410 | 3300005842 | Bacteria | 10614 |
| 142 | Ga0068860_100000166 | 3300005843 | Bacteria | 108310 |
| 143 | Ga0068860_100014460 | 3300005843 | Bacteria | 7727 |
| 144 | Ga0068862_100000205 | 3300005844 | Bacteria | 65575 |
| 145 | Ga0081455_10021015 | 3300005937 | Bacteria | 6131 |
| 146 | Ga0081455_10031663 | 3300005937 | Bacteria | 4779 |
| 147 | Ga0081455_10175698 | 3300005937 | Bacteria | 1626 |
| 148 | Ga0081540_1001213 | 3300005983 | Bacteria | 22516 |
| 149 | Ga0070717_10172559 | 3300006028 | Bacteria | 1881 |
| 150 | Ga0075365_10082479 | 3300006038 | Bacteria | 2180 |
| 151 | Ga0075363_100004182 | 3300006048 | Bacteria | 6271 |
| 152 | Ga0075363_100295787 | 3300006048 | Bacteria | 939 |
| 153 | Ga0075364_10000380 | 3300006051 | Bacteria | 21980 |
| 154 | Ga0075364_10023367 | 3300006051 | Bacteria | 3915 |
| 155 | Ga0070715_10003467 | 3300006163 | Bacteria | 5023 |
| 156 | Ga0070715_10006317 | 3300006163 | Bacteria | 4021 |
| 157 | Ga0070715_10081780 | 3300006163 | Bacteria | 1468 |
| 158 | Ga0070716_100108399 | 3300006173 | Bacteria | 1716 |
| 159 | Ga0070716_100140692 | 3300006173 | Bacteria | 1538 |
| 160 | Ga0070716_100198791 | 3300006173 | Bacteria | 1331 |
| 161 | Ga0070712_100006609 | 3300006175 | Bacteria | 7206 |
| 162 | Ga0070712_100010841 | 3300006175 | Bacteria | 5764 |
| 163 | Ga0075367_10000748 | 3300006178 | Bacteria | 12646 |
| 164 | Ga0075369_10001022 | 3300006186 | Bacteria | 9338 |
| 165 | Ga0075369_10012963 | 3300006186 | Bacteria | 3298 |
| 166 | Ga0075369_10019986 | 3300006186 | Bacteria | 2739 |
| 167 | Ga0097621_100212751 | 3300006237 | Bacteria | 1682 |
| 168 | Ga0097621_100303199 | 3300006237 | Bacteria | 1411 |
| 169 | Ga0075370_10059193 | 3300006353 | Bacteria | 2179 |
| 170 | Ga0075370_10090635 | 3300006353 | Bacteria | 1763 |
| 171 | Ga0068871_100038895 | 3300006358 | Bacteria | 3803 |
| 172 | Ga0068871_100039535 | 3300006358 | Bacteria | 3775 |
| 173 | Ga0068871_100380069 | 3300006358 | Bacteria | 1254 |
| 174 | Ga0075434_100506644 | 3300006871 | Bacteria | 1228 |
| 175 | Ga0068865_100005962 | 3300006881 | Bacteria | 7423 |
| 176 | Ga0075436_100204877 | 3300006914 | Bacteria | 1398 |
| 177 | Ga0097620_100016787 | 3300006931 | Bacteria | 7351 |
| 178 | Ga0097620_100018511 | 3300006931 | Bacteria | 6999 |
| 179 | Ga0097620_100203715 | 3300006931 | Bacteria | 2063 |
| 180 | Ga0075435_100171091 | 3300007076 | Bacteria | 1832 |
| 181 | Ga0099795_10005256 | 3300007788 | Bacteria | 3426 |
| 182 | Ga0105251_10044368 | 3300009011 | Bacteria | 2148 |
| 183 | Ga0105240_10072016 | 3300009093 | Bacteria | 4272 |
| 184 | Ga0105245_10000751 | 3300009098 | Bacteria | 29290 |
| 185 | Ga0105245_10362887 | 3300009098 | Bacteria | 1438 |
| 186 | Ga0105245_10612080 | 3300009098 | Bacteria | 1117 |
| 187 | Ga0105245_10876666 | 3300009098 | Bacteria | 938 |
| 188 | Ga0105247_10000082 | 3300009101 | Bacteria | 106460 |
| 189 | Ga0105247_10068074 | 3300009101 | Bacteria | 2219 |
| 190 | Ga0105243_10058847 | 3300009148 | Bacteria | 3064 |
| 191 | Ga0105243_10097497 | 3300009148 | Bacteria | 2433 |
| 192 | Ga0105241_10018048 | 3300009174 | Bacteria | 5186 |
| 193 | Ga0105241_10324144 | 3300009174 | Bacteria | 1329 |
| 194 | Ga0105242_10001294 | 3300009176 | Bacteria | 19789 |
| 195 | Ga0105242_10013381 | 3300009176 | Bacteria | 6338 |
| 196 | Ga0105248_10000576 | 3300009177 | Bacteria | 41774 |
| 197 | Ga0105248_10018392 | 3300009177 | Bacteria | 7721 |
| 198 | Ga0105248_10020738 | 3300009177 | Bacteria | 7281 |
| 199 | Ga0105248_10390632 | 3300009177 | Bacteria | 1567 |
| 200 | Ga0105237_10090102 | 3300009545 | Bacteria | 3057 |
| 201 | Ga0105238_10113718 | 3300009551 | Bacteria | 2686 |
| 202 | Ga0105238_10166966 | 3300009551 | Bacteria | 2177 |
| 203 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 204 | Ga0105249_10000326 | 3300009553 | Bacteria | 48114 |
| 205 | Ga0105249_10069767 | 3300009553 | Bacteria | 3244 |
| 206 | Ga0105249_10326518 | 3300009553 | Bacteria | 1547 |
| 207 | Ga0105239_10009518 | 3300010375 | Bacteria | 10936 |
| 208 | Ga0105239_10149564 | 3300010375 | Bacteria | 2606 |
| 209 | Ga0105239_10187638 | 3300010375 | Bacteria | 2314 |
| 210 | Ga0105246_10228948 | 3300011119 | Bacteria | 1462 |
| 211 | Ga0157373_10083034 | 3300013100 | Bacteria | 2258 |
| 212 | Ga0157371_10028027 | 3300013102 | Bacteria | 4081 |
| 213 | Ga0157370_10084492 | 3300013104 | Bacteria | 2984 |
| 214 | Ga0157369_10096605 | 3300013105 | Bacteria | 3152 |
| 215 | Ga0157369_10147148 | 3300013105 | Bacteria | 2490 |
| 216 | Ga0157374_10158360 | 3300013296 | Bacteria | 2205 |
| 217 | Ga0157374_10213401 | 3300013296 | Bacteria | 1893 |
| 218 | Ga0157378_10001214 | 3300013297 | Bacteria | 23353 |
| 219 | Ga0157378_10162432 | 3300013297 | Bacteria | 2090 |
| 220 | Ga0157378_10193811 | 3300013297 | Bacteria | 1918 |
| 221 | Ga0163162_10013482 | 3300013306 | Bacteria | 7980 |
| 222 | Ga0163162_10061514 | 3300013306 | Bacteria | 3792 |
| 223 | Ga0163162_10256801 | 3300013306 | Bacteria | 1879 |
| 224 | Ga0163162_10375185 | 3300013306 | Bacteria | 1555 |
| 225 | Ga0157372_10015740 | 3300013307 | Bacteria | 8111 |
| 226 | Ga0157375_10000173 | 3300013308 | Bacteria | 59878 |
| 227 | Ga0157375_10366826 | 3300013308 | Bacteria | 1606 |
| 228 | Ga0157380_10004546 | 3300014326 | Bacteria | 9629 |
| 229 | Ga0182008_10001369 | 3300014497 | Bacteria | 16527 |
| 230 | Ga0157377_10040504 | 3300014745 | Bacteria | 2580 |
| 231 | Ga0157377_10046778 | 3300014745 | Bacteria | 2422 |
| 232 | Ga0157379_10188007 | 3300014968 | Bacteria | 1867 |
| 233 | Ga0157376_10239439 | 3300014969 | Bacteria | 1690 |
| 234 | Ga0182007_10000387 | 3300015262 | Bacteria | 27336 |
| 235 | Ga0182005_1034250 | 3300015265 | Bacteria | 1382 |
| 236 | Ga0183367_1009 | 3300015688 | Bacteria | 484598 |
| 237 | Ga0163161_10041092 | 3300017792 | Bacteria | 3322 |
| 238 | Ga0163161_10176534 | 3300017792 | Bacteria | 1636 |
| 239 | Ga0163161_10424100 | 3300017792 | Bacteria | 1071 |
| 240 | Ga0206356_11555668 | 3300020070 | Bacteria | 2402 |
| 241 | Ga0206354_10656253 | 3300020081 | Bacteria | 1745 |
| 242 | Ga0213876_10003411 | 3300021384 | Bacteria | 9093 |
| 243 | Ga0213876_10044364 | 3300021384 | Bacteria | 2350 |
| 244 | Ga0213875_10006612 | 3300021388 | Bacteria | 6061 |
| 245 | Ga0213875_10024498 | 3300021388 | Bacteria | 2878 |
| 246 | Ga0224572_1022509 | 3300024225 | Bacteria | 1211 |
| 247 | Ga0209758_1004639 | 3300025297 | Bacteria | 11260 |
| 248 | Ga0207426_1002223 | 3300025302 | Bacteria | 12988 |
| 249 | Ga0207426_1002227 | 3300025302 | Bacteria | 12958 |
| 250 | Ga0207426_1013368 | 3300025302 | Bacteria | 3045 |
| 251 | Ga0207653_10004753 | 3300025885 | Bacteria | 4246 |
| 252 | Ga0207692_10039640 | 3300025898 | Bacteria | 2319 |
| 253 | Ga0207692_10044179 | 3300025898 | Bacteria | 2222 |
| 254 | Ga0207692_10045102 | 3300025898 | Bacteria | 2203 |
| 255 | Ga0207642_10000120 | 3300025899 | Bacteria | 21378 |
| 256 | Ga0207642_10046615 | 3300025899 | Bacteria | 1933 |
| 257 | Ga0207710_10000263 | 3300025900 | Bacteria | 43581 |
| 258 | Ga0207710_10002806 | 3300025900 | Bacteria | 7952 |
| 259 | Ga0207710_10055556 | 3300025900 | Bacteria | 1785 |
| 260 | Ga0207688_10000732 | 3300025901 | Bacteria | 16293 |
| 261 | Ga0207688_10046896 | 3300025901 | Bacteria | 2413 |
| 262 | Ga0207688_10082062 | 3300025901 | Bacteria | 1842 |
| 263 | Ga0207647_10130744 | 3300025904 | Bacteria | 1475 |
| 264 | Ga0207647_10246791 | 3300025904 | Bacteria | 1025 |
| 265 | Ga0207685_10009137 | 3300025905 | Bacteria | 2865 |
| 266 | Ga0207699_10034060 | 3300025906 | Bacteria | 2885 |
| 267 | Ga0207699_10038104 | 3300025906 | Bacteria | 2752 |
| 268 | Ga0207699_10064108 | 3300025906 | Bacteria | 2222 |
| 269 | Ga0207699_10347996 | 3300025906 | Bacteria | 1045 |
| 270 | Ga0207645_10043499 | 3300025907 | Bacteria | 2875 |
| 271 | Ga0207645_10124439 | 3300025907 | Bacteria | 1675 |
| 272 | Ga0207643_10135512 | 3300025908 | Bacteria | 1468 |
| 273 | Ga0207684_10009418 | 3300025910 | Bacteria | 8625 |
| 274 | Ga0207684_10029123 | 3300025910 | Bacteria | 4704 |
| 275 | Ga0207707_10070296 | 3300025912 | Bacteria | 3050 |
| 276 | Ga0207695_10327826 | 3300025913 | Bacteria | 1420 |
| 277 | Ga0207693_10000869 | 3300025915 | Bacteria | 27002 |
| 278 | Ga0207693_10035223 | 3300025915 | Bacteria | 3947 |
| 279 | Ga0207693_10092258 | 3300025915 | Bacteria | 2373 |
| 280 | Ga0207693_10130844 | 3300025915 | Bacteria | 1973 |
| 281 | Ga0207663_10000449 | 3300025916 | Bacteria | 17905 |
| 282 | Ga0207663_10022742 | 3300025916 | Bacteria | 3588 |
| 283 | Ga0207663_10288709 | 3300025916 | Bacteria | 1221 |
| 284 | Ga0207662_10008318 | 3300025918 | Bacteria | 5680 |
| 285 | Ga0207657_10003385 | 3300025919 | Bacteria | 17051 |
| 286 | Ga0207657_10061917 | 3300025919 | Bacteria | 3205 |
| 287 | Ga0207649_10069790 | 3300025920 | Bacteria | 2239 |
| 288 | Ga0207646_10015635 | 3300025922 | Bacteria | 7157 |
| 289 | Ga0207646_10022756 | 3300025922 | Bacteria | 5764 |
| 290 | Ga0207681_10007046 | 3300025923 | Bacteria | 6900 |
| 291 | Ga0207681_10050190 | 3300025923 | Bacteria | 2823 |
| 292 | Ga0207687_10004955 | 3300025927 | Bacteria | 8835 |
| 293 | Ga0207700_10019441 | 3300025928 | Bacteria | 4588 |
| 294 | Ga0207700_10194581 | 3300025928 | Bacteria | 1706 |
| 295 | Ga0207700_10312693 | 3300025928 | Bacteria | 1359 |
| 296 | Ga0207664_10003887 | 3300025929 | Bacteria | 10037 |
| 297 | Ga0207664_10085348 | 3300025929 | Bacteria | 2576 |
| 298 | Ga0207644_10074968 | 3300025931 | Bacteria | 2485 |
| 299 | Ga0207644_10170712 | 3300025931 | Bacteria | 1697 |
| 300 | Ga0207706_10004443 | 3300025933 | Bacteria | 13180 |
| 301 | Ga0207706_10160044 | 3300025933 | Bacteria | 1979 |
| 302 | Ga0207709_10003286 | 3300025935 | Bacteria | 9701 |
| 303 | Ga0207709_10445611 | 3300025935 | Bacteria | 1000 |
| 304 | Ga0207670_10039639 | 3300025936 | Bacteria | 3086 |
| 305 | Ga0207670_10043558 | 3300025936 | Bacteria | 2965 |
| 306 | Ga0207669_10143260 | 3300025937 | Bacteria | 1662 |
| 307 | Ga0207669_10239551 | 3300025937 | Bacteria | 1344 |
| 308 | Ga0207704_10000222 | 3300025938 | Bacteria | 28514 |
| 309 | Ga0207665_10002166 | 3300025939 | Bacteria | 13277 |
| 310 | Ga0207665_10014313 | 3300025939 | Bacteria | 5224 |
| 311 | Ga0207665_10014887 | 3300025939 | Bacteria | 5111 |
| 312 | Ga0207665_10016902 | 3300025939 | Bacteria | 4790 |
| 313 | Ga0207665_10030075 | 3300025939 | Bacteria | 3590 |
| 314 | Ga0207691_10015953 | 3300025940 | Bacteria | 7136 |
| 315 | Ga0207691_10157225 | 3300025940 | Bacteria | 1996 |
| 316 | Ga0207711_10000948 | 3300025941 | Bacteria | 27856 |
| 317 | Ga0207711_10307229 | 3300025941 | Bacteria | 1464 |
| 318 | Ga0207689_10005067 | 3300025942 | Bacteria | 11873 |
| 319 | Ga0207689_10010628 | 3300025942 | Bacteria | 7923 |
| 320 | Ga0207651_10125360 | 3300025960 | Bacteria | 1956 |
| 321 | Ga0207651_10324974 | 3300025960 | Bacteria | 1287 |
| 322 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 323 | Ga0207712_10239872 | 3300025961 | Bacteria | 1460 |
| 324 | Ga0207668_10016610 | 3300025972 | Bacteria | 4596 |
| 325 | Ga0207668_10171862 | 3300025972 | Bacteria | 1700 |
| 326 | Ga0207668_10277776 | 3300025972 | Bacteria | 1372 |
| 327 | Ga0207640_10099426 | 3300025981 | Bacteria | 2036 |
| 328 | Ga0207658_10002041 | 3300025986 | Bacteria | 15073 |
| 329 | Ga0207658_10069132 | 3300025986 | Bacteria | 2667 |
| 330 | Ga0207658_10078702 | 3300025986 | Bacteria | 2520 |
| 331 | Ga0207677_10002154 | 3300026023 | Bacteria | 10350 |
| 332 | Ga0207677_10025118 | 3300026023 | Bacteria | 3712 |
| 333 | Ga0207677_10086010 | 3300026023 | Bacteria | 2271 |
| 334 | Ga0207703_10008863 | 3300026035 | Bacteria | 7928 |
| 335 | Ga0207703_10246164 | 3300026035 | Bacteria | 1609 |
| 336 | Ga0207639_10020409 | 3300026041 | Bacteria | 4742 |
| 337 | Ga0207639_10072442 | 3300026041 | Bacteria | 2697 |
| 338 | Ga0207678_10000171 | 3300026067 | Bacteria | 54729 |
| 339 | Ga0207678_10008674 | 3300026067 | Bacteria | 8954 |
| 340 | Ga0207678_10035214 | 3300026067 | Bacteria | 4359 |
| 341 | Ga0207678_10083619 | 3300026067 | Bacteria | 2730 |
| 342 | Ga0207708_10004352 | 3300026075 | Bacteria | 10434 |
| 343 | Ga0207708_10027234 | 3300026075 | Bacteria | 4328 |
| 344 | Ga0207702_10094441 | 3300026078 | Bacteria | 2625 |
| 345 | Ga0207641_10000437 | 3300026088 | Bacteria | 47860 |
| 346 | Ga0207648_10038065 | 3300026089 | Bacteria | 4234 |
| 347 | Ga0207648_10162153 | 3300026089 | Bacteria | 1974 |
| 348 | Ga0207648_10269034 | 3300026089 | Bacteria | 1522 |
| 349 | Ga0207676_10202388 | 3300026095 | Bacteria | 1755 |
| 350 | Ga0207674_10010179 | 3300026116 | Bacteria | 10683 |
| 351 | Ga0207675_100000056 | 3300026118 | Bacteria | 82104 |
| 352 | Ga0207675_100014809 | 3300026118 | Bacteria | 7278 |
| 353 | Ga0207675_100022234 | 3300026118 | Bacteria | 5905 |
| 354 | Ga0207675_100248140 | 3300026118 | Bacteria | 1722 |
| 355 | Ga0207683_10000442 | 3300026121 | Bacteria | 38332 |
| 356 | Ga0207683_10115916 | 3300026121 | Bacteria | 2401 |
| 357 | Ga0207683_10186521 | 3300026121 | Bacteria | 1882 |
| 358 | Ga0207683_10307765 | 3300026121 | Bacteria | 1450 |
| 359 | Ga0207698_10207423 | 3300026142 | Bacteria | 1760 |
| 360 | Ga0209371_1012600 | 3300027312 | Bacteria | 2432 |
| 361 | Ga0268266_10011643 | 3300028379 | Bacteria | 7636 |
| 362 | Ga0268266_10210812 | 3300028379 | Bacteria | 1781 |
| 363 | Ga0268266_10230336 | 3300028379 | Bacteria | 1706 |
| 364 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 365 | Ga0268265_10020264 | 3300028380 | Bacteria | 4640 |
| 366 | Ga0268265_10179166 | 3300028380 | Bacteria | 1819 |
| 367 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 368 | Ga0268264_10220857 | 3300028381 | Bacteria | 1744 |
| 369 | Ga0307517_10001523 | 3300028786 | Bacteria | 38580 |
| 370 | Ga0307515_10000262 | 3300028794 | Bacteria | 130525 |
| 371 | Ga0307515_10170563 | 3300028794 | Bacteria | 2171 |
| 372 | Ga0268256_1013761 | 3300030500 | Bacteria | 2432 |
| 373 | Ga0307511_10001166 | 3300030521 | Bacteria | 27969 |
| 374 | Ga0307511_10039103 | 3300030521 | Bacteria | 4059 |
| 375 | Ga0307511_10072373 | 3300030521 | Bacteria | 2504 |
| 376 | Ga0307512_10003287 | 3300030522 | Bacteria | 19019 |
| 377 | Ga0307512_10021656 | 3300030522 | Bacteria | 5789 |
| 378 | Ga0307512_10098573 | 3300030522 | Bacteria | 1994 |
| 379 | Ga0307513_10101479 | 3300031456 | Bacteria | 2899 |
| 380 | Ga0307513_10157218 | 3300031456 | Bacteria | 2171 |
| 381 | Ga0307509_10022428 | 3300031507 | Bacteria | 7117 |
| 382 | Ga0307509_10038476 | 3300031507 | Bacteria | 5217 |
| 383 | Ga0307509_10192381 | 3300031507 | Bacteria | 1889 |
| 384 | Ga0307508_10011423 | 3300031616 | Bacteria | 8119 |
| 385 | Ga0307508_10024355 | 3300031616 | Bacteria | 5493 |
| 386 | Ga0307508_10097627 | 3300031616 | Bacteria | 2530 |
| 387 | Ga0307508_10385336 | 3300031616 | Bacteria | 993 |
| 388 | Ga0307514_10004230 | 3300031649 | Bacteria | 13290 |
| 389 | Ga0307514_10083805 | 3300031649 | Bacteria | 2348 |
| 390 | Ga0307514_10105230 | 3300031649 | Bacteria | 2016 |
| 391 | Ga0307516_10007840 | 3300031730 | Bacteria | 12175 |
| 392 | Ga0307516_10034680 | 3300031730 | Bacteria | 5069 |
| 393 | Ga0307516_10104985 | 3300031730 | Bacteria | 2637 |
| 394 | Ga0307518_10012292 | 3300031838 | Bacteria | 6120 |
| 395 | Ga0307518_10043316 | 3300031838 | Bacteria | 3276 |
| 396 | Ga0307410_10202267 | 3300031852 | Bacteria | 1517 |
| 397 | Ga0307409_100366644 | 3300031995 | Bacteria | 1364 |
| 398 | Ga0307416_100370142 | 3300032002 | Bacteria | 1459 |
| 399 | Ga0307414_10422459 | 3300032004 | Bacteria | 1163 |
| 400 | Ga0307415_100036094 | 3300032126 | Bacteria | 3236 |
| 401 | Ga0307507_10050253 | 3300033179 | Bacteria | 4028 |
| 402 | Ga0307510_10035955 | 3300033180 | Bacteria | 5521 |
| 403 | Ga0307510_10104532 | 3300033180 | Bacteria | 2604 |
| 404 | Ga0307510_10259218 | 3300033180 | Bacteria | 1221 |
| 405 | Ga0373930_0004186 | 3300034816 | Bacteria | 2334 |
| 406 | Ga0373926_0002751 | 3300035083 | Bacteria | 5601 |
| 407 | Ga0373934_0012900 | 3300035086 | Bacteria | 3158 |
| 408 | Ga0373940_0045890 | 3300035088 | Bacteria | 1214 |
| 409 | Ga0373944_0000937 | 3300035089 | Bacteria | 7236 |
| 410 | Ga0373944_0005705 | 3300035089 | Bacteria | 3284 |
| 411 | Ga0373951_0013166 | 3300035091 | Bacteria | 1860 |
| 412 | Ga0373952_0009709 | 3300035092 | Bacteria | 1849 |
| 413 | Ga0373923_0011003 | 3300035111 | Bacteria | 3308 |
| 414 | Ga0373932_0018425 | 3300035112 | Bacteria | 1805 |
| 415 | Ga0373932_0034040 | 3300035112 | Bacteria | 1434 |
| 416 | Ga0373936_0012017 | 3300035113 | Bacteria | 3286 |
| 417 | Ga0373936_0016608 | 3300035113 | Bacteria | 2832 |
| 418 | Ga0373939_0011694 | 3300035114 | Bacteria | 2222 |
| 419 | Ga0373939_0057105 | 3300035114 | Bacteria | 1231 |
| 420 | Ga0373945_0001360 | 3300035116 | Bacteria | 7435 |
| 421 | Ga0373945_0015958 | 3300035116 | Bacteria | 2531 |
| 422 | Ga0373953_0008491 | 3300035117 | Bacteria | 3492 |
| 423 | Ga0373956_0071848 | 3300035119 | Bacteria | 1579 |
| 424 | Ga0373956_0199692 | 3300035119 | Bacteria | 948 |
| 425 | Ga0373943_0000277 | 3300035170 | Bacteria | 21155 |
| 426 | Ga0373946_0000047 | 3300035171 | Bacteria | 31827 |
| 427 | Ga0373946_0003357 | 3300035171 | Bacteria | 5677 |
| 428 | Ga0373955_0103351 | 3300035172 | Bacteria | 1638 |
| 429 | Ga0373955_0217078 | 3300035172 | Bacteria | 1141 |
| 430 | Ga0373961_0025039 | 3300035241 | Bacteria | 1619 |
| 431 | Ga0373924_0004348 | 3300035410 | Bacteria | 4945 |
| 432 | Ga0373931_0058770 | 3300035691 | Bacteria | 2066 |
| 433 | Ga0373935_0002314 | 3300035692 | Bacteria | 10875 |
| 434 | Ga0373927_0000128 | 3300035695 | Bacteria | 58077 |
| 435 | Ga0373927_0033574 | 3300035695 | Bacteria | 3340 |
| 436 | Ga0373933_0012826 | 3300035724 | Bacteria | 4634 |
| 437 | Ga0373933_0117879 | 3300035724 | Bacteria | 1660 |
| 438 | Ga0373933_0270959 | 3300035724 | Bacteria | 1096 |
| 439 | Ga0373947_0000327 | 3300035725 | Bacteria | 26912 |
| 440 | Ga0373937_0164920 | 3300036401 | Bacteria | 2077 |
| 441 | Ga0373937_0943483 | 3300036401 | Bacteria | 811 |
| 442 | Ga0373925_0001723 | 3300037068 | Bacteria | 18387 |
| 443 | Ga0395898_0004836 | 3300037466 | Bacteria | 14644 |
| 444 | Ga0395898_0005281 | 3300037466 | Bacteria | 13965 |
| 445 | Ga0395898_0525145 | 3300037466 | Bacteria | 1125 |
| 446 | Ga0395905_0040820 | 3300037471 | Bacteria | 4354 |
| 447 | Ga0436364_0208258 | 3300037853 | Bacteria | 3615 |
| 448 | Ga0436364_0395198 | 3300037853 | Bacteria | 6107 |
| 449 | Ga0436364_0517842 | 3300037853 | Bacteria | 7013 |
| 450 | Ga0436364_0817251 | 3300037853 | Bacteria | 2356 |
| 451 | Ga0400483_166410 | 3300039062 | Bacteria | 32354 |
| 452 | Ga0436365_0470798 | 3300039437 | Bacteria | 31097 |
| 453 | Ga0436365_0967944 | 3300039437 | Bacteria | 29438 |
| 454 | Ga0436365_1677319 | 3300039437 | Bacteria | 958 |
| 455 | Ga0436360_1088767 | 3300039438 | Bacteria | 1213 |
| 456 | Ga0436363_0684294 | 3300039450 | Bacteria | 1291 |
| 457 | Ga0436362_1127991 | 3300039453 | Bacteria | 988 |
| 458 | Ga0439436_0001293 | 3300041404 | Bacteria | 7160 |
| 459 | Ga0439439_0001590 | 3300041406 | Bacteria | 4580 |
| 460 | Ga0439465_0008579 | 3300041413 | Bacteria | 3225 |
| 461 | Ga0439465_0057507 | 3300041413 | Bacteria | 1283 |
| 462 | Ga0451837_0441292 | 3300041494 | Bacteria | 6692 |
| 463 | Ga0439433_0006462 | 3300041999 | Bacteria | 2522 |
| 464 | Ga0439433_0017868 | 3300041999 | Bacteria | 1576 |
| 465 | Ga0439432_034153 | 3300042006 | Bacteria | 1634 |
| 466 | Ga0439449_0020539 | 3300042007 | Bacteria | 2474 |
| 467 | Ga0439449_0089172 | 3300042007 | Bacteria | 1138 |
| 468 | Ga0439455_0014033 | 3300042012 | Bacteria | 1824 |
| 469 | Ga0439457_000381 | 3300042014 | Bacteria | 12512 |
| 470 | Ga0439457_003517 | 3300042014 | Bacteria | 4253 |
| 471 | Ga0439457_005534 | 3300042014 | Bacteria | 3171 |
| 472 | Ga0450894_002527 | 3300042131 | Bacteria | 2452 |
| 473 | Ga0450898_000804 | 3300042134 | Bacteria | 3873 |
| 474 | Ga0450899_000387 | 3300042135 | Bacteria | 4890 |
| 475 | Ga0450903_000036 | 3300042138 | Bacteria | 26817 |
| 476 | Ga0450906_000131 | 3300042145 | Bacteria | 13303 |
| 477 | Ga0439458_0004847 | 3300042157 | Bacteria | 3054 |
| 478 | Ga0466969_0086897 | 3300044656 | Bacteria | 1485 |
| 479 | Ga0466972_0004743 | 3300044658 | Bacteria | 6806 |
| 480 | Ga0466972_0014843 | 3300044658 | Bacteria | 3898 |
| 481 | Ga0466972_0035207 | 3300044658 | Bacteria | 2450 |
| 482 | Ga0466972_0035479 | 3300044658 | Bacteria | 2440 |
| 483 | Ga0466972_0050303 | 3300044658 | Bacteria | 2012 |
| 484 | Ga0466972_0061881 | 3300044658 | Bacteria | 1794 |
| 485 | Ga0466972_0082680 | 3300044658 | Bacteria | 1528 |
| 486 | Ga0466965_0013546 | 3300044683 | Bacteria | 3849 |
| 487 | Ga0466966_0006730 | 3300044684 | Bacteria | 7611 |
| 488 | Ga0466966_0008986 | 3300044684 | Bacteria | 6622 |
| 489 | Ga0466961_0017828 | 3300044693 | Bacteria | 4563 |
| 490 | Ga0466961_0046233 | 3300044693 | Bacteria | 2784 |
| 491 | Ga0466961_0098382 | 3300044693 | Bacteria | 1844 |
| 492 | Ga0466961_0145283 | 3300044693 | Bacteria | 1483 |
| 493 | Ga0466961_0194769 | 3300044693 | Bacteria | 1255 |
| 494 | Ga0466963_0000196 | 3300044694 | Bacteria | 25509 |
| 495 | Ga0466963_0002936 | 3300044694 | Bacteria | 9633 |
| 496 | Ga0466963_0213735 | 3300044694 | Bacteria | 1350 |
| 497 | Ga0466963_0311262 | 3300044694 | Bacteria | 1108 |
| 498 | Ga0466963_0320350 | 3300044694 | Bacteria | 1091 |
| 499 | Ga0466964_0215056 | 3300044706 | Bacteria | 930 |
| 500 | Ga0466971_0016234 | 3300044719 | Bacteria | 3282 |
| 501 | Ga0466971_0024068 | 3300044719 | Bacteria | 2716 |
| 502 | Ga0466971_0035566 | 3300044719 | Bacteria | 2234 |
| 503 | Ga0466968_0007978 | 3300044735 | Bacteria | 4044 |
| 504 | Ga0466968_0030780 | 3300044735 | Bacteria | 2224 |
| 505 | Ga0466970_0003680 | 3300044765 | Bacteria | 7483 |
| 506 | Ga0466970_0004702 | 3300044765 | Bacteria | 6743 |
| 507 | Ga0466957_0020111 | 3300044842 | Bacteria | 3929 |
| 508 | Ga0466957_0085738 | 3300044842 | Bacteria | 1967 |
| 509 | Ga0466960_0000965 | 3300044901 | Bacteria | 10200 |
| 510 | Ga0466960_0029308 | 3300044901 | Bacteria | 2525 |
| 511 | Ga0466960_0107471 | 3300044901 | Bacteria | 1445 |
| 512 | Ga0466960_0116373 | 3300044901 | Bacteria | 1395 |
| 513 | Ga0466960_0274319 | 3300044901 | Bacteria | 943 |
| 514 | Ga0466959_0083606 | 3300045049 | Bacteria | 2298 |
| 515 | Ga0466959_0187050 | 3300045049 | Bacteria | 1446 |
| 516 | Ga0466958_0002583 | 3300045836 | Bacteria | 9143 |
| 517 | Ga0466967_0012779 | 3300045976 | Bacteria | 6449 |
| 518 | Ga0466967_0050586 | 3300045976 | Bacteria | 3639 |
| 519 | Ga0466967_0070420 | 3300045976 | Bacteria | 3129 |
| 520 | Ga0466967_0092774 | 3300045976 | Bacteria | 2746 |
| 521 | Ga0466967_0252530 | 3300045976 | Bacteria | 1685 |
| 522 | Ga0466967_0296825 | 3300045976 | Bacteria | 1554 |
| 523 | Ga0466967_0359330 | 3300045976 | Bacteria | 1411 |
| 524 | Ga0466967_0375460 | 3300045976 | Bacteria | 1380 |
| 525 | Ga0466967_0419386 | 3300045976 | Bacteria | 1304 |
| 526 | Ga0495617_027607 | 3300046452 | Bacteria | 1909 |
| 527 | Ga0495627_043249 | 3300046453 | Bacteria | 1378 |
| 528 | Ga0495592_0004397 | 3300046454 | Bacteria | 10307 |
| 529 | Ga0495603_0001858 | 3300046455 | Bacteria | 12437 |
| 530 | Ga0495603_0002751 | 3300046455 | Bacteria | 10361 |
| 531 | Ga0495603_0003617 | 3300046455 | Bacteria | 9190 |
| 532 | Ga0495603_0003796 | 3300046455 | Bacteria | 8994 |
| 533 | Ga0495603_0028037 | 3300046455 | Bacteria | 3396 |
| 534 | Ga0495603_0041056 | 3300046455 | Bacteria | 2767 |
| 535 | Ga0495590_0113503 | 3300046457 | Bacteria | 968 |
| 536 | Ga0495629_0006991 | 3300046459 | Bacteria | 8314 |
| 537 | Ga0495629_0009757 | 3300046459 | Bacteria | 7006 |
| 538 | Ga0495629_0019173 | 3300046459 | Bacteria | 4889 |
| 539 | Ga0495629_0041423 | 3300046459 | Bacteria | 3240 |
| 540 | Ga0495629_0044450 | 3300046459 | Bacteria | 3117 |
| 541 | Ga0495629_0063842 | 3300046459 | Bacteria | 2571 |
| 542 | Ga0495629_0095786 | 3300046459 | Bacteria | 2070 |
| 543 | Ga0495629_0294667 | 3300046459 | Bacteria | 1111 |
| 544 | Ga0495638_0008299 | 3300046460 | Bacteria | 7375 |
| 545 | Ga0495638_0016209 | 3300046460 | Bacteria | 4995 |
| 546 | Ga0495638_0018353 | 3300046460 | Bacteria | 4646 |
| 547 | Ga0495638_0023834 | 3300046460 | Bacteria | 3998 |
| 548 | Ga0495641_0080463 | 3300046461 | Bacteria | 1460 |
| 549 | Ga0495641_0203902 | 3300046461 | Bacteria | 886 |
| 550 | Ga0495651_0003483 | 3300046462 | Bacteria | 12065 |
| 551 | Ga0495651_0068437 | 3300046462 | Bacteria | 2706 |
| 552 | Ga0495651_0126494 | 3300046462 | Bacteria | 1871 |
| 553 | Ga0495651_0155399 | 3300046462 | Bacteria | 1644 |
| 554 | Ga0495653_0005693 | 3300046463 | Bacteria | 10181 |
| 555 | Ga0495653_0029215 | 3300046463 | Bacteria | 4404 |
| 556 | Ga0495653_0207761 | 3300046463 | Bacteria | 1324 |
| 557 | Ga0495580_0152366 | 3300046472 | Bacteria | 1601 |
| 558 | Ga0495582_0015241 | 3300046473 | Bacteria | 4226 |
| 559 | Ga0495582_0025537 | 3300046473 | Bacteria | 3236 |
| 560 | Ga0495605_0017534 | 3300046474 | Bacteria | 3851 |
| 561 | Ga0495639_0008710 | 3300046475 | Bacteria | 4350 |
| 562 | Ga0495662_0001859 | 3300046476 | Bacteria | 10571 |
| 563 | Ga0495662_0005451 | 3300046476 | Bacteria | 6369 |
| 564 | Ga0495662_0010695 | 3300046476 | Bacteria | 4487 |
| 565 | Ga0495662_0021273 | 3300046476 | Bacteria | 3135 |
| 566 | Ga0495662_0027853 | 3300046476 | Bacteria | 2729 |
| 567 | Ga0495664_0000355 | 3300046477 | Bacteria | 22087 |
| 568 | Ga0495664_0006519 | 3300046477 | Bacteria | 6452 |
| 569 | Ga0495664_0057721 | 3300046477 | Bacteria | 2309 |
| 570 | Ga0495664_0062536 | 3300046477 | Bacteria | 2217 |
| 571 | Ga0495585_0033955 | 3300046492 | Bacteria | 2885 |
| 572 | Ga0495585_0041242 | 3300046492 | Bacteria | 2589 |
| 573 | Ga0495594_0000244 | 3300046499 | Bacteria | 26387 |
| 574 | Ga0495594_0008294 | 3300046499 | Bacteria | 5348 |
| 575 | Ga0495594_0022825 | 3300046499 | Bacteria | 3350 |
| 576 | Ga0495594_0026897 | 3300046499 | Bacteria | 3098 |
| 577 | Ga0495607_0072554 | 3300046501 | Bacteria | 1916 |
| 578 | Ga0495583_0067536 | 3300046506 | Bacteria | 1579 |
| 579 | Ga0495606_0023291 | 3300046507 | Bacteria | 4491 |
| 580 | Ga0495608_0035702 | 3300046511 | Bacteria | 3351 |
| 581 | Ga0495608_0096471 | 3300046511 | Bacteria | 1910 |
| 582 | Ga0495616_0031733 | 3300046513 | Bacteria | 2764 |
| 583 | Ga0495618_0019675 | 3300046514 | Bacteria | 4154 |
| 584 | Ga0495618_0050115 | 3300046514 | Bacteria | 2637 |
| 585 | Ga0495618_0087109 | 3300046514 | Bacteria | 1997 |
| 586 | Ga0495618_0112689 | 3300046514 | Bacteria | 1741 |
| 587 | Ga0495620_0004961 | 3300046515 | Bacteria | 7462 |
| 588 | Ga0495620_0010780 | 3300046515 | Bacteria | 4806 |
| 589 | Ga0495628_0020376 | 3300046516 | Bacteria | 5471 |
| 590 | Ga0495628_0030094 | 3300046516 | Bacteria | 4397 |
| 591 | Ga0495628_0062151 | 3300046516 | Bacteria | 2928 |
| 592 | Ga0495628_0102837 | 3300046516 | Bacteria | 2203 |
| 593 | Ga0495630_0002641 | 3300046517 | Bacteria | 12417 |
| 594 | Ga0495630_0109868 | 3300046517 | Bacteria | 2088 |
| 595 | Ga0495631_0030629 | 3300046518 | Bacteria | 2439 |
| 596 | Ga0495643_0001406 | 3300046522 | Bacteria | 22332 |
| 597 | Ga0495643_0002819 | 3300046522 | Bacteria | 13260 |
| 598 | Ga0495666_0178764 | 3300046526 | Bacteria | 980 |
| 599 | Ga0495652_0045401 | 3300046529 | Bacteria | 3778 |
| 600 | Ga0495652_0051890 | 3300046529 | Bacteria | 3500 |
| 601 | Ga0495652_0057169 | 3300046529 | Bacteria | 3309 |
| 602 | Ga0495652_0197683 | 3300046529 | Bacteria | 1528 |
| 603 | Ga0495652_0262346 | 3300046529 | Bacteria | 1274 |
| 604 | Ga0495654_0159482 | 3300046530 | Bacteria | 991 |
| 605 | Ga0495665_0000881 | 3300046531 | Bacteria | 15706 |
| 606 | Ga0495665_0024190 | 3300046531 | Bacteria | 3263 |
| 607 | Ga0495640_0008927 | 3300046533 | Bacteria | 7828 |
| 608 | Ga0495640_0016406 | 3300046533 | Bacteria | 5541 |
| 609 | Ga0495640_0032961 | 3300046533 | Bacteria | 3685 |
| 610 | Ga0495640_0073049 | 3300046533 | Bacteria | 2297 |
| 611 | Ga0495640_0138852 | 3300046533 | Bacteria | 1567 |
| 612 | Ga0495587_0001034 | 3300046536 | Bacteria | 18306 |
| 613 | Ga0495587_0174832 | 3300046536 | Bacteria | 1219 |
| 614 | Ga0495587_0212372 | 3300046536 | Bacteria | 1092 |
| 615 | Ga0495597_0034798 | 3300046542 | Bacteria | 2275 |
| 616 | Ga0495645_0008885 | 3300046543 | Bacteria | 7019 |
| 617 | Ga0495645_0017893 | 3300046543 | Bacteria | 5085 |
| 618 | Ga0495645_0189859 | 3300046543 | Bacteria | 1401 |
| 619 | Ga0495622_0002073 | 3300046557 | Bacteria | 9794 |
| 620 | Ga0495622_0007613 | 3300046557 | Bacteria | 5028 |
| 621 | Ga0495622_0072386 | 3300046557 | Bacteria | 1590 |
| 622 | Ga0495633_0035129 | 3300046558 | Bacteria | 2408 |
| 623 | Ga0495667_0045895 | 3300046559 | Bacteria | 2890 |
| 624 | Ga0495668_0036891 | 3300046616 | Bacteria | 2737 |
| 625 | Ga0495668_0055969 | 3300046616 | Bacteria | 2178 |
| 626 | Ga0495634_0042766 | 3300046642 | Bacteria | 3072 |
| 627 | Ga0495634_0054527 | 3300046642 | Bacteria | 2675 |
| 628 | Ga0495634_0070018 | 3300046642 | Bacteria | 2313 |
| 629 | Ga0495634_0169106 | 3300046642 | Bacteria | 1374 |
| 630 | Ga0495611_0010852 | 3300046648 | Bacteria | 3858 |
| 631 | Ga0495611_0014161 | 3300046648 | Bacteria | 3403 |
| 632 | Ga0495625_0007730 | 3300046660 | Bacteria | 9297 |
| 633 | Ga0495625_0014809 | 3300046660 | Bacteria | 6207 |
| 634 | Ga0495625_0100161 | 3300046660 | Bacteria | 1992 |
| 635 | Ga0495625_0324724 | 3300046660 | Bacteria | 979 |
| 636 | Ga0495635_0000563 | 3300046663 | Bacteria | 23671 |
| 637 | Ga0495635_0006569 | 3300046663 | Bacteria | 8114 |
| 638 | Ga0495588_0002826 | 3300046674 | Bacteria | 7465 |
| 639 | Ga0495588_0007253 | 3300046674 | Bacteria | 5034 |
| 640 | Ga0495588_0007542 | 3300046674 | Bacteria | 4956 |
| 641 | Ga0495588_0220846 | 3300046674 | Bacteria | 1000 |
| 642 | Ga0495588_0268768 | 3300046674 | Bacteria | 898 |
| 643 | Ga0495657_0004129 | 3300046675 | Bacteria | 11629 |
| 644 | Ga0495657_0005323 | 3300046675 | Bacteria | 10182 |
| 645 | Ga0495657_0037987 | 3300046675 | Bacteria | 3315 |
| 646 | Ga0495657_0045198 | 3300046675 | Bacteria | 2989 |
| 647 | Ga0495657_0059729 | 3300046675 | Bacteria | 2528 |
| 648 | Ga0495599_0050336 | 3300046678 | Bacteria | 2610 |
| 649 | Ga0495599_0055249 | 3300046678 | Bacteria | 2487 |
| 650 | Ga0495599_0096137 | 3300046678 | Bacteria | 1847 |
| 651 | Ga0495623_0008756 | 3300046679 | Bacteria | 6571 |
| 652 | Ga0495646_0020434 | 3300046680 | Bacteria | 4190 |
| 653 | Ga0495646_0080930 | 3300046680 | Bacteria | 1893 |
| 654 | Ga0495646_0196749 | 3300046680 | Bacteria | 1099 |
| 655 | Ga0495613_0000689 | 3300046689 | Bacteria | 26707 |
| 656 | Ga0495613_0012437 | 3300046689 | Bacteria | 6324 |
| 657 | Ga0495613_0062646 | 3300046689 | Bacteria | 2721 |
| 658 | Ga0495624_0000942 | 3300046690 | Bacteria | 22948 |
| 659 | Ga0495624_0032904 | 3300046690 | Bacteria | 3359 |
| 660 | Ga0495624_0177540 | 3300046690 | Bacteria | 1298 |
| 661 | Ga0495670_0004493 | 3300046691 | Bacteria | 6836 |
| 662 | Ga0495670_0139317 | 3300046691 | Bacteria | 1268 |
| 663 | Ga0495671_0004121 | 3300046692 | Bacteria | 8764 |
| 664 | Ga0495649_0019128 | 3300046694 | Bacteria | 3848 |
| 665 | Ga0495589_0008402 | 3300046794 | Bacteria | 5396 |
| 666 | Ga0495589_0032763 | 3300046794 | Bacteria | 2612 |
| 667 | Ga0495589_0147436 | 3300046794 | Bacteria | 1124 |
| 668 | Ga0495600_0043021 | 3300046809 | Bacteria | 2944 |
| 669 | Ga0495600_0202277 | 3300046809 | Bacteria | 1275 |
| 670 | Ga0495660_0015012 | 3300046810 | Bacteria | 4477 |
| 671 | Ga0495660_0064945 | 3300046810 | Bacteria | 1949 |
| 672 | Ga0495660_0159007 | 3300046810 | Bacteria | 1109 |
| 673 | Ga0495581_0005923 | 3300047315 | Bacteria | 7088 |
| 674 | Ga0495581_0008559 | 3300047315 | Bacteria | 5929 |
| 675 | Ga0495581_0034431 | 3300047315 | Bacteria | 2931 |
| 676 | Ga0495581_0038805 | 3300047315 | Bacteria | 2757 |
| 677 | Ga0495581_0048903 | 3300047315 | Bacteria | 2442 |
| 678 | Ga0495581_0222785 | 3300047315 | Bacteria | 1103 |
| 679 | Ga0495604_0000177 | 3300047317 | Bacteria | 56559 |
| 680 | Ga0495604_0070900 | 3300047317 | Bacteria | 2637 |
| 681 | Ga0495636_0001903 | 3300047318 | Bacteria | 7979 |
| 682 | Ga0495636_0054307 | 3300047318 | Bacteria | 1683 |
| 683 | Ga0495636_0168546 | 3300047318 | Bacteria | 989 |
| 684 | Ga0495674_0001655 | 3300047319 | Bacteria | 21912 |
| 685 | Ga0495674_0046357 | 3300047319 | Bacteria | 3858 |
| 686 | Ga0495674_0047600 | 3300047319 | Bacteria | 3801 |
| 687 | Ga0495674_0244977 | 3300047319 | Bacteria | 1476 |
| 688 | Ga0495672_0054676 | 3300047320 | Bacteria | 2332 |
| 689 | Ga0495676_0002684 | 3300047321 | Bacteria | 15938 |
| 690 | Ga0495676_0002844 | 3300047321 | Bacteria | 15596 |
| 691 | Ga0495676_0031274 | 3300047321 | Bacteria | 4503 |
| 692 | Ga0495676_0065143 | 3300047321 | Bacteria | 2829 |
| 693 | Ga0495680_0015042 | 3300047322 | Bacteria | 6683 |
| 694 | Ga0495680_0060263 | 3300047322 | Bacteria | 2926 |
| 695 | Ga0495680_0173223 | 3300047322 | Bacteria | 1561 |
| 696 | Ga0495683_0009058 | 3300047323 | Bacteria | 5305 |
| 697 | Ga0495683_0020547 | 3300047323 | Bacteria | 3405 |
| 698 | Ga0495683_0065278 | 3300047323 | Bacteria | 1796 |
| 699 | Ga0495687_011361 | 3300047443 | Bacteria | 4797 |
| 700 | Ga0495675_0010024 | 3300047444 | Bacteria | 5910 |
| 701 | Ga0495675_0015663 | 3300047444 | Bacteria | 4793 |
| 702 | Ga0495675_0018918 | 3300047444 | Bacteria | 4376 |
| 703 | Ga0495675_0077824 | 3300047444 | Bacteria | 2089 |
| 704 | Ga0495675_0184571 | 3300047444 | Bacteria | 1276 |
| 705 | Ga0495679_013057 | 3300047446 | Bacteria | 3134 |
| 706 | Ga0495685_000162 | 3300047447 | Bacteria | 22500 |
| 707 | Ga0495685_005084 | 3300047447 | Bacteria | 4283 |
| 708 | Ga0495685_012571 | 3300047447 | Bacteria | 2868 |
| 709 | Ga0495685_020329 | 3300047447 | Bacteria | 2281 |
| 710 | Ga0495685_027732 | 3300047447 | Bacteria | 1948 |
| 711 | Ga0495685_093467 | 3300047447 | Bacteria | 995 |
| 712 | Ga0495681_0000665 | 3300047470 | Bacteria | 26108 |
| 713 | Ga0495681_0004558 | 3300047470 | Bacteria | 9443 |
| 714 | Ga0495684_0004089 | 3300047471 | Bacteria | 11392 |
| 715 | Ga0495684_0016370 | 3300047471 | Bacteria | 5710 |
| 716 | Ga0495684_0031322 | 3300047471 | Bacteria | 4083 |
| 717 | Ga0495684_0036554 | 3300047471 | Bacteria | 3764 |
| 718 | Ga0495684_0213823 | 3300047471 | Bacteria | 1416 |
| 719 | Ga0495686_0044087 | 3300047472 | Bacteria | 2824 |
| 720 | Ga0495593_0000803 | 3300047673 | Bacteria | 18157 |
| 721 | Ga0495593_0063670 | 3300047673 | Bacteria | 1925 |
| 722 | Ga0495593_0125196 | 3300047673 | Bacteria | 1306 |
| 723 | Ga0495602_0069887 | 3300048088 | Bacteria | 3008 |
| 724 | Ga0495602_0147797 | 3300048088 | Bacteria | 1851 |
| 725 | Ga0495614_0000585 | 3300048089 | Bacteria | 15189 |
| 726 | Ga0495614_0003178 | 3300048089 | Bacteria | 7336 |
| 727 | Ga0495614_0004622 | 3300048089 | Bacteria | 6199 |
| 728 | Ga0495614_0049198 | 3300048089 | Bacteria | 1807 |
| 729 | Ga0495614_0062271 | 3300048089 | Bacteria | 1603 |
| 730 | Ga0495626_0031833 | 3300048091 | Bacteria | 2535 |
| 731 | Ga0496100_0052514 | 3300048903 | Bacteria | 2650 |
| 732 | Ga0496100_0331658 | 3300048903 | Bacteria | 1145 |
| 733 | Ga0496101_0000252 | 3300048904 | Bacteria | 38425 |
| 734 | Ga0496101_0001313 | 3300048904 | Bacteria | 14862 |
| 735 | Ga0496101_0004785 | 3300048904 | Bacteria | 8584 |
| 736 | Ga0496101_0147959 | 3300048904 | Bacteria | 1794 |
| 737 | Ga0496102_0000277 | 3300048905 | Bacteria | 65492 |
| 738 | Ga0496102_0000868 | 3300048905 | Bacteria | 28888 |
| 739 | Ga0496102_0136274 | 3300048905 | Bacteria | 2300 |
| 740 | Ga0496102_0153296 | 3300048905 | Bacteria | 2166 |
| 741 | Ga0496103_0001078 | 3300048906 | Bacteria | 19063 |
| 742 | Ga0496103_0049367 | 3300048906 | Bacteria | 2602 |
| 743 | Ga0496103_0078199 | 3300048906 | Bacteria | 2077 |
| 744 | Ga0496103_0163234 | 3300048906 | Bacteria | 1429 |
| 745 | Ga0496104_0001573 | 3300048907 | Bacteria | 19634 |
| 746 | Ga0496105_0071906 | 3300048908 | Bacteria | 2859 |
| 747 | Ga0496105_0100421 | 3300048908 | Bacteria | 2389 |
| 748 | Ga0496106_0001380 | 3300048909 | Bacteria | 18204 |
| 749 | Ga0496106_0068337 | 3300048909 | Bacteria | 2710 |
| 750 | Ga0496106_0077490 | 3300048909 | Bacteria | 2549 |
| 751 | Ga0496106_0144231 | 3300048909 | Bacteria | 1874 |
| 752 | Ga0496106_0206178 | 3300048909 | Bacteria | 1565 |
| 753 | Ga0496107_0000829 | 3300048910 | Bacteria | 18033 |
| 754 | Ga0496107_0000879 | 3300048910 | Bacteria | 17697 |
| 755 | Ga0496107_0020468 | 3300048910 | Bacteria | 4673 |
| 756 | Ga0496107_0113584 | 3300048910 | Bacteria | 1992 |
| 757 | Ga0496107_0226112 | 3300048910 | Bacteria | 1392 |
| 758 | Ga0496108_0013057 | 3300048911 | Bacteria | 6769 |
| 759 | Ga0496108_0067612 | 3300048911 | Bacteria | 3014 |
| 760 | Ga0496109_0004360 | 3300048912 | Bacteria | 11826 |
| 761 | Ga0496109_0013710 | 3300048912 | Bacteria | 7041 |
| 762 | Ga0496109_0015110 | 3300048912 | Bacteria | 6719 |
| 763 | Ga0496109_0033398 | 3300048912 | Bacteria | 4629 |
| 764 | Ga0496109_0281083 | 3300048912 | Bacteria | 1568 |
| 765 | Ga0496110_0042530 | 3300048913 | Bacteria | 3965 |
| 766 | Ga0496111_0016904 | 3300048914 | Bacteria | 5036 |
| 767 | Ga0496112_0014095 | 3300048915 | Bacteria | 7402 |
| 768 | Ga0496112_0036501 | 3300048915 | Bacteria | 4795 |
| 769 | Ga0496113_0106327 | 3300048916 | Bacteria | 2179 |
| 770 | Ga0496114_0000514 | 3300048917 | Bacteria | 28427 |
| 771 | Ga0496114_0003450 | 3300048917 | Bacteria | 12126 |
| 772 | Ga0496114_0170668 | 3300048917 | Bacteria | 1895 |
| 773 | Ga0496115_0000799 | 3300048918 | Bacteria | 23089 |
| 774 | Ga0496115_0017268 | 3300048918 | Bacteria | 5510 |
| 775 | Ga0496115_0123144 | 3300048918 | Bacteria | 2134 |
| 776 | Ga0496116_0013362 | 3300048919 | Bacteria | 6626 |
| 777 | Ga0496117_0000760 | 3300048920 | Bacteria | 50798 |
| 778 | Ga0496118_0000225 | 3300048921 | Bacteria | 98639 |
| 779 | Ga0496119_0004423 | 3300048922 | Bacteria | 14003 |
| 780 | Ga0496120_0005250 | 3300048923 | Bacteria | 10408 |
| 781 | Ga0496121_0002455 | 3300048924 | Bacteria | 28318 |
| 782 | Ga0496124_0043494 | 3300048927 | Bacteria | 3861 |
| 783 | Ga0496125_0046539 | 3300048928 | Bacteria | 3638 |
| 784 | Ga0496126_0025517 | 3300048929 | Bacteria | 5683 |
| 785 | Ga0495678_021792 | 3300049459 | Bacteria | 2815 |
| 786 | Ga0495678_044356 | 3300049459 | Bacteria | 1759 |
| 787 | Ga0501032_0022832 | 3300049569 | Bacteria | 4333 |
| 788 | Ga0501033_0000315 | 3300049570 | Bacteria | 45917 |
| 789 | Ga0501033_0047859 | 3300049570 | Bacteria | 3178 |
| 790 | Ga0501033_0060032 | 3300049570 | Bacteria | 2806 |
| 791 | Ga0501033_0085241 | 3300049570 | Bacteria | 2314 |
| 792 | Ga0501034_0006261 | 3300049571 | Bacteria | 12805 |
| 793 | Ga0501034_0051993 | 3300049571 | Bacteria | 4130 |
| 794 | Ga0501034_0055411 | 3300049571 | Bacteria | 3990 |
| 795 | Ga0501034_0068916 | 3300049571 | Bacteria | 3548 |
| 796 | Ga0501034_0133382 | 3300049571 | Bacteria | 2466 |
| 797 | Ga0501036_0008190 | 3300049572 | Bacteria | 8567 |
| 798 | Ga0501036_0043493 | 3300049572 | Bacteria | 3804 |
| 799 | Ga0501037_0003381 | 3300049573 | Bacteria | 11596 |
| 800 | Ga0501038_0016541 | 3300049574 | Bacteria | 6686 |
| 801 | Ga0501038_0037143 | 3300049574 | Bacteria | 4273 |
| 802 | Ga0501038_0039741 | 3300049574 | Bacteria | 4114 |
| 803 | Ga0501039_0052942 | 3300049575 | Bacteria | 3140 |
| 804 | Ga0501042_0068751 | 3300049578 | Bacteria | 2533 |
| 805 | Ga0501043_0082017 | 3300049579 | Bacteria | 2534 |
| 806 | Ga0501046_0073534 | 3300049580 | Bacteria | 2652 |
| 807 | Ga0501046_0094212 | 3300049580 | Bacteria | 2301 |
| 808 | Ga0501047_0024286 | 3300049581 | Bacteria | 5819 |
| 809 | Ga0501047_0038824 | 3300049581 | Bacteria | 4606 |
| 810 | Ga0501047_0051334 | 3300049581 | Bacteria | 3984 |
| 811 | Ga0501047_0161347 | 3300049581 | Bacteria | 2113 |
| 812 | Ga0501047_0172013 | 3300049581 | Bacteria | 2034 |
| 813 | Ga0501048_0008440 | 3300049582 | Bacteria | 7790 |
| 814 | Ga0501067_0249764 | 3300049583 | Bacteria | 987 |
| 815 | Ga0501069_0064005 | 3300049585 | Bacteria | 2055 |
| 816 | Ga0501070_0000283 | 3300049586 | Bacteria | 47512 |
| 817 | Ga0501070_0149850 | 3300049586 | Bacteria | 1925 |
| 818 | Ga0501070_0203699 | 3300049586 | Bacteria | 1625 |
| 819 | Ga0501074_0000299 | 3300049590 | Bacteria | 28549 |
| 820 | Ga0501035_0001215 | 3300049822 | Bacteria | 26839 |
| 821 | Ga0501035_0001623 | 3300049822 | Bacteria | 22760 |
| 822 | Ga0501035_0036288 | 3300049822 | Bacteria | 4468 |
| 823 | Ga0501035_0109730 | 3300049822 | Bacteria | 2418 |
| 824 | Ga0501044_0004709 | 3300049823 | Bacteria | 15252 |
| 825 | Ga0501044_0006702 | 3300049823 | Bacteria | 12702 |
| 826 | Ga0501044_0021565 | 3300049823 | Bacteria | 6869 |
| 827 | Ga0501044_0033696 | 3300049823 | Bacteria | 5379 |
| 828 | Ga0501044_0089490 | 3300049823 | Bacteria | 3107 |
| 829 | Ga0501044_0097855 | 3300049823 | Bacteria | 2954 |
| 830 | Ga0501044_0252062 | 3300049823 | Bacteria | 1706 |
| 831 | Ga0501044_0361696 | 3300049823 | Bacteria | 1369 |
| 832 | nmdc:mga03n38_102260_c1 | 3300050490 | Bacteria | 1383 |
| 833 | nmdc:mga03n38_56077_c1 | 3300050490 | Bacteria | 1777 |
| 834 | nmdc:mga00v17_1073_c1 | 3300050491 | Bacteria | 14396 |
| 835 | nmdc:mga00v17_14428_c1 | 3300050491 | Bacteria | 4409 |
| 836 | nmdc:mga00v17_28849_c1 | 3300050491 | Bacteria | 3253 |
| 837 | nmdc:mga0yw44_447519_c1 | 3300050492 | Bacteria | 875 |
| 838 | nmdc:mga0yw44_89134_c1 | 3300050492 | Bacteria | 1946 |
| 839 | nmdc:mga06z11_107896_c1 | 3300050494 | Bacteria | 1537 |
| 840 | nmdc:mga06z11_14231_c1 | 3300050494 | Bacteria | 3519 |
| 841 | nmdc:mga0rr50_221664_c2 | 3300050513 | Bacteria | 1154 |
| 842 | nmdc:mga08x19_172417_c1 | 3300050514 | Bacteria | 1474 |
| 843 | nmdc:mga08x19_407920_c1 | 3300050514 | Bacteria | 954 |
| 844 | nmdc:mga0sz30_2757_c1 | 3300050516 | Bacteria | 6268 |
| 845 | nmdc:mga0sz30_30654_c1 | 3300050516 | Bacteria | 2223 |
| 846 | nmdc:mga0sz30_8083_c1 | 3300050516 | Bacteria | 2580 |
| 847 | Ga0495601_0181391 | 3300053077 | Bacteria | 1376 |
| 848 | Ga0495612_0004919 | 3300053078 | Bacteria | 5526 |
| 849 | Ga0495655_0012498 | 3300053083 | Bacteria | 1732 |
| 850 | Ga0495595_0003924 | 3300053084 | Bacteria | 5938 |
| 851 | Ga0495595_0028454 | 3300053084 | Bacteria | 2496 |
| 852 | Ga0500578_0004838 | 3300053086 | Bacteria | 9328 |
| 853 | Ga0500578_0178206 | 3300053086 | Bacteria | 1311 |
| 854 | Ga0500643_023061 | 3300053087 | Bacteria | 1993 |
| 855 | Ga0500646_0013121 | 3300053090 | Bacteria | 2145 |
| 856 | Ga0500566_0084045 | 3300053094 | Bacteria | 1767 |
| 857 | Ga0500640_006774 | 3300053095 | Bacteria | 4404 |
| 858 | Ga0500641_0023160 | 3300053096 | Bacteria | 2386 |
| 859 | Ga0500660_128514 | 3300053100 | Bacteria | 1036 |
| 860 | Ga0500560_000466 | 3300053107 | Bacteria | 5636 |
| 861 | Ga0500572_002226 | 3300053111 | Bacteria | 4735 |
| 862 | Ga0500580_027725 | 3300053113 | Bacteria | 2393 |
| 863 | Ga0500614_047686 | 3300053123 | Bacteria | 1113 |
| 864 | Ga0500628_003906 | 3300053129 | Bacteria | 2460 |
| 865 | Ga0500642_0089978 | 3300053130 | Bacteria | 1418 |
| 866 | Ga0500652_012499 | 3300053131 | Bacteria | 2981 |
| 867 | Ga0500658_0014891 | 3300053134 | Bacteria | 2882 |
| 868 | Ga0500573_0015931 | 3300053140 | Bacteria | 4264 |
| 869 | Ga0500573_0227879 | 3300053140 | Bacteria | 973 |
| 870 | Ga0500577_0176845 | 3300053142 | Bacteria | 915 |
| 871 | Ga0500579_061224 | 3300053143 | Bacteria | 2233 |
| 872 | Ga0500600_0007862 | 3300053149 | Bacteria | 6421 |
| 873 | Ga0500616_0004760 | 3300053153 | Bacteria | 9533 |
| 874 | Ga0500616_0012651 | 3300053153 | Bacteria | 4933 |
| 875 | Ga0500624_001614 | 3300053157 | Bacteria | 3423 |
| 876 | Ga0500627_0026268 | 3300053158 | Bacteria | 2402 |
| 877 | Ga0500633_0004692 | 3300053160 | Bacteria | 3168 |
| 878 | Ga0500634_0000287 | 3300053161 | Bacteria | 16181 |
| 879 | Ga0500645_077408 | 3300053730 | Bacteria | 950 |
| 880 | Ga0500587_000669 | 3300053739 | Bacteria | 4356 |
| 881 | Ga0466962_0008848 | 3300061719 | Bacteria | 4825 |
| 882 | Ga0466962_0010393 | 3300061719 | Bacteria | 4473 |
| 883 | Ga0466962_0121386 | 3300061719 | Bacteria | 1261 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035086 | Ga0373934_0012900 | Ga0373934_0012900_2443_3135 | 230 |
| 2 | 3300046455 | Ga0495603_0003617 | Ga0495603_0003617_8488_9180 | 230 |
| 3 | 3300046461 | Ga0495641_0203902 | Ga0495641_0203902_174_866 | 230 |
| 4 | 3300046462 | Ga0495651_0126494 | Ga0495651_0126494_1158_1850 | 230 |
| 5 | 3300046473 | Ga0495582_0025537 | Ga0495582_0025537_2523_3215 | 230 |
| 6 | 3300046536 | Ga0495587_0212372 | Ga0495587_0212372_390_1082 | 230 |
| 7 | 3300046674 | Ga0495588_0268768 | Ga0495588_0268768_193_885 | 230 |
| 8 | 3300047319 | Ga0495674_0244977 | Ga0495674_0244977_43_735 | 230 |
| 9 | 3300044706 | Ga0466964_0215056 | Ga0466964_0215056_188_892 | 234 |
| 10 | 3300005434 | Ga0070709_10094127 | Ga0070709_100941271 | 245 |
| 11 | 3300005435 | Ga0070714_100295956 | Ga0070714_1002959561 | 245 |
| 12 | 3300005436 | Ga0070713_100126557 | Ga0070713_1001265573 | 245 |
| 13 | 3300005439 | Ga0070711_100007962 | Ga0070711_1000079623 | 245 |
| 14 | 3300005445 | Ga0070708_100158001 | Ga0070708_1001580012 | 245 |
| 15 | 3300005468 | Ga0070707_100003017 | Ga0070707_1000030171 | 245 |
| 16 | 3300005468 | Ga0070707_100246731 | Ga0070707_1002467313 | 245 |
| 17 | 3300005518 | Ga0070699_100002168 | Ga0070699_1000021682 | 245 |
| 18 | 3300005536 | Ga0070697_100002896 | Ga0070697_10000289614 | 245 |
| 19 | 3300006028 | Ga0070717_10172559 | Ga0070717_101725592 | 245 |
| 20 | 3300006163 | Ga0070715_10081780 | Ga0070715_100817802 | 245 |
| 21 | 3300006173 | Ga0070716_100198791 | Ga0070716_1001987911 | 245 |
| 22 | 3300025898 | Ga0207692_10044179 | Ga0207692_100441792 | 245 |
| 23 | 3300025906 | Ga0207699_10347996 | Ga0207699_103479962 | 245 |
| 24 | 3300025910 | Ga0207684_10029123 | Ga0207684_100291232 | 245 |
| 25 | 3300025922 | Ga0207646_10022756 | Ga0207646_100227562 | 245 |
| 26 | 3300025939 | Ga0207665_10014887 | Ga0207665_100148872 | 245 |
| 27 | 3300035083 | Ga0373926_0002751 | Ga0373926_0002751_1731_2468 | 245 |
| 28 | 3300035088 | Ga0373940_0045890 | Ga0373940_0045890_131_868 | 245 |
| 29 | 3300035089 | Ga0373944_0000937 | Ga0373944_0000937_402_1139 | 245 |
| 30 | 3300035113 | Ga0373936_0012017 | Ga0373936_0012017_769_1506 | 245 |
| 31 | 3300035116 | Ga0373945_0015958 | Ga0373945_0015958_1435_2172 | 245 |
| 32 | 3300035119 | Ga0373956_0071848 | Ga0373956_0071848_45_782 | 245 |
| 33 | 3300035119 | Ga0373956_0199692 | Ga0373956_0199692_173_910 | 245 |
| 34 | 3300035170 | Ga0373943_0000277 | Ga0373943_0000277_19018_19755 | 245 |
| 35 | 3300035171 | Ga0373946_0000047 | Ga0373946_0000047_20076_20813 | 245 |
| 36 | 3300035172 | Ga0373955_0217078 | Ga0373955_0217078_262_999 | 245 |
| 37 | 3300035692 | Ga0373935_0002314 | Ga0373935_0002314_9242_9979 | 245 |
| 38 | 3300035695 | Ga0373927_0000128 | Ga0373927_0000128_37025_37762 | 245 |
| 39 | 3300035724 | Ga0373933_0270959 | Ga0373933_0270959_95_832 | 245 |
| 40 | 3300035725 | Ga0373947_0000327 | Ga0373947_0000327_18652_19389 | 245 |
| 41 | 3300036401 | Ga0373937_0164920 | Ga0373937_0164920_997_1734 | 245 |
| 42 | 3300036401 | Ga0373937_0943483 | Ga0373937_0943483_38_775 | 245 |
| 43 | 3300037068 | Ga0373925_0001723 | Ga0373925_0001723_7256_7993 | 245 |
| 44 | 3300046462 | Ga0495651_0155399 | Ga0495651_0155399_499_1236 | 245 |
| 45 | 3300046463 | Ga0495653_0005693 | Ga0495653_0005693_4115_4852 | 245 |
| 46 | 3300046463 | Ga0495653_0207761 | Ga0495653_0207761_279_1016 | 245 |
| 47 | 3300046472 | Ga0495580_0152366 | Ga0495580_0152366_36_773 | 245 |
| 48 | 3300046477 | Ga0495664_0000355 | Ga0495664_0000355_967_1704 | 245 |
| 49 | 3300046511 | Ga0495608_0035702 | Ga0495608_0035702_1542_2279 | 245 |
| 50 | 3300046514 | Ga0495618_0050115 | Ga0495618_0050115_1566_2303 | 245 |
| 51 | 3300046516 | Ga0495628_0062151 | Ga0495628_0062151_970_1707 | 245 |
| 52 | 3300046516 | Ga0495628_0102837 | Ga0495628_0102837_632_1369 | 245 |
| 53 | 3300046529 | Ga0495652_0057169 | Ga0495652_0057169_839_1576 | 245 |
| 54 | 3300046529 | Ga0495652_0197683 | Ga0495652_0197683_113_850 | 245 |
| 55 | 3300046529 | Ga0495652_0262346 | Ga0495652_0262346_35_772 | 245 |
| 56 | 3300046533 | Ga0495640_0032961 | Ga0495640_0032961_2607_3344 | 245 |
| 57 | 3300046543 | Ga0495645_0189859 | Ga0495645_0189859_467_1204 | 245 |
| 58 | 3300046559 | Ga0495667_0045895 | Ga0495667_0045895_443_1180 | 245 |
| 59 | 3300046642 | Ga0495634_0054527 | Ga0495634_0054527_438_1175 | 245 |
| 60 | 3300046663 | Ga0495635_0006569 | Ga0495635_0006569_1635_2372 | 245 |
| 61 | 3300046675 | Ga0495657_0037987 | Ga0495657_0037987_1328_2065 | 245 |
| 62 | 3300046678 | Ga0495599_0050336 | Ga0495599_0050336_296_1033 | 245 |
| 63 | 3300046678 | Ga0495599_0096137 | Ga0495599_0096137_1003_1740 | 245 |
| 64 | 3300046690 | Ga0495624_0000942 | Ga0495624_0000942_20614_21351 | 245 |
| 65 | 3300046809 | Ga0495600_0202277 | Ga0495600_0202277_292_1029 | 245 |
| 66 | 3300047315 | Ga0495581_0038805 | Ga0495581_0038805_1355_2092 | 245 |
| 67 | 3300047319 | Ga0495674_0001655 | Ga0495674_0001655_15272_16009 | 245 |
| 68 | 3300047319 | Ga0495674_0047600 | Ga0495674_0047600_2092_2829 | 245 |
| 69 | 3300047322 | Ga0495680_0060263 | Ga0495680_0060263_1959_2696 | 245 |
| 70 | 3300047322 | Ga0495680_0173223 | Ga0495680_0173223_260_997 | 245 |
| 71 | 3300047444 | Ga0495675_0184571 | Ga0495675_0184571_279_1016 | 245 |
| 72 | 3300047471 | Ga0495684_0004089 | Ga0495684_0004089_7762_8499 | 245 |
| 73 | 3300047471 | Ga0495684_0036554 | Ga0495684_0036554_1070_1807 | 245 |
| 74 | 3300047471 | Ga0495684_0213823 | Ga0495684_0213823_123_860 | 245 |
| 75 | 3300047673 | Ga0495593_0125196 | Ga0495593_0125196_313_1050 | 245 |
| 76 | 3300048088 | Ga0495602_0147797 | Ga0495602_0147797_98_835 | 245 |
| 77 | 3300053084 | Ga0495595_0003924 | Ga0495595_0003924_2900_3637 | 245 |
| 78 | 3300021388 | Ga0213875_10024498 | Ga0213875_100244983 | 246 |
| 79 | 3300050492 | nmdc:mga0yw44_447519_c1 | nmdc:mga0yw44_447519_c1_119_865 | 248 |
| 80 | 3300009098 | Ga0105245_10876666 | Ga0105245_108766662 | 250 |
| 81 | 3300044693 | Ga0466961_0145283 | Ga0466961_0145283_705_1457 | 250 |
| 82 | 3300048909 | Ga0496106_0206178 | Ga0496106_0206178_776_1528 | 250 |
| 83 | 3300049583 | Ga0501067_0249764 | Ga0501067_0249764_224_976 | 250 |
| 84 | 3300005617 | Ga0068859_100203724 | Ga0068859_1002037243 | 255 |
| 85 | 3300006931 | Ga0097620_100203715 | Ga0097620_1002037153 | 255 |
| 86 | 3300013297 | Ga0157378_10162432 | Ga0157378_101624322 | 255 |
| 87 | 3300005471 | Ga0070698_100117027 | Ga0070698_1001170272 | 257 |
| 88 | 3300013296 | Ga0157374_10158360 | Ga0157374_101583602 | 259 |
| 89 | 3300005445 | Ga0070708_100002561 | Ga0070708_10000256114 | 260 |
| 90 | 3300005467 | Ga0070706_100017699 | Ga0070706_1000176995 | 260 |
| 91 | 3300005468 | Ga0070707_100044510 | Ga0070707_1000445103 | 260 |
| 92 | 3300005471 | Ga0070698_100018642 | Ga0070698_1000186422 | 260 |
| 93 | 3300025910 | Ga0207684_10009418 | Ga0207684_100094183 | 260 |
| 94 | 3300025922 | Ga0207646_10015635 | Ga0207646_100156354 | 260 |
| 95 | iso_pu_bacteria | 2891326441 | 2891331097 | 262 |
| 96 | 3300037853 | Ga0436364_0817251 | Ga0436364_0817251_50_847 | 263 |
| 97 | 3300048912 | Ga0496109_0033398 | Ga0496109_0033398_1039_1830 | 263 |
| 98 | 3300003659 | JGI25404J52841_10000681 | JGI25404J52841_100006813 | 264 |
| 99 | 3300005983 | Ga0081540_1001213 | Ga0081540_100121317 | 264 |
| 100 | 3300025901 | Ga0207688_10046896 | Ga0207688_100468962 | 264 |
| 101 | iso_pu_bacteria | 2862574272 | 2862582601 | 264 |
| 102 | 3300005436 | Ga0070713_100030313 | Ga0070713_1000303134 | 265 |
| 103 | 3300025929 | Ga0207664_10003887 | Ga0207664_100038877 | 265 |
| 104 | 3300031995 | Ga0307409_100366644 | Ga0307409_1003666441 | 265 |
| 105 | 3300032004 | Ga0307414_10422459 | Ga0307414_104224591 | 265 |
| 106 | iso_pu_bacteria | 2643221578 | 2643897660 | 265 |
| 107 | iso_pu_bacteria | 2643221673 | 2644408806 | 265 |
| 108 | iso_pu_bacteria | 2808606982 | 2811847953 | 265 |
| 109 | iso_pu_bacteria | 2946045630 | 2946051072 | 265 |
| 110 | iso_pu_bacteria | 2997451912 | 2997456359 | 265 |
| 111 | iso_pu_bacteria | 2582581313 | 2585308396 | 266 |
| 112 | iso_pu_bacteria | 2582581314 | 2585313209 | 266 |
| 113 | iso_pu_bacteria | 2643221647 | 2644268884 | 266 |
| 114 | iso_pu_bacteria | 2643221714 | 2644632034 | 266 |
| 115 | iso_pu_bacteria | 2767802112 | 2768647273 | 266 |
| 116 | iso_pu_bacteria | 2784746768 | 2785368282 | 266 |
| 117 | iso_pu_bacteria | 2786546132 | 2786669280 | 266 |
| 118 | iso_pu_bacteria | 2808606375 | 2808919511 | 266 |
| 119 | iso_pu_bacteria | 2852635781 | 2852640789 | 266 |
| 120 | iso_pu_bacteria | 2862281513 | 2862288393 | 266 |
| 121 | iso_pu_bacteria | 2862705112 | 2862705254 | 266 |
| 122 | iso_pu_bacteria | 2867346516 | 2867347332 | 266 |
| 123 | iso_pu_bacteria | 2867428634 | 2867431506 | 266 |
| 124 | iso_pu_bacteria | 2875391855 | 2875393607 | 266 |
| 125 | iso_pu_bacteria | 2877676314 | 2877682297 | 266 |
| 126 | iso_pu_bacteria | 2899359706 | 2899366825 | 266 |
| 127 | iso_pu_bacteria | 2917736166 | 2917741383 | 266 |
| 128 | iso_pu_bacteria | 2946064051 | 2946066619 | 266 |
| 129 | iso_pu_bacteria | 2947224130 | 2947230574 | 266 |
| 130 | iso_pu_bacteria | 2954380949 | 2954387428 | 266 |
| 131 | iso_pu_bacteria | 2954673503 | 2954675743 | 266 |
| 132 | iso_pu_bacteria | 2954682443 | 2954688521 | 266 |
| 133 | iso_pu_bacteria | 2954691527 | 2954698262 | 266 |
| 134 | iso_pu_bacteria | 2954701450 | 2954703966 | 266 |
| 135 | iso_pu_bacteria | 2954711539 | 2954717283 | 266 |
| 136 | iso_pu_bacteria | 2954721474 | 2954727251 | 266 |
| 137 | iso_pu_bacteria | 2954731030 | 2954734541 | 266 |
| 138 | iso_pu_bacteria | 2954740390 | 2954746157 | 266 |
| 139 | iso_pu_bacteria | 2954749733 | 2954753438 | 266 |
| 140 | iso_pu_bacteria | 2954759201 | 2954765124 | 266 |
| 141 | iso_pu_bacteria | 2990044586 | 2990047748 | 266 |
| 142 | iso_pu_bacteria | 3006321560 | 3006322011 | 266 |
| 143 | iso_pu_bacteria | 3006493962 | 3006501942 | 266 |
| 144 | iso_pu_bacteria | 8003314358 | 8003323956 | 266 |
| 145 | iso_pu_bacteria | 8025478263 | 8025480032 | 266 |
| 146 | iso_pu_bacteria | 8025530807 | 8025531163 | 266 |
| 147 | 3300048908 | Ga0496105_0071906 | Ga0496105_0071906_1111_1914 | 267 |
| 148 | 3300048912 | Ga0496109_0013710 | Ga0496109_0013710_3062_3865 | 267 |
| 149 | 3300048914 | Ga0496111_0016904 | Ga0496111_0016904_3335_4138 | 267 |
| 150 | 3300048915 | Ga0496112_0036501 | Ga0496112_0036501_3898_4701 | 267 |
| 151 | iso_pu_bacteria | 2585427649 | 2586062360 | 267 |
| 152 | iso_pu_bacteria | 2643221548 | 2643759579 | 267 |
| 153 | iso_pu_bacteria | 2643221682 | 2644463005 | 267 |
| 154 | iso_pu_bacteria | 2751185734 | 2753069153 | 267 |
| 155 | iso_pu_bacteria | 2808606448 | 2809231221 | 267 |
| 156 | iso_pu_bacteria | 2808606522 | 2809588467 | 267 |
| 157 | iso_pu_bacteria | 2818991463 | 2819693839 | 267 |
| 158 | iso_pu_bacteria | 2862178590 | 2862182675 | 267 |
| 159 | iso_pu_bacteria | 2867475112 | 2867479616 | 267 |
| 160 | iso_pu_bacteria | 2870721527 | 2870728387 | 267 |
| 161 | iso_pu_bacteria | 2912715099 | 2912721195 | 267 |
| 162 | iso_pu_bacteria | 2915768154 | 2915770385 | 267 |
| 163 | iso_pu_bacteria | 2966598605 | 2966603470 | 267 |
| 164 | iso_pu_bacteria | 2990088156 | 2990089238 | 267 |
| 165 | iso_pu_bacteria | 8033684223 | 8033686189 | 267 |
| 166 | iso_pu_bacteria | 8056667051 | 8056673404 | 267 |
| 167 | 3300003316 | rootH1_10033851 | rootH1_100338512 | 268 |
| 168 | 3300003323 | rootH1_10007618 | rootH1_100076184 | 268 |
| 169 | 3300006048 | Ga0075363_100295787 | Ga0075363_1002957871 | 268 |
| 170 | 3300006353 | Ga0075370_10090635 | Ga0075370_100906352 | 268 |
| 171 | 3300024225 | Ga0224572_1022509 | Ga0224572_10225091 | 268 |
| 172 | 3300027312 | Ga0209371_1012600 | Ga0209371_10126002 | 268 |
| 173 | 3300028786 | Ga0307517_10001523 | Ga0307517_1000152320 | 268 |
| 174 | 3300028794 | Ga0307515_10000262 | Ga0307515_10000262118 | 268 |
| 175 | 3300030500 | Ga0268256_1013761 | Ga0268256_10137613 | 268 |
| 176 | 3300030522 | Ga0307512_10021656 | Ga0307512_100216562 | 268 |
| 177 | 3300031507 | Ga0307509_10022428 | Ga0307509_100224287 | 268 |
| 178 | 3300031616 | Ga0307508_10024355 | Ga0307508_100243554 | 268 |
| 179 | 3300031616 | Ga0307508_10097627 | Ga0307508_100976273 | 268 |
| 180 | 3300031649 | Ga0307514_10004230 | Ga0307514_100042302 | 268 |
| 181 | 3300031649 | Ga0307514_10083805 | Ga0307514_100838054 | 268 |
| 182 | 3300031730 | Ga0307516_10007840 | Ga0307516_1000784010 | 268 |
| 183 | 3300031838 | Ga0307518_10012292 | Ga0307518_100122926 | 268 |
| 184 | 3300032126 | Ga0307415_100036094 | Ga0307415_1000360941 | 268 |
| 185 | 3300033179 | Ga0307507_10050253 | Ga0307507_100502534 | 268 |
| 186 | 3300033180 | Ga0307510_10035955 | Ga0307510_100359555 | 268 |
| 187 | 3300039453 | Ga0436362_1127991 | Ga0436362_1127991_140_955 | 268 |
| 188 | 3300041404 | Ga0439436_0001293 | Ga0439436_0001293_5257_6072 | 268 |
| 189 | 3300041999 | Ga0439433_0017868 | Ga0439433_0017868_602_1417 | 268 |
| 190 | 3300042007 | Ga0439449_0089172 | Ga0439449_0089172_257_1072 | 268 |
| 191 | 3300042012 | Ga0439455_0014033 | Ga0439455_0014033_696_1511 | 268 |
| 192 | 3300042014 | Ga0439457_000381 | Ga0439457_000381_1079_1894 | 268 |
| 193 | 3300042138 | Ga0450903_000036 | Ga0450903_000036_7044_7859 | 268 |
| 194 | 3300042157 | Ga0439458_0004847 | Ga0439458_0004847_2048_2863 | 268 |
| 195 | 3300045976 | Ga0466967_0092774 | Ga0466967_0092774_885_1700 | 268 |
| 196 | 3300046455 | Ga0495603_0041056 | Ga0495603_0041056_1001_1810 | 268 |
| 197 | 3300046459 | Ga0495629_0006991 | Ga0495629_0006991_3188_4003 | 268 |
| 198 | 3300046460 | Ga0495638_0018353 | Ga0495638_0018353_2008_2817 | 268 |
| 199 | 3300046492 | Ga0495585_0041242 | Ga0495585_0041242_686_1495 | 268 |
| 200 | 3300046499 | Ga0495594_0022825 | Ga0495594_0022825_1815_2630 | 268 |
| 201 | 3300046499 | Ga0495594_0026897 | Ga0495594_0026897_1397_2206 | 268 |
| 202 | 3300046501 | Ga0495607_0072554 | Ga0495607_0072554_13_822 | 268 |
| 203 | 3300046616 | Ga0495668_0055969 | Ga0495668_0055969_490_1299 | 268 |
| 204 | 3300046660 | Ga0495625_0007730 | Ga0495625_0007730_2735_3550 | 268 |
| 205 | 3300046660 | Ga0495625_0324724 | Ga0495625_0324724_17_832 | 268 |
| 206 | 3300046674 | Ga0495588_0007253 | Ga0495588_0007253_3188_4003 | 268 |
| 207 | 3300046692 | Ga0495671_0004121 | Ga0495671_0004121_143_958 | 268 |
| 208 | 3300046794 | Ga0495589_0008402 | Ga0495589_0008402_2066_2875 | 268 |
| 209 | 3300047315 | Ga0495581_0048903 | Ga0495581_0048903_622_1431 | 268 |
| 210 | 3300047323 | Ga0495683_0065278 | Ga0495683_0065278_238_1047 | 268 |
| 211 | 3300047447 | Ga0495685_027732 | Ga0495685_027732_29_844 | 268 |
| 212 | 3300047470 | Ga0495681_0004558 | Ga0495681_0004558_4558_5373 | 268 |
| 213 | 3300048089 | Ga0495614_0004622 | Ga0495614_0004622_3458_4273 | 268 |
| 214 | 3300048089 | Ga0495614_0062271 | Ga0495614_0062271_30_839 | 268 |
| 215 | 3300049571 | Ga0501034_0051993 | Ga0501034_0051993_2287_3102 | 268 |
| 216 | 3300049580 | Ga0501046_0094212 | Ga0501046_0094212_71_886 | 268 |
| 217 | 3300049823 | Ga0501044_0021565 | Ga0501044_0021565_2166_2981 | 268 |
| 218 | 3300050490 | nmdc:mga03n38_102260_c1 | nmdc:mga03n38_102260_c1_103_918 | 268 |
| 219 | 3300053083 | Ga0495655_0012498 | Ga0495655_0012498_324_1139 | 268 |
| 220 | 3300053107 | Ga0500560_000466 | Ga0500560_000466_777_1592 | 268 |
| 221 | iso_pu_bacteria | 2547132111 | 2547407798 | 268 |
| 222 | iso_pu_bacteria | 2616644814 | 2616694633 | 268 |
| 223 | iso_pu_bacteria | 2643221678 | 2644436103 | 268 |
| 224 | iso_pu_bacteria | 2808606359 | 2808840929 | 268 |
| 225 | iso_pu_bacteria | 2811994917 | 2812481435 | 268 |
| 226 | iso_pu_bacteria | 2862507626 | 2862513984 | 268 |
| 227 | iso_pu_bacteria | 2946072368 | 2946074891 | 268 |
| 228 | iso_pu_bacteria | 2954002825 | 2954003989 | 268 |
| 229 | iso_pu_bacteria | 2990059506 | 2990066715 | 268 |
| 230 | iso_pu_bacteria | 3006393351 | 3006397302 | 268 |
| 231 | iso_pu_bacteria | 8008574985 | 8008579814 | 268 |
| 232 | iso_pu_bacteria | 8023623736 | 8023630420 | 268 |
| 233 | iso_pu_bacteria | 8048406513 | 8048407977 | 268 |
| 234 | 3300005327 | Ga0070658_10065148 | Ga0070658_100651482 | 269 |
| 235 | 3300005328 | Ga0070676_10056316 | Ga0070676_100563162 | 269 |
| 236 | 3300005329 | Ga0070683_100088869 | Ga0070683_1000888692 | 269 |
| 237 | 3300005330 | Ga0070690_100095578 | Ga0070690_1000955782 | 269 |
| 238 | 3300005334 | Ga0068869_100056050 | Ga0068869_1000560502 | 269 |
| 239 | 3300005335 | Ga0070666_10082505 | Ga0070666_100825052 | 269 |
| 240 | 3300005337 | Ga0070682_100149627 | Ga0070682_1001496272 | 269 |
| 241 | 3300005338 | Ga0068868_100114618 | Ga0068868_1001146182 | 269 |
| 242 | 3300005339 | Ga0070660_100114617 | Ga0070660_1001146171 | 269 |
| 243 | 3300005340 | Ga0070689_100098080 | Ga0070689_1000980801 | 269 |
| 244 | 3300005341 | Ga0070691_10034133 | Ga0070691_100341332 | 269 |
| 245 | 3300005343 | Ga0070687_100064508 | Ga0070687_1000645082 | 269 |
| 246 | 3300005344 | Ga0070661_100088132 | Ga0070661_1000881322 | 269 |
| 247 | 3300005354 | Ga0070675_100023116 | Ga0070675_1000231162 | 269 |
| 248 | 3300005364 | Ga0070673_100014484 | Ga0070673_1000144842 | 269 |
| 249 | 3300005366 | Ga0070659_100037404 | Ga0070659_1000374042 | 269 |
| 250 | 3300005367 | Ga0070667_100035601 | Ga0070667_1000356012 | 269 |
| 251 | 3300005406 | Ga0070703_10037765 | Ga0070703_100377652 | 269 |
| 252 | 3300005435 | Ga0070714_100060167 | Ga0070714_1000601672 | 269 |
| 253 | 3300005438 | Ga0070701_10040702 | Ga0070701_100407022 | 269 |
| 254 | 3300005441 | Ga0070700_100072979 | Ga0070700_1000729792 | 269 |
| 255 | 3300005455 | Ga0070663_100028008 | Ga0070663_1000280082 | 269 |
| 256 | 3300005456 | Ga0070678_100187397 | Ga0070678_1001873971 | 269 |
| 257 | 3300005457 | Ga0070662_100413515 | Ga0070662_1004135151 | 269 |
| 258 | 3300005458 | Ga0070681_10142039 | Ga0070681_101420392 | 269 |
| 259 | 3300005459 | Ga0068867_100131119 | Ga0068867_1001311192 | 269 |
| 260 | 3300005466 | Ga0070685_10023279 | Ga0070685_100232795 | 269 |
| 261 | 3300005467 | Ga0070706_100229854 | Ga0070706_1002298542 | 269 |
| 262 | 3300005471 | Ga0070698_100167332 | Ga0070698_1001673322 | 269 |
| 263 | 3300005471 | Ga0070698_100493464 | Ga0070698_1004934642 | 269 |
| 264 | 3300005530 | Ga0070679_100062937 | Ga0070679_1000629372 | 269 |
| 265 | 3300005539 | Ga0068853_100138644 | Ga0068853_1001386442 | 269 |
| 266 | 3300005543 | Ga0070672_100063933 | Ga0070672_1000639332 | 269 |
| 267 | 3300005544 | Ga0070686_100127980 | Ga0070686_1001279802 | 269 |
| 268 | 3300005545 | Ga0070695_100092461 | Ga0070695_1000924612 | 269 |
| 269 | 3300005546 | Ga0070696_100084313 | Ga0070696_1000843132 | 269 |
| 270 | 3300005547 | Ga0070693_100140106 | Ga0070693_1001401062 | 269 |
| 271 | 3300005548 | Ga0070665_100269768 | Ga0070665_1002697682 | 269 |
| 272 | 3300005549 | Ga0070704_100091132 | Ga0070704_1000911322 | 269 |
| 273 | 3300005563 | Ga0068855_100108036 | Ga0068855_1001080362 | 269 |
| 274 | 3300005577 | Ga0068857_100022331 | Ga0068857_1000223312 | 269 |
| 275 | 3300005578 | Ga0068854_100019373 | Ga0068854_1000193732 | 269 |
| 276 | 3300005615 | Ga0070702_100014334 | Ga0070702_1000143342 | 269 |
| 277 | 3300005618 | Ga0068864_100053513 | Ga0068864_1000535132 | 269 |
| 278 | 3300005834 | Ga0068851_10085036 | Ga0068851_100850362 | 269 |
| 279 | 3300005841 | Ga0068863_100108884 | Ga0068863_1001088842 | 269 |
| 280 | 3300005841 | Ga0068863_100254038 | Ga0068863_1002540382 | 269 |
| 281 | 3300005937 | Ga0081455_10175698 | Ga0081455_101756982 | 269 |
| 282 | 3300006163 | Ga0070715_10006317 | Ga0070715_100063172 | 269 |
| 283 | 3300006173 | Ga0070716_100140692 | Ga0070716_1001406922 | 269 |
| 284 | 3300006178 | Ga0075367_10000748 | Ga0075367_100007481 | 269 |
| 285 | 3300006237 | Ga0097621_100303199 | Ga0097621_1003031991 | 269 |
| 286 | 3300006358 | Ga0068871_100038895 | Ga0068871_1000388952 | 269 |
| 287 | 3300006871 | Ga0075434_100506644 | Ga0075434_1005066442 | 269 |
| 288 | 3300006914 | Ga0075436_100204877 | Ga0075436_1002048772 | 269 |
| 289 | 3300007076 | Ga0075435_100171091 | Ga0075435_1001710911 | 269 |
| 290 | 3300009011 | Ga0105251_10044368 | Ga0105251_100443682 | 269 |
| 291 | 3300009093 | Ga0105240_10072016 | Ga0105240_100720162 | 269 |
| 292 | 3300009098 | Ga0105245_10612080 | Ga0105245_106120802 | 269 |
| 293 | 3300009148 | Ga0105243_10058847 | Ga0105243_100588472 | 269 |
| 294 | 3300009174 | Ga0105241_10324144 | Ga0105241_103241442 | 269 |
| 295 | 3300009176 | Ga0105242_10013381 | Ga0105242_100133815 | 269 |
| 296 | 3300009177 | Ga0105248_10390632 | Ga0105248_103906322 | 269 |
| 297 | 3300009551 | Ga0105238_10113718 | Ga0105238_101137182 | 269 |
| 298 | 3300009553 | Ga0105249_10069767 | Ga0105249_100697672 | 269 |
| 299 | 3300010375 | Ga0105239_10187638 | Ga0105239_101876382 | 269 |
| 300 | 3300013100 | Ga0157373_10083034 | Ga0157373_100830342 | 269 |
| 301 | 3300013102 | Ga0157371_10028027 | Ga0157371_100280275 | 269 |
| 302 | 3300013104 | Ga0157370_10084492 | Ga0157370_100844922 | 269 |
| 303 | 3300014497 | Ga0182008_10001369 | Ga0182008_100013698 | 269 |
| 304 | 3300014745 | Ga0157377_10040504 | Ga0157377_100405044 | 269 |
| 305 | 3300015262 | Ga0182007_10000387 | Ga0182007_1000038710 | 269 |
| 306 | 3300015265 | Ga0182005_1034250 | Ga0182005_10342502 | 269 |
| 307 | 3300015688 | Ga0183367_1009 | Ga0183367_1009183 | 269 |
| 308 | 3300017792 | Ga0163161_10041092 | Ga0163161_100410924 | 269 |
| 309 | 3300020070 | Ga0206356_11555668 | Ga0206356_115556682 | 269 |
| 310 | 3300020081 | Ga0206354_10656253 | Ga0206354_106562532 | 269 |
| 311 | 3300025885 | Ga0207653_10004753 | Ga0207653_100047535 | 269 |
| 312 | 3300025898 | Ga0207692_10039640 | Ga0207692_100396402 | 269 |
| 313 | 3300025899 | Ga0207642_10046615 | Ga0207642_100466152 | 269 |
| 314 | 3300025900 | Ga0207710_10055556 | Ga0207710_100555562 | 269 |
| 315 | 3300025906 | Ga0207699_10034060 | Ga0207699_100340604 | 269 |
| 316 | 3300025906 | Ga0207699_10064108 | Ga0207699_100641082 | 269 |
| 317 | 3300025907 | Ga0207645_10124439 | Ga0207645_101244392 | 269 |
| 318 | 3300025912 | Ga0207707_10070296 | Ga0207707_100702962 | 269 |
| 319 | 3300025913 | Ga0207695_10327826 | Ga0207695_103278262 | 269 |
| 320 | 3300025915 | Ga0207693_10035223 | Ga0207693_100352232 | 269 |
| 321 | 3300025915 | Ga0207693_10092258 | Ga0207693_100922582 | 269 |
| 322 | 3300025916 | Ga0207663_10288709 | Ga0207663_102887092 | 269 |
| 323 | 3300025918 | Ga0207662_10008318 | Ga0207662_100083184 | 269 |
| 324 | 3300025919 | Ga0207657_10003385 | Ga0207657_100033856 | 269 |
| 325 | 3300025920 | Ga0207649_10069790 | Ga0207649_100697902 | 269 |
| 326 | 3300025928 | Ga0207700_10019441 | Ga0207700_100194413 | 269 |
| 327 | 3300025928 | Ga0207700_10312693 | Ga0207700_103126932 | 269 |
| 328 | 3300025931 | Ga0207644_10170712 | Ga0207644_101707122 | 269 |
| 329 | 3300025933 | Ga0207706_10160044 | Ga0207706_101600442 | 269 |
| 330 | 3300025936 | Ga0207670_10039639 | Ga0207670_100396392 | 269 |
| 331 | 3300025937 | Ga0207669_10239551 | Ga0207669_102395512 | 269 |
| 332 | 3300025939 | Ga0207665_10014313 | Ga0207665_100143136 | 269 |
| 333 | 3300025939 | Ga0207665_10016902 | Ga0207665_100169022 | 269 |
| 334 | 3300025940 | Ga0207691_10015953 | Ga0207691_100159532 | 269 |
| 335 | 3300025942 | Ga0207689_10005067 | Ga0207689_100050672 | 269 |
| 336 | 3300025960 | Ga0207651_10324974 | Ga0207651_103249741 | 269 |
| 337 | 3300026023 | Ga0207677_10086010 | Ga0207677_100860103 | 269 |
| 338 | 3300026067 | Ga0207678_10035214 | Ga0207678_100352145 | 269 |
| 339 | 3300026075 | Ga0207708_10027234 | Ga0207708_100272342 | 269 |
| 340 | 3300026078 | Ga0207702_10094441 | Ga0207702_100944412 | 269 |
| 341 | 3300026089 | Ga0207648_10162153 | Ga0207648_101621532 | 269 |
| 342 | 3300026095 | Ga0207676_10202388 | Ga0207676_102023882 | 269 |
| 343 | 3300026116 | Ga0207674_10010179 | Ga0207674_1001017910 | 269 |
| 344 | 3300026118 | Ga0207675_100014809 | Ga0207675_1000148092 | 269 |
| 345 | 3300026121 | Ga0207683_10186521 | Ga0207683_101865212 | 269 |
| 346 | 3300026142 | Ga0207698_10207423 | Ga0207698_102074232 | 269 |
| 347 | 3300028381 | Ga0268264_10220857 | Ga0268264_102208572 | 269 |
| 348 | 3300031456 | Ga0307513_10101479 | Ga0307513_101014793 | 269 |
| 349 | 3300034816 | Ga0373930_0004186 | Ga0373930_0004186_830_1642 | 269 |
| 350 | 3300035089 | Ga0373944_0005705 | Ga0373944_0005705_849_1661 | 269 |
| 351 | 3300035091 | Ga0373951_0013166 | Ga0373951_0013166_512_1324 | 269 |
| 352 | 3300035092 | Ga0373952_0009709 | Ga0373952_0009709_960_1772 | 269 |
| 353 | 3300035111 | Ga0373923_0011003 | Ga0373923_0011003_813_1625 | 269 |
| 354 | 3300035112 | Ga0373932_0018425 | Ga0373932_0018425_301_1113 | 269 |
| 355 | 3300035113 | Ga0373936_0016608 | Ga0373936_0016608_829_1641 | 269 |
| 356 | 3300035114 | Ga0373939_0057105 | Ga0373939_0057105_22_834 | 269 |
| 357 | 3300035116 | Ga0373945_0001360 | Ga0373945_0001360_1891_2703 | 269 |
| 358 | 3300035117 | Ga0373953_0008491 | Ga0373953_0008491_2207_3019 | 269 |
| 359 | 3300035171 | Ga0373946_0003357 | Ga0373946_0003357_2893_3705 | 269 |
| 360 | 3300035172 | Ga0373955_0103351 | Ga0373955_0103351_425_1237 | 269 |
| 361 | 3300035241 | Ga0373961_0025039 | Ga0373961_0025039_371_1183 | 269 |
| 362 | 3300035410 | Ga0373924_0004348 | Ga0373924_0004348_3356_4168 | 269 |
| 363 | 3300035691 | Ga0373931_0058770 | Ga0373931_0058770_563_1375 | 269 |
| 364 | 3300035695 | Ga0373927_0033574 | Ga0373927_0033574_1700_2512 | 269 |
| 365 | 3300035724 | Ga0373933_0012826 | Ga0373933_0012826_1997_2809 | 269 |
| 366 | 3300035724 | Ga0373933_0117879 | Ga0373933_0117879_798_1610 | 269 |
| 367 | 3300037853 | Ga0436364_0517842 | Ga0436364_0517842_4654_5472 | 269 |
| 368 | 3300039437 | Ga0436365_1677319 | Ga0436365_1677319_22_834 | 269 |
| 369 | 3300045976 | Ga0466967_0012779 | Ga0466967_0012779_1146_1958 | 269 |
| 370 | 3300045976 | Ga0466967_0252530 | Ga0466967_0252530_118_930 | 269 |
| 371 | 3300045976 | Ga0466967_0419386 | Ga0466967_0419386_469_1287 | 269 |
| 372 | 3300046459 | Ga0495629_0009757 | Ga0495629_0009757_1320_2132 | 269 |
| 373 | 3300046462 | Ga0495651_0068437 | Ga0495651_0068437_161_973 | 269 |
| 374 | 3300046463 | Ga0495653_0029215 | Ga0495653_0029215_3502_4314 | 269 |
| 375 | 3300046475 | Ga0495639_0008710 | Ga0495639_0008710_2892_3704 | 269 |
| 376 | 3300046476 | Ga0495662_0001859 | Ga0495662_0001859_7725_8537 | 269 |
| 377 | 3300046477 | Ga0495664_0057721 | Ga0495664_0057721_615_1427 | 269 |
| 378 | 3300046477 | Ga0495664_0062536 | Ga0495664_0062536_830_1642 | 269 |
| 379 | 3300046514 | Ga0495618_0019675 | Ga0495618_0019675_984_1796 | 269 |
| 380 | 3300046514 | Ga0495618_0087109 | Ga0495618_0087109_755_1567 | 269 |
| 381 | 3300046517 | Ga0495630_0109868 | Ga0495630_0109868_829_1641 | 269 |
| 382 | 3300046531 | Ga0495665_0000881 | Ga0495665_0000881_2786_3598 | 269 |
| 383 | 3300046533 | Ga0495640_0138852 | Ga0495640_0138852_253_1065 | 269 |
| 384 | 3300046543 | Ga0495645_0017893 | Ga0495645_0017893_1628_2440 | 269 |
| 385 | 3300046642 | Ga0495634_0169106 | Ga0495634_0169106_503_1315 | 269 |
| 386 | 3300046679 | Ga0495623_0008756 | Ga0495623_0008756_298_1110 | 269 |
| 387 | 3300046680 | Ga0495646_0080930 | Ga0495646_0080930_829_1641 | 269 |
| 388 | 3300046690 | Ga0495624_0032904 | Ga0495624_0032904_1719_2531 | 269 |
| 389 | 3300047315 | Ga0495581_0005923 | Ga0495581_0005923_402_1214 | 269 |
| 390 | 3300047315 | Ga0495581_0034431 | Ga0495581_0034431_1814_2626 | 269 |
| 391 | 3300047317 | Ga0495604_0070900 | Ga0495604_0070900_1320_2132 | 269 |
| 392 | 3300047322 | Ga0495680_0015042 | Ga0495680_0015042_1866_2678 | 269 |
| 393 | 3300047444 | Ga0495675_0077824 | Ga0495675_0077824_485_1297 | 269 |
| 394 | 3300047471 | Ga0495684_0016370 | Ga0495684_0016370_3214_4026 | 269 |
| 395 | 3300048089 | Ga0495614_0049198 | Ga0495614_0049198_193_1005 | 269 |
| 396 | 3300048904 | Ga0496101_0147959 | Ga0496101_0147959_295_1107 | 269 |
| 397 | 3300048905 | Ga0496102_0136274 | Ga0496102_0136274_966_1778 | 269 |
| 398 | 3300048906 | Ga0496103_0078199 | Ga0496103_0078199_548_1360 | 269 |
| 399 | 3300048908 | Ga0496105_0100421 | Ga0496105_0100421_682_1494 | 269 |
| 400 | 3300048910 | Ga0496107_0020468 | Ga0496107_0020468_319_1131 | 269 |
| 401 | 3300048912 | Ga0496109_0281083 | Ga0496109_0281083_208_1020 | 269 |
| 402 | 3300048913 | Ga0496110_0042530 | Ga0496110_0042530_1072_1884 | 269 |
| 403 | 3300048916 | Ga0496113_0106327 | Ga0496113_0106327_273_1085 | 269 |
| 404 | 3300048917 | Ga0496114_0170668 | Ga0496114_0170668_688_1500 | 269 |
| 405 | 3300048918 | Ga0496115_0123144 | Ga0496115_0123144_787_1599 | 269 |
| 406 | 3300049574 | Ga0501038_0016541 | Ga0501038_0016541_3090_3908 | 269 |
| 407 | 3300049579 | Ga0501043_0082017 | Ga0501043_0082017_535_1353 | 269 |
| 408 | 3300049581 | Ga0501047_0161347 | Ga0501047_0161347_19_837 | 269 |
| 409 | 3300049586 | Ga0501070_0149850 | Ga0501070_0149850_727_1545 | 269 |
| 410 | 3300049822 | Ga0501035_0036288 | Ga0501035_0036288_1146_1964 | 269 |
| 411 | 3300049823 | Ga0501044_0006702 | Ga0501044_0006702_10007_10825 | 269 |
| 412 | 3300049823 | Ga0501044_0089490 | Ga0501044_0089490_1525_2343 | 269 |
| 413 | 3300049823 | Ga0501044_0097855 | Ga0501044_0097855_1113_1931 | 269 |
| 414 | 3300050494 | nmdc:mga06z11_14231_c1 | nmdc:mga06z11_14231_c1_2520_3338 | 269 |
| 415 | 3300050513 | nmdc:mga0rr50_221664_c2 | nmdc:mga0rr50_221664_c2_306_1118 | 269 |
| 416 | 3300050514 | nmdc:mga08x19_172417_c1 | nmdc:mga08x19_172417_c1_644_1456 | 269 |
| 417 | 3300050514 | nmdc:mga08x19_407920_c1 | nmdc:mga08x19_407920_c1_43_855 | 269 |
| 418 | 3300053077 | Ga0495601_0181391 | Ga0495601_0181391_59_871 | 269 |
| 419 | 3300053078 | Ga0495612_0004919 | Ga0495612_0004919_2643_3455 | 269 |
| 420 | 3300053084 | Ga0495595_0028454 | Ga0495595_0028454_1077_1889 | 269 |
| 421 | iso_pu_bacteria | 2643221587 | 2643944875 | 269 |
| 422 | iso_pu_bacteria | 2643221677 | 2644431774 | 269 |
| 423 | iso_pu_bacteria | 2784132148 | 2784587655 | 269 |
| 424 | iso_pu_bacteria | 2811994879 | 2812359265 | 269 |
| 425 | iso_pu_bacteria | 2818991472 | 2819743024 | 269 |
| 426 | iso_pu_bacteria | 2862382967 | 2862387472 | 269 |
| 427 | iso_pu_bacteria | 2863404153 | 2863405882 | 269 |
| 428 | iso_pu_bacteria | 2912723979 | 2912725220 | 269 |
| 429 | iso_pu_bacteria | 2912757875 | 2912759773 | 269 |
| 430 | iso_pu_bacteria | 2919468124 | 2919468415 | 269 |
| 431 | iso_pu_bacteria | 8008558824 | 8008559240 | 269 |
| 432 | iso_pu_bacteria | 8056829672 | 8056836717 | 269 |
| 433 | 3300003322 | rootL2_10031424 | rootL2_100314241 | 270 |
| 434 | 3300003578 | Ga0006562J51391_1052003 | Ga0006562J51391_10520034 | 270 |
| 435 | 3300003578 | Ga0006562J51391_1052005 | Ga0006562J51391_10520052 | 270 |
| 436 | 3300003578 | Ga0006562J51391_1098872 | Ga0006562J51391_10988722 | 270 |
| 437 | 3300005347 | Ga0070668_100373774 | Ga0070668_1003737742 | 270 |
| 438 | 3300005456 | Ga0070678_100704122 | Ga0070678_1007041221 | 270 |
| 439 | 3300005577 | Ga0068857_100440695 | Ga0068857_1004406952 | 270 |
| 440 | 3300009098 | Ga0105245_10362887 | Ga0105245_103628872 | 270 |
| 441 | 3300011119 | Ga0105246_10228948 | Ga0105246_102289482 | 270 |
| 442 | 3300013105 | Ga0157369_10147148 | Ga0157369_101471482 | 270 |
| 443 | 3300025297 | Ga0209758_1004639 | Ga0209758_10046397 | 270 |
| 444 | 3300025302 | Ga0207426_1013368 | Ga0207426_10133685 | 270 |
| 445 | 3300025904 | Ga0207647_10246791 | Ga0207647_102467912 | 270 |
| 446 | 3300025928 | Ga0207700_10194581 | Ga0207700_101945811 | 270 |
| 447 | 3300025972 | Ga0207668_10016610 | Ga0207668_100166106 | 270 |
| 448 | 3300026041 | Ga0207639_10020409 | Ga0207639_100204093 | 270 |
| 449 | 3300026067 | Ga0207678_10000171 | Ga0207678_100001719 | 270 |
| 450 | 3300026121 | Ga0207683_10307765 | Ga0207683_103077652 | 270 |
| 451 | 3300028794 | Ga0307515_10170563 | Ga0307515_101705632 | 270 |
| 452 | 3300030521 | Ga0307511_10039103 | Ga0307511_100391034 | 270 |
| 453 | 3300030521 | Ga0307511_10072373 | Ga0307511_100723732 | 270 |
| 454 | 3300030522 | Ga0307512_10003287 | Ga0307512_1000328710 | 270 |
| 455 | 3300030522 | Ga0307512_10098573 | Ga0307512_100985733 | 270 |
| 456 | 3300031507 | Ga0307509_10038476 | Ga0307509_100384763 | 270 |
| 457 | 3300031616 | Ga0307508_10011423 | Ga0307508_100114231 | 270 |
| 458 | 3300031616 | Ga0307508_10385336 | Ga0307508_103853361 | 270 |
| 459 | 3300033180 | Ga0307510_10104532 | Ga0307510_101045323 | 270 |
| 460 | 3300033180 | Ga0307510_10259218 | Ga0307510_102592182 | 270 |
| 461 | 3300037466 | Ga0395898_0004836 | Ga0395898_0004836_6290_7120 | 270 |
| 462 | 3300037466 | Ga0395898_0005281 | Ga0395898_0005281_170_991 | 270 |
| 463 | 3300037466 | Ga0395898_0525145 | Ga0395898_0525145_139_960 | 270 |
| 464 | 3300037471 | Ga0395905_0040820 | Ga0395905_0040820_1662_2492 | 270 |
| 465 | 3300037853 | Ga0436364_0208258 | Ga0436364_0208258_500_1324 | 270 |
| 466 | 3300041406 | Ga0439439_0001590 | Ga0439439_0001590_1348_2169 | 270 |
| 467 | 3300041999 | Ga0439433_0006462 | Ga0439433_0006462_369_1190 | 270 |
| 468 | 3300042006 | Ga0439432_034153 | Ga0439432_034153_318_1139 | 270 |
| 469 | 3300042014 | Ga0439457_003517 | Ga0439457_003517_1043_1864 | 270 |
| 470 | 3300042014 | Ga0439457_005534 | Ga0439457_005534_1192_2013 | 270 |
| 471 | 3300042131 | Ga0450894_002527 | Ga0450894_002527_965_1786 | 270 |
| 472 | 3300042134 | Ga0450898_000804 | Ga0450898_000804_2823_3644 | 270 |
| 473 | 3300042135 | Ga0450899_000387 | Ga0450899_000387_434_1255 | 270 |
| 474 | 3300042145 | Ga0450906_000131 | Ga0450906_000131_11927_12748 | 270 |
| 475 | 3300044658 | Ga0466972_0014843 | Ga0466972_0014843_175_996 | 270 |
| 476 | 3300044658 | Ga0466972_0035207 | Ga0466972_0035207_636_1475 | 270 |
| 477 | 3300044658 | Ga0466972_0035479 | Ga0466972_0035479_1254_2069 | 270 |
| 478 | 3300044684 | Ga0466966_0006730 | Ga0466966_0006730_3649_4470 | 270 |
| 479 | 3300044693 | Ga0466961_0017828 | Ga0466961_0017828_2308_3147 | 270 |
| 480 | 3300044693 | Ga0466961_0194769 | Ga0466961_0194769_39_860 | 270 |
| 481 | 3300044694 | Ga0466963_0000196 | Ga0466963_0000196_10730_11563 | 270 |
| 482 | 3300044719 | Ga0466971_0035566 | Ga0466971_0035566_1319_2140 | 270 |
| 483 | 3300044765 | Ga0466970_0003680 | Ga0466970_0003680_5182_6003 | 270 |
| 484 | 3300044842 | Ga0466957_0020111 | Ga0466957_0020111_689_1510 | 270 |
| 485 | 3300044901 | Ga0466960_0029308 | Ga0466960_0029308_1184_2023 | 270 |
| 486 | 3300044901 | Ga0466960_0116373 | Ga0466960_0116373_471_1292 | 270 |
| 487 | 3300044901 | Ga0466960_0274319 | Ga0466960_0274319_88_903 | 270 |
| 488 | 3300045976 | Ga0466967_0050586 | Ga0466967_0050586_156_977 | 270 |
| 489 | 3300045976 | Ga0466967_0359330 | Ga0466967_0359330_549_1370 | 270 |
| 490 | 3300046452 | Ga0495617_027607 | Ga0495617_027607_189_1013 | 270 |
| 491 | 3300046455 | Ga0495603_0003796 | Ga0495603_0003796_2259_3080 | 270 |
| 492 | 3300046455 | Ga0495603_0028037 | Ga0495603_0028037_1731_2552 | 270 |
| 493 | 3300046459 | Ga0495629_0041423 | Ga0495629_0041423_2081_2905 | 270 |
| 494 | 3300046459 | Ga0495629_0044450 | Ga0495629_0044450_2226_3047 | 270 |
| 495 | 3300046461 | Ga0495641_0080463 | Ga0495641_0080463_544_1368 | 270 |
| 496 | 3300046474 | Ga0495605_0017534 | Ga0495605_0017534_1284_2108 | 270 |
| 497 | 3300046476 | Ga0495662_0010695 | Ga0495662_0010695_1458_2279 | 270 |
| 498 | 3300046476 | Ga0495662_0021273 | Ga0495662_0021273_818_1639 | 270 |
| 499 | 3300046476 | Ga0495662_0027853 | Ga0495662_0027853_1799_2620 | 270 |
| 500 | 3300046499 | Ga0495594_0008294 | Ga0495594_0008294_2724_3545 | 270 |
| 501 | 3300046506 | Ga0495583_0067536 | Ga0495583_0067536_205_1026 | 270 |
| 502 | 3300046507 | Ga0495606_0023291 | Ga0495606_0023291_285_1109 | 270 |
| 503 | 3300046511 | Ga0495608_0096471 | Ga0495608_0096471_114_938 | 270 |
| 504 | 3300046513 | Ga0495616_0031733 | Ga0495616_0031733_1762_2586 | 270 |
| 505 | 3300046514 | Ga0495618_0112689 | Ga0495618_0112689_452_1276 | 270 |
| 506 | 3300046515 | Ga0495620_0004961 | Ga0495620_0004961_2992_3816 | 270 |
| 507 | 3300046515 | Ga0495620_0010780 | Ga0495620_0010780_2904_3728 | 270 |
| 508 | 3300046516 | Ga0495628_0030094 | Ga0495628_0030094_1525_2349 | 270 |
| 509 | 3300046518 | Ga0495631_0030629 | Ga0495631_0030629_1301_2125 | 270 |
| 510 | 3300046522 | Ga0495643_0002819 | Ga0495643_0002819_7636_8460 | 270 |
| 511 | 3300046526 | Ga0495666_0178764 | Ga0495666_0178764_120_944 | 270 |
| 512 | 3300046529 | Ga0495652_0051890 | Ga0495652_0051890_2360_3184 | 270 |
| 513 | 3300046530 | Ga0495654_0159482 | Ga0495654_0159482_10_834 | 270 |
| 514 | 3300046531 | Ga0495665_0024190 | Ga0495665_0024190_2404_3228 | 270 |
| 515 | 3300046533 | Ga0495640_0008927 | Ga0495640_0008927_5982_6806 | 270 |
| 516 | 3300046536 | Ga0495587_0174832 | Ga0495587_0174832_281_1102 | 270 |
| 517 | 3300046542 | Ga0495597_0034798 | Ga0495597_0034798_297_1121 | 270 |
| 518 | 3300046557 | Ga0495622_0002073 | Ga0495622_0002073_321_1145 | 270 |
| 519 | 3300046616 | Ga0495668_0036891 | Ga0495668_0036891_1053_1877 | 270 |
| 520 | 3300046642 | Ga0495634_0070018 | Ga0495634_0070018_609_1433 | 270 |
| 521 | 3300046648 | Ga0495611_0014161 | Ga0495611_0014161_1475_2299 | 270 |
| 522 | 3300046660 | Ga0495625_0100161 | Ga0495625_0100161_1028_1852 | 270 |
| 523 | 3300046674 | Ga0495588_0002826 | Ga0495588_0002826_1297_2118 | 270 |
| 524 | 3300046674 | Ga0495588_0007542 | Ga0495588_0007542_2254_3075 | 270 |
| 525 | 3300046675 | Ga0495657_0005323 | Ga0495657_0005323_5861_6682 | 270 |
| 526 | 3300046675 | Ga0495657_0045198 | Ga0495657_0045198_537_1361 | 270 |
| 527 | 3300046675 | Ga0495657_0059729 | Ga0495657_0059729_836_1660 | 270 |
| 528 | 3300046680 | Ga0495646_0020434 | Ga0495646_0020434_579_1403 | 270 |
| 529 | 3300046689 | Ga0495613_0012437 | Ga0495613_0012437_3347_4168 | 270 |
| 530 | 3300046689 | Ga0495613_0062646 | Ga0495613_0062646_745_1566 | 270 |
| 531 | 3300046690 | Ga0495624_0177540 | Ga0495624_0177540_321_1145 | 270 |
| 532 | 3300046691 | Ga0495670_0139317 | Ga0495670_0139317_180_1001 | 270 |
| 533 | 3300046694 | Ga0495649_0019128 | Ga0495649_0019128_928_1752 | 270 |
| 534 | 3300046794 | Ga0495589_0032763 | Ga0495589_0032763_1133_1954 | 270 |
| 535 | 3300046794 | Ga0495589_0147436 | Ga0495589_0147436_110_934 | 270 |
| 536 | 3300046810 | Ga0495660_0064945 | Ga0495660_0064945_859_1683 | 270 |
| 537 | 3300046810 | Ga0495660_0159007 | Ga0495660_0159007_236_1060 | 270 |
| 538 | 3300047318 | Ga0495636_0001903 | Ga0495636_0001903_5017_5838 | 270 |
| 539 | 3300047318 | Ga0495636_0054307 | Ga0495636_0054307_737_1561 | 270 |
| 540 | 3300047318 | Ga0495636_0168546 | Ga0495636_0168546_141_962 | 270 |
| 541 | 3300047319 | Ga0495674_0046357 | Ga0495674_0046357_591_1415 | 270 |
| 542 | 3300047321 | Ga0495676_0065143 | Ga0495676_0065143_32_856 | 270 |
| 543 | 3300047323 | Ga0495683_0009058 | Ga0495683_0009058_3401_4225 | 270 |
| 544 | 3300047444 | Ga0495675_0010024 | Ga0495675_0010024_4795_5616 | 270 |
| 545 | 3300047444 | Ga0495675_0015663 | Ga0495675_0015663_3880_4704 | 270 |
| 546 | 3300047447 | Ga0495685_005084 | Ga0495685_005084_1954_2775 | 270 |
| 547 | 3300047447 | Ga0495685_012571 | Ga0495685_012571_103_924 | 270 |
| 548 | 3300047447 | Ga0495685_020329 | Ga0495685_020329_1348_2172 | 270 |
| 549 | 3300047447 | Ga0495685_093467 | Ga0495685_093467_55_879 | 270 |
| 550 | 3300047472 | Ga0495686_0044087 | Ga0495686_0044087_1973_2797 | 270 |
| 551 | 3300047673 | Ga0495593_0063670 | Ga0495593_0063670_895_1719 | 270 |
| 552 | 3300048091 | Ga0495626_0031833 | Ga0495626_0031833_1551_2375 | 270 |
| 553 | 3300048911 | Ga0496108_0067612 | Ga0496108_0067612_967_1788 | 270 |
| 554 | 3300048912 | Ga0496109_0015110 | Ga0496109_0015110_1969_2790 | 270 |
| 555 | 3300049459 | Ga0495678_021792 | Ga0495678_021792_1411_2235 | 270 |
| 556 | 3300049459 | Ga0495678_044356 | Ga0495678_044356_133_957 | 270 |
| 557 | 3300049569 | Ga0501032_0022832 | Ga0501032_0022832_1623_2468 | 270 |
| 558 | 3300049570 | Ga0501033_0047859 | Ga0501033_0047859_581_1426 | 270 |
| 559 | 3300049570 | Ga0501033_0060032 | Ga0501033_0060032_928_1749 | 270 |
| 560 | 3300049571 | Ga0501034_0006261 | Ga0501034_0006261_11753_12598 | 270 |
| 561 | 3300049571 | Ga0501034_0068916 | Ga0501034_0068916_874_1695 | 270 |
| 562 | 3300049572 | Ga0501036_0043493 | Ga0501036_0043493_774_1619 | 270 |
| 563 | 3300049573 | Ga0501037_0003381 | Ga0501037_0003381_5742_6587 | 270 |
| 564 | 3300049574 | Ga0501038_0039741 | Ga0501038_0039741_3074_3919 | 270 |
| 565 | 3300049578 | Ga0501042_0068751 | Ga0501042_0068751_20_865 | 270 |
| 566 | 3300049580 | Ga0501046_0073534 | Ga0501046_0073534_1410_2255 | 270 |
| 567 | 3300049581 | Ga0501047_0172013 | Ga0501047_0172013_207_1052 | 270 |
| 568 | 3300049582 | Ga0501048_0008440 | Ga0501048_0008440_4475_5320 | 270 |
| 569 | 3300049822 | Ga0501035_0109730 | Ga0501035_0109730_991_1836 | 270 |
| 570 | 3300049823 | Ga0501044_0033696 | Ga0501044_0033696_207_1052 | 270 |
| 571 | 3300053140 | Ga0500573_0015931 | Ga0500573_0015931_940_1800 | 270 |
| 572 | 3300061719 | Ga0466962_0121386 | Ga0466962_0121386_19_840 | 270 |
| 573 | iso_pu_bacteria | 2643221670 | 2644385176 | 270 |
| 574 | iso_pu_bacteria | 2773857759 | 2774383643 | 270 |
| 575 | iso_pu_bacteria | 2902792274 | 2902796943 | 270 |
| 576 | 3300003322 | rootL2_10002639 | rootL2_1000263911 | 271 |
| 577 | 3300003322 | rootL2_10237235 | rootL2_102372352 | 271 |
| 578 | 3300025302 | Ga0207426_1002223 | Ga0207426_10022235 | 271 |
| 579 | 3300025302 | Ga0207426_1002227 | Ga0207426_10022272 | 271 |
| 580 | 3300030521 | Ga0307511_10001166 | Ga0307511_1000116617 | 271 |
| 581 | 3300031456 | Ga0307513_10157218 | Ga0307513_101572183 | 271 |
| 582 | 3300031507 | Ga0307509_10192381 | Ga0307509_101923812 | 271 |
| 583 | 3300031649 | Ga0307514_10105230 | Ga0307514_101052302 | 271 |
| 584 | 3300031730 | Ga0307516_10034680 | Ga0307516_100346805 | 271 |
| 585 | 3300031730 | Ga0307516_10104985 | Ga0307516_101049853 | 271 |
| 586 | 3300031838 | Ga0307518_10043316 | Ga0307518_100433162 | 271 |
| 587 | 3300031852 | Ga0307410_10202267 | Ga0307410_102022673 | 271 |
| 588 | 3300032002 | Ga0307416_100370142 | Ga0307416_1003701422 | 271 |
| 589 | 3300039062 | Ga0400483_166410 | Ga0400483_166410_7726_8622 | 271 |
| 590 | 3300041494 | Ga0451837_0441292 | Ga0451837_0441292_1562_2386 | 271 |
| 591 | 3300042007 | Ga0439449_0020539 | Ga0439449_0020539_570_1391 | 271 |
| 592 | 3300044658 | Ga0466972_0050303 | Ga0466972_0050303_350_1177 | 271 |
| 593 | 3300044693 | Ga0466961_0046233 | Ga0466961_0046233_1299_2132 | 271 |
| 594 | 3300044694 | Ga0466963_0002936 | Ga0466963_0002936_8021_8854 | 271 |
| 595 | 3300044901 | Ga0466960_0107471 | Ga0466960_0107471_165_986 | 271 |
| 596 | 3300045976 | Ga0466967_0296825 | Ga0466967_0296825_24_848 | 271 |
| 597 | 3300046453 | Ga0495627_043249 | Ga0495627_043249_108_926 | 271 |
| 598 | 3300046454 | Ga0495592_0004397 | Ga0495592_0004397_1986_2810 | 271 |
| 599 | 3300046455 | Ga0495603_0001858 | Ga0495603_0001858_10952_11773 | 271 |
| 600 | 3300046455 | Ga0495603_0002751 | Ga0495603_0002751_2715_3539 | 271 |
| 601 | 3300046457 | Ga0495590_0113503 | Ga0495590_0113503_28_861 | 271 |
| 602 | 3300046459 | Ga0495629_0019173 | Ga0495629_0019173_1507_2331 | 271 |
| 603 | 3300046459 | Ga0495629_0063842 | Ga0495629_0063842_582_1403 | 271 |
| 604 | 3300046459 | Ga0495629_0095786 | Ga0495629_0095786_483_1307 | 271 |
| 605 | 3300046459 | Ga0495629_0294667 | Ga0495629_0294667_246_1079 | 271 |
| 606 | 3300046460 | Ga0495638_0008299 | Ga0495638_0008299_120_953 | 271 |
| 607 | 3300046460 | Ga0495638_0023834 | Ga0495638_0023834_3131_3955 | 271 |
| 608 | 3300046462 | Ga0495651_0003483 | Ga0495651_0003483_9700_10524 | 271 |
| 609 | 3300046473 | Ga0495582_0015241 | Ga0495582_0015241_1195_2019 | 271 |
| 610 | 3300046476 | Ga0495662_0005451 | Ga0495662_0005451_4159_4983 | 271 |
| 611 | 3300046477 | Ga0495664_0006519 | Ga0495664_0006519_4327_5151 | 271 |
| 612 | 3300046492 | Ga0495585_0033955 | Ga0495585_0033955_1774_2607 | 271 |
| 613 | 3300046499 | Ga0495594_0000244 | Ga0495594_0000244_16106_16930 | 271 |
| 614 | 3300046516 | Ga0495628_0020376 | Ga0495628_0020376_879_1703 | 271 |
| 615 | 3300046517 | Ga0495630_0002641 | Ga0495630_0002641_10798_11622 | 271 |
| 616 | 3300046522 | Ga0495643_0001406 | Ga0495643_0001406_2700_3533 | 271 |
| 617 | 3300046529 | Ga0495652_0045401 | Ga0495652_0045401_2905_3729 | 271 |
| 618 | 3300046533 | Ga0495640_0016406 | Ga0495640_0016406_3198_4022 | 271 |
| 619 | 3300046536 | Ga0495587_0001034 | Ga0495587_0001034_13222_14046 | 271 |
| 620 | 3300046543 | Ga0495645_0008885 | Ga0495645_0008885_682_1506 | 271 |
| 621 | 3300046557 | Ga0495622_0007613 | Ga0495622_0007613_566_1390 | 271 |
| 622 | 3300046557 | Ga0495622_0072386 | Ga0495622_0072386_272_1096 | 271 |
| 623 | 3300046558 | Ga0495633_0035129 | Ga0495633_0035129_1289_2122 | 271 |
| 624 | 3300046642 | Ga0495634_0042766 | Ga0495634_0042766_157_981 | 271 |
| 625 | 3300046648 | Ga0495611_0010852 | Ga0495611_0010852_2687_3511 | 271 |
| 626 | 3300046660 | Ga0495625_0014809 | Ga0495625_0014809_914_1741 | 271 |
| 627 | 3300046663 | Ga0495635_0000563 | Ga0495635_0000563_14998_15822 | 271 |
| 628 | 3300046674 | Ga0495588_0220846 | Ga0495588_0220846_121_945 | 271 |
| 629 | 3300046675 | Ga0495657_0004129 | Ga0495657_0004129_1190_2014 | 271 |
| 630 | 3300046678 | Ga0495599_0055249 | Ga0495599_0055249_1633_2457 | 271 |
| 631 | 3300046680 | Ga0495646_0196749 | Ga0495646_0196749_119_943 | 271 |
| 632 | 3300046689 | Ga0495613_0000689 | Ga0495613_0000689_206_1027 | 271 |
| 633 | 3300046691 | Ga0495670_0004493 | Ga0495670_0004493_5392_6225 | 271 |
| 634 | 3300046809 | Ga0495600_0043021 | Ga0495600_0043021_157_981 | 271 |
| 635 | 3300046810 | Ga0495660_0015012 | Ga0495660_0015012_2658_3491 | 271 |
| 636 | 3300047315 | Ga0495581_0008559 | Ga0495581_0008559_1603_2427 | 271 |
| 637 | 3300047315 | Ga0495581_0222785 | Ga0495581_0222785_150_971 | 271 |
| 638 | 3300047317 | Ga0495604_0000177 | Ga0495604_0000177_13388_14212 | 271 |
| 639 | 3300047321 | Ga0495676_0002684 | Ga0495676_0002684_1586_2410 | 271 |
| 640 | 3300047321 | Ga0495676_0002844 | Ga0495676_0002844_562_1383 | 271 |
| 641 | 3300047321 | Ga0495676_0031274 | Ga0495676_0031274_3572_4396 | 271 |
| 642 | 3300047323 | Ga0495683_0020547 | Ga0495683_0020547_1687_2520 | 271 |
| 643 | 3300047443 | Ga0495687_011361 | Ga0495687_011361_770_1594 | 271 |
| 644 | 3300047444 | Ga0495675_0018918 | Ga0495675_0018918_1592_2416 | 271 |
| 645 | 3300047446 | Ga0495679_013057 | Ga0495679_013057_1762_2595 | 271 |
| 646 | 3300047447 | Ga0495685_000162 | Ga0495685_000162_2877_3710 | 271 |
| 647 | 3300047470 | Ga0495681_0000665 | Ga0495681_0000665_6388_7221 | 271 |
| 648 | 3300047471 | Ga0495684_0031322 | Ga0495684_0031322_3103_3927 | 271 |
| 649 | 3300047673 | Ga0495593_0000803 | Ga0495593_0000803_13323_14147 | 271 |
| 650 | 3300048088 | Ga0495602_0069887 | Ga0495602_0069887_1771_2595 | 271 |
| 651 | 3300048089 | Ga0495614_0000585 | Ga0495614_0000585_1873_2694 | 271 |
| 652 | 3300048089 | Ga0495614_0003178 | Ga0495614_0003178_5526_6350 | 271 |
| 653 | 3300048909 | Ga0496106_0077490 | Ga0496106_0077490_965_1786 | 271 |
| 654 | 3300049570 | Ga0501033_0000315 | Ga0501033_0000315_41200_42024 | 271 |
| 655 | 3300049572 | Ga0501036_0008190 | Ga0501036_0008190_3591_4415 | 271 |
| 656 | 3300049574 | Ga0501038_0037143 | Ga0501038_0037143_955_1779 | 271 |
| 657 | 3300049575 | Ga0501039_0052942 | Ga0501039_0052942_1790_2614 | 271 |
| 658 | 3300049581 | Ga0501047_0038824 | Ga0501047_0038824_467_1291 | 271 |
| 659 | 3300049586 | Ga0501070_0000283 | Ga0501070_0000283_6469_7293 | 271 |
| 660 | 3300049590 | Ga0501074_0000299 | Ga0501074_0000299_18961_19785 | 271 |
| 661 | 3300049822 | Ga0501035_0001623 | Ga0501035_0001623_19762_20586 | 271 |
| 662 | 3300049823 | Ga0501044_0361696 | Ga0501044_0361696_409_1233 | 271 |
| 663 | 3300053086 | Ga0500578_0004838 | Ga0500578_0004838_2108_2941 | 271 |
| 664 | 3300053094 | Ga0500566_0084045 | Ga0500566_0084045_807_1640 | 271 |
| 665 | 3300053095 | Ga0500640_006774 | Ga0500640_006774_3314_4138 | 271 |
| 666 | 3300053100 | Ga0500660_128514 | Ga0500660_128514_149_982 | 271 |
| 667 | 3300053111 | Ga0500572_002226 | Ga0500572_002226_3458_4282 | 271 |
| 668 | 3300053113 | Ga0500580_027725 | Ga0500580_027725_1031_1864 | 271 |
| 669 | 3300053123 | Ga0500614_047686 | Ga0500614_047686_212_1045 | 271 |
| 670 | 3300053129 | Ga0500628_003906 | Ga0500628_003906_1108_1941 | 271 |
| 671 | 3300053134 | Ga0500658_0014891 | Ga0500658_0014891_460_1293 | 271 |
| 672 | 3300053140 | Ga0500573_0227879 | Ga0500573_0227879_125_955 | 271 |
| 673 | 3300053142 | Ga0500577_0176845 | Ga0500577_0176845_67_900 | 271 |
| 674 | 3300053143 | Ga0500579_061224 | Ga0500579_061224_362_1195 | 271 |
| 675 | 3300053149 | Ga0500600_0007862 | Ga0500600_0007862_5036_5869 | 271 |
| 676 | 3300053153 | Ga0500616_0004760 | Ga0500616_0004760_8289_9122 | 271 |
| 677 | 3300053157 | Ga0500624_001614 | Ga0500624_001614_1271_2095 | 271 |
| 678 | 3300053160 | Ga0500633_0004692 | Ga0500633_0004692_402_1235 | 271 |
| 679 | 3300053161 | Ga0500634_0000287 | Ga0500634_0000287_393_1226 | 271 |
| 680 | 3300053739 | Ga0500587_000669 | Ga0500587_000669_2712_3545 | 271 |
| 681 | 3300061719 | Ga0466962_0008848 | Ga0466962_0008848_902_1735 | 271 |
| 682 | iso_pu_bacteria | 2738541274 | 2738703773 | 271 |
| 683 | 3300005435 | Ga0070714_100252295 | Ga0070714_1002522952 | 272 |
| 684 | 3300005937 | Ga0081455_10031663 | Ga0081455_100316637 | 272 |
| 685 | 3300039437 | Ga0436365_0967944 | Ga0436365_0967944_18380_19207 | 272 |
| 686 | 3300044694 | Ga0466963_0311262 | Ga0466963_0311262_116_934 | 272 |
| 687 | 3300044719 | Ga0466971_0024068 | Ga0466971_0024068_697_1515 | 272 |
| 688 | 3300049823 | Ga0501044_0252062 | Ga0501044_0252062_846_1673 | 272 |
| 689 | 3300053130 | Ga0500642_0089978 | Ga0500642_0089978_256_1074 | 272 |
| 690 | 3300006048 | Ga0075363_100004182 | Ga0075363_1000041824 | 273 |
| 691 | 3300006353 | Ga0075370_10059193 | Ga0075370_100591932 | 273 |
| 692 | 3300021384 | Ga0213876_10003411 | Ga0213876_100034116 | 273 |
| 693 | 3300021388 | Ga0213875_10006612 | Ga0213875_100066122 | 273 |
| 694 | 3300037853 | Ga0436364_0395198 | Ga0436364_0395198_524_1345 | 273 |
| 695 | 3300039437 | Ga0436365_0470798 | Ga0436365_0470798_23602_24423 | 273 |
| 696 | 3300039438 | Ga0436360_1088767 | Ga0436360_1088767_341_1171 | 273 |
| 697 | 3300044694 | Ga0466963_0320350 | Ga0466963_0320350_51_872 | 273 |
| 698 | 3300050491 | nmdc:mga00v17_14428_c1 | nmdc:mga00v17_14428_c1_1103_1924 | 273 |
| 699 | 3300002077 | JGI24744J21845_10000054 | JGI24744J21845_100000547 | 274 |
| 700 | 3300002077 | JGI24744J21845_10003102 | JGI24744J21845_100031024 | 274 |
| 701 | 3300002244 | JGI24742J22300_10000699 | JGI24742J22300_100006992 | 274 |
| 702 | 3300005328 | Ga0070676_10166136 | Ga0070676_101661361 | 274 |
| 703 | 3300005330 | Ga0070690_100012537 | Ga0070690_1000125373 | 274 |
| 704 | 3300005334 | Ga0068869_100010144 | Ga0068869_1000101446 | 274 |
| 705 | 3300005337 | Ga0070682_100046630 | Ga0070682_1000466302 | 274 |
| 706 | 3300005337 | Ga0070682_100367501 | Ga0070682_1003675011 | 274 |
| 707 | 3300005338 | Ga0068868_100000692 | Ga0068868_1000006929 | 274 |
| 708 | 3300005340 | Ga0070689_100132048 | Ga0070689_1001320483 | 274 |
| 709 | 3300005340 | Ga0070689_100163672 | Ga0070689_1001636722 | 274 |
| 710 | 3300005347 | Ga0070668_100106344 | Ga0070668_1001063442 | 274 |
| 711 | 3300005353 | Ga0070669_100002285 | Ga0070669_1000022851 | 274 |
| 712 | 3300005353 | Ga0070669_100010546 | Ga0070669_1000105465 | 274 |
| 713 | 3300005353 | Ga0070669_100219553 | Ga0070669_1002195532 | 274 |
| 714 | 3300005355 | Ga0070671_100034440 | Ga0070671_1000344404 | 274 |
| 715 | 3300005355 | Ga0070671_100248661 | Ga0070671_1002486611 | 274 |
| 716 | 3300005356 | Ga0070674_100007386 | Ga0070674_1000073863 | 274 |
| 717 | 3300005356 | Ga0070674_100009109 | Ga0070674_1000091094 | 274 |
| 718 | 3300005356 | Ga0070674_100106983 | Ga0070674_1001069832 | 274 |
| 719 | 3300005364 | Ga0070673_100264147 | Ga0070673_1002641472 | 274 |
| 720 | 3300005365 | Ga0070688_100223667 | Ga0070688_1002236672 | 274 |
| 721 | 3300005366 | Ga0070659_100066605 | Ga0070659_1000666052 | 274 |
| 722 | 3300005367 | Ga0070667_100021512 | Ga0070667_1000215126 | 274 |
| 723 | 3300005436 | Ga0070713_100150225 | Ga0070713_1001502252 | 274 |
| 724 | 3300005437 | Ga0070710_10000486 | Ga0070710_100004865 | 274 |
| 725 | 3300005437 | Ga0070710_10005873 | Ga0070710_100058734 | 274 |
| 726 | 3300005438 | Ga0070701_10003037 | Ga0070701_100030375 | 274 |
| 727 | 3300005439 | Ga0070711_100005689 | Ga0070711_1000056897 | 274 |
| 728 | 3300005439 | Ga0070711_100007574 | Ga0070711_1000075743 | 274 |
| 729 | 3300005440 | Ga0070705_100002283 | Ga0070705_1000022836 | 274 |
| 730 | 3300005440 | Ga0070705_100079337 | Ga0070705_1000793372 | 274 |
| 731 | 3300005441 | Ga0070700_100149276 | Ga0070700_1001492762 | 274 |
| 732 | 3300005441 | Ga0070700_100439957 | Ga0070700_1004399571 | 274 |
| 733 | 3300005455 | Ga0070663_100024895 | Ga0070663_1000248952 | 274 |
| 734 | 3300005455 | Ga0070663_100143210 | Ga0070663_1001432102 | 274 |
| 735 | 3300005456 | Ga0070678_100000230 | Ga0070678_1000002306 | 274 |
| 736 | 3300005456 | Ga0070678_100119865 | Ga0070678_1001198651 | 274 |
| 737 | 3300005457 | Ga0070662_100003258 | Ga0070662_1000032588 | 274 |
| 738 | 3300005459 | Ga0068867_100018661 | Ga0068867_1000186612 | 274 |
| 739 | 3300005539 | Ga0068853_100030665 | Ga0068853_1000306654 | 274 |
| 740 | 3300005543 | Ga0070672_100426217 | Ga0070672_1004262172 | 274 |
| 741 | 3300005544 | Ga0070686_100185225 | Ga0070686_1001852252 | 274 |
| 742 | 3300005545 | Ga0070695_100306947 | Ga0070695_1003069471 | 274 |
| 743 | 3300005546 | Ga0070696_100002631 | Ga0070696_1000026312 | 274 |
| 744 | 3300005546 | Ga0070696_100495013 | Ga0070696_1004950131 | 274 |
| 745 | 3300005547 | Ga0070693_100059203 | Ga0070693_1000592032 | 274 |
| 746 | 3300005548 | Ga0070665_100013254 | Ga0070665_1000132542 | 274 |
| 747 | 3300005548 | Ga0070665_100047390 | Ga0070665_1000473904 | 274 |
| 748 | 3300005548 | Ga0070665_100304090 | Ga0070665_1003040903 | 274 |
| 749 | 3300005549 | Ga0070704_100113556 | Ga0070704_1001135561 | 274 |
| 750 | 3300005563 | Ga0068855_100128954 | Ga0068855_1001289543 | 274 |
| 751 | 3300005578 | Ga0068854_100000723 | Ga0068854_10000072322 | 274 |
| 752 | 3300005614 | Ga0068856_100022196 | Ga0068856_1000221964 | 274 |
| 753 | 3300005615 | Ga0070702_100000434 | Ga0070702_1000004348 | 274 |
| 754 | 3300005616 | Ga0068852_100016014 | Ga0068852_1000160144 | 274 |
| 755 | 3300005616 | Ga0068852_100085602 | Ga0068852_1000856022 | 274 |
| 756 | 3300005617 | Ga0068859_100016786 | Ga0068859_1000167867 | 274 |
| 757 | 3300005617 | Ga0068859_100018510 | Ga0068859_1000185104 | 274 |
| 758 | 3300005718 | Ga0068866_10000072 | Ga0068866_1000007241 | 274 |
| 759 | 3300005719 | Ga0068861_100064345 | Ga0068861_1000643452 | 274 |
| 760 | 3300005841 | Ga0068863_100000193 | Ga0068863_10000019356 | 274 |
| 761 | 3300005842 | Ga0068858_100005187 | Ga0068858_10000518711 | 274 |
| 762 | 3300005842 | Ga0068858_100007410 | Ga0068858_10000741010 | 274 |
| 763 | 3300005843 | Ga0068860_100000166 | Ga0068860_100000166107 | 274 |
| 764 | 3300005843 | Ga0068860_100014460 | Ga0068860_1000144605 | 274 |
| 765 | 3300005844 | Ga0068862_100000205 | Ga0068862_10000020526 | 274 |
| 766 | 3300005937 | Ga0081455_10021015 | Ga0081455_100210153 | 274 |
| 767 | 3300006038 | Ga0075365_10082479 | Ga0075365_100824792 | 274 |
| 768 | 3300006051 | Ga0075364_10000380 | Ga0075364_100003805 | 274 |
| 769 | 3300006051 | Ga0075364_10023367 | Ga0075364_100233674 | 274 |
| 770 | 3300006163 | Ga0070715_10003467 | Ga0070715_100034674 | 274 |
| 771 | 3300006173 | Ga0070716_100108399 | Ga0070716_1001083993 | 274 |
| 772 | 3300006175 | Ga0070712_100006609 | Ga0070712_1000066095 | 274 |
| 773 | 3300006175 | Ga0070712_100010841 | Ga0070712_1000108416 | 274 |
| 774 | 3300006186 | Ga0075369_10001022 | Ga0075369_100010228 | 274 |
| 775 | 3300006186 | Ga0075369_10012963 | Ga0075369_100129633 | 274 |
| 776 | 3300006186 | Ga0075369_10019986 | Ga0075369_100199863 | 274 |
| 777 | 3300006237 | Ga0097621_100212751 | Ga0097621_1002127512 | 274 |
| 778 | 3300006358 | Ga0068871_100039535 | Ga0068871_1000395353 | 274 |
| 779 | 3300006358 | Ga0068871_100380069 | Ga0068871_1003800692 | 274 |
| 780 | 3300006881 | Ga0068865_100005962 | Ga0068865_1000059627 | 274 |
| 781 | 3300006931 | Ga0097620_100016787 | Ga0097620_1000167877 | 274 |
| 782 | 3300006931 | Ga0097620_100018511 | Ga0097620_1000185117 | 274 |
| 783 | 3300007788 | Ga0099795_10005256 | Ga0099795_100052563 | 274 |
| 784 | 3300009098 | Ga0105245_10000751 | Ga0105245_1000075125 | 274 |
| 785 | 3300009101 | Ga0105247_10000082 | Ga0105247_1000008220 | 274 |
| 786 | 3300009101 | Ga0105247_10068074 | Ga0105247_100680741 | 274 |
| 787 | 3300009148 | Ga0105243_10097497 | Ga0105243_100974972 | 274 |
| 788 | 3300009174 | Ga0105241_10018048 | Ga0105241_100180485 | 274 |
| 789 | 3300009176 | Ga0105242_10001294 | Ga0105242_100012948 | 274 |
| 790 | 3300009177 | Ga0105248_10000576 | Ga0105248_100005767 | 274 |
| 791 | 3300009177 | Ga0105248_10018392 | Ga0105248_100183927 | 274 |
| 792 | 3300009177 | Ga0105248_10020738 | Ga0105248_100207387 | 274 |
| 793 | 3300009545 | Ga0105237_10090102 | Ga0105237_100901024 | 274 |
| 794 | 3300009551 | Ga0105238_10166966 | Ga0105238_101669661 | 274 |
| 795 | 3300009553 | Ga0105249_10000008 | Ga0105249_100000087 | 274 |
| 796 | 3300009553 | Ga0105249_10000326 | Ga0105249_1000032644 | 274 |
| 797 | 3300009553 | Ga0105249_10326518 | Ga0105249_103265182 | 274 |
| 798 | 3300010375 | Ga0105239_10009518 | Ga0105239_100095184 | 274 |
| 799 | 3300010375 | Ga0105239_10149564 | Ga0105239_101495643 | 274 |
| 800 | 3300013105 | Ga0157369_10096605 | Ga0157369_100966052 | 274 |
| 801 | 3300013296 | Ga0157374_10213401 | Ga0157374_102134013 | 274 |
| 802 | 3300013297 | Ga0157378_10001214 | Ga0157378_100012148 | 274 |
| 803 | 3300013297 | Ga0157378_10193811 | Ga0157378_101938113 | 274 |
| 804 | 3300013306 | Ga0163162_10013482 | Ga0163162_100134827 | 274 |
| 805 | 3300013306 | Ga0163162_10061514 | Ga0163162_100615143 | 274 |
| 806 | 3300013306 | Ga0163162_10256801 | Ga0163162_102568012 | 274 |
| 807 | 3300013306 | Ga0163162_10375185 | Ga0163162_103751852 | 274 |
| 808 | 3300013307 | Ga0157372_10015740 | Ga0157372_100157407 | 274 |
| 809 | 3300013308 | Ga0157375_10000173 | Ga0157375_100001737 | 274 |
| 810 | 3300013308 | Ga0157375_10366826 | Ga0157375_103668262 | 274 |
| 811 | 3300014326 | Ga0157380_10004546 | Ga0157380_100045469 | 274 |
| 812 | 3300014745 | Ga0157377_10046778 | Ga0157377_100467781 | 274 |
| 813 | 3300014968 | Ga0157379_10188007 | Ga0157379_101880072 | 274 |
| 814 | 3300014969 | Ga0157376_10239439 | Ga0157376_102394392 | 274 |
| 815 | 3300017792 | Ga0163161_10176534 | Ga0163161_101765341 | 274 |
| 816 | 3300017792 | Ga0163161_10424100 | Ga0163161_104241002 | 274 |
| 817 | 3300021384 | Ga0213876_10044364 | Ga0213876_100443642 | 274 |
| 818 | 3300025898 | Ga0207692_10045102 | Ga0207692_100451022 | 274 |
| 819 | 3300025899 | Ga0207642_10000120 | Ga0207642_100001204 | 274 |
| 820 | 3300025900 | Ga0207710_10000263 | Ga0207710_1000026316 | 274 |
| 821 | 3300025900 | Ga0207710_10002806 | Ga0207710_100028066 | 274 |
| 822 | 3300025901 | Ga0207688_10000732 | Ga0207688_100007323 | 274 |
| 823 | 3300025901 | Ga0207688_10082062 | Ga0207688_100820623 | 274 |
| 824 | 3300025904 | Ga0207647_10130744 | Ga0207647_101307442 | 274 |
| 825 | 3300025905 | Ga0207685_10009137 | Ga0207685_100091373 | 274 |
| 826 | 3300025906 | Ga0207699_10038104 | Ga0207699_100381042 | 274 |
| 827 | 3300025907 | Ga0207645_10043499 | Ga0207645_100434994 | 274 |
| 828 | 3300025908 | Ga0207643_10135512 | Ga0207643_101355122 | 274 |
| 829 | 3300025915 | Ga0207693_10000869 | Ga0207693_1000086923 | 274 |
| 830 | 3300025915 | Ga0207693_10130844 | Ga0207693_101308442 | 274 |
| 831 | 3300025916 | Ga0207663_10000449 | Ga0207663_100004493 | 274 |
| 832 | 3300025916 | Ga0207663_10022742 | Ga0207663_100227424 | 274 |
| 833 | 3300025919 | Ga0207657_10061917 | Ga0207657_100619173 | 274 |
| 834 | 3300025923 | Ga0207681_10007046 | Ga0207681_100070462 | 274 |
| 835 | 3300025923 | Ga0207681_10050190 | Ga0207681_100501902 | 274 |
| 836 | 3300025927 | Ga0207687_10004955 | Ga0207687_100049554 | 274 |
| 837 | 3300025929 | Ga0207664_10085348 | Ga0207664_100853483 | 274 |
| 838 | 3300025931 | Ga0207644_10074968 | Ga0207644_100749682 | 274 |
| 839 | 3300025933 | Ga0207706_10004443 | Ga0207706_100044437 | 274 |
| 840 | 3300025935 | Ga0207709_10003286 | Ga0207709_100032867 | 274 |
| 841 | 3300025935 | Ga0207709_10445611 | Ga0207709_104456111 | 274 |
| 842 | 3300025936 | Ga0207670_10043558 | Ga0207670_100435584 | 274 |
| 843 | 3300025937 | Ga0207669_10143260 | Ga0207669_101432602 | 274 |
| 844 | 3300025938 | Ga0207704_10000222 | Ga0207704_100002227 | 274 |
| 845 | 3300025939 | Ga0207665_10002166 | Ga0207665_100021667 | 274 |
| 846 | 3300025939 | Ga0207665_10030075 | Ga0207665_100300754 | 274 |
| 847 | 3300025940 | Ga0207691_10157225 | Ga0207691_101572252 | 274 |
| 848 | 3300025941 | Ga0207711_10000948 | Ga0207711_1000094820 | 274 |
| 849 | 3300025941 | Ga0207711_10307229 | Ga0207711_103072292 | 274 |
| 850 | 3300025942 | Ga0207689_10010628 | Ga0207689_100106283 | 274 |
| 851 | 3300025960 | Ga0207651_10125360 | Ga0207651_101253602 | 274 |
| 852 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011312 | 274 |
| 853 | 3300025961 | Ga0207712_10239872 | Ga0207712_102398722 | 274 |
| 854 | 3300025972 | Ga0207668_10171862 | Ga0207668_101718622 | 274 |
| 855 | 3300025972 | Ga0207668_10277776 | Ga0207668_102777762 | 274 |
| 856 | 3300025981 | Ga0207640_10099426 | Ga0207640_100994262 | 274 |
| 857 | 3300025986 | Ga0207658_10002041 | Ga0207658_100020417 | 274 |
| 858 | 3300025986 | Ga0207658_10069132 | Ga0207658_100691322 | 274 |
| 859 | 3300025986 | Ga0207658_10078702 | Ga0207658_100787023 | 274 |
| 860 | 3300026023 | Ga0207677_10002154 | Ga0207677_100021549 | 274 |
| 861 | 3300026023 | Ga0207677_10025118 | Ga0207677_100251183 | 274 |
| 862 | 3300026035 | Ga0207703_10008863 | Ga0207703_100088638 | 274 |
| 863 | 3300026035 | Ga0207703_10246164 | Ga0207703_102461642 | 274 |
| 864 | 3300026041 | Ga0207639_10072442 | Ga0207639_100724422 | 274 |
| 865 | 3300026067 | Ga0207678_10008674 | Ga0207678_100086742 | 274 |
| 866 | 3300026067 | Ga0207678_10083619 | Ga0207678_100836192 | 274 |
| 867 | 3300026075 | Ga0207708_10004352 | Ga0207708_100043526 | 274 |
| 868 | 3300026088 | Ga0207641_10000437 | Ga0207641_1000043714 | 274 |
| 869 | 3300026089 | Ga0207648_10038065 | Ga0207648_100380653 | 274 |
| 870 | 3300026089 | Ga0207648_10269034 | Ga0207648_102690342 | 274 |
| 871 | 3300026118 | Ga0207675_100000056 | Ga0207675_1000000567 | 274 |
| 872 | 3300026118 | Ga0207675_100022234 | Ga0207675_1000222345 | 274 |
| 873 | 3300026118 | Ga0207675_100248140 | Ga0207675_1002481402 | 274 |
| 874 | 3300026121 | Ga0207683_10000442 | Ga0207683_100004427 | 274 |
| 875 | 3300026121 | Ga0207683_10115916 | Ga0207683_101159163 | 274 |
| 876 | 3300028379 | Ga0268266_10011643 | Ga0268266_100116432 | 274 |
| 877 | 3300028379 | Ga0268266_10210812 | Ga0268266_102108122 | 274 |
| 878 | 3300028379 | Ga0268266_10230336 | Ga0268266_102303363 | 274 |
| 879 | 3300028380 | Ga0268265_10000007 | Ga0268265_10000007324 | 274 |
| 880 | 3300028380 | Ga0268265_10020264 | Ga0268265_100202642 | 274 |
| 881 | 3300028380 | Ga0268265_10179166 | Ga0268265_101791662 | 274 |
| 882 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007455 | 274 |
| 883 | 3300035112 | Ga0373932_0034040 | Ga0373932_0034040_426_1250 | 274 |
| 884 | 3300035114 | Ga0373939_0011694 | Ga0373939_0011694_633_1457 | 274 |
| 885 | 3300039450 | Ga0436363_0684294 | Ga0436363_0684294_432_1256 | 274 |
| 886 | 3300041413 | Ga0439465_0008579 | Ga0439465_0008579_555_1379 | 274 |
| 887 | 3300041413 | Ga0439465_0057507 | Ga0439465_0057507_420_1244 | 274 |
| 888 | 3300044656 | Ga0466969_0086897 | Ga0466969_0086897_568_1419 | 274 |
| 889 | 3300044658 | Ga0466972_0004743 | Ga0466972_0004743_2213_3037 | 274 |
| 890 | 3300044658 | Ga0466972_0061881 | Ga0466972_0061881_686_1519 | 274 |
| 891 | 3300044658 | Ga0466972_0082680 | Ga0466972_0082680_520_1344 | 274 |
| 892 | 3300044683 | Ga0466965_0013546 | Ga0466965_0013546_1542_2366 | 274 |
| 893 | 3300044684 | Ga0466966_0008986 | Ga0466966_0008986_5302_6153 | 274 |
| 894 | 3300044693 | Ga0466961_0098382 | Ga0466961_0098382_728_1579 | 274 |
| 895 | 3300044694 | Ga0466963_0213735 | Ga0466963_0213735_363_1187 | 274 |
| 896 | 3300044719 | Ga0466971_0016234 | Ga0466971_0016234_1209_2033 | 274 |
| 897 | 3300044735 | Ga0466968_0007978 | Ga0466968_0007978_2938_3789 | 274 |
| 898 | 3300044735 | Ga0466968_0030780 | Ga0466968_0030780_58_921 | 274 |
| 899 | 3300044765 | Ga0466970_0004702 | Ga0466970_0004702_2243_3067 | 274 |
| 900 | 3300044842 | Ga0466957_0085738 | Ga0466957_0085738_437_1288 | 274 |
| 901 | 3300044901 | Ga0466960_0000965 | Ga0466960_0000965_3235_4068 | 274 |
| 902 | 3300045049 | Ga0466959_0083606 | Ga0466959_0083606_28_852 | 274 |
| 903 | 3300045049 | Ga0466959_0187050 | Ga0466959_0187050_355_1206 | 274 |
| 904 | 3300045836 | Ga0466958_0002583 | Ga0466958_0002583_8044_8895 | 274 |
| 905 | 3300045976 | Ga0466967_0070420 | Ga0466967_0070420_1204_2028 | 274 |
| 906 | 3300045976 | Ga0466967_0375460 | Ga0466967_0375460_14_838 | 274 |
| 907 | 3300046460 | Ga0495638_0016209 | Ga0495638_0016209_603_1430 | 274 |
| 908 | 3300046533 | Ga0495640_0073049 | Ga0495640_0073049_191_1024 | 274 |
| 909 | 3300047320 | Ga0495672_0054676 | Ga0495672_0054676_211_1038 | 274 |
| 910 | 3300048903 | Ga0496100_0052514 | Ga0496100_0052514_1356_2180 | 274 |
| 911 | 3300048903 | Ga0496100_0331658 | Ga0496100_0331658_257_1081 | 274 |
| 912 | 3300048904 | Ga0496101_0000252 | Ga0496101_0000252_18261_19085 | 274 |
| 913 | 3300048904 | Ga0496101_0001313 | Ga0496101_0001313_12398_13222 | 274 |
| 914 | 3300048904 | Ga0496101_0004785 | Ga0496101_0004785_6575_7399 | 274 |
| 915 | 3300048905 | Ga0496102_0000277 | Ga0496102_0000277_349_1173 | 274 |
| 916 | 3300048905 | Ga0496102_0000868 | Ga0496102_0000868_2375_3199 | 274 |
| 917 | 3300048905 | Ga0496102_0153296 | Ga0496102_0153296_544_1368 | 274 |
| 918 | 3300048906 | Ga0496103_0001078 | Ga0496103_0001078_5061_5885 | 274 |
| 919 | 3300048906 | Ga0496103_0049367 | Ga0496103_0049367_141_965 | 274 |
| 920 | 3300048906 | Ga0496103_0163234 | Ga0496103_0163234_472_1296 | 274 |
| 921 | 3300048907 | Ga0496104_0001573 | Ga0496104_0001573_11062_11886 | 274 |
| 922 | 3300048909 | Ga0496106_0001380 | Ga0496106_0001380_9559_10383 | 274 |
| 923 | 3300048909 | Ga0496106_0068337 | Ga0496106_0068337_40_864 | 274 |
| 924 | 3300048909 | Ga0496106_0144231 | Ga0496106_0144231_455_1279 | 274 |
| 925 | 3300048910 | Ga0496107_0000829 | Ga0496107_0000829_868_1692 | 274 |
| 926 | 3300048910 | Ga0496107_0000879 | Ga0496107_0000879_11839_12663 | 274 |
| 927 | 3300048910 | Ga0496107_0113584 | Ga0496107_0113584_713_1537 | 274 |
| 928 | 3300048910 | Ga0496107_0226112 | Ga0496107_0226112_69_893 | 274 |
| 929 | 3300048911 | Ga0496108_0013057 | Ga0496108_0013057_5646_6470 | 274 |
| 930 | 3300048912 | Ga0496109_0004360 | Ga0496109_0004360_5355_6179 | 274 |
| 931 | 3300048915 | Ga0496112_0014095 | Ga0496112_0014095_5714_6538 | 274 |
| 932 | 3300048917 | Ga0496114_0000514 | Ga0496114_0000514_14765_15589 | 274 |
| 933 | 3300048917 | Ga0496114_0003450 | Ga0496114_0003450_2898_3722 | 274 |
| 934 | 3300048918 | Ga0496115_0000799 | Ga0496115_0000799_6196_7020 | 274 |
| 935 | 3300048918 | Ga0496115_0017268 | Ga0496115_0017268_2872_3696 | 274 |
| 936 | 3300048919 | Ga0496116_0013362 | Ga0496116_0013362_3196_4020 | 274 |
| 937 | 3300048920 | Ga0496117_0000760 | Ga0496117_0000760_45512_46336 | 274 |
| 938 | 3300048921 | Ga0496118_0000225 | Ga0496118_0000225_10769_11593 | 274 |
| 939 | 3300048922 | Ga0496119_0004423 | Ga0496119_0004423_7449_8273 | 274 |
| 940 | 3300048923 | Ga0496120_0005250 | Ga0496120_0005250_1608_2432 | 274 |
| 941 | 3300048924 | Ga0496121_0002455 | Ga0496121_0002455_12553_13377 | 274 |
| 942 | 3300048927 | Ga0496124_0043494 | Ga0496124_0043494_161_985 | 274 |
| 943 | 3300048928 | Ga0496125_0046539 | Ga0496125_0046539_1117_1941 | 274 |
| 944 | 3300048929 | Ga0496126_0025517 | Ga0496126_0025517_1161_1985 | 274 |
| 945 | 3300049570 | Ga0501033_0085241 | Ga0501033_0085241_515_1348 | 274 |
| 946 | 3300049571 | Ga0501034_0055411 | Ga0501034_0055411_623_1456 | 274 |
| 947 | 3300049571 | Ga0501034_0133382 | Ga0501034_0133382_768_1592 | 274 |
| 948 | 3300049581 | Ga0501047_0024286 | Ga0501047_0024286_1057_1890 | 274 |
| 949 | 3300049581 | Ga0501047_0051334 | Ga0501047_0051334_70_903 | 274 |
| 950 | 3300049585 | Ga0501069_0064005 | Ga0501069_0064005_998_1831 | 274 |
| 951 | 3300049586 | Ga0501070_0203699 | Ga0501070_0203699_710_1543 | 274 |
| 952 | 3300049822 | Ga0501035_0001215 | Ga0501035_0001215_11714_12547 | 274 |
| 953 | 3300049823 | Ga0501044_0004709 | Ga0501044_0004709_2462_3295 | 274 |
| 954 | 3300050490 | nmdc:mga03n38_56077_c1 | nmdc:mga03n38_56077_c1_252_1076 | 274 |
| 955 | 3300050491 | nmdc:mga00v17_1073_c1 | nmdc:mga00v17_1073_c1_6397_7221 | 274 |
| 956 | 3300050491 | nmdc:mga00v17_28849_c1 | nmdc:mga00v17_28849_c1_1030_1854 | 274 |
| 957 | 3300050492 | nmdc:mga0yw44_89134_c1 | nmdc:mga0yw44_89134_c1_644_1468 | 274 |
| 958 | 3300050494 | nmdc:mga06z11_107896_c1 | nmdc:mga06z11_107896_c1_14_838 | 274 |
| 959 | 3300050516 | nmdc:mga0sz30_2757_c1 | nmdc:mga0sz30_2757_c1_3278_4102 | 274 |
| 960 | 3300050516 | nmdc:mga0sz30_30654_c1 | nmdc:mga0sz30_30654_c1_53_877 | 274 |
| 961 | 3300050516 | nmdc:mga0sz30_8083_c1 | nmdc:mga0sz30_8083_c1_1337_2161 | 274 |
| 962 | 3300053086 | Ga0500578_0178206 | Ga0500578_0178206_160_987 | 274 |
| 963 | 3300053087 | Ga0500643_023061 | Ga0500643_023061_845_1672 | 274 |
| 964 | 3300053090 | Ga0500646_0013121 | Ga0500646_0013121_1130_1954 | 274 |
| 965 | 3300053096 | Ga0500641_0023160 | Ga0500641_0023160_1259_2086 | 274 |
| 966 | 3300053131 | Ga0500652_012499 | Ga0500652_012499_1541_2368 | 274 |
| 967 | 3300053153 | Ga0500616_0012651 | Ga0500616_0012651_2023_2856 | 274 |
| 968 | 3300053158 | Ga0500627_0026268 | Ga0500627_0026268_570_1397 | 274 |
| 969 | 3300053730 | Ga0500645_077408 | Ga0500645_077408_47_874 | 274 |
| 970 | 3300061719 | Ga0466962_0010393 | Ga0466962_0010393_2405_3229 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7j-assembly2.cif.gz_B | crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 | 0.9956 | 2 | 273 |
| 3i7j-assembly2.cif.gz_B | crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 | 0.9919 | 2 | 273 |
| 6kjr-assembly1.cif.gz_A | functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors | 0.8616 | 5 | 274 |
| 6kjq-assembly1.cif.gz_A | functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors | 0.8529 | 5 | 267 |
| 6kjr-assembly1.cif.gz_A | functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors | 0.8468 | 5 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9956 | 2 | 273 | 3.40.710.10 |
| 3i7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9919 | 2 | 273 | 3.40.710.10 |
| af_A0A1D8PKX8_25_403_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8338 | 11 | 264 | 3.40.710.10 |
| af_B0G0Z7_67_432_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8253 | 4 | 263 | 3.40.710.10 |
| af_Q8T2U3_27_449_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8207 | 5 | 271 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8MJP3-F1-model_v4 | deleted | 0.9969 | 125 | 274 |
|
| AF-A0A822MN51-F1-model_v4 | deleted | 0.9968 | 169 | 274 |
|
| AF-V7JI96-F1-model_v4 | deleted | 0.9962 | 1 | 271 |
|
| AF-V7L4U8-F1-model_v4 | deleted | 0.9962 | 57 | 272 |
|
| AF-A0A1A2N371-F1-model_v4 | Serine hydrolase | 0.9962 | 1 | 185 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar