F487087
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 970 | 310 | 970 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100000805|Ga0070699_10000080520 |
| Length | 147 |
| Sequence | MPMIDVYATRGTFKDPKSLARNLAATLMKIEKVPDIPMFRQNTAAFVHDLPDGALSNVEGQSNHVRVQVLTNAGALDREKQLSVVSEFSHIIAAAGDPSLSGRTWVLLTEAIEGGWGLSGHANTNAELIAAARAQIAELQQKKASGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 108 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 109 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 4.33 |
| Rhizosphere | 93.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1060663 | 3300001976 | Unclassified | 522 |
| 2 | JGI24033J26618_1055161 | 3300002155 | Bacteria | 576 |
| 3 | JGI24751J29686_10006875 | 3300002459 | Bacteria | 2319 |
| 4 | Ga0055527_1000032 | 3300003760 | Bacteria | 153292 |
| 5 | Ga0055527_1000091 | 3300003760 | Bacteria | 70221 |
| 6 | Ga0055542_1000216 | 3300003762 | Bacteria | 70219 |
| 7 | Ga0055529_1000234 | 3300003763 | Bacteria | 70241 |
| 8 | Ga0065707_10283270 | 3300005295 | Bacteria | 1042 |
| 9 | Ga0070683_100025354 | 3300005329 | Bacteria | 5325 |
| 10 | Ga0070683_100725288 | 3300005329 | Unclassified | 952 |
| 11 | Ga0070690_100240978 | 3300005330 | Bacteria | 1275 |
| 12 | Ga0070690_100373933 | 3300005330 | Bacteria | 1040 |
| 13 | Ga0070670_100019605 | 3300005331 | Bacteria | 5805 |
| 14 | Ga0070670_100674356 | 3300005331 | Bacteria | 928 |
| 15 | Ga0068869_100667522 | 3300005334 | Bacteria | 884 |
| 16 | Ga0070680_100078719 | 3300005336 | Bacteria | 2716 |
| 17 | Ga0070682_100752872 | 3300005337 | Bacteria | 787 |
| 18 | Ga0068868_101187130 | 3300005338 | Bacteria | 705 |
| 19 | Ga0068868_101235638 | 3300005338 | Bacteria | 692 |
| 20 | Ga0070689_101909920 | 3300005340 | Bacteria | 542 |
| 21 | Ga0070691_10484955 | 3300005341 | Bacteria | 712 |
| 22 | Ga0070687_100339295 | 3300005343 | Bacteria | 966 |
| 23 | Ga0070692_10031015 | 3300005345 | Unclassified | 2677 |
| 24 | Ga0070692_10039551 | 3300005345 | Bacteria | 2409 |
| 25 | Ga0070692_10908690 | 3300005345 | Bacteria | 609 |
| 26 | Ga0070668_100684008 | 3300005347 | Bacteria | 904 |
| 27 | Ga0070668_101371733 | 3300005347 | Bacteria | 644 |
| 28 | Ga0070675_100857826 | 3300005354 | Bacteria | 831 |
| 29 | Ga0070671_100068116 | 3300005355 | Bacteria | 2968 |
| 30 | Ga0070674_100061623 | 3300005356 | Bacteria | 2619 |
| 31 | Ga0070674_100136395 | 3300005356 | Bacteria | 1836 |
| 32 | Ga0070674_100175523 | 3300005356 | Bacteria | 1637 |
| 33 | Ga0070674_100445367 | 3300005356 | Bacteria | 1068 |
| 34 | Ga0070673_100531478 | 3300005364 | Bacteria | 1067 |
| 35 | Ga0070659_100625674 | 3300005366 | Unclassified | 927 |
| 36 | Ga0070659_101299038 | 3300005366 | Bacteria | 645 |
| 37 | Ga0070703_10003635 | 3300005406 | Bacteria | 4378 |
| 38 | Ga0070709_10039969 | 3300005434 | Bacteria | 2881 |
| 39 | Ga0070714_100033116 | 3300005435 | Bacteria | 4318 |
| 40 | Ga0070714_100065607 | 3300005435 | Bacteria | 3127 |
| 41 | Ga0070714_100156418 | 3300005435 | Bacteria | 2058 |
| 42 | Ga0070714_100196265 | 3300005435 | Bacteria | 1844 |
| 43 | Ga0070714_100265212 | 3300005435 | Bacteria | 1591 |
| 44 | Ga0070714_100378226 | 3300005435 | Archaea | 1335 |
| 45 | Ga0070714_100818319 | 3300005435 | Unclassified | 902 |
| 46 | Ga0070714_100996912 | 3300005435 | Unclassified | 815 |
| 47 | Ga0070714_102361509 | 3300005435 | Bacteria | 517 |
| 48 | Ga0070713_100086693 | 3300005436 | Bacteria | 2685 |
| 49 | Ga0070713_100244894 | 3300005436 | Bacteria | 1633 |
| 50 | Ga0070713_100253594 | 3300005436 | Unclassified | 1605 |
| 51 | Ga0070713_100680425 | 3300005436 | Unclassified | 981 |
| 52 | Ga0070713_101214766 | 3300005436 | Bacteria | 730 |
| 53 | Ga0070710_10243334 | 3300005437 | Bacteria | 1153 |
| 54 | Ga0070710_11233183 | 3300005437 | Bacteria | 554 |
| 55 | Ga0070701_10122361 | 3300005438 | Unclassified | 1468 |
| 56 | Ga0070701_10305595 | 3300005438 | Unclassified | 979 |
| 57 | Ga0070701_10907399 | 3300005438 | Bacteria | 608 |
| 58 | Ga0070711_100143253 | 3300005439 | Bacteria | 1794 |
| 59 | Ga0070705_100007053 | 3300005440 | Bacteria | 5522 |
| 60 | Ga0070705_100082374 | 3300005440 | Bacteria | 1980 |
| 61 | Ga0070705_100112137 | 3300005440 | Bacteria | 1745 |
| 62 | Ga0070705_100320949 | 3300005440 | Bacteria | 1118 |
| 63 | Ga0070705_100560240 | 3300005440 | Bacteria | 878 |
| 64 | Ga0070700_100113325 | 3300005441 | Bacteria | 1807 |
| 65 | Ga0070700_100410536 | 3300005441 | Bacteria | 1021 |
| 66 | Ga0070700_100495448 | 3300005441 | Bacteria | 939 |
| 67 | Ga0070700_101286267 | 3300005441 | Bacteria | 614 |
| 68 | Ga0070694_100032696 | 3300005444 | Bacteria | 3417 |
| 69 | Ga0070694_100081245 | 3300005444 | Bacteria | 2254 |
| 70 | Ga0070694_100086445 | 3300005444 | Bacteria | 2191 |
| 71 | Ga0070694_100092380 | 3300005444 | Bacteria | 2126 |
| 72 | Ga0070694_100793940 | 3300005444 | Bacteria | 776 |
| 73 | Ga0070708_100001281 | 3300005445 | Bacteria | 19353 |
| 74 | Ga0070708_100001720 | 3300005445 | Bacteria | 16828 |
| 75 | Ga0070708_100002506 | 3300005445 | Bacteria | 14170 |
| 76 | Ga0070708_100016020 | 3300005445 | Bacteria | 6209 |
| 77 | Ga0070708_100019788 | 3300005445 | Bacteria | 5663 |
| 78 | Ga0070708_100025182 | 3300005445 | Bacteria | 5084 |
| 79 | Ga0070708_100031340 | 3300005445 | Bacteria | 4601 |
| 80 | Ga0070708_100036593 | 3300005445 | Bacteria | 4281 |
| 81 | Ga0070708_100058163 | 3300005445 | Unclassified | 3444 |
| 82 | Ga0070708_100069824 | 3300005445 | Bacteria | 3159 |
| 83 | Ga0070708_100093904 | 3300005445 | Bacteria | 2736 |
| 84 | Ga0070708_100111438 | 3300005445 | Unclassified | 2516 |
| 85 | Ga0070708_100116352 | 3300005445 | Unclassified | 2461 |
| 86 | Ga0070708_100116556 | 3300005445 | Bacteria | 2459 |
| 87 | Ga0070708_100123730 | 3300005445 | Bacteria | 2388 |
| 88 | Ga0070708_100148423 | 3300005445 | Bacteria | 2179 |
| 89 | Ga0070708_100169282 | 3300005445 | Bacteria | 2039 |
| 90 | Ga0070708_100326565 | 3300005445 | Bacteria | 1445 |
| 91 | Ga0070708_100329136 | 3300005445 | Bacteria | 1439 |
| 92 | Ga0070708_100378973 | 3300005445 | Bacteria | 1334 |
| 93 | Ga0070708_100481776 | 3300005445 | Unclassified | 1170 |
| 94 | Ga0070708_100482530 | 3300005445 | Bacteria | 1169 |
| 95 | Ga0070708_100597147 | 3300005445 | Bacteria | 1041 |
| 96 | Ga0070708_100664196 | 3300005445 | Bacteria | 982 |
| 97 | Ga0070708_101137298 | 3300005445 | Bacteria | 731 |
| 98 | Ga0070708_101481238 | 3300005445 | Archaea | 632 |
| 99 | Ga0070708_101647589 | 3300005445 | Bacteria | 597 |
| 100 | Ga0070663_101249291 | 3300005455 | Bacteria | 654 |
| 101 | Ga0070678_100025557 | 3300005456 | Bacteria | 3975 |
| 102 | Ga0070678_100896143 | 3300005456 | Bacteria | 811 |
| 103 | Ga0070678_101357755 | 3300005456 | Bacteria | 663 |
| 104 | Ga0070662_100225858 | 3300005457 | Bacteria | 1496 |
| 105 | Ga0070662_100583459 | 3300005457 | Bacteria | 939 |
| 106 | Ga0068867_100294243 | 3300005459 | Bacteria | 1336 |
| 107 | Ga0068867_100640943 | 3300005459 | Unclassified | 931 |
| 108 | Ga0068867_101305548 | 3300005459 | Bacteria | 670 |
| 109 | Ga0070706_100000355 | 3300005467 | Bacteria | 55169 |
| 110 | Ga0070706_100000937 | 3300005467 | Bacteria | 31912 |
| 111 | Ga0070706_100001208 | 3300005467 | Bacteria | 27646 |
| 112 | Ga0070706_100001868 | 3300005467 | Bacteria | 21749 |
| 113 | Ga0070706_100003296 | 3300005467 | Bacteria | 15967 |
| 114 | Ga0070706_100004086 | 3300005467 | Bacteria | 14191 |
| 115 | Ga0070706_100005466 | 3300005467 | Bacteria | 12101 |
| 116 | Ga0070706_100008455 | 3300005467 | Bacteria | 9588 |
| 117 | Ga0070706_100009642 | 3300005467 | Bacteria | 8977 |
| 118 | Ga0070706_100017130 | 3300005467 | Bacteria | 6695 |
| 119 | Ga0070706_100023927 | 3300005467 | Bacteria | 5624 |
| 120 | Ga0070706_100024051 | 3300005467 | Bacteria | 5609 |
| 121 | Ga0070706_100029036 | 3300005467 | Bacteria | 5094 |
| 122 | Ga0070706_100043904 | 3300005467 | Bacteria | 4129 |
| 123 | Ga0070706_100070652 | 3300005467 | Bacteria | 3229 |
| 124 | Ga0070706_100089062 | 3300005467 | Bacteria | 2862 |
| 125 | Ga0070706_100105028 | 3300005467 | Bacteria | 2628 |
| 126 | Ga0070706_100114210 | 3300005467 | Bacteria | 2514 |
| 127 | Ga0070706_100121291 | 3300005467 | Bacteria | 2437 |
| 128 | Ga0070706_100155284 | 3300005467 | Bacteria | 2136 |
| 129 | Ga0070706_100194968 | 3300005467 | Bacteria | 1892 |
| 130 | Ga0070706_100256929 | 3300005467 | Bacteria | 1631 |
| 131 | Ga0070706_100321619 | 3300005467 | Bacteria | 1443 |
| 132 | Ga0070706_100517004 | 3300005467 | Bacteria | 1110 |
| 133 | Ga0070706_100611951 | 3300005467 | Bacteria | 1012 |
| 134 | Ga0070706_100760183 | 3300005467 | Bacteria | 898 |
| 135 | Ga0070706_100979686 | 3300005467 | Unclassified | 780 |
| 136 | Ga0070706_101192515 | 3300005467 | Unclassified | 700 |
| 137 | Ga0070707_100000762 | 3300005468 | Bacteria | 31790 |
| 138 | Ga0070707_100000793 | 3300005468 | Bacteria | 31219 |
| 139 | Ga0070707_100003826 | 3300005468 | Bacteria | 14191 |
| 140 | Ga0070707_100006232 | 3300005468 | Bacteria | 11102 |
| 141 | Ga0070707_100008729 | 3300005468 | Bacteria | 9398 |
| 142 | Ga0070707_100010515 | 3300005468 | Bacteria | 8622 |
| 143 | Ga0070707_100017247 | 3300005468 | Bacteria | 6786 |
| 144 | Ga0070707_100018505 | 3300005468 | Bacteria | 6554 |
| 145 | Ga0070707_100020220 | 3300005468 | Bacteria | 6277 |
| 146 | Ga0070707_100034004 | 3300005468 | Bacteria | 4862 |
| 147 | Ga0070707_100037785 | 3300005468 | Bacteria | 4610 |
| 148 | Ga0070707_100052540 | 3300005468 | Bacteria | 3907 |
| 149 | Ga0070707_100067641 | 3300005468 | Bacteria | 3437 |
| 150 | Ga0070707_100068793 | 3300005468 | Bacteria | 3408 |
| 151 | Ga0070707_100073346 | 3300005468 | Bacteria | 3300 |
| 152 | Ga0070707_100102269 | 3300005468 | Bacteria | 2776 |
| 153 | Ga0070707_100103892 | 3300005468 | Bacteria | 2754 |
| 154 | Ga0070707_100119600 | 3300005468 | Bacteria | 2557 |
| 155 | Ga0070707_100204939 | 3300005468 | Bacteria | 1922 |
| 156 | Ga0070707_100210348 | 3300005468 | Bacteria | 1896 |
| 157 | Ga0070707_100211856 | 3300005468 | Bacteria | 1888 |
| 158 | Ga0070707_100263776 | 3300005468 | Bacteria | 1675 |
| 159 | Ga0070707_100275584 | 3300005468 | Unclassified | 1635 |
| 160 | Ga0070707_100275738 | 3300005468 | Unclassified | 1635 |
| 161 | Ga0070707_100283545 | 3300005468 | Unclassified | 1610 |
| 162 | Ga0070707_100288035 | 3300005468 | Bacteria | 1596 |
| 163 | Ga0070707_100296061 | 3300005468 | Bacteria | 1572 |
| 164 | Ga0070707_100494691 | 3300005468 | Bacteria | 1184 |
| 165 | Ga0070707_100520646 | 3300005468 | Bacteria | 1151 |
| 166 | Ga0070707_100698561 | 3300005468 | Bacteria | 977 |
| 167 | Ga0070707_100723383 | 3300005468 | Bacteria | 958 |
| 168 | Ga0070707_100738781 | 3300005468 | Unclassified | 947 |
| 169 | Ga0070707_100835976 | 3300005468 | Bacteria | 885 |
| 170 | Ga0070707_100891925 | 3300005468 | Bacteria | 854 |
| 171 | Ga0070707_100928908 | 3300005468 | Unclassified | 835 |
| 172 | Ga0070707_100954612 | 3300005468 | Bacteria | 822 |
| 173 | Ga0070707_101018576 | 3300005468 | Bacteria | 793 |
| 174 | Ga0070707_101273599 | 3300005468 | Unclassified | 701 |
| 175 | Ga0070707_101370771 | 3300005468 | Unclassified | 674 |
| 176 | Ga0070707_101378656 | 3300005468 | Bacteria | 671 |
| 177 | Ga0070707_101687330 | 3300005468 | Bacteria | 601 |
| 178 | Ga0070698_100000448 | 3300005471 | Bacteria | 43798 |
| 179 | Ga0070698_100001509 | 3300005471 | Bacteria | 25802 |
| 180 | Ga0070698_100004279 | 3300005471 | Bacteria | 15698 |
| 181 | Ga0070698_100005770 | 3300005471 | Bacteria | 13538 |
| 182 | Ga0070698_100015160 | 3300005471 | Bacteria | 8150 |
| 183 | Ga0070698_100018758 | 3300005471 | Bacteria | 7282 |
| 184 | Ga0070698_100020451 | 3300005471 | Bacteria | 6938 |
| 185 | Ga0070698_100027998 | 3300005471 | Bacteria | 5856 |
| 186 | Ga0070698_100030365 | 3300005471 | Bacteria | 5604 |
| 187 | Ga0070698_100034878 | 3300005471 | Bacteria | 5205 |
| 188 | Ga0070698_100047358 | 3300005471 | Bacteria | 4395 |
| 189 | Ga0070698_100072371 | 3300005471 | Bacteria | 3455 |
| 190 | Ga0070698_100072567 | 3300005471 | Bacteria | 3450 |
| 191 | Ga0070698_100083498 | 3300005471 | Bacteria | 3183 |
| 192 | Ga0070698_100124437 | 3300005471 | Bacteria | 2536 |
| 193 | Ga0070698_100161743 | 3300005471 | Bacteria | 2182 |
| 194 | Ga0070698_100176031 | 3300005471 | Bacteria | 2079 |
| 195 | Ga0070698_100225157 | 3300005471 | Bacteria | 1809 |
| 196 | Ga0070698_100288059 | 3300005471 | Bacteria | 1573 |
| 197 | Ga0070698_100297529 | 3300005471 | Unclassified | 1545 |
| 198 | Ga0070698_100333414 | 3300005471 | Unclassified | 1448 |
| 199 | Ga0070698_100337157 | 3300005471 | Unclassified | 1439 |
| 200 | Ga0070698_100476027 | 3300005471 | Bacteria | 1185 |
| 201 | Ga0070698_100507252 | 3300005471 | Bacteria | 1144 |
| 202 | Ga0070698_100661976 | 3300005471 | Bacteria | 985 |
| 203 | Ga0070698_100694404 | 3300005471 | Bacteria | 959 |
| 204 | Ga0070698_100706197 | 3300005471 | Bacteria | 951 |
| 205 | Ga0070698_100823749 | 3300005471 | Bacteria | 872 |
| 206 | Ga0070698_100984801 | 3300005471 | Unclassified | 790 |
| 207 | Ga0070698_101543788 | 3300005471 | Bacteria | 616 |
| 208 | Ga0070699_100000805 | 3300005518 | Bacteria | 28976 |
| 209 | Ga0070699_100000806 | 3300005518 | Bacteria | 28959 |
| 210 | Ga0070699_100001002 | 3300005518 | Bacteria | 26266 |
| 211 | Ga0070699_100002301 | 3300005518 | Bacteria | 17189 |
| 212 | Ga0070699_100002562 | 3300005518 | Bacteria | 16308 |
| 213 | Ga0070699_100027236 | 3300005518 | Bacteria | 4931 |
| 214 | Ga0070699_100034048 | 3300005518 | Bacteria | 4402 |
| 215 | Ga0070699_100072460 | 3300005518 | Bacteria | 2996 |
| 216 | Ga0070699_100073844 | 3300005518 | Bacteria | 2967 |
| 217 | Ga0070699_100113091 | 3300005518 | Bacteria | 2385 |
| 218 | Ga0070699_100142317 | 3300005518 | Bacteria | 2119 |
| 219 | Ga0070699_100157927 | 3300005518 | Bacteria | 2007 |
| 220 | Ga0070699_100160050 | 3300005518 | Bacteria | 1992 |
| 221 | Ga0070699_100162891 | 3300005518 | Bacteria | 1974 |
| 222 | Ga0070699_100209132 | 3300005518 | Bacteria | 1736 |
| 223 | Ga0070699_100245449 | 3300005518 | Bacteria | 1599 |
| 224 | Ga0070699_100252521 | 3300005518 | Bacteria | 1576 |
| 225 | Ga0070699_100262920 | 3300005518 | Bacteria | 1543 |
| 226 | Ga0070699_100278332 | 3300005518 | Bacteria | 1498 |
| 227 | Ga0070699_100374023 | 3300005518 | Bacteria | 1286 |
| 228 | Ga0070699_100428107 | 3300005518 | Bacteria | 1198 |
| 229 | Ga0070699_100614139 | 3300005518 | Bacteria | 992 |
| 230 | Ga0070699_100703201 | 3300005518 | Bacteria | 923 |
| 231 | Ga0070699_100843735 | 3300005518 | Bacteria | 839 |
| 232 | Ga0070699_100910556 | 3300005518 | Bacteria | 806 |
| 233 | Ga0070699_100921109 | 3300005518 | Unclassified | 801 |
| 234 | Ga0070699_101148150 | 3300005518 | Bacteria | 713 |
| 235 | Ga0070699_101507130 | 3300005518 | Bacteria | 617 |
| 236 | Ga0070679_100503126 | 3300005530 | Bacteria | 1156 |
| 237 | Ga0070684_100100508 | 3300005535 | Bacteria | 2583 |
| 238 | Ga0070697_100000001 | 3300005536 | Bacteria | 662298 |
| 239 | Ga0070697_100000091 | 3300005536 | Bacteria | 75795 |
| 240 | Ga0070697_100001138 | 3300005536 | Bacteria | 20124 |
| 241 | Ga0070697_100003405 | 3300005536 | Bacteria | 12224 |
| 242 | Ga0070697_100013735 | 3300005536 | Bacteria | 6352 |
| 243 | Ga0070697_100014014 | 3300005536 | Bacteria | 6296 |
| 244 | Ga0070697_100035202 | 3300005536 | Bacteria | 4038 |
| 245 | Ga0070697_100113143 | 3300005536 | Unclassified | 2264 |
| 246 | Ga0070697_100118383 | 3300005536 | Bacteria | 2213 |
| 247 | Ga0070697_100157200 | 3300005536 | Bacteria | 1919 |
| 248 | Ga0070697_100163034 | 3300005536 | Unclassified | 1884 |
| 249 | Ga0070697_100250655 | 3300005536 | Unclassified | 1514 |
| 250 | Ga0070697_100364974 | 3300005536 | Bacteria | 1249 |
| 251 | Ga0070697_100366744 | 3300005536 | Unclassified | 1246 |
| 252 | Ga0070697_100453299 | 3300005536 | Bacteria | 1117 |
| 253 | Ga0070697_100752019 | 3300005536 | Bacteria | 861 |
| 254 | Ga0070697_100784801 | 3300005536 | Bacteria | 842 |
| 255 | Ga0070697_100805120 | 3300005536 | Bacteria | 831 |
| 256 | Ga0070695_100042084 | 3300005545 | Bacteria | 2899 |
| 257 | Ga0070695_100089868 | 3300005545 | Bacteria | 2048 |
| 258 | Ga0070695_100176422 | 3300005545 | Bacteria | 1511 |
| 259 | Ga0070695_100282030 | 3300005545 | Unclassified | 1221 |
| 260 | Ga0070695_100407124 | 3300005545 | Bacteria | 1033 |
| 261 | Ga0070695_101714729 | 3300005545 | Bacteria | 526 |
| 262 | Ga0070696_100083788 | 3300005546 | Bacteria | 2262 |
| 263 | Ga0070696_100119666 | 3300005546 | Bacteria | 1905 |
| 264 | Ga0070696_100151302 | 3300005546 | Bacteria | 1703 |
| 265 | Ga0070696_100176578 | 3300005546 | Bacteria | 1582 |
| 266 | Ga0070696_100508343 | 3300005546 | Bacteria | 959 |
| 267 | Ga0070696_101044899 | 3300005546 | Bacteria | 684 |
| 268 | Ga0070696_101564741 | 3300005546 | Unclassified | 566 |
| 269 | Ga0070696_101618710 | 3300005546 | Bacteria | 557 |
| 270 | Ga0070704_100004211 | 3300005549 | Bacteria | 8306 |
| 271 | Ga0070704_100004802 | 3300005549 | Bacteria | 7829 |
| 272 | Ga0070704_100013491 | 3300005549 | Bacteria | 5071 |
| 273 | Ga0070704_100057432 | 3300005549 | Bacteria | 2767 |
| 274 | Ga0070704_100273876 | 3300005549 | Bacteria | 1396 |
| 275 | Ga0070704_100378470 | 3300005549 | Bacteria | 1202 |
| 276 | Ga0070704_100614087 | 3300005549 | Bacteria | 957 |
| 277 | Ga0070704_100804223 | 3300005549 | Unclassified | 840 |
| 278 | Ga0070704_100867811 | 3300005549 | Bacteria | 810 |
| 279 | Ga0068857_100034650 | 3300005577 | Bacteria | 4465 |
| 280 | Ga0068857_100157245 | 3300005577 | Bacteria | 2061 |
| 281 | Ga0068857_100234623 | 3300005577 | Bacteria | 1678 |
| 282 | Ga0068854_100075271 | 3300005578 | Unclassified | 2478 |
| 283 | Ga0068856_100871248 | 3300005614 | Bacteria | 920 |
| 284 | Ga0068852_100376358 | 3300005616 | Bacteria | 1392 |
| 285 | Ga0068859_101712233 | 3300005617 | Unclassified | 694 |
| 286 | Ga0068864_100116724 | 3300005618 | Bacteria | 2382 |
| 287 | Ga0068864_100354344 | 3300005618 | Bacteria | 1385 |
| 288 | Ga0068864_100477933 | 3300005618 | Unclassified | 1196 |
| 289 | Ga0068866_10130013 | 3300005718 | Bacteria | 1431 |
| 290 | Ga0068861_100009800 | 3300005719 | Bacteria | 6625 |
| 291 | Ga0068861_100232452 | 3300005719 | Bacteria | 1564 |
| 292 | Ga0068861_100595320 | 3300005719 | Bacteria | 1014 |
| 293 | Ga0068870_10909465 | 3300005840 | Bacteria | 622 |
| 294 | Ga0068870_11078851 | 3300005840 | Bacteria | 576 |
| 295 | Ga0068863_100537165 | 3300005841 | Bacteria | 1154 |
| 296 | Ga0068863_101728879 | 3300005841 | Bacteria | 635 |
| 297 | Ga0068863_101831051 | 3300005841 | Bacteria | 617 |
| 298 | Ga0068858_100114858 | 3300005842 | Bacteria | 2515 |
| 299 | Ga0081455_10617997 | 3300005937 | Bacteria | 703 |
| 300 | Ga0081539_10002337 | 3300005985 | Bacteria | 27268 |
| 301 | Ga0070717_10000078 | 3300006028 | Bacteria | 80104 |
| 302 | Ga0070717_10005470 | 3300006028 | Bacteria | 9272 |
| 303 | Ga0070717_10009434 | 3300006028 | Bacteria | 7334 |
| 304 | Ga0070717_10034108 | 3300006028 | Bacteria | 4111 |
| 305 | Ga0070717_10051517 | 3300006028 | Bacteria | 3388 |
| 306 | Ga0070717_10065336 | 3300006028 | Bacteria | 3024 |
| 307 | Ga0070717_10092109 | 3300006028 | Bacteria | 2560 |
| 308 | Ga0070717_10129914 | 3300006028 | Bacteria | 2165 |
| 309 | Ga0070717_10391375 | 3300006028 | Bacteria | 1247 |
| 310 | Ga0070717_10682940 | 3300006028 | Unclassified | 933 |
| 311 | Ga0070717_11753211 | 3300006028 | Unclassified | 561 |
| 312 | Ga0075365_10127565 | 3300006038 | Bacteria | 1759 |
| 313 | Ga0075432_10031665 | 3300006058 | Bacteria | 1831 |
| 314 | Ga0070715_10032915 | 3300006163 | Bacteria | 2115 |
| 315 | Ga0070715_10218674 | 3300006163 | Bacteria | 978 |
| 316 | Ga0070716_100004566 | 3300006173 | Bacteria | 6634 |
| 317 | Ga0070716_100030432 | 3300006173 | Bacteria | 2928 |
| 318 | Ga0070716_100040061 | 3300006173 | Bacteria | 2604 |
| 319 | Ga0070716_100054229 | 3300006173 | Bacteria | 2289 |
| 320 | Ga0070716_100094475 | 3300006173 | Bacteria | 1818 |
| 321 | Ga0070716_100311114 | 3300006173 | Bacteria | 1100 |
| 322 | Ga0070716_100868124 | 3300006173 | Bacteria | 704 |
| 323 | Ga0070712_100004266 | 3300006175 | Bacteria | 8797 |
| 324 | Ga0070712_100069668 | 3300006175 | Bacteria | 2510 |
| 325 | Ga0070712_100094999 | 3300006175 | Bacteria | 2192 |
| 326 | Ga0070712_100189248 | 3300006175 | Bacteria | 1609 |
| 327 | Ga0070712_100367796 | 3300006175 | Bacteria | 1181 |
| 328 | Ga0070712_100852126 | 3300006175 | Unclassified | 784 |
| 329 | Ga0068871_100250162 | 3300006358 | Unclassified | 1544 |
| 330 | Ga0068871_101367791 | 3300006358 | Bacteria | 667 |
| 331 | Ga0075428_100014419 | 3300006844 | Bacteria | 8781 |
| 332 | Ga0075428_100248935 | 3300006844 | Bacteria | 1916 |
| 333 | Ga0075428_100330118 | 3300006844 | Bacteria | 1638 |
| 334 | Ga0075428_100810221 | 3300006844 | Unclassified | 995 |
| 335 | Ga0075428_101510144 | 3300006844 | Unclassified | 704 |
| 336 | Ga0075430_100175215 | 3300006846 | Bacteria | 1784 |
| 337 | Ga0075431_100210148 | 3300006847 | Bacteria | 1988 |
| 338 | Ga0075431_100403679 | 3300006847 | Bacteria | 1367 |
| 339 | Ga0075431_100779647 | 3300006847 | Bacteria | 930 |
| 340 | Ga0075431_100780964 | 3300006847 | Bacteria | 929 |
| 341 | Ga0075431_101199765 | 3300006847 | Bacteria | 722 |
| 342 | Ga0075433_10032631 | 3300006852 | Bacteria | 4461 |
| 343 | Ga0075433_10291039 | 3300006852 | Unclassified | 1446 |
| 344 | Ga0075433_10371449 | 3300006852 | Bacteria | 1263 |
| 345 | Ga0075433_11294707 | 3300006852 | Bacteria | 632 |
| 346 | Ga0075433_11974890 | 3300006852 | Bacteria | 500 |
| 347 | Ga0075434_100015933 | 3300006871 | Bacteria | 7221 |
| 348 | Ga0075434_100021534 | 3300006871 | Bacteria | 6267 |
| 349 | Ga0075434_100084830 | 3300006871 | Bacteria | 3166 |
| 350 | Ga0075434_100230026 | 3300006871 | Bacteria | 1873 |
| 351 | Ga0075434_100234879 | 3300006871 | Bacteria | 1853 |
| 352 | Ga0075434_100548534 | 3300006871 | Bacteria | 1176 |
| 353 | Ga0075434_101161390 | 3300006871 | Bacteria | 785 |
| 354 | Ga0075434_101314150 | 3300006871 | Bacteria | 734 |
| 355 | Ga0075434_101592477 | 3300006871 | Bacteria | 662 |
| 356 | Ga0075434_101685726 | 3300006871 | Bacteria | 642 |
| 357 | Ga0075434_102078831 | 3300006871 | Bacteria | 573 |
| 358 | Ga0075429_101359648 | 3300006880 | Bacteria | 619 |
| 359 | Ga0068865_100237916 | 3300006881 | Bacteria | 1431 |
| 360 | Ga0068865_100381844 | 3300006881 | Bacteria | 1149 |
| 361 | Ga0068865_100415425 | 3300006881 | Bacteria | 1105 |
| 362 | Ga0068865_100782138 | 3300006881 | Bacteria | 822 |
| 363 | Ga0075436_100031969 | 3300006914 | Bacteria | 3626 |
| 364 | Ga0075436_100053527 | 3300006914 | Bacteria | 2786 |
| 365 | Ga0075436_100067414 | 3300006914 | Bacteria | 2473 |
| 366 | Ga0075436_100099996 | 3300006914 | Bacteria | 2019 |
| 367 | Ga0075436_100146037 | 3300006914 | Bacteria | 1663 |
| 368 | Ga0075436_100326720 | 3300006914 | Bacteria | 1102 |
| 369 | Ga0075436_100346388 | 3300006914 | Bacteria | 1070 |
| 370 | Ga0075436_100437866 | 3300006914 | Bacteria | 951 |
| 371 | Ga0075436_100499728 | 3300006914 | Bacteria | 889 |
| 372 | Ga0075436_100569326 | 3300006914 | Bacteria | 833 |
| 373 | Ga0075436_100993512 | 3300006914 | Bacteria | 630 |
| 374 | Ga0097620_100699736 | 3300006931 | Bacteria | 1104 |
| 375 | Ga0097620_101712551 | 3300006931 | Unclassified | 694 |
| 376 | Ga0075435_100035672 | 3300007076 | Bacteria | 3947 |
| 377 | Ga0075435_100053053 | 3300007076 | Plasmid | 3268 |
| 378 | Ga0075435_100093290 | 3300007076 | Bacteria | 2487 |
| 379 | Ga0075435_100260853 | 3300007076 | Bacteria | 1476 |
| 380 | Ga0075435_100453835 | 3300007076 | Bacteria | 1105 |
| 381 | Ga0075435_100464997 | 3300007076 | Bacteria | 1091 |
| 382 | Ga0075435_100469068 | 3300007076 | Unclassified | 1086 |
| 383 | Ga0075435_101162429 | 3300007076 | Bacteria | 675 |
| 384 | Ga0099794_10009761 | 3300007265 | Bacteria | 4051 |
| 385 | Ga0099794_10061960 | 3300007265 | Bacteria | 1818 |
| 386 | Ga0099794_10149093 | 3300007265 | Unclassified | 1187 |
| 387 | Ga0099794_10196163 | 3300007265 | Bacteria | 1033 |
| 388 | Ga0099795_10055352 | 3300007788 | Bacteria | 1457 |
| 389 | Ga0099795_10098025 | 3300007788 | Bacteria | 1146 |
| 390 | Ga0099795_10144718 | 3300007788 | Bacteria | 969 |
| 391 | Ga0105251_10121122 | 3300009011 | Unclassified | 1188 |
| 392 | Ga0111539_10007869 | 3300009094 | Bacteria | 13610 |
| 393 | Ga0111539_10089009 | 3300009094 | Bacteria | 3627 |
| 394 | Ga0111539_10220914 | 3300009094 | Bacteria | 2207 |
| 395 | Ga0111539_10521842 | 3300009094 | Bacteria | 1384 |
| 396 | Ga0105245_10060620 | 3300009098 | Bacteria | 3407 |
| 397 | Ga0105245_10658782 | 3300009098 | Bacteria | 1077 |
| 398 | Ga0105245_10898693 | 3300009098 | Unclassified | 927 |
| 399 | Ga0105245_10907345 | 3300009098 | Bacteria | 923 |
| 400 | Ga0105245_11830501 | 3300009098 | Bacteria | 660 |
| 401 | Ga0105247_10379024 | 3300009101 | Bacteria | 1002 |
| 402 | Ga0114129_10007918 | 3300009147 | Bacteria | 15129 |
| 403 | Ga0114129_10072023 | 3300009147 | Bacteria | 4818 |
| 404 | Ga0114129_10185240 | 3300009147 | Bacteria | 2830 |
| 405 | Ga0114129_10264924 | 3300009147 | Bacteria | 2301 |
| 406 | Ga0114129_10351522 | 3300009147 | Bacteria | 1952 |
| 407 | Ga0114129_10361615 | 3300009147 | Bacteria | 1920 |
| 408 | Ga0114129_10919516 | 3300009147 | Bacteria | 1107 |
| 409 | Ga0114129_11069609 | 3300009147 | Unclassified | 1012 |
| 410 | Ga0114129_11189327 | 3300009147 | Bacteria | 950 |
| 411 | Ga0114129_11722820 | 3300009147 | Unclassified | 764 |
| 412 | Ga0105243_10062331 | 3300009148 | Bacteria | 2985 |
| 413 | Ga0105243_10074659 | 3300009148 | Bacteria | 2750 |
| 414 | Ga0105243_10100578 | 3300009148 | Bacteria | 2399 |
| 415 | Ga0105243_10173929 | 3300009148 | Bacteria | 1867 |
| 416 | Ga0105243_10366092 | 3300009148 | Bacteria | 1329 |
| 417 | Ga0105243_10565969 | 3300009148 | Bacteria | 1088 |
| 418 | Ga0105241_11333572 | 3300009174 | Unclassified | 685 |
| 419 | Ga0105241_11642247 | 3300009174 | Bacteria | 623 |
| 420 | Ga0105242_10036378 | 3300009176 | Bacteria | 3950 |
| 421 | Ga0105242_10064171 | 3300009176 | Bacteria | 3026 |
| 422 | Ga0105242_10186921 | 3300009176 | Bacteria | 1831 |
| 423 | Ga0105242_10463724 | 3300009176 | Bacteria | 1197 |
| 424 | Ga0105242_10650216 | 3300009176 | Bacteria | 1025 |
| 425 | Ga0105242_11752391 | 3300009176 | Bacteria | 658 |
| 426 | Ga0105248_10039370 | 3300009177 | Bacteria | 5293 |
| 427 | Ga0105248_12042724 | 3300009177 | Bacteria | 651 |
| 428 | Ga0105249_11305342 | 3300009553 | Unclassified | 797 |
| 429 | Ga0105239_10079574 | 3300010375 | Bacteria | 3606 |
| 430 | Ga0105239_10372244 | 3300010375 | Bacteria | 1614 |
| 431 | Ga0105246_10147894 | 3300011119 | Unclassified | 1775 |
| 432 | Ga0105246_10420980 | 3300011119 | Bacteria | 1115 |
| 433 | Ga0105246_10835859 | 3300011119 | Bacteria | 820 |
| 434 | Ga0157370_10756507 | 3300013104 | Bacteria | 885 |
| 435 | Ga0157369_10073440 | 3300013105 | Bacteria | 3670 |
| 436 | Ga0157369_10097558 | 3300013105 | Bacteria | 3135 |
| 437 | Ga0157374_10498194 | 3300013296 | Bacteria | 1222 |
| 438 | Ga0157374_10516932 | 3300013296 | Bacteria | 1200 |
| 439 | Ga0157378_10008857 | 3300013297 | Bacteria | 8757 |
| 440 | Ga0157378_10069094 | 3300013297 | Unclassified | 3168 |
| 441 | Ga0157378_10095271 | 3300013297 | Bacteria | 2711 |
| 442 | Ga0157378_10331098 | 3300013297 | Bacteria | 1482 |
| 443 | Ga0157378_11301129 | 3300013297 | Bacteria | 768 |
| 444 | Ga0157378_11304838 | 3300013297 | Bacteria | 767 |
| 445 | Ga0157378_12059674 | 3300013297 | Unclassified | 621 |
| 446 | Ga0163162_10056620 | 3300013306 | Bacteria | 3948 |
| 447 | Ga0163162_11273827 | 3300013306 | Bacteria | 835 |
| 448 | Ga0163162_12147973 | 3300013306 | Unclassified | 641 |
| 449 | Ga0163162_12707613 | 3300013306 | Bacteria | 571 |
| 450 | Ga0157372_10682861 | 3300013307 | Bacteria | 1195 |
| 451 | Ga0157375_10165078 | 3300013308 | Bacteria | 2359 |
| 452 | Ga0157375_10303229 | 3300013308 | Bacteria | 1761 |
| 453 | Ga0157375_10403236 | 3300013308 | Bacteria | 1534 |
| 454 | Ga0157375_10808797 | 3300013308 | Bacteria | 1086 |
| 455 | Ga0163163_10202896 | 3300014325 | Bacteria | 2031 |
| 456 | Ga0163163_10775761 | 3300014325 | Bacteria | 1022 |
| 457 | Ga0163163_11291165 | 3300014325 | Bacteria | 792 |
| 458 | Ga0163163_11437779 | 3300014325 | Unclassified | 751 |
| 459 | Ga0157380_10210813 | 3300014326 | Bacteria | 1731 |
| 460 | Ga0157380_10604598 | 3300014326 | Bacteria | 1085 |
| 461 | Ga0157380_11717158 | 3300014326 | Unclassified | 686 |
| 462 | Ga0157380_12404822 | 3300014326 | Bacteria | 592 |
| 463 | Ga0157380_12438336 | 3300014326 | Bacteria | 588 |
| 464 | Ga0157377_10141281 | 3300014745 | Bacteria | 1480 |
| 465 | Ga0157377_10374686 | 3300014745 | Bacteria | 962 |
| 466 | Ga0157379_10191735 | 3300014968 | Bacteria | 1847 |
| 467 | Ga0157379_10346741 | 3300014968 | Bacteria | 1359 |
| 468 | Ga0157379_11222073 | 3300014968 | Bacteria | 723 |
| 469 | Ga0157379_11372113 | 3300014968 | Bacteria | 684 |
| 470 | Ga0157379_11482785 | 3300014968 | Bacteria | 659 |
| 471 | Ga0157376_10049673 | 3300014969 | Bacteria | 3476 |
| 472 | Ga0157376_12833348 | 3300014969 | Bacteria | 525 |
| 473 | Ga0163161_10088071 | 3300017792 | Bacteria | 2294 |
| 474 | Ga0224572_1006688 | 3300024225 | Bacteria | 2090 |
| 475 | Ga0228598_1013894 | 3300024227 | Bacteria | 1593 |
| 476 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 477 | Ga0209147_100370 | 3300025229 | Bacteria | 31762 |
| 478 | Ga0209258_101558 | 3300025242 | Bacteria | 7663 |
| 479 | Ga0209148_1000152 | 3300025254 | Bacteria | 153782 |
| 480 | Ga0209455_1000134 | 3300025272 | Bacteria | 153783 |
| 481 | Ga0207653_10020950 | 3300025885 | Bacteria | 2072 |
| 482 | Ga0207692_10065337 | 3300025898 | Bacteria | 1897 |
| 483 | Ga0207692_10193998 | 3300025898 | Bacteria | 1190 |
| 484 | Ga0207642_10136974 | 3300025899 | Bacteria | 1285 |
| 485 | Ga0207647_10046513 | 3300025904 | Bacteria | 2704 |
| 486 | Ga0207685_10012820 | 3300025905 | Bacteria | 2572 |
| 487 | Ga0207685_10032117 | 3300025905 | Bacteria | 1887 |
| 488 | Ga0207685_10161047 | 3300025905 | Bacteria | 1025 |
| 489 | Ga0207685_10298442 | 3300025905 | Bacteria | 796 |
| 490 | Ga0207699_10002909 | 3300025906 | Bacteria | 8135 |
| 491 | Ga0207684_10000006 | 3300025910 | Bacteria | 688605 |
| 492 | Ga0207684_10000084 | 3300025910 | Bacteria | 176027 |
| 493 | Ga0207684_10000583 | 3300025910 | Bacteria | 44299 |
| 494 | Ga0207684_10000970 | 3300025910 | Bacteria | 32131 |
| 495 | Ga0207684_10000988 | 3300025910 | Bacteria | 31913 |
| 496 | Ga0207684_10001237 | 3300025910 | Bacteria | 28369 |
| 497 | Ga0207684_10001698 | 3300025910 | Bacteria | 23386 |
| 498 | Ga0207684_10003801 | 3300025910 | Bacteria | 14564 |
| 499 | Ga0207684_10004915 | 3300025910 | Bacteria | 12473 |
| 500 | Ga0207684_10005817 | 3300025910 | Bacteria | 11301 |
| 501 | Ga0207684_10007853 | 3300025910 | Bacteria | 9542 |
| 502 | Ga0207684_10014884 | 3300025910 | Bacteria | 6694 |
| 503 | Ga0207684_10022460 | 3300025910 | Bacteria | 5385 |
| 504 | Ga0207684_10041420 | 3300025910 | Bacteria | 3905 |
| 505 | Ga0207684_10121985 | 3300025910 | Bacteria | 2234 |
| 506 | Ga0207684_10175478 | 3300025910 | Bacteria | 1848 |
| 507 | Ga0207684_10221687 | 3300025910 | Bacteria | 1632 |
| 508 | Ga0207684_10290721 | 3300025910 | Bacteria | 1409 |
| 509 | Ga0207684_10291849 | 3300025910 | Bacteria | 1406 |
| 510 | Ga0207684_10344372 | 3300025910 | Bacteria | 1283 |
| 511 | Ga0207684_10351918 | 3300025910 | Bacteria | 1268 |
| 512 | Ga0207684_10437446 | 3300025910 | Bacteria | 1123 |
| 513 | Ga0207684_10454937 | 3300025910 | Bacteria | 1099 |
| 514 | Ga0207684_10585385 | 3300025910 | Bacteria | 954 |
| 515 | Ga0207684_10683430 | 3300025910 | Bacteria | 873 |
| 516 | Ga0207684_10686997 | 3300025910 | Bacteria | 870 |
| 517 | Ga0207684_10901021 | 3300025910 | Bacteria | 743 |
| 518 | Ga0207684_11205167 | 3300025910 | Bacteria | 627 |
| 519 | Ga0207695_11284909 | 3300025913 | Bacteria | 612 |
| 520 | Ga0207693_10022761 | 3300025915 | Bacteria | 4976 |
| 521 | Ga0207693_10054771 | 3300025915 | Bacteria | 3128 |
| 522 | Ga0207693_10055489 | 3300025915 | Bacteria | 3108 |
| 523 | Ga0207693_10104924 | 3300025915 | Bacteria | 2216 |
| 524 | Ga0207693_10116021 | 3300025915 | Bacteria | 2102 |
| 525 | Ga0207663_10026630 | 3300025916 | Bacteria | 3359 |
| 526 | Ga0207660_10546659 | 3300025917 | Bacteria | 942 |
| 527 | Ga0207662_10250330 | 3300025918 | Bacteria | 1162 |
| 528 | Ga0207646_10000031 | 3300025922 | Bacteria | 219144 |
| 529 | Ga0207646_10000033 | 3300025922 | Bacteria | 213090 |
| 530 | Ga0207646_10000063 | 3300025922 | Bacteria | 150574 |
| 531 | Ga0207646_10000218 | 3300025922 | Bacteria | 78329 |
| 532 | Ga0207646_10000746 | 3300025922 | Bacteria | 42261 |
| 533 | Ga0207646_10001161 | 3300025922 | Bacteria | 33425 |
| 534 | Ga0207646_10001607 | 3300025922 | Bacteria | 27577 |
| 535 | Ga0207646_10001916 | 3300025922 | Bacteria | 25054 |
| 536 | Ga0207646_10002200 | 3300025922 | Bacteria | 23223 |
| 537 | Ga0207646_10021826 | 3300025922 | Bacteria | 5908 |
| 538 | Ga0207646_10024235 | 3300025922 | Bacteria | 5560 |
| 539 | Ga0207646_10025800 | 3300025922 | Bacteria | 5373 |
| 540 | Ga0207646_10026423 | 3300025922 | Bacteria | 5297 |
| 541 | Ga0207646_10032134 | 3300025922 | Bacteria | 4749 |
| 542 | Ga0207646_10034230 | 3300025922 | Bacteria | 4592 |
| 543 | Ga0207646_10037181 | 3300025922 | Plasmid | 4390 |
| 544 | Ga0207646_10037700 | 3300025922 | Bacteria | 4357 |
| 545 | Ga0207646_10045604 | 3300025922 | Bacteria | 3935 |
| 546 | Ga0207646_10055797 | 3300025922 | Bacteria | 3532 |
| 547 | Ga0207646_10063357 | 3300025922 | Unclassified | 3301 |
| 548 | Ga0207646_10067041 | 3300025922 | Bacteria | 3204 |
| 549 | Ga0207646_10069049 | 3300025922 | Bacteria | 3156 |
| 550 | Ga0207646_10114490 | 3300025922 | Bacteria | 2422 |
| 551 | Ga0207646_10139665 | 3300025922 | Bacteria | 2181 |
| 552 | Ga0207646_10142933 | 3300025922 | Bacteria | 2156 |
| 553 | Ga0207646_10177334 | 3300025922 | Bacteria | 1925 |
| 554 | Ga0207646_10248607 | 3300025922 | Bacteria | 1606 |
| 555 | Ga0207646_10252825 | 3300025922 | Bacteria | 1592 |
| 556 | Ga0207646_10275126 | 3300025922 | Bacteria | 1522 |
| 557 | Ga0207646_10282620 | 3300025922 | Unclassified | 1500 |
| 558 | Ga0207646_10356479 | 3300025922 | Bacteria | 1321 |
| 559 | Ga0207646_10367298 | 3300025922 | Bacteria | 1300 |
| 560 | Ga0207646_10460877 | 3300025922 | Bacteria | 1147 |
| 561 | Ga0207646_10587629 | 3300025922 | Bacteria | 1000 |
| 562 | Ga0207646_10758200 | 3300025922 | Bacteria | 866 |
| 563 | Ga0207646_10902467 | 3300025922 | Bacteria | 784 |
| 564 | Ga0207646_11680241 | 3300025922 | Bacteria | 546 |
| 565 | Ga0207650_10213733 | 3300025925 | Bacteria | 1549 |
| 566 | Ga0207650_10375661 | 3300025925 | Bacteria | 1173 |
| 567 | Ga0207659_10578244 | 3300025926 | Bacteria | 956 |
| 568 | Ga0207687_10302967 | 3300025927 | Bacteria | 1288 |
| 569 | Ga0207687_10493148 | 3300025927 | Bacteria | 1021 |
| 570 | Ga0207687_11138409 | 3300025927 | Bacteria | 670 |
| 571 | Ga0207687_11212068 | 3300025927 | Bacteria | 649 |
| 572 | Ga0207700_10006843 | 3300025928 | Bacteria | 6931 |
| 573 | Ga0207700_10031452 | 3300025928 | Bacteria | 3771 |
| 574 | Ga0207700_10202829 | 3300025928 | Bacteria | 1672 |
| 575 | Ga0207700_10829382 | 3300025928 | Bacteria | 827 |
| 576 | Ga0207664_10015814 | 3300025929 | Bacteria | 5490 |
| 577 | Ga0207664_10019469 | 3300025929 | Bacteria | 5017 |
| 578 | Ga0207664_10032019 | 3300025929 | Bacteria | 4028 |
| 579 | Ga0207664_10032521 | 3300025929 | Bacteria | 3999 |
| 580 | Ga0207664_10095880 | 3300025929 | Bacteria | 2441 |
| 581 | Ga0207664_10263581 | 3300025929 | Unclassified | 1508 |
| 582 | Ga0207664_11037786 | 3300025929 | Bacteria | 734 |
| 583 | Ga0207664_11045222 | 3300025929 | Unclassified | 731 |
| 584 | Ga0207644_10424783 | 3300025931 | Bacteria | 1089 |
| 585 | Ga0207690_10328242 | 3300025932 | Bacteria | 1204 |
| 586 | Ga0207690_10765447 | 3300025932 | Bacteria | 797 |
| 587 | Ga0207706_10527600 | 3300025933 | Bacteria | 1018 |
| 588 | Ga0207706_10680600 | 3300025933 | Bacteria | 880 |
| 589 | Ga0207706_10857952 | 3300025933 | Unclassified | 769 |
| 590 | Ga0207686_10006047 | 3300025934 | Bacteria | 6498 |
| 591 | Ga0207709_10061332 | 3300025935 | Bacteria | 2350 |
| 592 | Ga0207709_10074201 | 3300025935 | Bacteria | 2170 |
| 593 | Ga0207709_10191329 | 3300025935 | Bacteria | 1454 |
| 594 | Ga0207709_10192779 | 3300025935 | Bacteria | 1449 |
| 595 | Ga0207669_10020784 | 3300025937 | Bacteria | 3450 |
| 596 | Ga0207669_10239409 | 3300025937 | Bacteria | 1344 |
| 597 | Ga0207669_10545223 | 3300025937 | Bacteria | 935 |
| 598 | Ga0207704_10139516 | 3300025938 | Bacteria | 1693 |
| 599 | Ga0207665_10021842 | 3300025939 | Bacteria | 4209 |
| 600 | Ga0207665_10026452 | 3300025939 | Bacteria | 3830 |
| 601 | Ga0207665_10065715 | 3300025939 | Bacteria | 2467 |
| 602 | Ga0207665_10117335 | 3300025939 | Bacteria | 1877 |
| 603 | Ga0207665_10156542 | 3300025939 | Bacteria | 1636 |
| 604 | Ga0207711_10273215 | 3300025941 | Bacteria | 1555 |
| 605 | Ga0207689_10096197 | 3300025942 | Bacteria | 2432 |
| 606 | Ga0207661_10052193 | 3300025944 | Bacteria | 3266 |
| 607 | Ga0207651_11293948 | 3300025960 | Bacteria | 655 |
| 608 | Ga0207651_11736826 | 3300025960 | Bacteria | 562 |
| 609 | Ga0207712_10024455 | 3300025961 | Bacteria | 4000 |
| 610 | Ga0207712_10175325 | 3300025961 | Bacteria | 1680 |
| 611 | Ga0207712_10424986 | 3300025961 | Unclassified | 1122 |
| 612 | Ga0207640_10264706 | 3300025981 | Bacteria | 1342 |
| 613 | Ga0207658_10321818 | 3300025986 | Bacteria | 1339 |
| 614 | Ga0207677_10294914 | 3300026023 | Bacteria | 1337 |
| 615 | Ga0207677_10333263 | 3300026023 | Bacteria | 1265 |
| 616 | Ga0207703_10048549 | 3300026035 | Bacteria | 3427 |
| 617 | Ga0207708_10224470 | 3300026075 | Bacteria | 1506 |
| 618 | Ga0207708_10306716 | 3300026075 | Bacteria | 1292 |
| 619 | Ga0207708_10456355 | 3300026075 | Bacteria | 1065 |
| 620 | Ga0207708_10922032 | 3300026075 | Bacteria | 757 |
| 621 | Ga0207708_11253233 | 3300026075 | Bacteria | 649 |
| 622 | Ga0207708_11757772 | 3300026075 | Bacteria | 544 |
| 623 | Ga0207702_10104943 | 3300026078 | Bacteria | 2502 |
| 624 | Ga0207648_10013776 | 3300026089 | Bacteria | 7501 |
| 625 | Ga0207648_10387177 | 3300026089 | Unclassified | 1265 |
| 626 | Ga0207648_11678580 | 3300026089 | Bacteria | 597 |
| 627 | Ga0207676_10227056 | 3300026095 | Bacteria | 1667 |
| 628 | Ga0207676_10542781 | 3300026095 | Bacteria | 1110 |
| 629 | Ga0207676_11165855 | 3300026095 | Bacteria | 763 |
| 630 | Ga0207674_10154834 | 3300026116 | Bacteria | 2247 |
| 631 | Ga0207674_10249365 | 3300026116 | Bacteria | 1722 |
| 632 | Ga0207675_100018630 | 3300026118 | Bacteria | 6478 |
| 633 | Ga0207675_100376962 | 3300026118 | Bacteria | 1394 |
| 634 | Ga0207675_101002978 | 3300026118 | Bacteria | 853 |
| 635 | Ga0207675_101064474 | 3300026118 | Bacteria | 828 |
| 636 | Ga0207683_10054598 | 3300026121 | Bacteria | 3503 |
| 637 | Ga0207683_10176333 | 3300026121 | Bacteria | 1937 |
| 638 | Ga0207683_10501124 | 3300026121 | Bacteria | 1121 |
| 639 | Ga0207683_11245635 | 3300026121 | Bacteria | 689 |
| 640 | Ga0207698_12570365 | 3300026142 | Bacteria | 519 |
| 641 | Ga0209588_1000068 | 3300027671 | Bacteria | 35839 |
| 642 | Ga0209588_1057541 | 3300027671 | Bacteria | 1257 |
| 643 | Ga0207428_10005408 | 3300027907 | Bacteria | 11912 |
| 644 | Ga0207428_10006297 | 3300027907 | Bacteria | 10973 |
| 645 | Ga0207428_10093794 | 3300027907 | Bacteria | 2328 |
| 646 | Ga0207428_11219774 | 3300027907 | Bacteria | 523 |
| 647 | Ga0268266_11212788 | 3300028379 | Bacteria | 730 |
| 648 | Ga0265337_1001280 | 3300028556 | Bacteria | 12624 |
| 649 | Ga0265326_10000946 | 3300028558 | Bacteria | 10474 |
| 650 | Ga0265319_1001192 | 3300028563 | Bacteria | 16077 |
| 651 | Ga0265334_10002226 | 3300028573 | Bacteria | 9125 |
| 652 | Ga0265323_10017550 | 3300028653 | Bacteria | 2778 |
| 653 | Ga0265322_10024912 | 3300028654 | Bacteria | 1712 |
| 654 | Ga0265336_10006771 | 3300028666 | Bacteria | 4106 |
| 655 | Ga0265338_10003705 | 3300028800 | Bacteria | 21275 |
| 656 | Ga0265324_10008561 | 3300029957 | Bacteria | 4059 |
| 657 | Ga0265762_1026280 | 3300030760 | Unclassified | 1089 |
| 658 | Ga0265760_10188056 | 3300031090 | Unclassified | 692 |
| 659 | Ga0265332_10002916 | 3300031238 | Bacteria | 8423 |
| 660 | Ga0265320_10003514 | 3300031240 | Bacteria | 10499 |
| 661 | Ga0265325_10068831 | 3300031241 | Bacteria | 1781 |
| 662 | Ga0265325_10547522 | 3300031241 | Bacteria | 500 |
| 663 | Ga0265340_10001257 | 3300031247 | Bacteria | 14564 |
| 664 | Ga0265339_10005329 | 3300031249 | Bacteria | 8570 |
| 665 | Ga0265339_10215050 | 3300031249 | Bacteria | 942 |
| 666 | Ga0265331_10165003 | 3300031250 | Bacteria | 1003 |
| 667 | Ga0265313_10005391 | 3300031595 | Bacteria | 9433 |
| 668 | Ga0265314_10014104 | 3300031711 | Bacteria | 6416 |
| 669 | Ga0265314_10033265 | 3300031711 | Bacteria | 3783 |
| 670 | Ga0265342_10004204 | 3300031712 | Bacteria | 11445 |
| 671 | Ga0265342_10004500 | 3300031712 | Bacteria | 10938 |
| 672 | Ga0265342_10187349 | 3300031712 | Unclassified | 1131 |
| 673 | Ga0373929_0185795 | 3300035085 | Bacteria | 575 |
| 674 | Ga0373936_0100922 | 3300035113 | Unclassified | 1217 |
| 675 | Ga0373960_0159118 | 3300035121 | Bacteria | 776 |
| 676 | Ga0373943_0123911 | 3300035170 | Bacteria | 1376 |
| 677 | Ga0373946_0227262 | 3300035171 | Bacteria | 903 |
| 678 | Ga0373946_0277237 | 3300035171 | Bacteria | 824 |
| 679 | Ga0373942_0131230 | 3300035207 | Bacteria | 791 |
| 680 | Ga0373962_0116412 | 3300035242 | Bacteria | 848 |
| 681 | Ga0373924_0124290 | 3300035410 | Bacteria | 1121 |
| 682 | Ga0373931_0069434 | 3300035691 | Unclassified | 1920 |
| 683 | Ga0373931_0255414 | 3300035691 | Bacteria | 1067 |
| 684 | Ga0373931_0639409 | 3300035691 | Bacteria | 698 |
| 685 | Ga0373935_0229495 | 3300035692 | Bacteria | 1292 |
| 686 | Ga0373933_0159426 | 3300035724 | Bacteria | 1432 |
| 687 | Ga0373933_0231057 | 3300035724 | Bacteria | 1188 |
| 688 | Ga0373947_0302389 | 3300035725 | Bacteria | 1067 |
| 689 | Ga0373947_1153116 | 3300035725 | Bacteria | 528 |
| 690 | Ga0373937_0306813 | 3300036401 | Bacteria | 1501 |
| 691 | Ga0373937_0409024 | 3300036401 | Bacteria | 1287 |
| 692 | Ga0373937_0737286 | 3300036401 | Bacteria | 932 |
| 693 | Ga0373925_0019090 | 3300037068 | Bacteria | 4985 |
| 694 | Ga0373925_0956935 | 3300037068 | Bacteria | 705 |
| 695 | Ga0373925_1376889 | 3300037068 | Bacteria | 578 |
| 696 | Ga0395899_0002229 | 3300037312 | Bacteria | 15878 |
| 697 | Ga0395900_0003555 | 3300037418 | Bacteria | 16760 |
| 698 | Ga0395900_0005158 | 3300037418 | Bacteria | 13719 |
| 699 | Ga0395898_0000060 | 3300037466 | Bacteria | 273835 |
| 700 | Ga0395898_0001657 | 3300037466 | Bacteria | 30012 |
| 701 | Ga0395905_0000949 | 3300037471 | Bacteria | 37219 |
| 702 | Ga0395905_0594055 | 3300037471 | Bacteria | 1009 |
| 703 | Ga0395901_0002577 | 3300038443 | Bacteria | 18377 |
| 704 | Ga0242420_080981 | 3300038996 | Bacteria | 671 |
| 705 | Ga0451577_1259367 | 3300042876 | Unclassified | 659 |
| 706 | Ga0495617_155320 | 3300046452 | Bacteria | 727 |
| 707 | Ga0495617_267426 | 3300046452 | Bacteria | 525 |
| 708 | Ga0495627_069833 | 3300046453 | Bacteria | 1028 |
| 709 | Ga0495627_186857 | 3300046453 | Bacteria | 573 |
| 710 | Ga0495592_0072343 | 3300046454 | Bacteria | 2508 |
| 711 | Ga0495603_0038524 | 3300046455 | Bacteria | 2866 |
| 712 | Ga0495603_0455384 | 3300046455 | Bacteria | 733 |
| 713 | Ga0495629_0082498 | 3300046459 | Bacteria | 2244 |
| 714 | Ga0495629_0579325 | 3300046459 | Bacteria | 752 |
| 715 | Ga0495651_0227599 | 3300046462 | Bacteria | 1286 |
| 716 | Ga0495651_0589249 | 3300046462 | Bacteria | 702 |
| 717 | Ga0495653_0069288 | 3300046463 | Bacteria | 2643 |
| 718 | Ga0495653_0114589 | 3300046463 | Bacteria | 1931 |
| 719 | Ga0495653_0151817 | 3300046463 | Bacteria | 1618 |
| 720 | Ga0495653_0209400 | 3300046463 | Bacteria | 1318 |
| 721 | Ga0495653_0311448 | 3300046463 | Bacteria | 1023 |
| 722 | Ga0495580_0033697 | 3300046472 | Bacteria | 3689 |
| 723 | Ga0495605_0204601 | 3300046474 | Bacteria | 859 |
| 724 | Ga0495639_0109488 | 3300046475 | Bacteria | 1310 |
| 725 | Ga0495662_0002907 | 3300046476 | Bacteria | 8654 |
| 726 | Ga0495662_0066859 | 3300046476 | Bacteria | 1739 |
| 727 | Ga0495664_0013980 | 3300046477 | Bacteria | 4547 |
| 728 | Ga0495664_0759899 | 3300046477 | Bacteria | 571 |
| 729 | Ga0495584_0215131 | 3300046491 | Bacteria | 977 |
| 730 | Ga0495584_0309855 | 3300046491 | Unclassified | 802 |
| 731 | Ga0495585_0078383 | 3300046492 | Bacteria | 1792 |
| 732 | Ga0495585_0084220 | 3300046492 | Bacteria | 1720 |
| 733 | Ga0495585_0365049 | 3300046492 | Bacteria | 700 |
| 734 | Ga0495594_0827815 | 3300046499 | Bacteria | 521 |
| 735 | Ga0495596_0041253 | 3300046500 | Bacteria | 1820 |
| 736 | Ga0495607_0066220 | 3300046501 | Bacteria | 2034 |
| 737 | Ga0495607_0067040 | 3300046501 | Bacteria | 2018 |
| 738 | Ga0495607_0123121 | 3300046501 | Bacteria | 1359 |
| 739 | Ga0495607_0170121 | 3300046501 | Bacteria | 1101 |
| 740 | Ga0495607_0318687 | 3300046501 | Bacteria | 726 |
| 741 | Ga0495608_0022297 | 3300046511 | Bacteria | 4341 |
| 742 | Ga0495608_0030021 | 3300046511 | Bacteria | 3683 |
| 743 | Ga0495608_0734524 | 3300046511 | Bacteria | 586 |
| 744 | Ga0495618_0095291 | 3300046514 | Bacteria | 1903 |
| 745 | Ga0495618_0156238 | 3300046514 | Bacteria | 1456 |
| 746 | Ga0495618_0461453 | 3300046514 | Bacteria | 770 |
| 747 | Ga0495628_0091068 | 3300046516 | Bacteria | 2360 |
| 748 | Ga0495628_0533023 | 3300046516 | Bacteria | 845 |
| 749 | Ga0495628_0885596 | 3300046516 | Bacteria | 620 |
| 750 | Ga0495630_0107982 | 3300046517 | Bacteria | 2108 |
| 751 | Ga0495630_0201800 | 3300046517 | Bacteria | 1517 |
| 752 | Ga0495630_0204261 | 3300046517 | Bacteria | 1508 |
| 753 | Ga0495637_0182363 | 3300046520 | Bacteria | 778 |
| 754 | Ga0495644_0007487 | 3300046523 | Bacteria | 4208 |
| 755 | Ga0495644_0057437 | 3300046523 | Bacteria | 1463 |
| 756 | Ga0495644_0123397 | 3300046523 | Bacteria | 986 |
| 757 | Ga0495663_0042186 | 3300046525 | Bacteria | 1390 |
| 758 | Ga0495663_0321263 | 3300046525 | Bacteria | 560 |
| 759 | Ga0495666_0026974 | 3300046526 | Bacteria | 2827 |
| 760 | Ga0495642_0077281 | 3300046528 | Bacteria | 1398 |
| 761 | Ga0495642_0174042 | 3300046528 | Bacteria | 936 |
| 762 | Ga0495652_0012109 | 3300046529 | Bacteria | 7792 |
| 763 | Ga0495652_0054026 | 3300046529 | Bacteria | 3422 |
| 764 | Ga0495654_0404509 | 3300046530 | Unclassified | 542 |
| 765 | Ga0495665_0038339 | 3300046531 | Bacteria | 2555 |
| 766 | Ga0495640_0038011 | 3300046533 | Bacteria | 3389 |
| 767 | Ga0495640_0399522 | 3300046533 | Bacteria | 844 |
| 768 | Ga0495586_0010003 | 3300046535 | Bacteria | 5054 |
| 769 | Ga0495587_0160939 | 3300046536 | Bacteria | 1277 |
| 770 | Ga0495587_0174632 | 3300046536 | Bacteria | 1219 |
| 771 | Ga0495587_0315844 | 3300046536 | Bacteria | 873 |
| 772 | Ga0495598_0005026 | 3300046537 | Bacteria | 2904 |
| 773 | Ga0495598_0125918 | 3300046537 | Bacteria | 873 |
| 774 | Ga0495598_0271193 | 3300046537 | Bacteria | 634 |
| 775 | Ga0495609_0087100 | 3300046538 | Bacteria | 1361 |
| 776 | Ga0495621_0065667 | 3300046539 | Bacteria | 1326 |
| 777 | Ga0495621_0314256 | 3300046539 | Bacteria | 652 |
| 778 | Ga0495597_0401702 | 3300046542 | Bacteria | 521 |
| 779 | Ga0495645_0053497 | 3300046543 | Bacteria | 2934 |
| 780 | Ga0495645_0804554 | 3300046543 | Bacteria | 564 |
| 781 | Ga0495633_0044106 | 3300046558 | Bacteria | 2114 |
| 782 | Ga0495633_0352874 | 3300046558 | Bacteria | 666 |
| 783 | Ga0495667_0037816 | 3300046559 | Bacteria | 3215 |
| 784 | Ga0495667_0039220 | 3300046559 | Bacteria | 3150 |
| 785 | Ga0495667_0124133 | 3300046559 | Bacteria | 1666 |
| 786 | Ga0495667_0358315 | 3300046559 | Bacteria | 921 |
| 787 | Ga0495656_0015839 | 3300046615 | Bacteria | 2853 |
| 788 | Ga0495656_0055583 | 3300046615 | Bacteria | 1708 |
| 789 | Ga0495656_0342654 | 3300046615 | Bacteria | 773 |
| 790 | Ga0495668_0435829 | 3300046616 | Bacteria | 721 |
| 791 | Ga0495668_0772609 | 3300046616 | Bacteria | 532 |
| 792 | Ga0495634_0019504 | 3300046642 | Bacteria | 4817 |
| 793 | Ga0495634_0175117 | 3300046642 | Bacteria | 1346 |
| 794 | Ga0495634_0274119 | 3300046642 | Bacteria | 1026 |
| 795 | Ga0495634_0359635 | 3300046642 | Bacteria | 870 |
| 796 | Ga0495611_0184241 | 3300046648 | Bacteria | 975 |
| 797 | Ga0495611_0311491 | 3300046648 | Bacteria | 725 |
| 798 | Ga0495611_0408590 | 3300046648 | Bacteria | 620 |
| 799 | Ga0495611_0492798 | 3300046648 | Unclassified | 557 |
| 800 | Ga0495635_0010045 | 3300046663 | Bacteria | 6619 |
| 801 | Ga0495635_0075980 | 3300046663 | Bacteria | 2301 |
| 802 | Ga0495635_0133620 | 3300046663 | Bacteria | 1691 |
| 803 | Ga0495659_0042672 | 3300046664 | Bacteria | 1624 |
| 804 | Ga0495659_0107840 | 3300046664 | Unclassified | 1085 |
| 805 | Ga0495659_0165906 | 3300046664 | Unclassified | 894 |
| 806 | Ga0495661_0172181 | 3300046665 | Bacteria | 1154 |
| 807 | Ga0495657_0012580 | 3300046675 | Bacteria | 6279 |
| 808 | Ga0495657_0045056 | 3300046675 | Bacteria | 2995 |
| 809 | Ga0495657_0062362 | 3300046675 | Bacteria | 2463 |
| 810 | Ga0495599_0046300 | 3300046678 | Bacteria | 2727 |
| 811 | Ga0495599_0392567 | 3300046678 | Bacteria | 827 |
| 812 | Ga0495623_0187429 | 3300046679 | Bacteria | 1197 |
| 813 | Ga0495646_0014574 | 3300046680 | Bacteria | 4995 |
| 814 | Ga0495658_0561499 | 3300046683 | Bacteria | 731 |
| 815 | Ga0495669_0491004 | 3300046684 | Bacteria | 597 |
| 816 | Ga0495613_0006059 | 3300046689 | Bacteria | 9049 |
| 817 | Ga0495624_0500757 | 3300046690 | Bacteria | 727 |
| 818 | Ga0495624_0670535 | 3300046690 | Unclassified | 616 |
| 819 | Ga0495670_0002276 | 3300046691 | Bacteria | 9469 |
| 820 | Ga0495670_0039216 | 3300046691 | Bacteria | 2362 |
| 821 | Ga0495670_0257525 | 3300046691 | Bacteria | 931 |
| 822 | Ga0495671_0266351 | 3300046692 | Bacteria | 826 |
| 823 | Ga0495589_0081179 | 3300046794 | Bacteria | 1578 |
| 824 | Ga0495589_0086660 | 3300046794 | Bacteria | 1521 |
| 825 | Ga0495589_0264253 | 3300046794 | Bacteria | 802 |
| 826 | Ga0495600_0098167 | 3300046809 | Bacteria | 1909 |
| 827 | Ga0495600_0222518 | 3300046809 | Bacteria | 1207 |
| 828 | Ga0495660_0412022 | 3300046810 | Unclassified | 590 |
| 829 | Ga0495581_0051716 | 3300047315 | Bacteria | 2373 |
| 830 | Ga0495604_0130563 | 3300047317 | Bacteria | 1806 |
| 831 | Ga0495636_0011678 | 3300047318 | Bacteria | 3479 |
| 832 | Ga0495674_0051797 | 3300047319 | Bacteria | 3617 |
| 833 | Ga0495674_0065464 | 3300047319 | Bacteria | 3156 |
| 834 | Ga0495674_0082204 | 3300047319 | Bacteria | 2762 |
| 835 | Ga0495674_1054530 | 3300047319 | Bacteria | 621 |
| 836 | Ga0495674_1122333 | 3300047319 | Unclassified | 598 |
| 837 | Ga0495676_0164973 | 3300047321 | Bacteria | 1564 |
| 838 | Ga0495676_0194748 | 3300047321 | Bacteria | 1412 |
| 839 | Ga0495676_0323811 | 3300047321 | Bacteria | 1035 |
| 840 | Ga0495676_0549454 | 3300047321 | Bacteria | 755 |
| 841 | Ga0495676_0654403 | 3300047321 | Bacteria | 682 |
| 842 | Ga0495680_0074334 | 3300047322 | Bacteria | 2581 |
| 843 | Ga0495680_0125668 | 3300047322 | Bacteria | 1889 |
| 844 | Ga0495680_0195483 | 3300047322 | Bacteria | 1453 |
| 845 | Ga0495675_0088931 | 3300047444 | Bacteria | 1939 |
| 846 | Ga0495677_0030518 | 3300047445 | Bacteria | 1962 |
| 847 | Ga0495685_113987 | 3300047447 | Bacteria | 889 |
| 848 | Ga0495684_0008224 | 3300047471 | Bacteria | 8075 |
| 849 | Ga0495684_0058752 | 3300047471 | Bacteria | 2929 |
| 850 | Ga0495684_0304936 | 3300047471 | Bacteria | 1143 |
| 851 | Ga0495684_0932892 | 3300047471 | Bacteria | 556 |
| 852 | Ga0495593_0024361 | 3300047673 | Bacteria | 3355 |
| 853 | Ga0495602_0676530 | 3300048088 | Bacteria | 702 |
| 854 | Ga0495602_0853821 | 3300048088 | Bacteria | 608 |
| 855 | Ga0495615_0290372 | 3300048090 | Bacteria | 527 |
| 856 | Ga0495626_0264769 | 3300048091 | Bacteria | 686 |
| 857 | Ga0496100_0041492 | 3300048903 | Bacteria | 2933 |
| 858 | Ga0496100_0077464 | 3300048903 | Bacteria | 2235 |
| 859 | Ga0496101_0075154 | 3300048904 | Bacteria | 2486 |
| 860 | Ga0496101_0127586 | 3300048904 | Bacteria | 1929 |
| 861 | Ga0496101_0861377 | 3300048904 | Bacteria | 714 |
| 862 | Ga0496102_0019678 | 3300048905 | Bacteria | 5948 |
| 863 | Ga0496102_0193032 | 3300048905 | Bacteria | 1919 |
| 864 | Ga0496102_0391201 | 3300048905 | Bacteria | 1308 |
| 865 | Ga0496102_0798427 | 3300048905 | Bacteria | 866 |
| 866 | Ga0496102_0956078 | 3300048905 | Bacteria | 778 |
| 867 | Ga0496102_0968848 | 3300048905 | Bacteria | 771 |
| 868 | Ga0496102_1189017 | 3300048905 | Bacteria | 682 |
| 869 | Ga0496102_1266692 | 3300048905 | Unclassified | 657 |
| 870 | Ga0496103_0027742 | 3300048906 | Bacteria | 3433 |
| 871 | Ga0496103_0281742 | 3300048906 | Bacteria | 1069 |
| 872 | Ga0496104_0010875 | 3300048907 | Bacteria | 8139 |
| 873 | Ga0496104_0411564 | 3300048907 | Bacteria | 1264 |
| 874 | Ga0496105_0093253 | 3300048908 | Bacteria | 2486 |
| 875 | Ga0496105_0150162 | 3300048908 | Bacteria | 1915 |
| 876 | Ga0496105_0298365 | 3300048908 | Unclassified | 1296 |
| 877 | Ga0496106_0036049 | 3300048909 | Bacteria | 3700 |
| 878 | Ga0496106_0051870 | 3300048909 | Bacteria | 3093 |
| 879 | Ga0496106_0127153 | 3300048909 | Bacteria | 1996 |
| 880 | Ga0496106_0502341 | 3300048909 | Bacteria | 974 |
| 881 | Ga0496107_0005090 | 3300048910 | Bacteria | 8962 |
| 882 | Ga0496107_0144686 | 3300048910 | Unclassified | 1757 |
| 883 | Ga0496107_0224933 | 3300048910 | Bacteria | 1396 |
| 884 | Ga0496108_0055149 | 3300048911 | Bacteria | 3336 |
| 885 | Ga0496108_1122195 | 3300048911 | Bacteria | 667 |
| 886 | Ga0496109_0378228 | 3300048912 | Bacteria | 1338 |
| 887 | Ga0496110_0176225 | 3300048913 | Unclassified | 1940 |
| 888 | Ga0496111_0036770 | 3300048914 | Bacteria | 3502 |
| 889 | Ga0496111_0166986 | 3300048914 | Bacteria | 1635 |
| 890 | Ga0496112_0164403 | 3300048915 | Bacteria | 2185 |
| 891 | Ga0496112_0274026 | 3300048915 | Bacteria | 1635 |
| 892 | Ga0496113_0592333 | 3300048916 | Bacteria | 888 |
| 893 | Ga0496114_0010401 | 3300048917 | Bacteria | 7402 |
| 894 | Ga0496114_0222897 | 3300048917 | Bacteria | 1655 |
| 895 | Ga0496115_0011105 | 3300048918 | Bacteria | 6749 |
| 896 | Ga0496115_0591828 | 3300048918 | Unclassified | 883 |
| 897 | Ga0496115_0683825 | 3300048918 | Unclassified | 808 |
| 898 | Ga0496115_1335582 | 3300048918 | Bacteria | 532 |
| 899 | Ga0496123_0057222 | 3300048926 | Bacteria | 2540 |
| 900 | Ga0496126_0020033 | 3300048929 | Bacteria | 6569 |
| 901 | Ga0496126_0178301 | 3300048929 | Bacteria | 1806 |
| 902 | Ga0501067_0074277 | 3300049583 | Bacteria | 1884 |
| 903 | Ga0501068_0087351 | 3300049584 | Bacteria | 1920 |
| 904 | Ga0501070_0000034 | 3300049586 | Bacteria | 128605 |
| 905 | nmdc:mga00v17_221996_c1 | 3300050491 | Bacteria | 1223 |
| 906 | nmdc:mga00v17_886910_c1 | 3300050491 | Bacteria | 565 |
| 907 | nmdc:mga0yw44_9191_c1 | 3300050492 | Bacteria | 4974 |
| 908 | nmdc:mga05p37_137915_c1 | 3300050507 | Bacteria | 2990 |
| 909 | nmdc:mga05p37_2250218_c1 | 3300050507 | Bacteria | 504 |
| 910 | nmdc:mga05p37_2754_c1 | 3300050507 | Bacteria | 20427 |
| 911 | nmdc:mga05p37_292347_c1 | 3300050507 | Bacteria | 1939 |
| 912 | nmdc:mga05p37_52031_c1 | 3300050507 | Bacteria | 5036 |
| 913 | nmdc:mga05p37_719764_c1 | 3300050507 | Bacteria | 1106 |
| 914 | nmdc:mga05p37_7324_c1 | 3300050507 | Bacteria | 13024 |
| 915 | nmdc:mga09592_1041057_c1 | 3300050508 | Bacteria | 683 |
| 916 | nmdc:mga09592_223530_c1 | 3300050508 | Bacteria | 1631 |
| 917 | nmdc:mga09592_544133_c1 | 3300050508 | Bacteria | 997 |
| 918 | nmdc:mga0qj67_648654_c1 | 3300050509 | Bacteria | 842 |
| 919 | nmdc:mga06r32_1459976_c1 | 3300050510 | Bacteria | 625 |
| 920 | nmdc:mga06r32_17228_c1 | 3300050510 | Bacteria | 6595 |
| 921 | nmdc:mga06r32_188217_c1 | 3300050510 | Bacteria | 2051 |
| 922 | nmdc:mga06r32_454065_c1 | 3300050510 | Bacteria | 1261 |
| 923 | nmdc:mga06r32_80097_c1 | 3300050510 | Bacteria | 3178 |
| 924 | nmdc:mga08y16_1141306_c1 | 3300050511 | Bacteria | 753 |
| 925 | nmdc:mga08y16_11664_c1 | 3300050511 | Bacteria | 9234 |
| 926 | nmdc:mga08y16_1299503_c1 | 3300050511 | Bacteria | 694 |
| 927 | nmdc:mga08y16_20192_c1 | 3300050511 | Bacteria | 7032 |
| 928 | nmdc:mga08y16_326534_c1 | 3300050511 | Bacteria | 1579 |
| 929 | nmdc:mga08y16_53577_c1 | 3300050511 | Bacteria | 4218 |
| 930 | nmdc:mga08y16_67612_c1 | 3300050511 | Bacteria | 3727 |
| 931 | nmdc:mga0n895_1218388_c1 | 3300050512 | Bacteria | 726 |
| 932 | nmdc:mga0n895_164404_c1 | 3300050512 | Bacteria | 2251 |
| 933 | nmdc:mga0n895_19321_c1 | 3300050512 | Bacteria | 6331 |
| 934 | nmdc:mga0n895_526213_c1 | 3300050512 | Bacteria | 1190 |
| 935 | nmdc:mga0n895_81435_c1 | 3300050512 | Bacteria | 3226 |
| 936 | nmdc:mga0n895_85910_c1 | 3300050512 | Bacteria | 3142 |
| 937 | nmdc:mga0rr50_122528_c1 | 3300050513 | Bacteria | 2072 |
| 938 | nmdc:mga0rr50_174797_c1 | 3300050513 | Unclassified | 1752 |
| 939 | nmdc:mga0rr50_211069_c1 | 3300050513 | Bacteria | 1599 |
| 940 | nmdc:mga0rr50_283552_c1 | 3300050513 | Bacteria | 1383 |
| 941 | nmdc:mga0rr50_313721_c1 | 3300050513 | Bacteria | 1314 |
| 942 | nmdc:mga0rr50_322291_c1 | 3300050513 | Unclassified | 1296 |
| 943 | nmdc:mga0rr50_606182_c1 | 3300050513 | Bacteria | 934 |
| 944 | nmdc:mga0rr50_93269_c1 | 3300050513 | Unclassified | 2349 |
| 945 | nmdc:mga08x19_113065_c1 | 3300050514 | Bacteria | 1813 |
| 946 | nmdc:mga08x19_20798_c1 | 3300050514 | Bacteria | 4045 |
| 947 | nmdc:mga08x19_27814_c1 | 3300050514 | Unclassified | 3539 |
| 948 | nmdc:mga08x19_279539_c1 | 3300050514 | Bacteria | 1156 |
| 949 | nmdc:mga08x19_608098_c1 | 3300050514 | Bacteria | 775 |
| 950 | nmdc:mga08x19_79412_c1 | 3300050514 | Bacteria | 2152 |
| 951 | nmdc:mga08x19_94502_c1 | 3300050514 | Bacteria | 1977 |
| 952 | nmdc:mga0a205_127892_c1 | 3300050515 | Bacteria | 1926 |
| 953 | nmdc:mga0a205_131255_c1 | 3300050515 | Unclassified | 2405 |
| 954 | nmdc:mga0a205_131805_c1 | 3300050515 | Bacteria | 2400 |
| 955 | nmdc:mga0a205_256052_c1 | 3300050515 | Bacteria | 1629 |
| 956 | nmdc:mga0a205_332620_c1 | 3300050515 | Bacteria | 1389 |
| 957 | nmdc:mga0a205_651512_c1 | 3300050515 | Bacteria | 904 |
| 958 | nmdc:mga0a205_66434_c1 | 3300050515 | Bacteria | 3485 |
| 959 | nmdc:mga0a205_9925_c1 | 3300050515 | Bacteria | 8732 |
| 960 | Ga0495601_0018231 | 3300053077 | Bacteria | 4269 |
| 961 | Ga0495601_0165696 | 3300053077 | Bacteria | 1444 |
| 962 | Ga0495601_0338717 | 3300053077 | Bacteria | 978 |
| 963 | Ga0495601_0341615 | 3300053077 | Bacteria | 974 |
| 964 | Ga0495612_0208171 | 3300053078 | Bacteria | 864 |
| 965 | Ga0495595_0178776 | 3300053084 | Bacteria | 1052 |
| 966 | Ga0495619_0038895 | 3300053085 | Bacteria | 3104 |
| 967 | Ga0495619_0039646 | 3300053085 | Bacteria | 3075 |
| 968 | Ga0495619_0242681 | 3300053085 | Bacteria | 1248 |
| 969 | Ga0500559_0142437 | 3300053136 | Bacteria | 1123 |
| 970 | Ga0500559_0573484 | 3300053136 | Bacteria | 513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_101712233 | Ga0068859_1017122331 | 123 |
| 2 | 3300006931 | Ga0097620_101712551 | Ga0097620_1017125511 | 123 |
| 3 | 3300035724 | Ga0373933_0231057 | Ga0373933_0231057_164_583 | 137 |
| 4 | 3300036401 | Ga0373937_0306813 | Ga0373937_0306813_1046_1465 | 137 |
| 5 | 3300046463 | Ga0495653_0151817 | Ga0495653_0151817_982_1401 | 137 |
| 6 | 3300046511 | Ga0495608_0734524 | Ga0495608_0734524_73_492 | 137 |
| 7 | 3300046517 | Ga0495630_0107982 | Ga0495630_0107982_489_908 | 137 |
| 8 | 3300046529 | Ga0495652_0054026 | Ga0495652_0054026_1504_1923 | 137 |
| 9 | 3300046533 | Ga0495640_0399522 | Ga0495640_0399522_116_535 | 137 |
| 10 | 3300046642 | Ga0495634_0019504 | Ga0495634_0019504_3128_3547 | 137 |
| 11 | 3300047319 | Ga0495674_1054530 | Ga0495674_1054530_30_449 | 137 |
| 12 | 3300047322 | Ga0495680_0074334 | Ga0495680_0074334_20_439 | 137 |
| 13 | 3300047471 | Ga0495684_0058752 | Ga0495684_0058752_2351_2770 | 137 |
| 14 | 3300048907 | Ga0496104_0411564 | Ga0496104_0411564_385_798 | 137 |
| 15 | 3300048909 | Ga0496106_0502341 | Ga0496106_0502341_378_791 | 137 |
| 16 | 3300048917 | Ga0496114_0222897 | Ga0496114_0222897_142_555 | 137 |
| 17 | 3300048929 | Ga0496126_0178301 | Ga0496126_0178301_91_504 | 137 |
| 18 | 3300053078 | Ga0495612_0208171 | Ga0495612_0208171_144_563 | 137 |
| 19 | 3300053085 | Ga0495619_0039646 | Ga0495619_0039646_2595_3014 | 137 |
| 20 | 3300005549 | Ga0070704_100804223 | Ga0070704_1008042232 | 138 |
| 21 | 3300005468 | Ga0070707_100275738 | Ga0070707_1002757383 | 139 |
| 22 | 3300006847 | Ga0075431_100780964 | Ga0075431_1007809641 | 139 |
| 23 | 3300046543 | Ga0495645_0804554 | Ga0495645_0804554_29_451 | 140 |
| 24 | 3300005440 | Ga0070705_100082374 | Ga0070705_1000823742 | 141 |
| 25 | 3300013105 | Ga0157369_10073440 | Ga0157369_100734404 | 141 |
| 26 | 3300025910 | Ga0207684_10437446 | Ga0207684_104374462 | 141 |
| 27 | 3300046648 | Ga0495611_0184241 | Ga0495611_0184241_432_866 | 141 |
| 28 | 3300050513 | nmdc:mga0rr50_313721_c1 | nmdc:mga0rr50_313721_c1_134_571 | 141 |
| 29 | 3300053136 | Ga0500559_0142437 | Ga0500559_0142437_30_455 | 141 |
| 30 | 3300053136 | Ga0500559_0573484 | Ga0500559_0573484_23_448 | 141 |
| 31 | 3300002459 | JGI24751J29686_10006875 | JGI24751J29686_100068753 | 142 |
| 32 | 3300005331 | Ga0070670_100019605 | Ga0070670_1000196053 | 142 |
| 33 | 3300005337 | Ga0070682_100752872 | Ga0070682_1007528721 | 142 |
| 34 | 3300005434 | Ga0070709_10039969 | Ga0070709_100399693 | 142 |
| 35 | 3300005435 | Ga0070714_100196265 | Ga0070714_1001962652 | 142 |
| 36 | 3300005437 | Ga0070710_10243334 | Ga0070710_102433342 | 142 |
| 37 | 3300005437 | Ga0070710_11233183 | Ga0070710_112331831 | 142 |
| 38 | 3300005439 | Ga0070711_100143253 | Ga0070711_1001432532 | 142 |
| 39 | 3300005445 | Ga0070708_100025182 | Ga0070708_1000251822 | 142 |
| 40 | 3300005937 | Ga0081455_10617997 | Ga0081455_106179972 | 142 |
| 41 | 3300006163 | Ga0070715_10032915 | Ga0070715_100329152 | 142 |
| 42 | 3300006173 | Ga0070716_100040061 | Ga0070716_1000400612 | 142 |
| 43 | 3300006173 | Ga0070716_100094475 | Ga0070716_1000944751 | 142 |
| 44 | 3300006871 | Ga0075434_100084830 | Ga0075434_1000848302 | 142 |
| 45 | 3300006871 | Ga0075434_101161390 | Ga0075434_1011613902 | 142 |
| 46 | 3300006914 | Ga0075436_100993512 | Ga0075436_1009935122 | 142 |
| 47 | 3300007076 | Ga0075435_100053053 | Ga0075435_1000530534 | 142 |
| 48 | 3300007265 | Ga0099794_10061960 | Ga0099794_100619602 | 142 |
| 49 | 3300007265 | Ga0099794_10149093 | Ga0099794_101490931 | 142 |
| 50 | 3300007265 | Ga0099794_10196163 | Ga0099794_101961632 | 142 |
| 51 | 3300007788 | Ga0099795_10055352 | Ga0099795_100553523 | 142 |
| 52 | 3300007788 | Ga0099795_10098025 | Ga0099795_100980252 | 142 |
| 53 | 3300007788 | Ga0099795_10144718 | Ga0099795_101447181 | 142 |
| 54 | 3300009094 | Ga0111539_10007869 | Ga0111539_1000786917 | 142 |
| 55 | 3300009098 | Ga0105245_11830501 | Ga0105245_118305012 | 142 |
| 56 | 3300009147 | Ga0114129_11189327 | Ga0114129_111893271 | 142 |
| 57 | 3300009148 | Ga0105243_10100578 | Ga0105243_101005783 | 142 |
| 58 | 3300009177 | Ga0105248_12042724 | Ga0105248_120427241 | 142 |
| 59 | 3300010375 | Ga0105239_10372244 | Ga0105239_103722442 | 142 |
| 60 | 3300013104 | Ga0157370_10756507 | Ga0157370_107565072 | 142 |
| 61 | 3300013105 | Ga0157369_10097558 | Ga0157369_100975584 | 142 |
| 62 | 3300013297 | Ga0157378_11301129 | Ga0157378_113011292 | 142 |
| 63 | 3300013306 | Ga0163162_12147973 | Ga0163162_121479731 | 142 |
| 64 | 3300014325 | Ga0163163_10202896 | Ga0163163_102028962 | 142 |
| 65 | 3300014325 | Ga0163163_11437779 | Ga0163163_114377792 | 142 |
| 66 | 3300014326 | Ga0157380_10604598 | Ga0157380_106045982 | 142 |
| 67 | 3300014326 | Ga0157380_11717158 | Ga0157380_117171582 | 142 |
| 68 | 3300014968 | Ga0157379_10191735 | Ga0157379_101917352 | 142 |
| 69 | 3300025898 | Ga0207692_10065337 | Ga0207692_100653372 | 142 |
| 70 | 3300025905 | Ga0207685_10012820 | Ga0207685_100128202 | 142 |
| 71 | 3300025906 | Ga0207699_10002909 | Ga0207699_100029098 | 142 |
| 72 | 3300025922 | Ga0207646_10021826 | Ga0207646_100218263 | 142 |
| 73 | 3300025922 | Ga0207646_10282620 | Ga0207646_102826202 | 142 |
| 74 | 3300025927 | Ga0207687_10493148 | Ga0207687_104931482 | 142 |
| 75 | 3300025928 | Ga0207700_10006843 | Ga0207700_100068435 | 142 |
| 76 | 3300025929 | Ga0207664_10015814 | Ga0207664_100158145 | 142 |
| 77 | 3300026078 | Ga0207702_10104943 | Ga0207702_101049432 | 142 |
| 78 | 3300031712 | Ga0265342_10187349 | Ga0265342_101873492 | 142 |
| 79 | 3300035085 | Ga0373929_0185795 | Ga0373929_0185795_110_547 | 142 |
| 80 | 3300035121 | Ga0373960_0159118 | Ga0373960_0159118_74_511 | 142 |
| 81 | 3300035171 | Ga0373946_0227262 | Ga0373946_0227262_233_673 | 142 |
| 82 | 3300035207 | Ga0373942_0131230 | Ga0373942_0131230_144_584 | 142 |
| 83 | 3300035242 | Ga0373962_0116412 | Ga0373962_0116412_86_523 | 142 |
| 84 | 3300035691 | Ga0373931_0069434 | Ga0373931_0069434_31_468 | 142 |
| 85 | 3300035691 | Ga0373931_0255414 | Ga0373931_0255414_46_477 | 142 |
| 86 | 3300035691 | Ga0373931_0639409 | Ga0373931_0639409_246_686 | 142 |
| 87 | 3300035692 | Ga0373935_0229495 | Ga0373935_0229495_287_727 | 142 |
| 88 | 3300035724 | Ga0373933_0159426 | Ga0373933_0159426_715_1155 | 142 |
| 89 | 3300036401 | Ga0373937_0737286 | Ga0373937_0737286_421_861 | 142 |
| 90 | 3300037068 | Ga0373925_0956935 | Ga0373925_0956935_23_463 | 142 |
| 91 | 3300037068 | Ga0373925_1376889 | Ga0373925_1376889_120_557 | 142 |
| 92 | 3300037312 | Ga0395899_0002229 | Ga0395899_0002229_8144_8581 | 142 |
| 93 | 3300037418 | Ga0395900_0003555 | Ga0395900_0003555_1911_2351 | 142 |
| 94 | 3300037418 | Ga0395900_0005158 | Ga0395900_0005158_7429_7866 | 142 |
| 95 | 3300037466 | Ga0395898_0000060 | Ga0395898_0000060_146136_146576 | 142 |
| 96 | 3300037466 | Ga0395898_0001657 | Ga0395898_0001657_1669_2106 | 142 |
| 97 | 3300037471 | Ga0395905_0000949 | Ga0395905_0000949_7953_8390 | 142 |
| 98 | 3300038443 | Ga0395901_0002577 | Ga0395901_0002577_13308_13745 | 142 |
| 99 | 3300038996 | Ga0242420_080981 | Ga0242420_080981_215_655 | 142 |
| 100 | 3300046452 | Ga0495617_155320 | Ga0495617_155320_224_661 | 142 |
| 101 | 3300046453 | Ga0495627_186857 | Ga0495627_186857_111_548 | 142 |
| 102 | 3300046454 | Ga0495592_0072343 | Ga0495592_0072343_619_1056 | 142 |
| 103 | 3300046459 | Ga0495629_0579325 | Ga0495629_0579325_41_481 | 142 |
| 104 | 3300046462 | Ga0495651_0589249 | Ga0495651_0589249_158_595 | 142 |
| 105 | 3300046463 | Ga0495653_0069288 | Ga0495653_0069288_1563_2000 | 142 |
| 106 | 3300046463 | Ga0495653_0311448 | Ga0495653_0311448_195_635 | 142 |
| 107 | 3300046472 | Ga0495580_0033697 | Ga0495580_0033697_3079_3516 | 142 |
| 108 | 3300046476 | Ga0495662_0002907 | Ga0495662_0002907_5667_6104 | 142 |
| 109 | 3300046477 | Ga0495664_0013980 | Ga0495664_0013980_2530_2967 | 142 |
| 110 | 3300046491 | Ga0495584_0215131 | Ga0495584_0215131_383_820 | 142 |
| 111 | 3300046492 | Ga0495585_0078383 | Ga0495585_0078383_835_1314 | 142 |
| 112 | 3300046492 | Ga0495585_0365049 | Ga0495585_0365049_61_498 | 142 |
| 113 | 3300046501 | Ga0495607_0066220 | Ga0495607_0066220_1172_1609 | 142 |
| 114 | 3300046501 | Ga0495607_0067040 | Ga0495607_0067040_270_749 | 142 |
| 115 | 3300046501 | Ga0495607_0170121 | Ga0495607_0170121_528_965 | 142 |
| 116 | 3300046501 | Ga0495607_0318687 | Ga0495607_0318687_258_695 | 142 |
| 117 | 3300046511 | Ga0495608_0022297 | Ga0495608_0022297_2444_2881 | 142 |
| 118 | 3300046511 | Ga0495608_0030021 | Ga0495608_0030021_1075_1515 | 142 |
| 119 | 3300046514 | Ga0495618_0095291 | Ga0495618_0095291_561_1001 | 142 |
| 120 | 3300046516 | Ga0495628_0091068 | Ga0495628_0091068_240_677 | 142 |
| 121 | 3300046517 | Ga0495630_0201800 | Ga0495630_0201800_419_856 | 142 |
| 122 | 3300046520 | Ga0495637_0182363 | Ga0495637_0182363_225_662 | 142 |
| 123 | 3300046523 | Ga0495644_0123397 | Ga0495644_0123397_269_706 | 142 |
| 124 | 3300046525 | Ga0495663_0321263 | Ga0495663_0321263_49_486 | 142 |
| 125 | 3300046526 | Ga0495666_0026974 | Ga0495666_0026974_240_677 | 142 |
| 126 | 3300046528 | Ga0495642_0077281 | Ga0495642_0077281_213_650 | 142 |
| 127 | 3300046529 | Ga0495652_0012109 | Ga0495652_0012109_12_449 | 142 |
| 128 | 3300046531 | Ga0495665_0038339 | Ga0495665_0038339_965_1402 | 142 |
| 129 | 3300046533 | Ga0495640_0038011 | Ga0495640_0038011_2534_2971 | 142 |
| 130 | 3300046535 | Ga0495586_0010003 | Ga0495586_0010003_4343_4780 | 142 |
| 131 | 3300046536 | Ga0495587_0160939 | Ga0495587_0160939_195_635 | 142 |
| 132 | 3300046536 | Ga0495587_0174632 | Ga0495587_0174632_771_1208 | 142 |
| 133 | 3300046537 | Ga0495598_0005026 | Ga0495598_0005026_361_840 | 142 |
| 134 | 3300046538 | Ga0495609_0087100 | Ga0495609_0087100_200_637 | 142 |
| 135 | 3300046539 | Ga0495621_0314256 | Ga0495621_0314256_89_526 | 142 |
| 136 | 3300046543 | Ga0495645_0053497 | Ga0495645_0053497_2316_2753 | 142 |
| 137 | 3300046558 | Ga0495633_0044106 | Ga0495633_0044106_352_789 | 142 |
| 138 | 3300046559 | Ga0495667_0039220 | Ga0495667_0039220_1765_2202 | 142 |
| 139 | 3300046559 | Ga0495667_0124133 | Ga0495667_0124133_783_1223 | 142 |
| 140 | 3300046615 | Ga0495656_0342654 | Ga0495656_0342654_14_451 | 142 |
| 141 | 3300046616 | Ga0495668_0772609 | Ga0495668_0772609_53_490 | 142 |
| 142 | 3300046642 | Ga0495634_0175117 | Ga0495634_0175117_12_449 | 142 |
| 143 | 3300046648 | Ga0495611_0408590 | Ga0495611_0408590_48_485 | 142 |
| 144 | 3300046663 | Ga0495635_0075980 | Ga0495635_0075980_1853_2290 | 142 |
| 145 | 3300046663 | Ga0495635_0133620 | Ga0495635_0133620_1174_1614 | 142 |
| 146 | 3300046664 | Ga0495659_0042672 | Ga0495659_0042672_213_650 | 142 |
| 147 | 3300046664 | Ga0495659_0165906 | Ga0495659_0165906_56_493 | 142 |
| 148 | 3300046675 | Ga0495657_0012580 | Ga0495657_0012580_4067_4504 | 142 |
| 149 | 3300046675 | Ga0495657_0045056 | Ga0495657_0045056_746_1186 | 142 |
| 150 | 3300046678 | Ga0495599_0046300 | Ga0495599_0046300_727_1164 | 142 |
| 151 | 3300046678 | Ga0495599_0392567 | Ga0495599_0392567_266_706 | 142 |
| 152 | 3300046679 | Ga0495623_0187429 | Ga0495623_0187429_158_595 | 142 |
| 153 | 3300046680 | Ga0495646_0014574 | Ga0495646_0014574_3940_4377 | 142 |
| 154 | 3300046684 | Ga0495669_0491004 | Ga0495669_0491004_139_576 | 142 |
| 155 | 3300046689 | Ga0495613_0006059 | Ga0495613_0006059_7841_8278 | 142 |
| 156 | 3300046690 | Ga0495624_0500757 | Ga0495624_0500757_267_707 | 142 |
| 157 | 3300046691 | Ga0495670_0257525 | Ga0495670_0257525_276_713 | 142 |
| 158 | 3300046692 | Ga0495671_0266351 | Ga0495671_0266351_247_684 | 142 |
| 159 | 3300046809 | Ga0495600_0098167 | Ga0495600_0098167_1233_1670 | 142 |
| 160 | 3300046809 | Ga0495600_0222518 | Ga0495600_0222518_26_466 | 142 |
| 161 | 3300047315 | Ga0495581_0051716 | Ga0495581_0051716_896_1333 | 142 |
| 162 | 3300047317 | Ga0495604_0130563 | Ga0495604_0130563_158_595 | 142 |
| 163 | 3300047318 | Ga0495636_0011678 | Ga0495636_0011678_887_1366 | 142 |
| 164 | 3300047319 | Ga0495674_0051797 | Ga0495674_0051797_2815_3255 | 142 |
| 165 | 3300047319 | Ga0495674_0065464 | Ga0495674_0065464_1118_1555 | 142 |
| 166 | 3300047321 | Ga0495676_0164973 | Ga0495676_0164973_1091_1522 | 142 |
| 167 | 3300047321 | Ga0495676_0549454 | Ga0495676_0549454_212_649 | 142 |
| 168 | 3300047321 | Ga0495676_0654403 | Ga0495676_0654403_75_515 | 142 |
| 169 | 3300047322 | Ga0495680_0125668 | Ga0495680_0125668_1359_1799 | 142 |
| 170 | 3300047444 | Ga0495675_0088931 | Ga0495675_0088931_195_632 | 142 |
| 171 | 3300047445 | Ga0495677_0030518 | Ga0495677_0030518_1311_1892 | 142 |
| 172 | 3300047471 | Ga0495684_0008224 | Ga0495684_0008224_2893_3333 | 142 |
| 173 | 3300047471 | Ga0495684_0932892 | Ga0495684_0932892_12_449 | 142 |
| 174 | 3300047673 | Ga0495593_0024361 | Ga0495593_0024361_2374_2811 | 142 |
| 175 | 3300048088 | Ga0495602_0676530 | Ga0495602_0676530_158_595 | 142 |
| 176 | 3300048090 | Ga0495615_0290372 | Ga0495615_0290372_43_480 | 142 |
| 177 | 3300048904 | Ga0496101_0127586 | Ga0496101_0127586_1027_1467 | 142 |
| 178 | 3300048905 | Ga0496102_0193032 | Ga0496102_0193032_856_1305 | 142 |
| 179 | 3300048905 | Ga0496102_0391201 | Ga0496102_0391201_662_1099 | 142 |
| 180 | 3300048905 | Ga0496102_0956078 | Ga0496102_0956078_314_751 | 142 |
| 181 | 3300048906 | Ga0496103_0281742 | Ga0496103_0281742_489_926 | 142 |
| 182 | 3300048907 | Ga0496104_0010875 | Ga0496104_0010875_769_1209 | 142 |
| 183 | 3300048908 | Ga0496105_0093253 | Ga0496105_0093253_1211_1651 | 142 |
| 184 | 3300048915 | Ga0496112_0164403 | Ga0496112_0164403_667_1107 | 142 |
| 185 | 3300048918 | Ga0496115_0011105 | Ga0496115_0011105_5643_6083 | 142 |
| 186 | 3300048926 | Ga0496123_0057222 | Ga0496123_0057222_688_1122 | 142 |
| 187 | 3300049586 | Ga0501070_0000034 | Ga0501070_0000034_81522_81956 | 142 |
| 188 | 3300050491 | nmdc:mga00v17_886910_c1 | nmdc:mga00v17_886910_c1_117_554 | 142 |
| 189 | 3300050507 | nmdc:mga05p37_2250218_c1 | nmdc:mga05p37_2250218_c1_23_460 | 142 |
| 190 | 3300050507 | nmdc:mga05p37_292347_c1 | nmdc:mga05p37_292347_c1_479_913 | 142 |
| 191 | 3300050507 | nmdc:mga05p37_7324_c1 | nmdc:mga05p37_7324_c1_4121_4558 | 142 |
| 192 | 3300050508 | nmdc:mga09592_1041057_c1 | nmdc:mga09592_1041057_c1_229_666 | 142 |
| 193 | 3300050508 | nmdc:mga09592_223530_c1 | nmdc:mga09592_223530_c1_818_1255 | 142 |
| 194 | 3300050509 | nmdc:mga0qj67_648654_c1 | nmdc:mga0qj67_648654_c1_122_559 | 142 |
| 195 | 3300050510 | nmdc:mga06r32_1459976_c1 | nmdc:mga06r32_1459976_c1_57_497 | 142 |
| 196 | 3300050510 | nmdc:mga06r32_188217_c1 | nmdc:mga06r32_188217_c1_1295_1732 | 142 |
| 197 | 3300050510 | nmdc:mga06r32_454065_c1 | nmdc:mga06r32_454065_c1_514_951 | 142 |
| 198 | 3300050510 | nmdc:mga06r32_80097_c1 | nmdc:mga06r32_80097_c1_595_1032 | 142 |
| 199 | 3300050511 | nmdc:mga08y16_1141306_c1 | nmdc:mga08y16_1141306_c1_37_474 | 142 |
| 200 | 3300050511 | nmdc:mga08y16_11664_c1 | nmdc:mga08y16_11664_c1_7029_7466 | 142 |
| 201 | 3300050511 | nmdc:mga08y16_1299503_c1 | nmdc:mga08y16_1299503_c1_86_523 | 142 |
| 202 | 3300050511 | nmdc:mga08y16_53577_c1 | nmdc:mga08y16_53577_c1_1529_1963 | 142 |
| 203 | 3300050512 | nmdc:mga0n895_1218388_c1 | nmdc:mga0n895_1218388_c1_218_652 | 142 |
| 204 | 3300050512 | nmdc:mga0n895_164404_c1 | nmdc:mga0n895_164404_c1_199_636 | 142 |
| 205 | 3300050512 | nmdc:mga0n895_526213_c1 | nmdc:mga0n895_526213_c1_89_526 | 142 |
| 206 | 3300050513 | nmdc:mga0rr50_606182_c1 | nmdc:mga0rr50_606182_c1_38_466 | 142 |
| 207 | 3300050515 | nmdc:mga0a205_332620_c1 | nmdc:mga0a205_332620_c1_211_648 | 142 |
| 208 | 3300050515 | nmdc:mga0a205_9925_c1 | nmdc:mga0a205_9925_c1_4322_4759 | 142 |
| 209 | 3300053077 | Ga0495601_0165696 | Ga0495601_0165696_699_1136 | 142 |
| 210 | 3300053077 | Ga0495601_0338717 | Ga0495601_0338717_488_919 | 142 |
| 211 | 3300053077 | Ga0495601_0341615 | Ga0495601_0341615_260_700 | 142 |
| 212 | 3300053085 | Ga0495619_0038895 | Ga0495619_0038895_789_1226 | 142 |
| 213 | 3300005330 | Ga0070690_100373933 | Ga0070690_1003739332 | 143 |
| 214 | 3300005336 | Ga0070680_100078719 | Ga0070680_1000787193 | 143 |
| 215 | 3300005445 | Ga0070708_100597147 | Ga0070708_1005971472 | 143 |
| 216 | 3300005467 | Ga0070706_100517004 | Ga0070706_1005170041 | 143 |
| 217 | 3300005467 | Ga0070706_100611951 | Ga0070706_1006119512 | 143 |
| 218 | 3300005468 | Ga0070707_100928908 | Ga0070707_1009289082 | 143 |
| 219 | 3300005471 | Ga0070698_100661976 | Ga0070698_1006619762 | 143 |
| 220 | 3300005518 | Ga0070699_100000805 | Ga0070699_10000080520 | 143 |
| 221 | 3300005530 | Ga0070679_100503126 | Ga0070679_1005031262 | 143 |
| 222 | 3300005546 | Ga0070696_100083788 | Ga0070696_1000837882 | 143 |
| 223 | 3300005549 | Ga0070704_100013491 | Ga0070704_1000134911 | 143 |
| 224 | 3300005718 | Ga0068866_10130013 | Ga0068866_101300132 | 143 |
| 225 | 3300006871 | Ga0075434_101314150 | Ga0075434_1013141502 | 143 |
| 226 | 3300006914 | Ga0075436_100067414 | Ga0075436_1000674143 | 143 |
| 227 | 3300006914 | Ga0075436_100099996 | Ga0075436_1000999963 | 143 |
| 228 | 3300006914 | Ga0075436_100346388 | Ga0075436_1003463881 | 143 |
| 229 | 3300007076 | Ga0075435_101162429 | Ga0075435_1011624292 | 143 |
| 230 | 3300009148 | Ga0105243_10074659 | Ga0105243_100746592 | 143 |
| 231 | 3300009148 | Ga0105243_10173929 | Ga0105243_101739292 | 143 |
| 232 | 3300009174 | Ga0105241_11333572 | Ga0105241_113335721 | 143 |
| 233 | 3300013297 | Ga0157378_10331098 | Ga0157378_103310982 | 143 |
| 234 | 3300025910 | Ga0207684_10291849 | Ga0207684_102918491 | 143 |
| 235 | 3300025935 | Ga0207709_10191329 | Ga0207709_101913292 | 143 |
| 236 | 3300046500 | Ga0495596_0041253 | Ga0495596_0041253_1149_1589 | 143 |
| 237 | 3300046537 | Ga0495598_0125918 | Ga0495598_0125918_147_587 | 143 |
| 238 | 3300048905 | Ga0496102_0968848 | Ga0496102_0968848_50_481 | 143 |
| 239 | 3300048905 | Ga0496102_1266692 | Ga0496102_1266692_198_629 | 143 |
| 240 | 3300048906 | Ga0496103_0027742 | Ga0496103_0027742_2117_2548 | 143 |
| 241 | 3300048908 | Ga0496105_0150162 | Ga0496105_0150162_1078_1509 | 143 |
| 242 | 3300048909 | Ga0496106_0127153 | Ga0496106_0127153_1555_1986 | 143 |
| 243 | 3300048910 | Ga0496107_0224933 | Ga0496107_0224933_903_1334 | 143 |
| 244 | 3300050514 | nmdc:mga08x19_113065_c1 | nmdc:mga08x19_113065_c1_933_1376 | 143 |
| 245 | 3300050514 | nmdc:mga08x19_279539_c1 | nmdc:mga08x19_279539_c1_404_847 | 143 |
| 246 | 3300001976 | JGI24752J21851_1060663 | JGI24752J21851_10606631 | 144 |
| 247 | 3300002155 | JGI24033J26618_1055161 | JGI24033J26618_10551611 | 144 |
| 248 | 3300003760 | Ga0055527_1000032 | Ga0055527_100003239 | 144 |
| 249 | 3300003760 | Ga0055527_1000091 | Ga0055527_100009139 | 144 |
| 250 | 3300003762 | Ga0055542_1000216 | Ga0055542_100021639 | 144 |
| 251 | 3300003763 | Ga0055529_1000234 | Ga0055529_100023439 | 144 |
| 252 | 3300005295 | Ga0065707_10283270 | Ga0065707_102832702 | 144 |
| 253 | 3300005329 | Ga0070683_100025354 | Ga0070683_1000253548 | 144 |
| 254 | 3300005329 | Ga0070683_100725288 | Ga0070683_1007252881 | 144 |
| 255 | 3300005330 | Ga0070690_100240978 | Ga0070690_1002409783 | 144 |
| 256 | 3300005331 | Ga0070670_100674356 | Ga0070670_1006743562 | 144 |
| 257 | 3300005334 | Ga0068869_100667522 | Ga0068869_1006675222 | 144 |
| 258 | 3300005338 | Ga0068868_101187130 | Ga0068868_1011871301 | 144 |
| 259 | 3300005338 | Ga0068868_101235638 | Ga0068868_1012356381 | 144 |
| 260 | 3300005340 | Ga0070689_101909920 | Ga0070689_1019099201 | 144 |
| 261 | 3300005341 | Ga0070691_10484955 | Ga0070691_104849551 | 144 |
| 262 | 3300005343 | Ga0070687_100339295 | Ga0070687_1003392951 | 144 |
| 263 | 3300005345 | Ga0070692_10031015 | Ga0070692_100310154 | 144 |
| 264 | 3300005345 | Ga0070692_10039551 | Ga0070692_100395512 | 144 |
| 265 | 3300005345 | Ga0070692_10908690 | Ga0070692_109086901 | 144 |
| 266 | 3300005347 | Ga0070668_100684008 | Ga0070668_1006840081 | 144 |
| 267 | 3300005347 | Ga0070668_101371733 | Ga0070668_1013717331 | 144 |
| 268 | 3300005354 | Ga0070675_100857826 | Ga0070675_1008578262 | 144 |
| 269 | 3300005355 | Ga0070671_100068116 | Ga0070671_1000681164 | 144 |
| 270 | 3300005356 | Ga0070674_100061623 | Ga0070674_1000616232 | 144 |
| 271 | 3300005356 | Ga0070674_100136395 | Ga0070674_1001363952 | 144 |
| 272 | 3300005356 | Ga0070674_100175523 | Ga0070674_1001755232 | 144 |
| 273 | 3300005356 | Ga0070674_100445367 | Ga0070674_1004453672 | 144 |
| 274 | 3300005364 | Ga0070673_100531478 | Ga0070673_1005314782 | 144 |
| 275 | 3300005366 | Ga0070659_100625674 | Ga0070659_1006256742 | 144 |
| 276 | 3300005366 | Ga0070659_101299038 | Ga0070659_1012990381 | 144 |
| 277 | 3300005406 | Ga0070703_10003635 | Ga0070703_100036354 | 144 |
| 278 | 3300005435 | Ga0070714_100033116 | Ga0070714_1000331162 | 144 |
| 279 | 3300005435 | Ga0070714_100065607 | Ga0070714_1000656072 | 144 |
| 280 | 3300005435 | Ga0070714_100156418 | Ga0070714_1001564183 | 144 |
| 281 | 3300005435 | Ga0070714_100265212 | Ga0070714_1002652123 | 144 |
| 282 | 3300005435 | Ga0070714_100378226 | Ga0070714_1003782262 | 144 |
| 283 | 3300005435 | Ga0070714_100818319 | Ga0070714_1008183192 | 144 |
| 284 | 3300005435 | Ga0070714_100996912 | Ga0070714_1009969122 | 144 |
| 285 | 3300005435 | Ga0070714_102361509 | Ga0070714_1023615091 | 144 |
| 286 | 3300005436 | Ga0070713_100086693 | Ga0070713_1000866933 | 144 |
| 287 | 3300005436 | Ga0070713_100244894 | Ga0070713_1002448941 | 144 |
| 288 | 3300005436 | Ga0070713_100253594 | Ga0070713_1002535942 | 144 |
| 289 | 3300005436 | Ga0070713_100680425 | Ga0070713_1006804252 | 144 |
| 290 | 3300005436 | Ga0070713_101214766 | Ga0070713_1012147661 | 144 |
| 291 | 3300005438 | Ga0070701_10122361 | Ga0070701_101223611 | 144 |
| 292 | 3300005438 | Ga0070701_10305595 | Ga0070701_103055951 | 144 |
| 293 | 3300005438 | Ga0070701_10907399 | Ga0070701_109073991 | 144 |
| 294 | 3300005440 | Ga0070705_100007053 | Ga0070705_1000070532 | 144 |
| 295 | 3300005440 | Ga0070705_100112137 | Ga0070705_1001121373 | 144 |
| 296 | 3300005440 | Ga0070705_100320949 | Ga0070705_1003209491 | 144 |
| 297 | 3300005440 | Ga0070705_100560240 | Ga0070705_1005602402 | 144 |
| 298 | 3300005441 | Ga0070700_100113325 | Ga0070700_1001133252 | 144 |
| 299 | 3300005441 | Ga0070700_100410536 | Ga0070700_1004105362 | 144 |
| 300 | 3300005441 | Ga0070700_100495448 | Ga0070700_1004954482 | 144 |
| 301 | 3300005441 | Ga0070700_101286267 | Ga0070700_1012862671 | 144 |
| 302 | 3300005444 | Ga0070694_100032696 | Ga0070694_1000326963 | 144 |
| 303 | 3300005444 | Ga0070694_100081245 | Ga0070694_1000812453 | 144 |
| 304 | 3300005444 | Ga0070694_100086445 | Ga0070694_1000864453 | 144 |
| 305 | 3300005444 | Ga0070694_100092380 | Ga0070694_1000923802 | 144 |
| 306 | 3300005444 | Ga0070694_100793940 | Ga0070694_1007939401 | 144 |
| 307 | 3300005445 | Ga0070708_100001281 | Ga0070708_10000128115 | 144 |
| 308 | 3300005445 | Ga0070708_100001720 | Ga0070708_1000017204 | 144 |
| 309 | 3300005445 | Ga0070708_100002506 | Ga0070708_10000250611 | 144 |
| 310 | 3300005445 | Ga0070708_100016020 | Ga0070708_1000160206 | 144 |
| 311 | 3300005445 | Ga0070708_100019788 | Ga0070708_1000197883 | 144 |
| 312 | 3300005445 | Ga0070708_100031340 | Ga0070708_1000313402 | 144 |
| 313 | 3300005445 | Ga0070708_100036593 | Ga0070708_1000365935 | 144 |
| 314 | 3300005445 | Ga0070708_100058163 | Ga0070708_1000581633 | 144 |
| 315 | 3300005445 | Ga0070708_100069824 | Ga0070708_1000698243 | 144 |
| 316 | 3300005445 | Ga0070708_100093904 | Ga0070708_1000939042 | 144 |
| 317 | 3300005445 | Ga0070708_100111438 | Ga0070708_1001114383 | 144 |
| 318 | 3300005445 | Ga0070708_100116352 | Ga0070708_1001163521 | 144 |
| 319 | 3300005445 | Ga0070708_100116556 | Ga0070708_1001165563 | 144 |
| 320 | 3300005445 | Ga0070708_100123730 | Ga0070708_1001237303 | 144 |
| 321 | 3300005445 | Ga0070708_100148423 | Ga0070708_1001484231 | 144 |
| 322 | 3300005445 | Ga0070708_100169282 | Ga0070708_1001692822 | 144 |
| 323 | 3300005445 | Ga0070708_100326565 | Ga0070708_1003265653 | 144 |
| 324 | 3300005445 | Ga0070708_100329136 | Ga0070708_1003291362 | 144 |
| 325 | 3300005445 | Ga0070708_100378973 | Ga0070708_1003789732 | 144 |
| 326 | 3300005445 | Ga0070708_100481776 | Ga0070708_1004817762 | 144 |
| 327 | 3300005445 | Ga0070708_100482530 | Ga0070708_1004825302 | 144 |
| 328 | 3300005445 | Ga0070708_100664196 | Ga0070708_1006641963 | 144 |
| 329 | 3300005445 | Ga0070708_101137298 | Ga0070708_1011372981 | 144 |
| 330 | 3300005445 | Ga0070708_101481238 | Ga0070708_1014812382 | 144 |
| 331 | 3300005445 | Ga0070708_101647589 | Ga0070708_1016475891 | 144 |
| 332 | 3300005455 | Ga0070663_101249291 | Ga0070663_1012492912 | 144 |
| 333 | 3300005456 | Ga0070678_100025557 | Ga0070678_1000255575 | 144 |
| 334 | 3300005456 | Ga0070678_100896143 | Ga0070678_1008961432 | 144 |
| 335 | 3300005456 | Ga0070678_101357755 | Ga0070678_1013577552 | 144 |
| 336 | 3300005457 | Ga0070662_100225858 | Ga0070662_1002258582 | 144 |
| 337 | 3300005457 | Ga0070662_100583459 | Ga0070662_1005834591 | 144 |
| 338 | 3300005459 | Ga0068867_100294243 | Ga0068867_1002942432 | 144 |
| 339 | 3300005459 | Ga0068867_100640943 | Ga0068867_1006409431 | 144 |
| 340 | 3300005459 | Ga0068867_101305548 | Ga0068867_1013055482 | 144 |
| 341 | 3300005467 | Ga0070706_100000355 | Ga0070706_1000003557 | 144 |
| 342 | 3300005467 | Ga0070706_100000937 | Ga0070706_1000009374 | 144 |
| 343 | 3300005467 | Ga0070706_100001208 | Ga0070706_10000120825 | 144 |
| 344 | 3300005467 | Ga0070706_100001868 | Ga0070706_1000018688 | 144 |
| 345 | 3300005467 | Ga0070706_100003296 | Ga0070706_1000032963 | 144 |
| 346 | 3300005467 | Ga0070706_100004086 | Ga0070706_10000408611 | 144 |
| 347 | 3300005467 | Ga0070706_100005466 | Ga0070706_10000546612 | 144 |
| 348 | 3300005467 | Ga0070706_100008455 | Ga0070706_1000084556 | 144 |
| 349 | 3300005467 | Ga0070706_100009642 | Ga0070706_1000096425 | 144 |
| 350 | 3300005467 | Ga0070706_100017130 | Ga0070706_1000171305 | 144 |
| 351 | 3300005467 | Ga0070706_100023927 | Ga0070706_1000239274 | 144 |
| 352 | 3300005467 | Ga0070706_100024051 | Ga0070706_1000240512 | 144 |
| 353 | 3300005467 | Ga0070706_100029036 | Ga0070706_1000290362 | 144 |
| 354 | 3300005467 | Ga0070706_100043904 | Ga0070706_1000439042 | 144 |
| 355 | 3300005467 | Ga0070706_100070652 | Ga0070706_1000706522 | 144 |
| 356 | 3300005467 | Ga0070706_100089062 | Ga0070706_1000890622 | 144 |
| 357 | 3300005467 | Ga0070706_100105028 | Ga0070706_1001050282 | 144 |
| 358 | 3300005467 | Ga0070706_100114210 | Ga0070706_1001142102 | 144 |
| 359 | 3300005467 | Ga0070706_100121291 | Ga0070706_1001212914 | 144 |
| 360 | 3300005467 | Ga0070706_100155284 | Ga0070706_1001552843 | 144 |
| 361 | 3300005467 | Ga0070706_100194968 | Ga0070706_1001949682 | 144 |
| 362 | 3300005467 | Ga0070706_100256929 | Ga0070706_1002569292 | 144 |
| 363 | 3300005467 | Ga0070706_100321619 | Ga0070706_1003216192 | 144 |
| 364 | 3300005467 | Ga0070706_100760183 | Ga0070706_1007601832 | 144 |
| 365 | 3300005467 | Ga0070706_100979686 | Ga0070706_1009796861 | 144 |
| 366 | 3300005467 | Ga0070706_101192515 | Ga0070706_1011925152 | 144 |
| 367 | 3300005468 | Ga0070707_100000762 | Ga0070707_10000076215 | 144 |
| 368 | 3300005468 | Ga0070707_100000793 | Ga0070707_1000007937 | 144 |
| 369 | 3300005468 | Ga0070707_100003826 | Ga0070707_10000382611 | 144 |
| 370 | 3300005468 | Ga0070707_100006232 | Ga0070707_1000062322 | 144 |
| 371 | 3300005468 | Ga0070707_100008729 | Ga0070707_1000087294 | 144 |
| 372 | 3300005468 | Ga0070707_100010515 | Ga0070707_1000105156 | 144 |
| 373 | 3300005468 | Ga0070707_100017247 | Ga0070707_1000172475 | 144 |
| 374 | 3300005468 | Ga0070707_100018505 | Ga0070707_1000185054 | 144 |
| 375 | 3300005468 | Ga0070707_100020220 | Ga0070707_1000202205 | 144 |
| 376 | 3300005468 | Ga0070707_100034004 | Ga0070707_1000340043 | 144 |
| 377 | 3300005468 | Ga0070707_100037785 | Ga0070707_1000377852 | 144 |
| 378 | 3300005468 | Ga0070707_100052540 | Ga0070707_1000525403 | 144 |
| 379 | 3300005468 | Ga0070707_100067641 | Ga0070707_1000676412 | 144 |
| 380 | 3300005468 | Ga0070707_100068793 | Ga0070707_1000687932 | 144 |
| 381 | 3300005468 | Ga0070707_100073346 | Ga0070707_1000733462 | 144 |
| 382 | 3300005468 | Ga0070707_100102269 | Ga0070707_1001022693 | 144 |
| 383 | 3300005468 | Ga0070707_100103892 | Ga0070707_1001038924 | 144 |
| 384 | 3300005468 | Ga0070707_100119600 | Ga0070707_1001196002 | 144 |
| 385 | 3300005468 | Ga0070707_100204939 | Ga0070707_1002049393 | 144 |
| 386 | 3300005468 | Ga0070707_100210348 | Ga0070707_1002103483 | 144 |
| 387 | 3300005468 | Ga0070707_100211856 | Ga0070707_1002118562 | 144 |
| 388 | 3300005468 | Ga0070707_100263776 | Ga0070707_1002637763 | 144 |
| 389 | 3300005468 | Ga0070707_100275584 | Ga0070707_1002755842 | 144 |
| 390 | 3300005468 | Ga0070707_100283545 | Ga0070707_1002835452 | 144 |
| 391 | 3300005468 | Ga0070707_100288035 | Ga0070707_1002880353 | 144 |
| 392 | 3300005468 | Ga0070707_100296061 | Ga0070707_1002960612 | 144 |
| 393 | 3300005468 | Ga0070707_100494691 | Ga0070707_1004946912 | 144 |
| 394 | 3300005468 | Ga0070707_100520646 | Ga0070707_1005206463 | 144 |
| 395 | 3300005468 | Ga0070707_100698561 | Ga0070707_1006985611 | 144 |
| 396 | 3300005468 | Ga0070707_100723383 | Ga0070707_1007233832 | 144 |
| 397 | 3300005468 | Ga0070707_100738781 | Ga0070707_1007387812 | 144 |
| 398 | 3300005468 | Ga0070707_100835976 | Ga0070707_1008359761 | 144 |
| 399 | 3300005468 | Ga0070707_100891925 | Ga0070707_1008919252 | 144 |
| 400 | 3300005468 | Ga0070707_100954612 | Ga0070707_1009546122 | 144 |
| 401 | 3300005468 | Ga0070707_101018576 | Ga0070707_1010185762 | 144 |
| 402 | 3300005468 | Ga0070707_101273599 | Ga0070707_1012735992 | 144 |
| 403 | 3300005468 | Ga0070707_101370771 | Ga0070707_1013707712 | 144 |
| 404 | 3300005468 | Ga0070707_101378656 | Ga0070707_1013786562 | 144 |
| 405 | 3300005468 | Ga0070707_101687330 | Ga0070707_1016873301 | 144 |
| 406 | 3300005471 | Ga0070698_100000448 | Ga0070698_10000044817 | 144 |
| 407 | 3300005471 | Ga0070698_100001509 | Ga0070698_1000015091 | 144 |
| 408 | 3300005471 | Ga0070698_100004279 | Ga0070698_10000427911 | 144 |
| 409 | 3300005471 | Ga0070698_100005770 | Ga0070698_1000057705 | 144 |
| 410 | 3300005471 | Ga0070698_100015160 | Ga0070698_1000151604 | 144 |
| 411 | 3300005471 | Ga0070698_100018758 | Ga0070698_1000187585 | 144 |
| 412 | 3300005471 | Ga0070698_100020451 | Ga0070698_1000204515 | 144 |
| 413 | 3300005471 | Ga0070698_100027998 | Ga0070698_1000279984 | 144 |
| 414 | 3300005471 | Ga0070698_100030365 | Ga0070698_1000303654 | 144 |
| 415 | 3300005471 | Ga0070698_100034878 | Ga0070698_1000348784 | 144 |
| 416 | 3300005471 | Ga0070698_100047358 | Ga0070698_1000473582 | 144 |
| 417 | 3300005471 | Ga0070698_100072371 | Ga0070698_1000723715 | 144 |
| 418 | 3300005471 | Ga0070698_100072567 | Ga0070698_1000725673 | 144 |
| 419 | 3300005471 | Ga0070698_100083498 | Ga0070698_1000834983 | 144 |
| 420 | 3300005471 | Ga0070698_100124437 | Ga0070698_1001244373 | 144 |
| 421 | 3300005471 | Ga0070698_100161743 | Ga0070698_1001617432 | 144 |
| 422 | 3300005471 | Ga0070698_100176031 | Ga0070698_1001760312 | 144 |
| 423 | 3300005471 | Ga0070698_100225157 | Ga0070698_1002251573 | 144 |
| 424 | 3300005471 | Ga0070698_100288059 | Ga0070698_1002880592 | 144 |
| 425 | 3300005471 | Ga0070698_100297529 | Ga0070698_1002975292 | 144 |
| 426 | 3300005471 | Ga0070698_100333414 | Ga0070698_1003334142 | 144 |
| 427 | 3300005471 | Ga0070698_100337157 | Ga0070698_1003371572 | 144 |
| 428 | 3300005471 | Ga0070698_100476027 | Ga0070698_1004760272 | 144 |
| 429 | 3300005471 | Ga0070698_100507252 | Ga0070698_1005072521 | 144 |
| 430 | 3300005471 | Ga0070698_100694404 | Ga0070698_1006944042 | 144 |
| 431 | 3300005471 | Ga0070698_100706197 | Ga0070698_1007061971 | 144 |
| 432 | 3300005471 | Ga0070698_100823749 | Ga0070698_1008237492 | 144 |
| 433 | 3300005471 | Ga0070698_100984801 | Ga0070698_1009848011 | 144 |
| 434 | 3300005471 | Ga0070698_101543788 | Ga0070698_1015437881 | 144 |
| 435 | 3300005518 | Ga0070699_100000806 | Ga0070699_10000080622 | 144 |
| 436 | 3300005518 | Ga0070699_100001002 | Ga0070699_10000100223 | 144 |
| 437 | 3300005518 | Ga0070699_100002301 | Ga0070699_1000023013 | 144 |
| 438 | 3300005518 | Ga0070699_100002562 | Ga0070699_1000025626 | 144 |
| 439 | 3300005518 | Ga0070699_100027236 | Ga0070699_1000272365 | 144 |
| 440 | 3300005518 | Ga0070699_100034048 | Ga0070699_1000340483 | 144 |
| 441 | 3300005518 | Ga0070699_100072460 | Ga0070699_1000724603 | 144 |
| 442 | 3300005518 | Ga0070699_100073844 | Ga0070699_1000738443 | 144 |
| 443 | 3300005518 | Ga0070699_100113091 | Ga0070699_1001130911 | 144 |
| 444 | 3300005518 | Ga0070699_100142317 | Ga0070699_1001423173 | 144 |
| 445 | 3300005518 | Ga0070699_100157927 | Ga0070699_1001579274 | 144 |
| 446 | 3300005518 | Ga0070699_100160050 | Ga0070699_1001600503 | 144 |
| 447 | 3300005518 | Ga0070699_100162891 | Ga0070699_1001628912 | 144 |
| 448 | 3300005518 | Ga0070699_100209132 | Ga0070699_1002091323 | 144 |
| 449 | 3300005518 | Ga0070699_100245449 | Ga0070699_1002454492 | 144 |
| 450 | 3300005518 | Ga0070699_100252521 | Ga0070699_1002525213 | 144 |
| 451 | 3300005518 | Ga0070699_100262920 | Ga0070699_1002629201 | 144 |
| 452 | 3300005518 | Ga0070699_100278332 | Ga0070699_1002783322 | 144 |
| 453 | 3300005518 | Ga0070699_100374023 | Ga0070699_1003740231 | 144 |
| 454 | 3300005518 | Ga0070699_100428107 | Ga0070699_1004281072 | 144 |
| 455 | 3300005518 | Ga0070699_100614139 | Ga0070699_1006141392 | 144 |
| 456 | 3300005518 | Ga0070699_100703201 | Ga0070699_1007032012 | 144 |
| 457 | 3300005518 | Ga0070699_100843735 | Ga0070699_1008437351 | 144 |
| 458 | 3300005518 | Ga0070699_100910556 | Ga0070699_1009105562 | 144 |
| 459 | 3300005518 | Ga0070699_100921109 | Ga0070699_1009211091 | 144 |
| 460 | 3300005518 | Ga0070699_101148150 | Ga0070699_1011481501 | 144 |
| 461 | 3300005518 | Ga0070699_101507130 | Ga0070699_1015071301 | 144 |
| 462 | 3300005535 | Ga0070684_100100508 | Ga0070684_1001005083 | 144 |
| 463 | 3300005536 | Ga0070697_100000001 | Ga0070697_100000001653 | 144 |
| 464 | 3300005536 | Ga0070697_100000091 | Ga0070697_10000009179 | 144 |
| 465 | 3300005536 | Ga0070697_100001138 | Ga0070697_10000113817 | 144 |
| 466 | 3300005536 | Ga0070697_100003405 | Ga0070697_10000340512 | 144 |
| 467 | 3300005536 | Ga0070697_100013735 | Ga0070697_1000137355 | 144 |
| 468 | 3300005536 | Ga0070697_100014014 | Ga0070697_1000140147 | 144 |
| 469 | 3300005536 | Ga0070697_100035202 | Ga0070697_1000352023 | 144 |
| 470 | 3300005536 | Ga0070697_100113143 | Ga0070697_1001131433 | 144 |
| 471 | 3300005536 | Ga0070697_100118383 | Ga0070697_1001183832 | 144 |
| 472 | 3300005536 | Ga0070697_100157200 | Ga0070697_1001572003 | 144 |
| 473 | 3300005536 | Ga0070697_100163034 | Ga0070697_1001630342 | 144 |
| 474 | 3300005536 | Ga0070697_100250655 | Ga0070697_1002506552 | 144 |
| 475 | 3300005536 | Ga0070697_100364974 | Ga0070697_1003649742 | 144 |
| 476 | 3300005536 | Ga0070697_100366744 | Ga0070697_1003667442 | 144 |
| 477 | 3300005536 | Ga0070697_100453299 | Ga0070697_1004532992 | 144 |
| 478 | 3300005536 | Ga0070697_100752019 | Ga0070697_1007520192 | 144 |
| 479 | 3300005536 | Ga0070697_100784801 | Ga0070697_1007848012 | 144 |
| 480 | 3300005536 | Ga0070697_100805120 | Ga0070697_1008051202 | 144 |
| 481 | 3300005545 | Ga0070695_100042084 | Ga0070695_1000420843 | 144 |
| 482 | 3300005545 | Ga0070695_100089868 | Ga0070695_1000898683 | 144 |
| 483 | 3300005545 | Ga0070695_100176422 | Ga0070695_1001764221 | 144 |
| 484 | 3300005545 | Ga0070695_100282030 | Ga0070695_1002820302 | 144 |
| 485 | 3300005545 | Ga0070695_100407124 | Ga0070695_1004071242 | 144 |
| 486 | 3300005545 | Ga0070695_101714729 | Ga0070695_1017147291 | 144 |
| 487 | 3300005546 | Ga0070696_100119666 | Ga0070696_1001196662 | 144 |
| 488 | 3300005546 | Ga0070696_100151302 | Ga0070696_1001513022 | 144 |
| 489 | 3300005546 | Ga0070696_100176578 | Ga0070696_1001765782 | 144 |
| 490 | 3300005546 | Ga0070696_100508343 | Ga0070696_1005083432 | 144 |
| 491 | 3300005546 | Ga0070696_101044899 | Ga0070696_1010448992 | 144 |
| 492 | 3300005546 | Ga0070696_101564741 | Ga0070696_1015647411 | 144 |
| 493 | 3300005546 | Ga0070696_101618710 | Ga0070696_1016187101 | 144 |
| 494 | 3300005549 | Ga0070704_100004211 | Ga0070704_1000042114 | 144 |
| 495 | 3300005549 | Ga0070704_100004802 | Ga0070704_10000480210 | 144 |
| 496 | 3300005549 | Ga0070704_100057432 | Ga0070704_1000574322 | 144 |
| 497 | 3300005549 | Ga0070704_100273876 | Ga0070704_1002738762 | 144 |
| 498 | 3300005549 | Ga0070704_100378470 | Ga0070704_1003784702 | 144 |
| 499 | 3300005549 | Ga0070704_100614087 | Ga0070704_1006140872 | 144 |
| 500 | 3300005549 | Ga0070704_100867811 | Ga0070704_1008678112 | 144 |
| 501 | 3300005577 | Ga0068857_100034650 | Ga0068857_1000346502 | 144 |
| 502 | 3300005577 | Ga0068857_100157245 | Ga0068857_1001572454 | 144 |
| 503 | 3300005577 | Ga0068857_100234623 | Ga0068857_1002346232 | 144 |
| 504 | 3300005578 | Ga0068854_100075271 | Ga0068854_1000752712 | 144 |
| 505 | 3300005614 | Ga0068856_100871248 | Ga0068856_1008712482 | 144 |
| 506 | 3300005616 | Ga0068852_100376358 | Ga0068852_1003763581 | 144 |
| 507 | 3300005618 | Ga0068864_100116724 | Ga0068864_1001167243 | 144 |
| 508 | 3300005618 | Ga0068864_100354344 | Ga0068864_1003543442 | 144 |
| 509 | 3300005618 | Ga0068864_100477933 | Ga0068864_1004779332 | 144 |
| 510 | 3300005719 | Ga0068861_100009800 | Ga0068861_1000098009 | 144 |
| 511 | 3300005719 | Ga0068861_100232452 | Ga0068861_1002324523 | 144 |
| 512 | 3300005719 | Ga0068861_100595320 | Ga0068861_1005953202 | 144 |
| 513 | 3300005840 | Ga0068870_10909465 | Ga0068870_109094651 | 144 |
| 514 | 3300005840 | Ga0068870_11078851 | Ga0068870_110788511 | 144 |
| 515 | 3300005841 | Ga0068863_100537165 | Ga0068863_1005371652 | 144 |
| 516 | 3300005841 | Ga0068863_101728879 | Ga0068863_1017288791 | 144 |
| 517 | 3300005841 | Ga0068863_101831051 | Ga0068863_1018310512 | 144 |
| 518 | 3300005842 | Ga0068858_100114858 | Ga0068858_1001148581 | 144 |
| 519 | 3300005985 | Ga0081539_10002337 | Ga0081539_100023372 | 144 |
| 520 | 3300006028 | Ga0070717_10000078 | Ga0070717_1000007842 | 144 |
| 521 | 3300006028 | Ga0070717_10005470 | Ga0070717_100054704 | 144 |
| 522 | 3300006028 | Ga0070717_10009434 | Ga0070717_100094346 | 144 |
| 523 | 3300006028 | Ga0070717_10034108 | Ga0070717_100341083 | 144 |
| 524 | 3300006028 | Ga0070717_10051517 | Ga0070717_100515173 | 144 |
| 525 | 3300006028 | Ga0070717_10065336 | Ga0070717_100653362 | 144 |
| 526 | 3300006028 | Ga0070717_10092109 | Ga0070717_100921093 | 144 |
| 527 | 3300006028 | Ga0070717_10129914 | Ga0070717_101299143 | 144 |
| 528 | 3300006028 | Ga0070717_10391375 | Ga0070717_103913752 | 144 |
| 529 | 3300006028 | Ga0070717_10682940 | Ga0070717_106829402 | 144 |
| 530 | 3300006028 | Ga0070717_11753211 | Ga0070717_117532111 | 144 |
| 531 | 3300006038 | Ga0075365_10127565 | Ga0075365_101275651 | 144 |
| 532 | 3300006058 | Ga0075432_10031665 | Ga0075432_100316652 | 144 |
| 533 | 3300006163 | Ga0070715_10218674 | Ga0070715_102186742 | 144 |
| 534 | 3300006173 | Ga0070716_100004566 | Ga0070716_1000045663 | 144 |
| 535 | 3300006173 | Ga0070716_100030432 | Ga0070716_1000304323 | 144 |
| 536 | 3300006173 | Ga0070716_100054229 | Ga0070716_1000542293 | 144 |
| 537 | 3300006173 | Ga0070716_100311114 | Ga0070716_1003111142 | 144 |
| 538 | 3300006173 | Ga0070716_100868124 | Ga0070716_1008681241 | 144 |
| 539 | 3300006175 | Ga0070712_100004266 | Ga0070712_1000042662 | 144 |
| 540 | 3300006175 | Ga0070712_100069668 | Ga0070712_1000696682 | 144 |
| 541 | 3300006175 | Ga0070712_100094999 | Ga0070712_1000949993 | 144 |
| 542 | 3300006175 | Ga0070712_100189248 | Ga0070712_1001892481 | 144 |
| 543 | 3300006175 | Ga0070712_100367796 | Ga0070712_1003677962 | 144 |
| 544 | 3300006175 | Ga0070712_100852126 | Ga0070712_1008521262 | 144 |
| 545 | 3300006358 | Ga0068871_100250162 | Ga0068871_1002501623 | 144 |
| 546 | 3300006358 | Ga0068871_101367791 | Ga0068871_1013677911 | 144 |
| 547 | 3300006844 | Ga0075428_100014419 | Ga0075428_10001441912 | 144 |
| 548 | 3300006844 | Ga0075428_100248935 | Ga0075428_1002489352 | 144 |
| 549 | 3300006844 | Ga0075428_100330118 | Ga0075428_1003301182 | 144 |
| 550 | 3300006844 | Ga0075428_100810221 | Ga0075428_1008102212 | 144 |
| 551 | 3300006844 | Ga0075428_101510144 | Ga0075428_1015101441 | 144 |
| 552 | 3300006846 | Ga0075430_100175215 | Ga0075430_1001752153 | 144 |
| 553 | 3300006847 | Ga0075431_100210148 | Ga0075431_1002101482 | 144 |
| 554 | 3300006847 | Ga0075431_100403679 | Ga0075431_1004036792 | 144 |
| 555 | 3300006847 | Ga0075431_100779647 | Ga0075431_1007796471 | 144 |
| 556 | 3300006847 | Ga0075431_101199765 | Ga0075431_1011997651 | 144 |
| 557 | 3300006852 | Ga0075433_10032631 | Ga0075433_100326312 | 144 |
| 558 | 3300006852 | Ga0075433_10291039 | Ga0075433_102910392 | 144 |
| 559 | 3300006852 | Ga0075433_10371449 | Ga0075433_103714492 | 144 |
| 560 | 3300006852 | Ga0075433_11294707 | Ga0075433_112947071 | 144 |
| 561 | 3300006852 | Ga0075433_11974890 | Ga0075433_119748901 | 144 |
| 562 | 3300006871 | Ga0075434_100015933 | Ga0075434_1000159333 | 144 |
| 563 | 3300006871 | Ga0075434_100021534 | Ga0075434_1000215342 | 144 |
| 564 | 3300006871 | Ga0075434_100230026 | Ga0075434_1002300262 | 144 |
| 565 | 3300006871 | Ga0075434_100234879 | Ga0075434_1002348792 | 144 |
| 566 | 3300006871 | Ga0075434_100548534 | Ga0075434_1005485342 | 144 |
| 567 | 3300006871 | Ga0075434_101592477 | Ga0075434_1015924772 | 144 |
| 568 | 3300006871 | Ga0075434_101685726 | Ga0075434_1016857261 | 144 |
| 569 | 3300006871 | Ga0075434_102078831 | Ga0075434_1020788311 | 144 |
| 570 | 3300006880 | Ga0075429_101359648 | Ga0075429_1013596481 | 144 |
| 571 | 3300006881 | Ga0068865_100237916 | Ga0068865_1002379162 | 144 |
| 572 | 3300006881 | Ga0068865_100381844 | Ga0068865_1003818442 | 144 |
| 573 | 3300006881 | Ga0068865_100415425 | Ga0068865_1004154252 | 144 |
| 574 | 3300006881 | Ga0068865_100782138 | Ga0068865_1007821381 | 144 |
| 575 | 3300006914 | Ga0075436_100031969 | Ga0075436_1000319694 | 144 |
| 576 | 3300006914 | Ga0075436_100053527 | Ga0075436_1000535272 | 144 |
| 577 | 3300006914 | Ga0075436_100146037 | Ga0075436_1001460372 | 144 |
| 578 | 3300006914 | Ga0075436_100326720 | Ga0075436_1003267202 | 144 |
| 579 | 3300006914 | Ga0075436_100437866 | Ga0075436_1004378662 | 144 |
| 580 | 3300006914 | Ga0075436_100499728 | Ga0075436_1004997281 | 144 |
| 581 | 3300006914 | Ga0075436_100569326 | Ga0075436_1005693262 | 144 |
| 582 | 3300006931 | Ga0097620_100699736 | Ga0097620_1006997362 | 144 |
| 583 | 3300007076 | Ga0075435_100035672 | Ga0075435_1000356721 | 144 |
| 584 | 3300007076 | Ga0075435_100093290 | Ga0075435_1000932903 | 144 |
| 585 | 3300007076 | Ga0075435_100260853 | Ga0075435_1002608532 | 144 |
| 586 | 3300007076 | Ga0075435_100453835 | Ga0075435_1004538352 | 144 |
| 587 | 3300007076 | Ga0075435_100464997 | Ga0075435_1004649972 | 144 |
| 588 | 3300007076 | Ga0075435_100469068 | Ga0075435_1004690682 | 144 |
| 589 | 3300007265 | Ga0099794_10009761 | Ga0099794_100097612 | 144 |
| 590 | 3300009011 | Ga0105251_10121122 | Ga0105251_101211222 | 144 |
| 591 | 3300009094 | Ga0111539_10089009 | Ga0111539_100890092 | 144 |
| 592 | 3300009094 | Ga0111539_10220914 | Ga0111539_102209142 | 144 |
| 593 | 3300009094 | Ga0111539_10521842 | Ga0111539_105218422 | 144 |
| 594 | 3300009098 | Ga0105245_10060620 | Ga0105245_100606204 | 144 |
| 595 | 3300009098 | Ga0105245_10658782 | Ga0105245_106587822 | 144 |
| 596 | 3300009098 | Ga0105245_10898693 | Ga0105245_108986932 | 144 |
| 597 | 3300009098 | Ga0105245_10907345 | Ga0105245_109073451 | 144 |
| 598 | 3300009101 | Ga0105247_10379024 | Ga0105247_103790242 | 144 |
| 599 | 3300009147 | Ga0114129_10007918 | Ga0114129_100079183 | 144 |
| 600 | 3300009147 | Ga0114129_10072023 | Ga0114129_100720234 | 144 |
| 601 | 3300009147 | Ga0114129_10185240 | Ga0114129_101852402 | 144 |
| 602 | 3300009147 | Ga0114129_10264924 | Ga0114129_102649243 | 144 |
| 603 | 3300009147 | Ga0114129_10351522 | Ga0114129_103515222 | 144 |
| 604 | 3300009147 | Ga0114129_10361615 | Ga0114129_103616152 | 144 |
| 605 | 3300009147 | Ga0114129_10919516 | Ga0114129_109195161 | 144 |
| 606 | 3300009147 | Ga0114129_11069609 | Ga0114129_110696092 | 144 |
| 607 | 3300009147 | Ga0114129_11722820 | Ga0114129_117228201 | 144 |
| 608 | 3300009148 | Ga0105243_10062331 | Ga0105243_100623312 | 144 |
| 609 | 3300009148 | Ga0105243_10366092 | Ga0105243_103660923 | 144 |
| 610 | 3300009148 | Ga0105243_10565969 | Ga0105243_105659692 | 144 |
| 611 | 3300009174 | Ga0105241_11642247 | Ga0105241_116422471 | 144 |
| 612 | 3300009176 | Ga0105242_10036378 | Ga0105242_100363785 | 144 |
| 613 | 3300009176 | Ga0105242_10064171 | Ga0105242_100641714 | 144 |
| 614 | 3300009176 | Ga0105242_10186921 | Ga0105242_101869211 | 144 |
| 615 | 3300009176 | Ga0105242_10463724 | Ga0105242_104637242 | 144 |
| 616 | 3300009176 | Ga0105242_10650216 | Ga0105242_106502162 | 144 |
| 617 | 3300009176 | Ga0105242_11752391 | Ga0105242_117523911 | 144 |
| 618 | 3300009177 | Ga0105248_10039370 | Ga0105248_100393706 | 144 |
| 619 | 3300009553 | Ga0105249_11305342 | Ga0105249_113053421 | 144 |
| 620 | 3300010375 | Ga0105239_10079574 | Ga0105239_100795743 | 144 |
| 621 | 3300011119 | Ga0105246_10147894 | Ga0105246_101478942 | 144 |
| 622 | 3300011119 | Ga0105246_10420980 | Ga0105246_104209802 | 144 |
| 623 | 3300011119 | Ga0105246_10835859 | Ga0105246_108358591 | 144 |
| 624 | 3300013296 | Ga0157374_10498194 | Ga0157374_104981942 | 144 |
| 625 | 3300013296 | Ga0157374_10516932 | Ga0157374_105169322 | 144 |
| 626 | 3300013297 | Ga0157378_10008857 | Ga0157378_100088576 | 144 |
| 627 | 3300013297 | Ga0157378_10069094 | Ga0157378_100690945 | 144 |
| 628 | 3300013297 | Ga0157378_10095271 | Ga0157378_100952713 | 144 |
| 629 | 3300013297 | Ga0157378_11304838 | Ga0157378_113048382 | 144 |
| 630 | 3300013297 | Ga0157378_12059674 | Ga0157378_120596741 | 144 |
| 631 | 3300013306 | Ga0163162_10056620 | Ga0163162_100566202 | 144 |
| 632 | 3300013306 | Ga0163162_11273827 | Ga0163162_112738271 | 144 |
| 633 | 3300013306 | Ga0163162_12707613 | Ga0163162_127076131 | 144 |
| 634 | 3300013307 | Ga0157372_10682861 | Ga0157372_106828611 | 144 |
| 635 | 3300013308 | Ga0157375_10165078 | Ga0157375_101650784 | 144 |
| 636 | 3300013308 | Ga0157375_10303229 | Ga0157375_103032292 | 144 |
| 637 | 3300013308 | Ga0157375_10403236 | Ga0157375_104032362 | 144 |
| 638 | 3300013308 | Ga0157375_10808797 | Ga0157375_108087972 | 144 |
| 639 | 3300014325 | Ga0163163_10775761 | Ga0163163_107757612 | 144 |
| 640 | 3300014325 | Ga0163163_11291165 | Ga0163163_112911651 | 144 |
| 641 | 3300014326 | Ga0157380_10210813 | Ga0157380_102108133 | 144 |
| 642 | 3300014326 | Ga0157380_12404822 | Ga0157380_124048221 | 144 |
| 643 | 3300014326 | Ga0157380_12438336 | Ga0157380_124383361 | 144 |
| 644 | 3300014745 | Ga0157377_10141281 | Ga0157377_101412812 | 144 |
| 645 | 3300014745 | Ga0157377_10374686 | Ga0157377_103746862 | 144 |
| 646 | 3300014968 | Ga0157379_10346741 | Ga0157379_103467412 | 144 |
| 647 | 3300014968 | Ga0157379_11222073 | Ga0157379_112220732 | 144 |
| 648 | 3300014968 | Ga0157379_11372113 | Ga0157379_113721131 | 144 |
| 649 | 3300014968 | Ga0157379_11482785 | Ga0157379_114827852 | 144 |
| 650 | 3300014969 | Ga0157376_10049673 | Ga0157376_100496735 | 144 |
| 651 | 3300014969 | Ga0157376_12833348 | Ga0157376_128333481 | 144 |
| 652 | 3300017792 | Ga0163161_10088071 | Ga0163161_100880712 | 144 |
| 653 | 3300024225 | Ga0224572_1006688 | Ga0224572_10066882 | 144 |
| 654 | 3300024227 | Ga0228598_1013894 | Ga0228598_10138941 | 144 |
| 655 | 3300025228 | Ga0209672_100006 | Ga0209672_100006119 | 144 |
| 656 | 3300025229 | Ga0209147_100370 | Ga0209147_1003703 | 144 |
| 657 | 3300025242 | Ga0209258_101558 | Ga0209258_1015584 | 144 |
| 658 | 3300025254 | Ga0209148_1000152 | Ga0209148_100015239 | 144 |
| 659 | 3300025272 | Ga0209455_1000134 | Ga0209455_100013439 | 144 |
| 660 | 3300025885 | Ga0207653_10020950 | Ga0207653_100209503 | 144 |
| 661 | 3300025898 | Ga0207692_10193998 | Ga0207692_101939982 | 144 |
| 662 | 3300025899 | Ga0207642_10136974 | Ga0207642_101369742 | 144 |
| 663 | 3300025904 | Ga0207647_10046513 | Ga0207647_100465134 | 144 |
| 664 | 3300025905 | Ga0207685_10032117 | Ga0207685_100321172 | 144 |
| 665 | 3300025905 | Ga0207685_10161047 | Ga0207685_101610472 | 144 |
| 666 | 3300025905 | Ga0207685_10298442 | Ga0207685_102984421 | 144 |
| 667 | 3300025910 | Ga0207684_10000006 | Ga0207684_10000006658 | 144 |
| 668 | 3300025910 | Ga0207684_10000084 | Ga0207684_10000084180 | 144 |
| 669 | 3300025910 | Ga0207684_10000583 | Ga0207684_1000058312 | 144 |
| 670 | 3300025910 | Ga0207684_10000970 | Ga0207684_100009703 | 144 |
| 671 | 3300025910 | Ga0207684_10000988 | Ga0207684_100009884 | 144 |
| 672 | 3300025910 | Ga0207684_10001237 | Ga0207684_100012375 | 144 |
| 673 | 3300025910 | Ga0207684_10001698 | Ga0207684_1000169824 | 144 |
| 674 | 3300025910 | Ga0207684_10003801 | Ga0207684_100038014 | 144 |
| 675 | 3300025910 | Ga0207684_10004915 | Ga0207684_100049154 | 144 |
| 676 | 3300025910 | Ga0207684_10005817 | Ga0207684_100058176 | 144 |
| 677 | 3300025910 | Ga0207684_10007853 | Ga0207684_100078536 | 144 |
| 678 | 3300025910 | Ga0207684_10014884 | Ga0207684_100148845 | 144 |
| 679 | 3300025910 | Ga0207684_10022460 | Ga0207684_100224602 | 144 |
| 680 | 3300025910 | Ga0207684_10041420 | Ga0207684_100414202 | 144 |
| 681 | 3300025910 | Ga0207684_10121985 | Ga0207684_101219852 | 144 |
| 682 | 3300025910 | Ga0207684_10175478 | Ga0207684_101754783 | 144 |
| 683 | 3300025910 | Ga0207684_10221687 | Ga0207684_102216872 | 144 |
| 684 | 3300025910 | Ga0207684_10290721 | Ga0207684_102907212 | 144 |
| 685 | 3300025910 | Ga0207684_10344372 | Ga0207684_103443721 | 144 |
| 686 | 3300025910 | Ga0207684_10351918 | Ga0207684_103519182 | 144 |
| 687 | 3300025910 | Ga0207684_10454937 | Ga0207684_104549372 | 144 |
| 688 | 3300025910 | Ga0207684_10585385 | Ga0207684_105853852 | 144 |
| 689 | 3300025910 | Ga0207684_10683430 | Ga0207684_106834302 | 144 |
| 690 | 3300025910 | Ga0207684_10686997 | Ga0207684_106869971 | 144 |
| 691 | 3300025910 | Ga0207684_10901021 | Ga0207684_109010211 | 144 |
| 692 | 3300025910 | Ga0207684_11205167 | Ga0207684_112051672 | 144 |
| 693 | 3300025913 | Ga0207695_11284909 | Ga0207695_112849091 | 144 |
| 694 | 3300025915 | Ga0207693_10022761 | Ga0207693_100227612 | 144 |
| 695 | 3300025915 | Ga0207693_10054771 | Ga0207693_100547713 | 144 |
| 696 | 3300025915 | Ga0207693_10055489 | Ga0207693_100554893 | 144 |
| 697 | 3300025915 | Ga0207693_10104924 | Ga0207693_101049242 | 144 |
| 698 | 3300025915 | Ga0207693_10116021 | Ga0207693_101160212 | 144 |
| 699 | 3300025916 | Ga0207663_10026630 | Ga0207663_100266302 | 144 |
| 700 | 3300025917 | Ga0207660_10546659 | Ga0207660_105466592 | 144 |
| 701 | 3300025918 | Ga0207662_10250330 | Ga0207662_102503302 | 144 |
| 702 | 3300025922 | Ga0207646_10000031 | Ga0207646_10000031180 | 144 |
| 703 | 3300025922 | Ga0207646_10000033 | Ga0207646_10000033105 | 144 |
| 704 | 3300025922 | Ga0207646_10000063 | Ga0207646_1000006318 | 144 |
| 705 | 3300025922 | Ga0207646_10000218 | Ga0207646_1000021830 | 144 |
| 706 | 3300025922 | Ga0207646_10000746 | Ga0207646_1000074639 | 144 |
| 707 | 3300025922 | Ga0207646_10001161 | Ga0207646_1000116125 | 144 |
| 708 | 3300025922 | Ga0207646_10001607 | Ga0207646_100016075 | 144 |
| 709 | 3300025922 | Ga0207646_10001916 | Ga0207646_1000191619 | 144 |
| 710 | 3300025922 | Ga0207646_10002200 | Ga0207646_1000220019 | 144 |
| 711 | 3300025922 | Ga0207646_10024235 | Ga0207646_100242352 | 144 |
| 712 | 3300025922 | Ga0207646_10025800 | Ga0207646_100258004 | 144 |
| 713 | 3300025922 | Ga0207646_10026423 | Ga0207646_100264233 | 144 |
| 714 | 3300025922 | Ga0207646_10032134 | Ga0207646_100321343 | 144 |
| 715 | 3300025922 | Ga0207646_10034230 | Ga0207646_100342304 | 144 |
| 716 | 3300025922 | Ga0207646_10037181 | Ga0207646_100371817 | 144 |
| 717 | 3300025922 | Ga0207646_10037700 | Ga0207646_100377003 | 144 |
| 718 | 3300025922 | Ga0207646_10045604 | Ga0207646_100456043 | 144 |
| 719 | 3300025922 | Ga0207646_10055797 | Ga0207646_100557972 | 144 |
| 720 | 3300025922 | Ga0207646_10063357 | Ga0207646_100633572 | 144 |
| 721 | 3300025922 | Ga0207646_10067041 | Ga0207646_100670412 | 144 |
| 722 | 3300025922 | Ga0207646_10069049 | Ga0207646_100690493 | 144 |
| 723 | 3300025922 | Ga0207646_10114490 | Ga0207646_101144902 | 144 |
| 724 | 3300025922 | Ga0207646_10139665 | Ga0207646_101396653 | 144 |
| 725 | 3300025922 | Ga0207646_10142933 | Ga0207646_101429332 | 144 |
| 726 | 3300025922 | Ga0207646_10177334 | Ga0207646_101773343 | 144 |
| 727 | 3300025922 | Ga0207646_10248607 | Ga0207646_102486072 | 144 |
| 728 | 3300025922 | Ga0207646_10252825 | Ga0207646_102528252 | 144 |
| 729 | 3300025922 | Ga0207646_10275126 | Ga0207646_102751263 | 144 |
| 730 | 3300025922 | Ga0207646_10356479 | Ga0207646_103564792 | 144 |
| 731 | 3300025922 | Ga0207646_10367298 | Ga0207646_103672982 | 144 |
| 732 | 3300025922 | Ga0207646_10460877 | Ga0207646_104608771 | 144 |
| 733 | 3300025922 | Ga0207646_10587629 | Ga0207646_105876291 | 144 |
| 734 | 3300025922 | Ga0207646_10758200 | Ga0207646_107582001 | 144 |
| 735 | 3300025922 | Ga0207646_10902467 | Ga0207646_109024671 | 144 |
| 736 | 3300025922 | Ga0207646_11680241 | Ga0207646_116802411 | 144 |
| 737 | 3300025925 | Ga0207650_10213733 | Ga0207650_102137331 | 144 |
| 738 | 3300025925 | Ga0207650_10375661 | Ga0207650_103756613 | 144 |
| 739 | 3300025926 | Ga0207659_10578244 | Ga0207659_105782442 | 144 |
| 740 | 3300025927 | Ga0207687_10302967 | Ga0207687_103029672 | 144 |
| 741 | 3300025927 | Ga0207687_11138409 | Ga0207687_111384092 | 144 |
| 742 | 3300025927 | Ga0207687_11212068 | Ga0207687_112120681 | 144 |
| 743 | 3300025928 | Ga0207700_10031452 | Ga0207700_100314523 | 144 |
| 744 | 3300025928 | Ga0207700_10202829 | Ga0207700_102028293 | 144 |
| 745 | 3300025928 | Ga0207700_10829382 | Ga0207700_108293822 | 144 |
| 746 | 3300025929 | Ga0207664_10019469 | Ga0207664_100194696 | 144 |
| 747 | 3300025929 | Ga0207664_10032019 | Ga0207664_100320193 | 144 |
| 748 | 3300025929 | Ga0207664_10032521 | Ga0207664_100325215 | 144 |
| 749 | 3300025929 | Ga0207664_10095880 | Ga0207664_100958801 | 144 |
| 750 | 3300025929 | Ga0207664_10263581 | Ga0207664_102635812 | 144 |
| 751 | 3300025929 | Ga0207664_11037786 | Ga0207664_110377861 | 144 |
| 752 | 3300025929 | Ga0207664_11045222 | Ga0207664_110452221 | 144 |
| 753 | 3300025931 | Ga0207644_10424783 | Ga0207644_104247831 | 144 |
| 754 | 3300025932 | Ga0207690_10328242 | Ga0207690_103282422 | 144 |
| 755 | 3300025932 | Ga0207690_10765447 | Ga0207690_107654472 | 144 |
| 756 | 3300025933 | Ga0207706_10527600 | Ga0207706_105276001 | 144 |
| 757 | 3300025933 | Ga0207706_10680600 | Ga0207706_106806002 | 144 |
| 758 | 3300025933 | Ga0207706_10857952 | Ga0207706_108579522 | 144 |
| 759 | 3300025934 | Ga0207686_10006047 | Ga0207686_100060476 | 144 |
| 760 | 3300025935 | Ga0207709_10061332 | Ga0207709_100613322 | 144 |
| 761 | 3300025935 | Ga0207709_10074201 | Ga0207709_100742014 | 144 |
| 762 | 3300025935 | Ga0207709_10192779 | Ga0207709_101927792 | 144 |
| 763 | 3300025937 | Ga0207669_10020784 | Ga0207669_100207844 | 144 |
| 764 | 3300025937 | Ga0207669_10239409 | Ga0207669_102394092 | 144 |
| 765 | 3300025937 | Ga0207669_10545223 | Ga0207669_105452232 | 144 |
| 766 | 3300025938 | Ga0207704_10139516 | Ga0207704_101395162 | 144 |
| 767 | 3300025939 | Ga0207665_10021842 | Ga0207665_100218425 | 144 |
| 768 | 3300025939 | Ga0207665_10026452 | Ga0207665_100264523 | 144 |
| 769 | 3300025939 | Ga0207665_10065715 | Ga0207665_100657153 | 144 |
| 770 | 3300025939 | Ga0207665_10117335 | Ga0207665_101173352 | 144 |
| 771 | 3300025939 | Ga0207665_10156542 | Ga0207665_101565422 | 144 |
| 772 | 3300025941 | Ga0207711_10273215 | Ga0207711_102732152 | 144 |
| 773 | 3300025942 | Ga0207689_10096197 | Ga0207689_100961973 | 144 |
| 774 | 3300025944 | Ga0207661_10052193 | Ga0207661_100521931 | 144 |
| 775 | 3300025960 | Ga0207651_11293948 | Ga0207651_112939481 | 144 |
| 776 | 3300025960 | Ga0207651_11736826 | Ga0207651_117368262 | 144 |
| 777 | 3300025961 | Ga0207712_10024455 | Ga0207712_100244553 | 144 |
| 778 | 3300025961 | Ga0207712_10175325 | Ga0207712_101753253 | 144 |
| 779 | 3300025961 | Ga0207712_10424986 | Ga0207712_104249862 | 144 |
| 780 | 3300025981 | Ga0207640_10264706 | Ga0207640_102647062 | 144 |
| 781 | 3300025986 | Ga0207658_10321818 | Ga0207658_103218182 | 144 |
| 782 | 3300026023 | Ga0207677_10294914 | Ga0207677_102949142 | 144 |
| 783 | 3300026023 | Ga0207677_10333263 | Ga0207677_103332632 | 144 |
| 784 | 3300026035 | Ga0207703_10048549 | Ga0207703_100485495 | 144 |
| 785 | 3300026075 | Ga0207708_10224470 | Ga0207708_102244703 | 144 |
| 786 | 3300026075 | Ga0207708_10306716 | Ga0207708_103067162 | 144 |
| 787 | 3300026075 | Ga0207708_10456355 | Ga0207708_104563552 | 144 |
| 788 | 3300026075 | Ga0207708_10922032 | Ga0207708_109220322 | 144 |
| 789 | 3300026075 | Ga0207708_11253233 | Ga0207708_112532332 | 144 |
| 790 | 3300026075 | Ga0207708_11757772 | Ga0207708_117577721 | 144 |
| 791 | 3300026089 | Ga0207648_10013776 | Ga0207648_100137762 | 144 |
| 792 | 3300026089 | Ga0207648_10387177 | Ga0207648_103871771 | 144 |
| 793 | 3300026089 | Ga0207648_11678580 | Ga0207648_116785801 | 144 |
| 794 | 3300026095 | Ga0207676_10227056 | Ga0207676_102270562 | 144 |
| 795 | 3300026095 | Ga0207676_10542781 | Ga0207676_105427812 | 144 |
| 796 | 3300026095 | Ga0207676_11165855 | Ga0207676_111658552 | 144 |
| 797 | 3300026116 | Ga0207674_10154834 | Ga0207674_101548344 | 144 |
| 798 | 3300026116 | Ga0207674_10249365 | Ga0207674_102493652 | 144 |
| 799 | 3300026118 | Ga0207675_100018630 | Ga0207675_1000186303 | 144 |
| 800 | 3300026118 | Ga0207675_100376962 | Ga0207675_1003769622 | 144 |
| 801 | 3300026118 | Ga0207675_101002978 | Ga0207675_1010029781 | 144 |
| 802 | 3300026118 | Ga0207675_101064474 | Ga0207675_1010644741 | 144 |
| 803 | 3300026121 | Ga0207683_10054598 | Ga0207683_100545985 | 144 |
| 804 | 3300026121 | Ga0207683_10176333 | Ga0207683_101763332 | 144 |
| 805 | 3300026121 | Ga0207683_10501124 | Ga0207683_105011242 | 144 |
| 806 | 3300026121 | Ga0207683_11245635 | Ga0207683_112456351 | 144 |
| 807 | 3300026142 | Ga0207698_12570365 | Ga0207698_125703651 | 144 |
| 808 | 3300027671 | Ga0209588_1000068 | Ga0209588_10000685 | 144 |
| 809 | 3300027671 | Ga0209588_1057541 | Ga0209588_10575412 | 144 |
| 810 | 3300027907 | Ga0207428_10005408 | Ga0207428_1000540816 | 144 |
| 811 | 3300027907 | Ga0207428_10006297 | Ga0207428_100062976 | 144 |
| 812 | 3300027907 | Ga0207428_10093794 | Ga0207428_100937943 | 144 |
| 813 | 3300027907 | Ga0207428_11219774 | Ga0207428_112197741 | 144 |
| 814 | 3300028379 | Ga0268266_11212788 | Ga0268266_112127882 | 144 |
| 815 | 3300028556 | Ga0265337_1001280 | Ga0265337_100128010 | 144 |
| 816 | 3300028558 | Ga0265326_10000946 | Ga0265326_100009467 | 144 |
| 817 | 3300028563 | Ga0265319_1001192 | Ga0265319_10011928 | 144 |
| 818 | 3300028573 | Ga0265334_10002226 | Ga0265334_100022269 | 144 |
| 819 | 3300028653 | Ga0265323_10017550 | Ga0265323_100175504 | 144 |
| 820 | 3300028654 | Ga0265322_10024912 | Ga0265322_100249123 | 144 |
| 821 | 3300028666 | Ga0265336_10006771 | Ga0265336_100067714 | 144 |
| 822 | 3300028800 | Ga0265338_10003705 | Ga0265338_1000370515 | 144 |
| 823 | 3300029957 | Ga0265324_10008561 | Ga0265324_100085615 | 144 |
| 824 | 3300030760 | Ga0265762_1026280 | Ga0265762_10262802 | 144 |
| 825 | 3300031090 | Ga0265760_10188056 | Ga0265760_101880562 | 144 |
| 826 | 3300031238 | Ga0265332_10002916 | Ga0265332_100029165 | 144 |
| 827 | 3300031240 | Ga0265320_10003514 | Ga0265320_1000351410 | 144 |
| 828 | 3300031241 | Ga0265325_10068831 | Ga0265325_100688312 | 144 |
| 829 | 3300031241 | Ga0265325_10547522 | Ga0265325_105475221 | 144 |
| 830 | 3300031247 | Ga0265340_10001257 | Ga0265340_100012576 | 144 |
| 831 | 3300031249 | Ga0265339_10005329 | Ga0265339_100053298 | 144 |
| 832 | 3300031249 | Ga0265339_10215050 | Ga0265339_102150502 | 144 |
| 833 | 3300031250 | Ga0265331_10165003 | Ga0265331_101650031 | 144 |
| 834 | 3300031595 | Ga0265313_10005391 | Ga0265313_100053914 | 144 |
| 835 | 3300031711 | Ga0265314_10014104 | Ga0265314_100141042 | 144 |
| 836 | 3300031711 | Ga0265314_10033265 | Ga0265314_100332653 | 144 |
| 837 | 3300031712 | Ga0265342_10004204 | Ga0265342_100042044 | 144 |
| 838 | 3300031712 | Ga0265342_10004500 | Ga0265342_100045007 | 144 |
| 839 | 3300035113 | Ga0373936_0100922 | Ga0373936_0100922_755_1195 | 144 |
| 840 | 3300035170 | Ga0373943_0123911 | Ga0373943_0123911_475_915 | 144 |
| 841 | 3300035171 | Ga0373946_0277237 | Ga0373946_0277237_241_681 | 144 |
| 842 | 3300035410 | Ga0373924_0124290 | Ga0373924_0124290_221_661 | 144 |
| 843 | 3300035725 | Ga0373947_0302389 | Ga0373947_0302389_336_782 | 144 |
| 844 | 3300035725 | Ga0373947_1153116 | Ga0373947_1153116_59_511 | 144 |
| 845 | 3300036401 | Ga0373937_0409024 | Ga0373937_0409024_280_720 | 144 |
| 846 | 3300037068 | Ga0373925_0019090 | Ga0373925_0019090_3423_3875 | 144 |
| 847 | 3300037471 | Ga0395905_0594055 | Ga0395905_0594055_123_566 | 144 |
| 848 | 3300042876 | Ga0451577_1259367 | Ga0451577_1259367_34_486 | 144 |
| 849 | 3300046452 | Ga0495617_267426 | Ga0495617_267426_21_467 | 144 |
| 850 | 3300046453 | Ga0495627_069833 | Ga0495627_069833_403_846 | 144 |
| 851 | 3300046455 | Ga0495603_0038524 | Ga0495603_0038524_2208_2651 | 144 |
| 852 | 3300046455 | Ga0495603_0455384 | Ga0495603_0455384_220_663 | 144 |
| 853 | 3300046459 | Ga0495629_0082498 | Ga0495629_0082498_316_759 | 144 |
| 854 | 3300046462 | Ga0495651_0227599 | Ga0495651_0227599_677_1117 | 144 |
| 855 | 3300046463 | Ga0495653_0114589 | Ga0495653_0114589_901_1341 | 144 |
| 856 | 3300046463 | Ga0495653_0209400 | Ga0495653_0209400_187_630 | 144 |
| 857 | 3300046474 | Ga0495605_0204601 | Ga0495605_0204601_146_631 | 144 |
| 858 | 3300046475 | Ga0495639_0109488 | Ga0495639_0109488_302_745 | 144 |
| 859 | 3300046476 | Ga0495662_0066859 | Ga0495662_0066859_768_1211 | 144 |
| 860 | 3300046477 | Ga0495664_0759899 | Ga0495664_0759899_87_530 | 144 |
| 861 | 3300046491 | Ga0495584_0309855 | Ga0495584_0309855_162_602 | 144 |
| 862 | 3300046492 | Ga0495585_0084220 | Ga0495585_0084220_206_652 | 144 |
| 863 | 3300046499 | Ga0495594_0827815 | Ga0495594_0827815_19_462 | 144 |
| 864 | 3300046501 | Ga0495607_0123121 | Ga0495607_0123121_645_1091 | 144 |
| 865 | 3300046514 | Ga0495618_0156238 | Ga0495618_0156238_203_643 | 144 |
| 866 | 3300046514 | Ga0495618_0461453 | Ga0495618_0461453_47_490 | 144 |
| 867 | 3300046516 | Ga0495628_0533023 | Ga0495628_0533023_52_492 | 144 |
| 868 | 3300046516 | Ga0495628_0885596 | Ga0495628_0885596_85_528 | 144 |
| 869 | 3300046517 | Ga0495630_0204261 | Ga0495630_0204261_657_1100 | 144 |
| 870 | 3300046523 | Ga0495644_0007487 | Ga0495644_0007487_363_848 | 144 |
| 871 | 3300046523 | Ga0495644_0057437 | Ga0495644_0057437_928_1401 | 144 |
| 872 | 3300046525 | Ga0495663_0042186 | Ga0495663_0042186_157_603 | 144 |
| 873 | 3300046528 | Ga0495642_0174042 | Ga0495642_0174042_431_871 | 144 |
| 874 | 3300046530 | Ga0495654_0404509 | Ga0495654_0404509_43_489 | 144 |
| 875 | 3300046536 | Ga0495587_0315844 | Ga0495587_0315844_308_751 | 144 |
| 876 | 3300046537 | Ga0495598_0271193 | Ga0495598_0271193_13_453 | 144 |
| 877 | 3300046539 | Ga0495621_0065667 | Ga0495621_0065667_789_1235 | 144 |
| 878 | 3300046542 | Ga0495597_0401702 | Ga0495597_0401702_40_480 | 144 |
| 879 | 3300046558 | Ga0495633_0352874 | Ga0495633_0352874_211_654 | 144 |
| 880 | 3300046559 | Ga0495667_0037816 | Ga0495667_0037816_733_1173 | 144 |
| 881 | 3300046559 | Ga0495667_0358315 | Ga0495667_0358315_61_504 | 144 |
| 882 | 3300046615 | Ga0495656_0015839 | Ga0495656_0015839_597_1043 | 144 |
| 883 | 3300046615 | Ga0495656_0055583 | Ga0495656_0055583_611_1147 | 144 |
| 884 | 3300046616 | Ga0495668_0435829 | Ga0495668_0435829_201_647 | 144 |
| 885 | 3300046642 | Ga0495634_0274119 | Ga0495634_0274119_112_552 | 144 |
| 886 | 3300046642 | Ga0495634_0359635 | Ga0495634_0359635_61_504 | 144 |
| 887 | 3300046648 | Ga0495611_0311491 | Ga0495611_0311491_173_709 | 144 |
| 888 | 3300046648 | Ga0495611_0492798 | Ga0495611_0492798_32_478 | 144 |
| 889 | 3300046663 | Ga0495635_0010045 | Ga0495635_0010045_6054_6494 | 144 |
| 890 | 3300046664 | Ga0495659_0107840 | Ga0495659_0107840_560_1006 | 144 |
| 891 | 3300046665 | Ga0495661_0172181 | Ga0495661_0172181_32_472 | 144 |
| 892 | 3300046675 | Ga0495657_0062362 | Ga0495657_0062362_297_737 | 144 |
| 893 | 3300046683 | Ga0495658_0561499 | Ga0495658_0561499_236_679 | 144 |
| 894 | 3300046690 | Ga0495624_0670535 | Ga0495624_0670535_85_528 | 144 |
| 895 | 3300046691 | Ga0495670_0002276 | Ga0495670_0002276_1314_1799 | 144 |
| 896 | 3300046691 | Ga0495670_0039216 | Ga0495670_0039216_232_678 | 144 |
| 897 | 3300046794 | Ga0495589_0081179 | Ga0495589_0081179_1053_1499 | 144 |
| 898 | 3300046794 | Ga0495589_0086660 | Ga0495589_0086660_898_1341 | 144 |
| 899 | 3300046794 | Ga0495589_0264253 | Ga0495589_0264253_237_680 | 144 |
| 900 | 3300046810 | Ga0495660_0412022 | Ga0495660_0412022_58_504 | 144 |
| 901 | 3300047319 | Ga0495674_0082204 | Ga0495674_0082204_908_1351 | 144 |
| 902 | 3300047319 | Ga0495674_1122333 | Ga0495674_1122333_26_505 | 144 |
| 903 | 3300047321 | Ga0495676_0194748 | Ga0495676_0194748_148_591 | 144 |
| 904 | 3300047321 | Ga0495676_0323811 | Ga0495676_0323811_330_773 | 144 |
| 905 | 3300047322 | Ga0495680_0195483 | Ga0495680_0195483_242_682 | 144 |
| 906 | 3300047447 | Ga0495685_113987 | Ga0495685_113987_262_747 | 144 |
| 907 | 3300047471 | Ga0495684_0304936 | Ga0495684_0304936_160_600 | 144 |
| 908 | 3300048088 | Ga0495602_0853821 | Ga0495602_0853821_39_479 | 144 |
| 909 | 3300048091 | Ga0495626_0264769 | Ga0495626_0264769_67_513 | 144 |
| 910 | 3300048903 | Ga0496100_0041492 | Ga0496100_0041492_1864_2307 | 144 |
| 911 | 3300048903 | Ga0496100_0077464 | Ga0496100_0077464_1474_1908 | 144 |
| 912 | 3300048904 | Ga0496101_0075154 | Ga0496101_0075154_1464_1898 | 144 |
| 913 | 3300048904 | Ga0496101_0861377 | Ga0496101_0861377_251_691 | 144 |
| 914 | 3300048905 | Ga0496102_0019678 | Ga0496102_0019678_4713_5147 | 144 |
| 915 | 3300048905 | Ga0496102_0798427 | Ga0496102_0798427_365_808 | 144 |
| 916 | 3300048905 | Ga0496102_1189017 | Ga0496102_1189017_156_599 | 144 |
| 917 | 3300048908 | Ga0496105_0298365 | Ga0496105_0298365_481_915 | 144 |
| 918 | 3300048909 | Ga0496106_0036049 | Ga0496106_0036049_1611_2054 | 144 |
| 919 | 3300048909 | Ga0496106_0051870 | Ga0496106_0051870_1472_1906 | 144 |
| 920 | 3300048910 | Ga0496107_0005090 | Ga0496107_0005090_1666_2109 | 144 |
| 921 | 3300048910 | Ga0496107_0144686 | Ga0496107_0144686_1134_1568 | 144 |
| 922 | 3300048911 | Ga0496108_0055149 | Ga0496108_0055149_598_1032 | 144 |
| 923 | 3300048911 | Ga0496108_1122195 | Ga0496108_1122195_123_566 | 144 |
| 924 | 3300048912 | Ga0496109_0378228 | Ga0496109_0378228_657_1100 | 144 |
| 925 | 3300048913 | Ga0496110_0176225 | Ga0496110_0176225_610_1044 | 144 |
| 926 | 3300048914 | Ga0496111_0036770 | Ga0496111_0036770_987_1421 | 144 |
| 927 | 3300048914 | Ga0496111_0166986 | Ga0496111_0166986_586_1020 | 144 |
| 928 | 3300048915 | Ga0496112_0274026 | Ga0496112_0274026_678_1112 | 144 |
| 929 | 3300048916 | Ga0496113_0592333 | Ga0496113_0592333_254_694 | 144 |
| 930 | 3300048917 | Ga0496114_0010401 | Ga0496114_0010401_6779_7213 | 144 |
| 931 | 3300048918 | Ga0496115_0591828 | Ga0496115_0591828_428_868 | 144 |
| 932 | 3300048918 | Ga0496115_0683825 | Ga0496115_0683825_328_762 | 144 |
| 933 | 3300048918 | Ga0496115_1335582 | Ga0496115_1335582_67_510 | 144 |
| 934 | 3300048929 | Ga0496126_0020033 | Ga0496126_0020033_5296_5736 | 144 |
| 935 | 3300049583 | Ga0501067_0074277 | Ga0501067_0074277_88_531 | 144 |
| 936 | 3300049584 | Ga0501068_0087351 | Ga0501068_0087351_849_1289 | 144 |
| 937 | 3300050491 | nmdc:mga00v17_221996_c1 | nmdc:mga00v17_221996_c1_166_612 | 144 |
| 938 | 3300050492 | nmdc:mga0yw44_9191_c1 | nmdc:mga0yw44_9191_c1_2587_3021 | 144 |
| 939 | 3300050507 | nmdc:mga05p37_137915_c1 | nmdc:mga05p37_137915_c1_1877_2320 | 144 |
| 940 | 3300050507 | nmdc:mga05p37_2754_c1 | nmdc:mga05p37_2754_c1_3099_3542 | 144 |
| 941 | 3300050507 | nmdc:mga05p37_52031_c1 | nmdc:mga05p37_52031_c1_3490_3936 | 144 |
| 942 | 3300050507 | nmdc:mga05p37_719764_c1 | nmdc:mga05p37_719764_c1_168_608 | 144 |
| 943 | 3300050508 | nmdc:mga09592_544133_c1 | nmdc:mga09592_544133_c1_449_895 | 144 |
| 944 | 3300050510 | nmdc:mga06r32_17228_c1 | nmdc:mga06r32_17228_c1_3995_4435 | 144 |
| 945 | 3300050511 | nmdc:mga08y16_20192_c1 | nmdc:mga08y16_20192_c1_4432_4872 | 144 |
| 946 | 3300050511 | nmdc:mga08y16_326534_c1 | nmdc:mga08y16_326534_c1_83_517 | 144 |
| 947 | 3300050511 | nmdc:mga08y16_67612_c1 | nmdc:mga08y16_67612_c1_2551_2985 | 144 |
| 948 | 3300050512 | nmdc:mga0n895_19321_c1 | nmdc:mga0n895_19321_c1_246_689 | 144 |
| 949 | 3300050512 | nmdc:mga0n895_81435_c1 | nmdc:mga0n895_81435_c1_2198_2638 | 144 |
| 950 | 3300050512 | nmdc:mga0n895_85910_c1 | nmdc:mga0n895_85910_c1_462_902 | 144 |
| 951 | 3300050513 | nmdc:mga0rr50_122528_c1 | nmdc:mga0rr50_122528_c1_549_989 | 144 |
| 952 | 3300050513 | nmdc:mga0rr50_174797_c1 | nmdc:mga0rr50_174797_c1_582_1028 | 144 |
| 953 | 3300050513 | nmdc:mga0rr50_211069_c1 | nmdc:mga0rr50_211069_c1_385_837 | 144 |
| 954 | 3300050513 | nmdc:mga0rr50_283552_c1 | nmdc:mga0rr50_283552_c1_229_675 | 144 |
| 955 | 3300050513 | nmdc:mga0rr50_322291_c1 | nmdc:mga0rr50_322291_c1_675_1121 | 144 |
| 956 | 3300050513 | nmdc:mga0rr50_93269_c1 | nmdc:mga0rr50_93269_c1_911_1357 | 144 |
| 957 | 3300050514 | nmdc:mga08x19_20798_c1 | nmdc:mga08x19_20798_c1_3474_3914 | 144 |
| 958 | 3300050514 | nmdc:mga08x19_27814_c1 | nmdc:mga08x19_27814_c1_1667_2113 | 144 |
| 959 | 3300050514 | nmdc:mga08x19_608098_c1 | nmdc:mga08x19_608098_c1_303_749 | 144 |
| 960 | 3300050514 | nmdc:mga08x19_79412_c1 | nmdc:mga08x19_79412_c1_422_868 | 144 |
| 961 | 3300050514 | nmdc:mga08x19_94502_c1 | nmdc:mga08x19_94502_c1_1078_1524 | 144 |
| 962 | 3300050515 | nmdc:mga0a205_127892_c1 | nmdc:mga0a205_127892_c1_343_795 | 144 |
| 963 | 3300050515 | nmdc:mga0a205_131255_c1 | nmdc:mga0a205_131255_c1_129_575 | 144 |
| 964 | 3300050515 | nmdc:mga0a205_131805_c1 | nmdc:mga0a205_131805_c1_1242_1688 | 144 |
| 965 | 3300050515 | nmdc:mga0a205_256052_c1 | nmdc:mga0a205_256052_c1_21_461 | 144 |
| 966 | 3300050515 | nmdc:mga0a205_651512_c1 | nmdc:mga0a205_651512_c1_345_785 | 144 |
| 967 | 3300050515 | nmdc:mga0a205_66434_c1 | nmdc:mga0a205_66434_c1_248_688 | 144 |
| 968 | 3300053077 | Ga0495601_0018231 | Ga0495601_0018231_540_983 | 144 |
| 969 | 3300053084 | Ga0495595_0178776 | Ga0495595_0178776_512_955 | 144 |
| 970 | 3300053085 | Ga0495619_0242681 | Ga0495619_0242681_711_1154 | 144 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x4k-assembly1.cif.gz_A | crystal structure of sar1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant staphylococcus aureus (mrsa) | 0.9162 | 68 | 121 |
| 1otf-assembly1.cif.gz_D | 4-oxalocrotonate tautomerase-triclinic crystal form | 0.9126 | 68 | 122 |
| 6fps-assembly3.cif.gz_P | crystal structure of 4-oxalocrotonate tautomerase triple mutant l8y/m45y/f50a | 0.9111 | 68 | 123 |
| 1bjp-assembly1.cif.gz_A | crystal structure of 4-oxalocrotonate tautomerase inactivated by 2-oxo-3-pentynoate at 2.4 angstroms resolution | 0.9081 | 68 | 122 |
| 8t9o-assembly1.cif.gz_D | crystal structure of cf, a heterohexamer of the 4-oxalocrotonate tautomerase (4-ot) family | 0.906 | 66 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2op8B00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.9025 | 66 | 123 | 3.30.429.10 |
| 4fdxA00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8559 | 68 | 129 | 3.30.429.10 |
| af_C6SWU3_1_117_3.30.429.10 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8471 | 1 | 121 | 3.30.429.10 |
| 3ry0B00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8465 | 68 | 131 | 3.30.429.10 |
| 3abfB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8423 | 68 | 121 | 3.30.429.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A495IFZ6-F1-model_v4 | Phenylpyruvate tautomerase PptA (4-oxalocrotonate tautomerase family) | 1.002 | 1 | 143 |
|
| AF-A0A6I5X7Q5-F1-model_v4 | 4-oxalocrotonate tautomerase-like domain-containing protein | 1.001 | 1 | 141 |
GO:0016853
|
| AF-A0A3E0VJU1-F1-model_v4 | 4-oxalocrotonate tautomerase | 0.9993 | 1 | 143 |
|
| AF-A0A535A3C2-F1-model_v4 | 4-oxalocrotonate tautomerase | 0.9985 | 1 | 143 |
|
| AF-A0A4Y9R6N1-F1-model_v4 | 4-oxalocrotonate tautomerase | 0.9978 | 3 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar