F487087

General Info

Members Datasets Scaffolds Average Seq Length
970 310 970 147

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000805|Ga0070699_10000080520
Length 147
Sequence MPMIDVYATRGTFKDPKSLARNLAATLMKIEKVPDIPMFRQNTAAFVHDLPDGALSNVEGQSNHVRVQVLTNAGALDREKQLSVVSEFSHIIAAAGDPSLSGRTWVLLTEAIEGGWGLSGHANTNAELIAAARAQIAELQQKKASGG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
108 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 4.33
Rhizosphere 93.81
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1060663 3300001976 Unclassified 522
2 JGI24033J26618_1055161 3300002155 Bacteria 576
3 JGI24751J29686_10006875 3300002459 Bacteria 2319
4 Ga0055527_1000032 3300003760 Bacteria 153292
5 Ga0055527_1000091 3300003760 Bacteria 70221
6 Ga0055542_1000216 3300003762 Bacteria 70219
7 Ga0055529_1000234 3300003763 Bacteria 70241
8 Ga0065707_10283270 3300005295 Bacteria 1042
9 Ga0070683_100025354 3300005329 Bacteria 5325
10 Ga0070683_100725288 3300005329 Unclassified 952
11 Ga0070690_100240978 3300005330 Bacteria 1275
12 Ga0070690_100373933 3300005330 Bacteria 1040
13 Ga0070670_100019605 3300005331 Bacteria 5805
14 Ga0070670_100674356 3300005331 Bacteria 928
15 Ga0068869_100667522 3300005334 Bacteria 884
16 Ga0070680_100078719 3300005336 Bacteria 2716
17 Ga0070682_100752872 3300005337 Bacteria 787
18 Ga0068868_101187130 3300005338 Bacteria 705
19 Ga0068868_101235638 3300005338 Bacteria 692
20 Ga0070689_101909920 3300005340 Bacteria 542
21 Ga0070691_10484955 3300005341 Bacteria 712
22 Ga0070687_100339295 3300005343 Bacteria 966
23 Ga0070692_10031015 3300005345 Unclassified 2677
24 Ga0070692_10039551 3300005345 Bacteria 2409
25 Ga0070692_10908690 3300005345 Bacteria 609
26 Ga0070668_100684008 3300005347 Bacteria 904
27 Ga0070668_101371733 3300005347 Bacteria 644
28 Ga0070675_100857826 3300005354 Bacteria 831
29 Ga0070671_100068116 3300005355 Bacteria 2968
30 Ga0070674_100061623 3300005356 Bacteria 2619
31 Ga0070674_100136395 3300005356 Bacteria 1836
32 Ga0070674_100175523 3300005356 Bacteria 1637
33 Ga0070674_100445367 3300005356 Bacteria 1068
34 Ga0070673_100531478 3300005364 Bacteria 1067
35 Ga0070659_100625674 3300005366 Unclassified 927
36 Ga0070659_101299038 3300005366 Bacteria 645
37 Ga0070703_10003635 3300005406 Bacteria 4378
38 Ga0070709_10039969 3300005434 Bacteria 2881
39 Ga0070714_100033116 3300005435 Bacteria 4318
40 Ga0070714_100065607 3300005435 Bacteria 3127
41 Ga0070714_100156418 3300005435 Bacteria 2058
42 Ga0070714_100196265 3300005435 Bacteria 1844
43 Ga0070714_100265212 3300005435 Bacteria 1591
44 Ga0070714_100378226 3300005435 Archaea 1335
45 Ga0070714_100818319 3300005435 Unclassified 902
46 Ga0070714_100996912 3300005435 Unclassified 815
47 Ga0070714_102361509 3300005435 Bacteria 517
48 Ga0070713_100086693 3300005436 Bacteria 2685
49 Ga0070713_100244894 3300005436 Bacteria 1633
50 Ga0070713_100253594 3300005436 Unclassified 1605
51 Ga0070713_100680425 3300005436 Unclassified 981
52 Ga0070713_101214766 3300005436 Bacteria 730
53 Ga0070710_10243334 3300005437 Bacteria 1153
54 Ga0070710_11233183 3300005437 Bacteria 554
55 Ga0070701_10122361 3300005438 Unclassified 1468
56 Ga0070701_10305595 3300005438 Unclassified 979
57 Ga0070701_10907399 3300005438 Bacteria 608
58 Ga0070711_100143253 3300005439 Bacteria 1794
59 Ga0070705_100007053 3300005440 Bacteria 5522
60 Ga0070705_100082374 3300005440 Bacteria 1980
61 Ga0070705_100112137 3300005440 Bacteria 1745
62 Ga0070705_100320949 3300005440 Bacteria 1118
63 Ga0070705_100560240 3300005440 Bacteria 878
64 Ga0070700_100113325 3300005441 Bacteria 1807
65 Ga0070700_100410536 3300005441 Bacteria 1021
66 Ga0070700_100495448 3300005441 Bacteria 939
67 Ga0070700_101286267 3300005441 Bacteria 614
68 Ga0070694_100032696 3300005444 Bacteria 3417
69 Ga0070694_100081245 3300005444 Bacteria 2254
70 Ga0070694_100086445 3300005444 Bacteria 2191
71 Ga0070694_100092380 3300005444 Bacteria 2126
72 Ga0070694_100793940 3300005444 Bacteria 776
73 Ga0070708_100001281 3300005445 Bacteria 19353
74 Ga0070708_100001720 3300005445 Bacteria 16828
75 Ga0070708_100002506 3300005445 Bacteria 14170
76 Ga0070708_100016020 3300005445 Bacteria 6209
77 Ga0070708_100019788 3300005445 Bacteria 5663
78 Ga0070708_100025182 3300005445 Bacteria 5084
79 Ga0070708_100031340 3300005445 Bacteria 4601
80 Ga0070708_100036593 3300005445 Bacteria 4281
81 Ga0070708_100058163 3300005445 Unclassified 3444
82 Ga0070708_100069824 3300005445 Bacteria 3159
83 Ga0070708_100093904 3300005445 Bacteria 2736
84 Ga0070708_100111438 3300005445 Unclassified 2516
85 Ga0070708_100116352 3300005445 Unclassified 2461
86 Ga0070708_100116556 3300005445 Bacteria 2459
87 Ga0070708_100123730 3300005445 Bacteria 2388
88 Ga0070708_100148423 3300005445 Bacteria 2179
89 Ga0070708_100169282 3300005445 Bacteria 2039
90 Ga0070708_100326565 3300005445 Bacteria 1445
91 Ga0070708_100329136 3300005445 Bacteria 1439
92 Ga0070708_100378973 3300005445 Bacteria 1334
93 Ga0070708_100481776 3300005445 Unclassified 1170
94 Ga0070708_100482530 3300005445 Bacteria 1169
95 Ga0070708_100597147 3300005445 Bacteria 1041
96 Ga0070708_100664196 3300005445 Bacteria 982
97 Ga0070708_101137298 3300005445 Bacteria 731
98 Ga0070708_101481238 3300005445 Archaea 632
99 Ga0070708_101647589 3300005445 Bacteria 597
100 Ga0070663_101249291 3300005455 Bacteria 654
101 Ga0070678_100025557 3300005456 Bacteria 3975
102 Ga0070678_100896143 3300005456 Bacteria 811
103 Ga0070678_101357755 3300005456 Bacteria 663
104 Ga0070662_100225858 3300005457 Bacteria 1496
105 Ga0070662_100583459 3300005457 Bacteria 939
106 Ga0068867_100294243 3300005459 Bacteria 1336
107 Ga0068867_100640943 3300005459 Unclassified 931
108 Ga0068867_101305548 3300005459 Bacteria 670
109 Ga0070706_100000355 3300005467 Bacteria 55169
110 Ga0070706_100000937 3300005467 Bacteria 31912
111 Ga0070706_100001208 3300005467 Bacteria 27646
112 Ga0070706_100001868 3300005467 Bacteria 21749
113 Ga0070706_100003296 3300005467 Bacteria 15967
114 Ga0070706_100004086 3300005467 Bacteria 14191
115 Ga0070706_100005466 3300005467 Bacteria 12101
116 Ga0070706_100008455 3300005467 Bacteria 9588
117 Ga0070706_100009642 3300005467 Bacteria 8977
118 Ga0070706_100017130 3300005467 Bacteria 6695
119 Ga0070706_100023927 3300005467 Bacteria 5624
120 Ga0070706_100024051 3300005467 Bacteria 5609
121 Ga0070706_100029036 3300005467 Bacteria 5094
122 Ga0070706_100043904 3300005467 Bacteria 4129
123 Ga0070706_100070652 3300005467 Bacteria 3229
124 Ga0070706_100089062 3300005467 Bacteria 2862
125 Ga0070706_100105028 3300005467 Bacteria 2628
126 Ga0070706_100114210 3300005467 Bacteria 2514
127 Ga0070706_100121291 3300005467 Bacteria 2437
128 Ga0070706_100155284 3300005467 Bacteria 2136
129 Ga0070706_100194968 3300005467 Bacteria 1892
130 Ga0070706_100256929 3300005467 Bacteria 1631
131 Ga0070706_100321619 3300005467 Bacteria 1443
132 Ga0070706_100517004 3300005467 Bacteria 1110
133 Ga0070706_100611951 3300005467 Bacteria 1012
134 Ga0070706_100760183 3300005467 Bacteria 898
135 Ga0070706_100979686 3300005467 Unclassified 780
136 Ga0070706_101192515 3300005467 Unclassified 700
137 Ga0070707_100000762 3300005468 Bacteria 31790
138 Ga0070707_100000793 3300005468 Bacteria 31219
139 Ga0070707_100003826 3300005468 Bacteria 14191
140 Ga0070707_100006232 3300005468 Bacteria 11102
141 Ga0070707_100008729 3300005468 Bacteria 9398
142 Ga0070707_100010515 3300005468 Bacteria 8622
143 Ga0070707_100017247 3300005468 Bacteria 6786
144 Ga0070707_100018505 3300005468 Bacteria 6554
145 Ga0070707_100020220 3300005468 Bacteria 6277
146 Ga0070707_100034004 3300005468 Bacteria 4862
147 Ga0070707_100037785 3300005468 Bacteria 4610
148 Ga0070707_100052540 3300005468 Bacteria 3907
149 Ga0070707_100067641 3300005468 Bacteria 3437
150 Ga0070707_100068793 3300005468 Bacteria 3408
151 Ga0070707_100073346 3300005468 Bacteria 3300
152 Ga0070707_100102269 3300005468 Bacteria 2776
153 Ga0070707_100103892 3300005468 Bacteria 2754
154 Ga0070707_100119600 3300005468 Bacteria 2557
155 Ga0070707_100204939 3300005468 Bacteria 1922
156 Ga0070707_100210348 3300005468 Bacteria 1896
157 Ga0070707_100211856 3300005468 Bacteria 1888
158 Ga0070707_100263776 3300005468 Bacteria 1675
159 Ga0070707_100275584 3300005468 Unclassified 1635
160 Ga0070707_100275738 3300005468 Unclassified 1635
161 Ga0070707_100283545 3300005468 Unclassified 1610
162 Ga0070707_100288035 3300005468 Bacteria 1596
163 Ga0070707_100296061 3300005468 Bacteria 1572
164 Ga0070707_100494691 3300005468 Bacteria 1184
165 Ga0070707_100520646 3300005468 Bacteria 1151
166 Ga0070707_100698561 3300005468 Bacteria 977
167 Ga0070707_100723383 3300005468 Bacteria 958
168 Ga0070707_100738781 3300005468 Unclassified 947
169 Ga0070707_100835976 3300005468 Bacteria 885
170 Ga0070707_100891925 3300005468 Bacteria 854
171 Ga0070707_100928908 3300005468 Unclassified 835
172 Ga0070707_100954612 3300005468 Bacteria 822
173 Ga0070707_101018576 3300005468 Bacteria 793
174 Ga0070707_101273599 3300005468 Unclassified 701
175 Ga0070707_101370771 3300005468 Unclassified 674
176 Ga0070707_101378656 3300005468 Bacteria 671
177 Ga0070707_101687330 3300005468 Bacteria 601
178 Ga0070698_100000448 3300005471 Bacteria 43798
179 Ga0070698_100001509 3300005471 Bacteria 25802
180 Ga0070698_100004279 3300005471 Bacteria 15698
181 Ga0070698_100005770 3300005471 Bacteria 13538
182 Ga0070698_100015160 3300005471 Bacteria 8150
183 Ga0070698_100018758 3300005471 Bacteria 7282
184 Ga0070698_100020451 3300005471 Bacteria 6938
185 Ga0070698_100027998 3300005471 Bacteria 5856
186 Ga0070698_100030365 3300005471 Bacteria 5604
187 Ga0070698_100034878 3300005471 Bacteria 5205
188 Ga0070698_100047358 3300005471 Bacteria 4395
189 Ga0070698_100072371 3300005471 Bacteria 3455
190 Ga0070698_100072567 3300005471 Bacteria 3450
191 Ga0070698_100083498 3300005471 Bacteria 3183
192 Ga0070698_100124437 3300005471 Bacteria 2536
193 Ga0070698_100161743 3300005471 Bacteria 2182
194 Ga0070698_100176031 3300005471 Bacteria 2079
195 Ga0070698_100225157 3300005471 Bacteria 1809
196 Ga0070698_100288059 3300005471 Bacteria 1573
197 Ga0070698_100297529 3300005471 Unclassified 1545
198 Ga0070698_100333414 3300005471 Unclassified 1448
199 Ga0070698_100337157 3300005471 Unclassified 1439
200 Ga0070698_100476027 3300005471 Bacteria 1185
201 Ga0070698_100507252 3300005471 Bacteria 1144
202 Ga0070698_100661976 3300005471 Bacteria 985
203 Ga0070698_100694404 3300005471 Bacteria 959
204 Ga0070698_100706197 3300005471 Bacteria 951
205 Ga0070698_100823749 3300005471 Bacteria 872
206 Ga0070698_100984801 3300005471 Unclassified 790
207 Ga0070698_101543788 3300005471 Bacteria 616
208 Ga0070699_100000805 3300005518 Bacteria 28976
209 Ga0070699_100000806 3300005518 Bacteria 28959
210 Ga0070699_100001002 3300005518 Bacteria 26266
211 Ga0070699_100002301 3300005518 Bacteria 17189
212 Ga0070699_100002562 3300005518 Bacteria 16308
213 Ga0070699_100027236 3300005518 Bacteria 4931
214 Ga0070699_100034048 3300005518 Bacteria 4402
215 Ga0070699_100072460 3300005518 Bacteria 2996
216 Ga0070699_100073844 3300005518 Bacteria 2967
217 Ga0070699_100113091 3300005518 Bacteria 2385
218 Ga0070699_100142317 3300005518 Bacteria 2119
219 Ga0070699_100157927 3300005518 Bacteria 2007
220 Ga0070699_100160050 3300005518 Bacteria 1992
221 Ga0070699_100162891 3300005518 Bacteria 1974
222 Ga0070699_100209132 3300005518 Bacteria 1736
223 Ga0070699_100245449 3300005518 Bacteria 1599
224 Ga0070699_100252521 3300005518 Bacteria 1576
225 Ga0070699_100262920 3300005518 Bacteria 1543
226 Ga0070699_100278332 3300005518 Bacteria 1498
227 Ga0070699_100374023 3300005518 Bacteria 1286
228 Ga0070699_100428107 3300005518 Bacteria 1198
229 Ga0070699_100614139 3300005518 Bacteria 992
230 Ga0070699_100703201 3300005518 Bacteria 923
231 Ga0070699_100843735 3300005518 Bacteria 839
232 Ga0070699_100910556 3300005518 Bacteria 806
233 Ga0070699_100921109 3300005518 Unclassified 801
234 Ga0070699_101148150 3300005518 Bacteria 713
235 Ga0070699_101507130 3300005518 Bacteria 617
236 Ga0070679_100503126 3300005530 Bacteria 1156
237 Ga0070684_100100508 3300005535 Bacteria 2583
238 Ga0070697_100000001 3300005536 Bacteria 662298
239 Ga0070697_100000091 3300005536 Bacteria 75795
240 Ga0070697_100001138 3300005536 Bacteria 20124
241 Ga0070697_100003405 3300005536 Bacteria 12224
242 Ga0070697_100013735 3300005536 Bacteria 6352
243 Ga0070697_100014014 3300005536 Bacteria 6296
244 Ga0070697_100035202 3300005536 Bacteria 4038
245 Ga0070697_100113143 3300005536 Unclassified 2264
246 Ga0070697_100118383 3300005536 Bacteria 2213
247 Ga0070697_100157200 3300005536 Bacteria 1919
248 Ga0070697_100163034 3300005536 Unclassified 1884
249 Ga0070697_100250655 3300005536 Unclassified 1514
250 Ga0070697_100364974 3300005536 Bacteria 1249
251 Ga0070697_100366744 3300005536 Unclassified 1246
252 Ga0070697_100453299 3300005536 Bacteria 1117
253 Ga0070697_100752019 3300005536 Bacteria 861
254 Ga0070697_100784801 3300005536 Bacteria 842
255 Ga0070697_100805120 3300005536 Bacteria 831
256 Ga0070695_100042084 3300005545 Bacteria 2899
257 Ga0070695_100089868 3300005545 Bacteria 2048
258 Ga0070695_100176422 3300005545 Bacteria 1511
259 Ga0070695_100282030 3300005545 Unclassified 1221
260 Ga0070695_100407124 3300005545 Bacteria 1033
261 Ga0070695_101714729 3300005545 Bacteria 526
262 Ga0070696_100083788 3300005546 Bacteria 2262
263 Ga0070696_100119666 3300005546 Bacteria 1905
264 Ga0070696_100151302 3300005546 Bacteria 1703
265 Ga0070696_100176578 3300005546 Bacteria 1582
266 Ga0070696_100508343 3300005546 Bacteria 959
267 Ga0070696_101044899 3300005546 Bacteria 684
268 Ga0070696_101564741 3300005546 Unclassified 566
269 Ga0070696_101618710 3300005546 Bacteria 557
270 Ga0070704_100004211 3300005549 Bacteria 8306
271 Ga0070704_100004802 3300005549 Bacteria 7829
272 Ga0070704_100013491 3300005549 Bacteria 5071
273 Ga0070704_100057432 3300005549 Bacteria 2767
274 Ga0070704_100273876 3300005549 Bacteria 1396
275 Ga0070704_100378470 3300005549 Bacteria 1202
276 Ga0070704_100614087 3300005549 Bacteria 957
277 Ga0070704_100804223 3300005549 Unclassified 840
278 Ga0070704_100867811 3300005549 Bacteria 810
279 Ga0068857_100034650 3300005577 Bacteria 4465
280 Ga0068857_100157245 3300005577 Bacteria 2061
281 Ga0068857_100234623 3300005577 Bacteria 1678
282 Ga0068854_100075271 3300005578 Unclassified 2478
283 Ga0068856_100871248 3300005614 Bacteria 920
284 Ga0068852_100376358 3300005616 Bacteria 1392
285 Ga0068859_101712233 3300005617 Unclassified 694
286 Ga0068864_100116724 3300005618 Bacteria 2382
287 Ga0068864_100354344 3300005618 Bacteria 1385
288 Ga0068864_100477933 3300005618 Unclassified 1196
289 Ga0068866_10130013 3300005718 Bacteria 1431
290 Ga0068861_100009800 3300005719 Bacteria 6625
291 Ga0068861_100232452 3300005719 Bacteria 1564
292 Ga0068861_100595320 3300005719 Bacteria 1014
293 Ga0068870_10909465 3300005840 Bacteria 622
294 Ga0068870_11078851 3300005840 Bacteria 576
295 Ga0068863_100537165 3300005841 Bacteria 1154
296 Ga0068863_101728879 3300005841 Bacteria 635
297 Ga0068863_101831051 3300005841 Bacteria 617
298 Ga0068858_100114858 3300005842 Bacteria 2515
299 Ga0081455_10617997 3300005937 Bacteria 703
300 Ga0081539_10002337 3300005985 Bacteria 27268
301 Ga0070717_10000078 3300006028 Bacteria 80104
302 Ga0070717_10005470 3300006028 Bacteria 9272
303 Ga0070717_10009434 3300006028 Bacteria 7334
304 Ga0070717_10034108 3300006028 Bacteria 4111
305 Ga0070717_10051517 3300006028 Bacteria 3388
306 Ga0070717_10065336 3300006028 Bacteria 3024
307 Ga0070717_10092109 3300006028 Bacteria 2560
308 Ga0070717_10129914 3300006028 Bacteria 2165
309 Ga0070717_10391375 3300006028 Bacteria 1247
310 Ga0070717_10682940 3300006028 Unclassified 933
311 Ga0070717_11753211 3300006028 Unclassified 561
312 Ga0075365_10127565 3300006038 Bacteria 1759
313 Ga0075432_10031665 3300006058 Bacteria 1831
314 Ga0070715_10032915 3300006163 Bacteria 2115
315 Ga0070715_10218674 3300006163 Bacteria 978
316 Ga0070716_100004566 3300006173 Bacteria 6634
317 Ga0070716_100030432 3300006173 Bacteria 2928
318 Ga0070716_100040061 3300006173 Bacteria 2604
319 Ga0070716_100054229 3300006173 Bacteria 2289
320 Ga0070716_100094475 3300006173 Bacteria 1818
321 Ga0070716_100311114 3300006173 Bacteria 1100
322 Ga0070716_100868124 3300006173 Bacteria 704
323 Ga0070712_100004266 3300006175 Bacteria 8797
324 Ga0070712_100069668 3300006175 Bacteria 2510
325 Ga0070712_100094999 3300006175 Bacteria 2192
326 Ga0070712_100189248 3300006175 Bacteria 1609
327 Ga0070712_100367796 3300006175 Bacteria 1181
328 Ga0070712_100852126 3300006175 Unclassified 784
329 Ga0068871_100250162 3300006358 Unclassified 1544
330 Ga0068871_101367791 3300006358 Bacteria 667
331 Ga0075428_100014419 3300006844 Bacteria 8781
332 Ga0075428_100248935 3300006844 Bacteria 1916
333 Ga0075428_100330118 3300006844 Bacteria 1638
334 Ga0075428_100810221 3300006844 Unclassified 995
335 Ga0075428_101510144 3300006844 Unclassified 704
336 Ga0075430_100175215 3300006846 Bacteria 1784
337 Ga0075431_100210148 3300006847 Bacteria 1988
338 Ga0075431_100403679 3300006847 Bacteria 1367
339 Ga0075431_100779647 3300006847 Bacteria 930
340 Ga0075431_100780964 3300006847 Bacteria 929
341 Ga0075431_101199765 3300006847 Bacteria 722
342 Ga0075433_10032631 3300006852 Bacteria 4461
343 Ga0075433_10291039 3300006852 Unclassified 1446
344 Ga0075433_10371449 3300006852 Bacteria 1263
345 Ga0075433_11294707 3300006852 Bacteria 632
346 Ga0075433_11974890 3300006852 Bacteria 500
347 Ga0075434_100015933 3300006871 Bacteria 7221
348 Ga0075434_100021534 3300006871 Bacteria 6267
349 Ga0075434_100084830 3300006871 Bacteria 3166
350 Ga0075434_100230026 3300006871 Bacteria 1873
351 Ga0075434_100234879 3300006871 Bacteria 1853
352 Ga0075434_100548534 3300006871 Bacteria 1176
353 Ga0075434_101161390 3300006871 Bacteria 785
354 Ga0075434_101314150 3300006871 Bacteria 734
355 Ga0075434_101592477 3300006871 Bacteria 662
356 Ga0075434_101685726 3300006871 Bacteria 642
357 Ga0075434_102078831 3300006871 Bacteria 573
358 Ga0075429_101359648 3300006880 Bacteria 619
359 Ga0068865_100237916 3300006881 Bacteria 1431
360 Ga0068865_100381844 3300006881 Bacteria 1149
361 Ga0068865_100415425 3300006881 Bacteria 1105
362 Ga0068865_100782138 3300006881 Bacteria 822
363 Ga0075436_100031969 3300006914 Bacteria 3626
364 Ga0075436_100053527 3300006914 Bacteria 2786
365 Ga0075436_100067414 3300006914 Bacteria 2473
366 Ga0075436_100099996 3300006914 Bacteria 2019
367 Ga0075436_100146037 3300006914 Bacteria 1663
368 Ga0075436_100326720 3300006914 Bacteria 1102
369 Ga0075436_100346388 3300006914 Bacteria 1070
370 Ga0075436_100437866 3300006914 Bacteria 951
371 Ga0075436_100499728 3300006914 Bacteria 889
372 Ga0075436_100569326 3300006914 Bacteria 833
373 Ga0075436_100993512 3300006914 Bacteria 630
374 Ga0097620_100699736 3300006931 Bacteria 1104
375 Ga0097620_101712551 3300006931 Unclassified 694
376 Ga0075435_100035672 3300007076 Bacteria 3947
377 Ga0075435_100053053 3300007076 Plasmid 3268
378 Ga0075435_100093290 3300007076 Bacteria 2487
379 Ga0075435_100260853 3300007076 Bacteria 1476
380 Ga0075435_100453835 3300007076 Bacteria 1105
381 Ga0075435_100464997 3300007076 Bacteria 1091
382 Ga0075435_100469068 3300007076 Unclassified 1086
383 Ga0075435_101162429 3300007076 Bacteria 675
384 Ga0099794_10009761 3300007265 Bacteria 4051
385 Ga0099794_10061960 3300007265 Bacteria 1818
386 Ga0099794_10149093 3300007265 Unclassified 1187
387 Ga0099794_10196163 3300007265 Bacteria 1033
388 Ga0099795_10055352 3300007788 Bacteria 1457
389 Ga0099795_10098025 3300007788 Bacteria 1146
390 Ga0099795_10144718 3300007788 Bacteria 969
391 Ga0105251_10121122 3300009011 Unclassified 1188
392 Ga0111539_10007869 3300009094 Bacteria 13610
393 Ga0111539_10089009 3300009094 Bacteria 3627
394 Ga0111539_10220914 3300009094 Bacteria 2207
395 Ga0111539_10521842 3300009094 Bacteria 1384
396 Ga0105245_10060620 3300009098 Bacteria 3407
397 Ga0105245_10658782 3300009098 Bacteria 1077
398 Ga0105245_10898693 3300009098 Unclassified 927
399 Ga0105245_10907345 3300009098 Bacteria 923
400 Ga0105245_11830501 3300009098 Bacteria 660
401 Ga0105247_10379024 3300009101 Bacteria 1002
402 Ga0114129_10007918 3300009147 Bacteria 15129
403 Ga0114129_10072023 3300009147 Bacteria 4818
404 Ga0114129_10185240 3300009147 Bacteria 2830
405 Ga0114129_10264924 3300009147 Bacteria 2301
406 Ga0114129_10351522 3300009147 Bacteria 1952
407 Ga0114129_10361615 3300009147 Bacteria 1920
408 Ga0114129_10919516 3300009147 Bacteria 1107
409 Ga0114129_11069609 3300009147 Unclassified 1012
410 Ga0114129_11189327 3300009147 Bacteria 950
411 Ga0114129_11722820 3300009147 Unclassified 764
412 Ga0105243_10062331 3300009148 Bacteria 2985
413 Ga0105243_10074659 3300009148 Bacteria 2750
414 Ga0105243_10100578 3300009148 Bacteria 2399
415 Ga0105243_10173929 3300009148 Bacteria 1867
416 Ga0105243_10366092 3300009148 Bacteria 1329
417 Ga0105243_10565969 3300009148 Bacteria 1088
418 Ga0105241_11333572 3300009174 Unclassified 685
419 Ga0105241_11642247 3300009174 Bacteria 623
420 Ga0105242_10036378 3300009176 Bacteria 3950
421 Ga0105242_10064171 3300009176 Bacteria 3026
422 Ga0105242_10186921 3300009176 Bacteria 1831
423 Ga0105242_10463724 3300009176 Bacteria 1197
424 Ga0105242_10650216 3300009176 Bacteria 1025
425 Ga0105242_11752391 3300009176 Bacteria 658
426 Ga0105248_10039370 3300009177 Bacteria 5293
427 Ga0105248_12042724 3300009177 Bacteria 651
428 Ga0105249_11305342 3300009553 Unclassified 797
429 Ga0105239_10079574 3300010375 Bacteria 3606
430 Ga0105239_10372244 3300010375 Bacteria 1614
431 Ga0105246_10147894 3300011119 Unclassified 1775
432 Ga0105246_10420980 3300011119 Bacteria 1115
433 Ga0105246_10835859 3300011119 Bacteria 820
434 Ga0157370_10756507 3300013104 Bacteria 885
435 Ga0157369_10073440 3300013105 Bacteria 3670
436 Ga0157369_10097558 3300013105 Bacteria 3135
437 Ga0157374_10498194 3300013296 Bacteria 1222
438 Ga0157374_10516932 3300013296 Bacteria 1200
439 Ga0157378_10008857 3300013297 Bacteria 8757
440 Ga0157378_10069094 3300013297 Unclassified 3168
441 Ga0157378_10095271 3300013297 Bacteria 2711
442 Ga0157378_10331098 3300013297 Bacteria 1482
443 Ga0157378_11301129 3300013297 Bacteria 768
444 Ga0157378_11304838 3300013297 Bacteria 767
445 Ga0157378_12059674 3300013297 Unclassified 621
446 Ga0163162_10056620 3300013306 Bacteria 3948
447 Ga0163162_11273827 3300013306 Bacteria 835
448 Ga0163162_12147973 3300013306 Unclassified 641
449 Ga0163162_12707613 3300013306 Bacteria 571
450 Ga0157372_10682861 3300013307 Bacteria 1195
451 Ga0157375_10165078 3300013308 Bacteria 2359
452 Ga0157375_10303229 3300013308 Bacteria 1761
453 Ga0157375_10403236 3300013308 Bacteria 1534
454 Ga0157375_10808797 3300013308 Bacteria 1086
455 Ga0163163_10202896 3300014325 Bacteria 2031
456 Ga0163163_10775761 3300014325 Bacteria 1022
457 Ga0163163_11291165 3300014325 Bacteria 792
458 Ga0163163_11437779 3300014325 Unclassified 751
459 Ga0157380_10210813 3300014326 Bacteria 1731
460 Ga0157380_10604598 3300014326 Bacteria 1085
461 Ga0157380_11717158 3300014326 Unclassified 686
462 Ga0157380_12404822 3300014326 Bacteria 592
463 Ga0157380_12438336 3300014326 Bacteria 588
464 Ga0157377_10141281 3300014745 Bacteria 1480
465 Ga0157377_10374686 3300014745 Bacteria 962
466 Ga0157379_10191735 3300014968 Bacteria 1847
467 Ga0157379_10346741 3300014968 Bacteria 1359
468 Ga0157379_11222073 3300014968 Bacteria 723
469 Ga0157379_11372113 3300014968 Bacteria 684
470 Ga0157379_11482785 3300014968 Bacteria 659
471 Ga0157376_10049673 3300014969 Bacteria 3476
472 Ga0157376_12833348 3300014969 Bacteria 525
473 Ga0163161_10088071 3300017792 Bacteria 2294
474 Ga0224572_1006688 3300024225 Bacteria 2090
475 Ga0228598_1013894 3300024227 Bacteria 1593
476 Ga0209672_100006 3300025228 Bacteria 1004497
477 Ga0209147_100370 3300025229 Bacteria 31762
478 Ga0209258_101558 3300025242 Bacteria 7663
479 Ga0209148_1000152 3300025254 Bacteria 153782
480 Ga0209455_1000134 3300025272 Bacteria 153783
481 Ga0207653_10020950 3300025885 Bacteria 2072
482 Ga0207692_10065337 3300025898 Bacteria 1897
483 Ga0207692_10193998 3300025898 Bacteria 1190
484 Ga0207642_10136974 3300025899 Bacteria 1285
485 Ga0207647_10046513 3300025904 Bacteria 2704
486 Ga0207685_10012820 3300025905 Bacteria 2572
487 Ga0207685_10032117 3300025905 Bacteria 1887
488 Ga0207685_10161047 3300025905 Bacteria 1025
489 Ga0207685_10298442 3300025905 Bacteria 796
490 Ga0207699_10002909 3300025906 Bacteria 8135
491 Ga0207684_10000006 3300025910 Bacteria 688605
492 Ga0207684_10000084 3300025910 Bacteria 176027
493 Ga0207684_10000583 3300025910 Bacteria 44299
494 Ga0207684_10000970 3300025910 Bacteria 32131
495 Ga0207684_10000988 3300025910 Bacteria 31913
496 Ga0207684_10001237 3300025910 Bacteria 28369
497 Ga0207684_10001698 3300025910 Bacteria 23386
498 Ga0207684_10003801 3300025910 Bacteria 14564
499 Ga0207684_10004915 3300025910 Bacteria 12473
500 Ga0207684_10005817 3300025910 Bacteria 11301
501 Ga0207684_10007853 3300025910 Bacteria 9542
502 Ga0207684_10014884 3300025910 Bacteria 6694
503 Ga0207684_10022460 3300025910 Bacteria 5385
504 Ga0207684_10041420 3300025910 Bacteria 3905
505 Ga0207684_10121985 3300025910 Bacteria 2234
506 Ga0207684_10175478 3300025910 Bacteria 1848
507 Ga0207684_10221687 3300025910 Bacteria 1632
508 Ga0207684_10290721 3300025910 Bacteria 1409
509 Ga0207684_10291849 3300025910 Bacteria 1406
510 Ga0207684_10344372 3300025910 Bacteria 1283
511 Ga0207684_10351918 3300025910 Bacteria 1268
512 Ga0207684_10437446 3300025910 Bacteria 1123
513 Ga0207684_10454937 3300025910 Bacteria 1099
514 Ga0207684_10585385 3300025910 Bacteria 954
515 Ga0207684_10683430 3300025910 Bacteria 873
516 Ga0207684_10686997 3300025910 Bacteria 870
517 Ga0207684_10901021 3300025910 Bacteria 743
518 Ga0207684_11205167 3300025910 Bacteria 627
519 Ga0207695_11284909 3300025913 Bacteria 612
520 Ga0207693_10022761 3300025915 Bacteria 4976
521 Ga0207693_10054771 3300025915 Bacteria 3128
522 Ga0207693_10055489 3300025915 Bacteria 3108
523 Ga0207693_10104924 3300025915 Bacteria 2216
524 Ga0207693_10116021 3300025915 Bacteria 2102
525 Ga0207663_10026630 3300025916 Bacteria 3359
526 Ga0207660_10546659 3300025917 Bacteria 942
527 Ga0207662_10250330 3300025918 Bacteria 1162
528 Ga0207646_10000031 3300025922 Bacteria 219144
529 Ga0207646_10000033 3300025922 Bacteria 213090
530 Ga0207646_10000063 3300025922 Bacteria 150574
531 Ga0207646_10000218 3300025922 Bacteria 78329
532 Ga0207646_10000746 3300025922 Bacteria 42261
533 Ga0207646_10001161 3300025922 Bacteria 33425
534 Ga0207646_10001607 3300025922 Bacteria 27577
535 Ga0207646_10001916 3300025922 Bacteria 25054
536 Ga0207646_10002200 3300025922 Bacteria 23223
537 Ga0207646_10021826 3300025922 Bacteria 5908
538 Ga0207646_10024235 3300025922 Bacteria 5560
539 Ga0207646_10025800 3300025922 Bacteria 5373
540 Ga0207646_10026423 3300025922 Bacteria 5297
541 Ga0207646_10032134 3300025922 Bacteria 4749
542 Ga0207646_10034230 3300025922 Bacteria 4592
543 Ga0207646_10037181 3300025922 Plasmid 4390
544 Ga0207646_10037700 3300025922 Bacteria 4357
545 Ga0207646_10045604 3300025922 Bacteria 3935
546 Ga0207646_10055797 3300025922 Bacteria 3532
547 Ga0207646_10063357 3300025922 Unclassified 3301
548 Ga0207646_10067041 3300025922 Bacteria 3204
549 Ga0207646_10069049 3300025922 Bacteria 3156
550 Ga0207646_10114490 3300025922 Bacteria 2422
551 Ga0207646_10139665 3300025922 Bacteria 2181
552 Ga0207646_10142933 3300025922 Bacteria 2156
553 Ga0207646_10177334 3300025922 Bacteria 1925
554 Ga0207646_10248607 3300025922 Bacteria 1606
555 Ga0207646_10252825 3300025922 Bacteria 1592
556 Ga0207646_10275126 3300025922 Bacteria 1522
557 Ga0207646_10282620 3300025922 Unclassified 1500
558 Ga0207646_10356479 3300025922 Bacteria 1321
559 Ga0207646_10367298 3300025922 Bacteria 1300
560 Ga0207646_10460877 3300025922 Bacteria 1147
561 Ga0207646_10587629 3300025922 Bacteria 1000
562 Ga0207646_10758200 3300025922 Bacteria 866
563 Ga0207646_10902467 3300025922 Bacteria 784
564 Ga0207646_11680241 3300025922 Bacteria 546
565 Ga0207650_10213733 3300025925 Bacteria 1549
566 Ga0207650_10375661 3300025925 Bacteria 1173
567 Ga0207659_10578244 3300025926 Bacteria 956
568 Ga0207687_10302967 3300025927 Bacteria 1288
569 Ga0207687_10493148 3300025927 Bacteria 1021
570 Ga0207687_11138409 3300025927 Bacteria 670
571 Ga0207687_11212068 3300025927 Bacteria 649
572 Ga0207700_10006843 3300025928 Bacteria 6931
573 Ga0207700_10031452 3300025928 Bacteria 3771
574 Ga0207700_10202829 3300025928 Bacteria 1672
575 Ga0207700_10829382 3300025928 Bacteria 827
576 Ga0207664_10015814 3300025929 Bacteria 5490
577 Ga0207664_10019469 3300025929 Bacteria 5017
578 Ga0207664_10032019 3300025929 Bacteria 4028
579 Ga0207664_10032521 3300025929 Bacteria 3999
580 Ga0207664_10095880 3300025929 Bacteria 2441
581 Ga0207664_10263581 3300025929 Unclassified 1508
582 Ga0207664_11037786 3300025929 Bacteria 734
583 Ga0207664_11045222 3300025929 Unclassified 731
584 Ga0207644_10424783 3300025931 Bacteria 1089
585 Ga0207690_10328242 3300025932 Bacteria 1204
586 Ga0207690_10765447 3300025932 Bacteria 797
587 Ga0207706_10527600 3300025933 Bacteria 1018
588 Ga0207706_10680600 3300025933 Bacteria 880
589 Ga0207706_10857952 3300025933 Unclassified 769
590 Ga0207686_10006047 3300025934 Bacteria 6498
591 Ga0207709_10061332 3300025935 Bacteria 2350
592 Ga0207709_10074201 3300025935 Bacteria 2170
593 Ga0207709_10191329 3300025935 Bacteria 1454
594 Ga0207709_10192779 3300025935 Bacteria 1449
595 Ga0207669_10020784 3300025937 Bacteria 3450
596 Ga0207669_10239409 3300025937 Bacteria 1344
597 Ga0207669_10545223 3300025937 Bacteria 935
598 Ga0207704_10139516 3300025938 Bacteria 1693
599 Ga0207665_10021842 3300025939 Bacteria 4209
600 Ga0207665_10026452 3300025939 Bacteria 3830
601 Ga0207665_10065715 3300025939 Bacteria 2467
602 Ga0207665_10117335 3300025939 Bacteria 1877
603 Ga0207665_10156542 3300025939 Bacteria 1636
604 Ga0207711_10273215 3300025941 Bacteria 1555
605 Ga0207689_10096197 3300025942 Bacteria 2432
606 Ga0207661_10052193 3300025944 Bacteria 3266
607 Ga0207651_11293948 3300025960 Bacteria 655
608 Ga0207651_11736826 3300025960 Bacteria 562
609 Ga0207712_10024455 3300025961 Bacteria 4000
610 Ga0207712_10175325 3300025961 Bacteria 1680
611 Ga0207712_10424986 3300025961 Unclassified 1122
612 Ga0207640_10264706 3300025981 Bacteria 1342
613 Ga0207658_10321818 3300025986 Bacteria 1339
614 Ga0207677_10294914 3300026023 Bacteria 1337
615 Ga0207677_10333263 3300026023 Bacteria 1265
616 Ga0207703_10048549 3300026035 Bacteria 3427
617 Ga0207708_10224470 3300026075 Bacteria 1506
618 Ga0207708_10306716 3300026075 Bacteria 1292
619 Ga0207708_10456355 3300026075 Bacteria 1065
620 Ga0207708_10922032 3300026075 Bacteria 757
621 Ga0207708_11253233 3300026075 Bacteria 649
622 Ga0207708_11757772 3300026075 Bacteria 544
623 Ga0207702_10104943 3300026078 Bacteria 2502
624 Ga0207648_10013776 3300026089 Bacteria 7501
625 Ga0207648_10387177 3300026089 Unclassified 1265
626 Ga0207648_11678580 3300026089 Bacteria 597
627 Ga0207676_10227056 3300026095 Bacteria 1667
628 Ga0207676_10542781 3300026095 Bacteria 1110
629 Ga0207676_11165855 3300026095 Bacteria 763
630 Ga0207674_10154834 3300026116 Bacteria 2247
631 Ga0207674_10249365 3300026116 Bacteria 1722
632 Ga0207675_100018630 3300026118 Bacteria 6478
633 Ga0207675_100376962 3300026118 Bacteria 1394
634 Ga0207675_101002978 3300026118 Bacteria 853
635 Ga0207675_101064474 3300026118 Bacteria 828
636 Ga0207683_10054598 3300026121 Bacteria 3503
637 Ga0207683_10176333 3300026121 Bacteria 1937
638 Ga0207683_10501124 3300026121 Bacteria 1121
639 Ga0207683_11245635 3300026121 Bacteria 689
640 Ga0207698_12570365 3300026142 Bacteria 519
641 Ga0209588_1000068 3300027671 Bacteria 35839
642 Ga0209588_1057541 3300027671 Bacteria 1257
643 Ga0207428_10005408 3300027907 Bacteria 11912
644 Ga0207428_10006297 3300027907 Bacteria 10973
645 Ga0207428_10093794 3300027907 Bacteria 2328
646 Ga0207428_11219774 3300027907 Bacteria 523
647 Ga0268266_11212788 3300028379 Bacteria 730
648 Ga0265337_1001280 3300028556 Bacteria 12624
649 Ga0265326_10000946 3300028558 Bacteria 10474
650 Ga0265319_1001192 3300028563 Bacteria 16077
651 Ga0265334_10002226 3300028573 Bacteria 9125
652 Ga0265323_10017550 3300028653 Bacteria 2778
653 Ga0265322_10024912 3300028654 Bacteria 1712
654 Ga0265336_10006771 3300028666 Bacteria 4106
655 Ga0265338_10003705 3300028800 Bacteria 21275
656 Ga0265324_10008561 3300029957 Bacteria 4059
657 Ga0265762_1026280 3300030760 Unclassified 1089
658 Ga0265760_10188056 3300031090 Unclassified 692
659 Ga0265332_10002916 3300031238 Bacteria 8423
660 Ga0265320_10003514 3300031240 Bacteria 10499
661 Ga0265325_10068831 3300031241 Bacteria 1781
662 Ga0265325_10547522 3300031241 Bacteria 500
663 Ga0265340_10001257 3300031247 Bacteria 14564
664 Ga0265339_10005329 3300031249 Bacteria 8570
665 Ga0265339_10215050 3300031249 Bacteria 942
666 Ga0265331_10165003 3300031250 Bacteria 1003
667 Ga0265313_10005391 3300031595 Bacteria 9433
668 Ga0265314_10014104 3300031711 Bacteria 6416
669 Ga0265314_10033265 3300031711 Bacteria 3783
670 Ga0265342_10004204 3300031712 Bacteria 11445
671 Ga0265342_10004500 3300031712 Bacteria 10938
672 Ga0265342_10187349 3300031712 Unclassified 1131
673 Ga0373929_0185795 3300035085 Bacteria 575
674 Ga0373936_0100922 3300035113 Unclassified 1217
675 Ga0373960_0159118 3300035121 Bacteria 776
676 Ga0373943_0123911 3300035170 Bacteria 1376
677 Ga0373946_0227262 3300035171 Bacteria 903
678 Ga0373946_0277237 3300035171 Bacteria 824
679 Ga0373942_0131230 3300035207 Bacteria 791
680 Ga0373962_0116412 3300035242 Bacteria 848
681 Ga0373924_0124290 3300035410 Bacteria 1121
682 Ga0373931_0069434 3300035691 Unclassified 1920
683 Ga0373931_0255414 3300035691 Bacteria 1067
684 Ga0373931_0639409 3300035691 Bacteria 698
685 Ga0373935_0229495 3300035692 Bacteria 1292
686 Ga0373933_0159426 3300035724 Bacteria 1432
687 Ga0373933_0231057 3300035724 Bacteria 1188
688 Ga0373947_0302389 3300035725 Bacteria 1067
689 Ga0373947_1153116 3300035725 Bacteria 528
690 Ga0373937_0306813 3300036401 Bacteria 1501
691 Ga0373937_0409024 3300036401 Bacteria 1287
692 Ga0373937_0737286 3300036401 Bacteria 932
693 Ga0373925_0019090 3300037068 Bacteria 4985
694 Ga0373925_0956935 3300037068 Bacteria 705
695 Ga0373925_1376889 3300037068 Bacteria 578
696 Ga0395899_0002229 3300037312 Bacteria 15878
697 Ga0395900_0003555 3300037418 Bacteria 16760
698 Ga0395900_0005158 3300037418 Bacteria 13719
699 Ga0395898_0000060 3300037466 Bacteria 273835
700 Ga0395898_0001657 3300037466 Bacteria 30012
701 Ga0395905_0000949 3300037471 Bacteria 37219
702 Ga0395905_0594055 3300037471 Bacteria 1009
703 Ga0395901_0002577 3300038443 Bacteria 18377
704 Ga0242420_080981 3300038996 Bacteria 671
705 Ga0451577_1259367 3300042876 Unclassified 659
706 Ga0495617_155320 3300046452 Bacteria 727
707 Ga0495617_267426 3300046452 Bacteria 525
708 Ga0495627_069833 3300046453 Bacteria 1028
709 Ga0495627_186857 3300046453 Bacteria 573
710 Ga0495592_0072343 3300046454 Bacteria 2508
711 Ga0495603_0038524 3300046455 Bacteria 2866
712 Ga0495603_0455384 3300046455 Bacteria 733
713 Ga0495629_0082498 3300046459 Bacteria 2244
714 Ga0495629_0579325 3300046459 Bacteria 752
715 Ga0495651_0227599 3300046462 Bacteria 1286
716 Ga0495651_0589249 3300046462 Bacteria 702
717 Ga0495653_0069288 3300046463 Bacteria 2643
718 Ga0495653_0114589 3300046463 Bacteria 1931
719 Ga0495653_0151817 3300046463 Bacteria 1618
720 Ga0495653_0209400 3300046463 Bacteria 1318
721 Ga0495653_0311448 3300046463 Bacteria 1023
722 Ga0495580_0033697 3300046472 Bacteria 3689
723 Ga0495605_0204601 3300046474 Bacteria 859
724 Ga0495639_0109488 3300046475 Bacteria 1310
725 Ga0495662_0002907 3300046476 Bacteria 8654
726 Ga0495662_0066859 3300046476 Bacteria 1739
727 Ga0495664_0013980 3300046477 Bacteria 4547
728 Ga0495664_0759899 3300046477 Bacteria 571
729 Ga0495584_0215131 3300046491 Bacteria 977
730 Ga0495584_0309855 3300046491 Unclassified 802
731 Ga0495585_0078383 3300046492 Bacteria 1792
732 Ga0495585_0084220 3300046492 Bacteria 1720
733 Ga0495585_0365049 3300046492 Bacteria 700
734 Ga0495594_0827815 3300046499 Bacteria 521
735 Ga0495596_0041253 3300046500 Bacteria 1820
736 Ga0495607_0066220 3300046501 Bacteria 2034
737 Ga0495607_0067040 3300046501 Bacteria 2018
738 Ga0495607_0123121 3300046501 Bacteria 1359
739 Ga0495607_0170121 3300046501 Bacteria 1101
740 Ga0495607_0318687 3300046501 Bacteria 726
741 Ga0495608_0022297 3300046511 Bacteria 4341
742 Ga0495608_0030021 3300046511 Bacteria 3683
743 Ga0495608_0734524 3300046511 Bacteria 586
744 Ga0495618_0095291 3300046514 Bacteria 1903
745 Ga0495618_0156238 3300046514 Bacteria 1456
746 Ga0495618_0461453 3300046514 Bacteria 770
747 Ga0495628_0091068 3300046516 Bacteria 2360
748 Ga0495628_0533023 3300046516 Bacteria 845
749 Ga0495628_0885596 3300046516 Bacteria 620
750 Ga0495630_0107982 3300046517 Bacteria 2108
751 Ga0495630_0201800 3300046517 Bacteria 1517
752 Ga0495630_0204261 3300046517 Bacteria 1508
753 Ga0495637_0182363 3300046520 Bacteria 778
754 Ga0495644_0007487 3300046523 Bacteria 4208
755 Ga0495644_0057437 3300046523 Bacteria 1463
756 Ga0495644_0123397 3300046523 Bacteria 986
757 Ga0495663_0042186 3300046525 Bacteria 1390
758 Ga0495663_0321263 3300046525 Bacteria 560
759 Ga0495666_0026974 3300046526 Bacteria 2827
760 Ga0495642_0077281 3300046528 Bacteria 1398
761 Ga0495642_0174042 3300046528 Bacteria 936
762 Ga0495652_0012109 3300046529 Bacteria 7792
763 Ga0495652_0054026 3300046529 Bacteria 3422
764 Ga0495654_0404509 3300046530 Unclassified 542
765 Ga0495665_0038339 3300046531 Bacteria 2555
766 Ga0495640_0038011 3300046533 Bacteria 3389
767 Ga0495640_0399522 3300046533 Bacteria 844
768 Ga0495586_0010003 3300046535 Bacteria 5054
769 Ga0495587_0160939 3300046536 Bacteria 1277
770 Ga0495587_0174632 3300046536 Bacteria 1219
771 Ga0495587_0315844 3300046536 Bacteria 873
772 Ga0495598_0005026 3300046537 Bacteria 2904
773 Ga0495598_0125918 3300046537 Bacteria 873
774 Ga0495598_0271193 3300046537 Bacteria 634
775 Ga0495609_0087100 3300046538 Bacteria 1361
776 Ga0495621_0065667 3300046539 Bacteria 1326
777 Ga0495621_0314256 3300046539 Bacteria 652
778 Ga0495597_0401702 3300046542 Bacteria 521
779 Ga0495645_0053497 3300046543 Bacteria 2934
780 Ga0495645_0804554 3300046543 Bacteria 564
781 Ga0495633_0044106 3300046558 Bacteria 2114
782 Ga0495633_0352874 3300046558 Bacteria 666
783 Ga0495667_0037816 3300046559 Bacteria 3215
784 Ga0495667_0039220 3300046559 Bacteria 3150
785 Ga0495667_0124133 3300046559 Bacteria 1666
786 Ga0495667_0358315 3300046559 Bacteria 921
787 Ga0495656_0015839 3300046615 Bacteria 2853
788 Ga0495656_0055583 3300046615 Bacteria 1708
789 Ga0495656_0342654 3300046615 Bacteria 773
790 Ga0495668_0435829 3300046616 Bacteria 721
791 Ga0495668_0772609 3300046616 Bacteria 532
792 Ga0495634_0019504 3300046642 Bacteria 4817
793 Ga0495634_0175117 3300046642 Bacteria 1346
794 Ga0495634_0274119 3300046642 Bacteria 1026
795 Ga0495634_0359635 3300046642 Bacteria 870
796 Ga0495611_0184241 3300046648 Bacteria 975
797 Ga0495611_0311491 3300046648 Bacteria 725
798 Ga0495611_0408590 3300046648 Bacteria 620
799 Ga0495611_0492798 3300046648 Unclassified 557
800 Ga0495635_0010045 3300046663 Bacteria 6619
801 Ga0495635_0075980 3300046663 Bacteria 2301
802 Ga0495635_0133620 3300046663 Bacteria 1691
803 Ga0495659_0042672 3300046664 Bacteria 1624
804 Ga0495659_0107840 3300046664 Unclassified 1085
805 Ga0495659_0165906 3300046664 Unclassified 894
806 Ga0495661_0172181 3300046665 Bacteria 1154
807 Ga0495657_0012580 3300046675 Bacteria 6279
808 Ga0495657_0045056 3300046675 Bacteria 2995
809 Ga0495657_0062362 3300046675 Bacteria 2463
810 Ga0495599_0046300 3300046678 Bacteria 2727
811 Ga0495599_0392567 3300046678 Bacteria 827
812 Ga0495623_0187429 3300046679 Bacteria 1197
813 Ga0495646_0014574 3300046680 Bacteria 4995
814 Ga0495658_0561499 3300046683 Bacteria 731
815 Ga0495669_0491004 3300046684 Bacteria 597
816 Ga0495613_0006059 3300046689 Bacteria 9049
817 Ga0495624_0500757 3300046690 Bacteria 727
818 Ga0495624_0670535 3300046690 Unclassified 616
819 Ga0495670_0002276 3300046691 Bacteria 9469
820 Ga0495670_0039216 3300046691 Bacteria 2362
821 Ga0495670_0257525 3300046691 Bacteria 931
822 Ga0495671_0266351 3300046692 Bacteria 826
823 Ga0495589_0081179 3300046794 Bacteria 1578
824 Ga0495589_0086660 3300046794 Bacteria 1521
825 Ga0495589_0264253 3300046794 Bacteria 802
826 Ga0495600_0098167 3300046809 Bacteria 1909
827 Ga0495600_0222518 3300046809 Bacteria 1207
828 Ga0495660_0412022 3300046810 Unclassified 590
829 Ga0495581_0051716 3300047315 Bacteria 2373
830 Ga0495604_0130563 3300047317 Bacteria 1806
831 Ga0495636_0011678 3300047318 Bacteria 3479
832 Ga0495674_0051797 3300047319 Bacteria 3617
833 Ga0495674_0065464 3300047319 Bacteria 3156
834 Ga0495674_0082204 3300047319 Bacteria 2762
835 Ga0495674_1054530 3300047319 Bacteria 621
836 Ga0495674_1122333 3300047319 Unclassified 598
837 Ga0495676_0164973 3300047321 Bacteria 1564
838 Ga0495676_0194748 3300047321 Bacteria 1412
839 Ga0495676_0323811 3300047321 Bacteria 1035
840 Ga0495676_0549454 3300047321 Bacteria 755
841 Ga0495676_0654403 3300047321 Bacteria 682
842 Ga0495680_0074334 3300047322 Bacteria 2581
843 Ga0495680_0125668 3300047322 Bacteria 1889
844 Ga0495680_0195483 3300047322 Bacteria 1453
845 Ga0495675_0088931 3300047444 Bacteria 1939
846 Ga0495677_0030518 3300047445 Bacteria 1962
847 Ga0495685_113987 3300047447 Bacteria 889
848 Ga0495684_0008224 3300047471 Bacteria 8075
849 Ga0495684_0058752 3300047471 Bacteria 2929
850 Ga0495684_0304936 3300047471 Bacteria 1143
851 Ga0495684_0932892 3300047471 Bacteria 556
852 Ga0495593_0024361 3300047673 Bacteria 3355
853 Ga0495602_0676530 3300048088 Bacteria 702
854 Ga0495602_0853821 3300048088 Bacteria 608
855 Ga0495615_0290372 3300048090 Bacteria 527
856 Ga0495626_0264769 3300048091 Bacteria 686
857 Ga0496100_0041492 3300048903 Bacteria 2933
858 Ga0496100_0077464 3300048903 Bacteria 2235
859 Ga0496101_0075154 3300048904 Bacteria 2486
860 Ga0496101_0127586 3300048904 Bacteria 1929
861 Ga0496101_0861377 3300048904 Bacteria 714
862 Ga0496102_0019678 3300048905 Bacteria 5948
863 Ga0496102_0193032 3300048905 Bacteria 1919
864 Ga0496102_0391201 3300048905 Bacteria 1308
865 Ga0496102_0798427 3300048905 Bacteria 866
866 Ga0496102_0956078 3300048905 Bacteria 778
867 Ga0496102_0968848 3300048905 Bacteria 771
868 Ga0496102_1189017 3300048905 Bacteria 682
869 Ga0496102_1266692 3300048905 Unclassified 657
870 Ga0496103_0027742 3300048906 Bacteria 3433
871 Ga0496103_0281742 3300048906 Bacteria 1069
872 Ga0496104_0010875 3300048907 Bacteria 8139
873 Ga0496104_0411564 3300048907 Bacteria 1264
874 Ga0496105_0093253 3300048908 Bacteria 2486
875 Ga0496105_0150162 3300048908 Bacteria 1915
876 Ga0496105_0298365 3300048908 Unclassified 1296
877 Ga0496106_0036049 3300048909 Bacteria 3700
878 Ga0496106_0051870 3300048909 Bacteria 3093
879 Ga0496106_0127153 3300048909 Bacteria 1996
880 Ga0496106_0502341 3300048909 Bacteria 974
881 Ga0496107_0005090 3300048910 Bacteria 8962
882 Ga0496107_0144686 3300048910 Unclassified 1757
883 Ga0496107_0224933 3300048910 Bacteria 1396
884 Ga0496108_0055149 3300048911 Bacteria 3336
885 Ga0496108_1122195 3300048911 Bacteria 667
886 Ga0496109_0378228 3300048912 Bacteria 1338
887 Ga0496110_0176225 3300048913 Unclassified 1940
888 Ga0496111_0036770 3300048914 Bacteria 3502
889 Ga0496111_0166986 3300048914 Bacteria 1635
890 Ga0496112_0164403 3300048915 Bacteria 2185
891 Ga0496112_0274026 3300048915 Bacteria 1635
892 Ga0496113_0592333 3300048916 Bacteria 888
893 Ga0496114_0010401 3300048917 Bacteria 7402
894 Ga0496114_0222897 3300048917 Bacteria 1655
895 Ga0496115_0011105 3300048918 Bacteria 6749
896 Ga0496115_0591828 3300048918 Unclassified 883
897 Ga0496115_0683825 3300048918 Unclassified 808
898 Ga0496115_1335582 3300048918 Bacteria 532
899 Ga0496123_0057222 3300048926 Bacteria 2540
900 Ga0496126_0020033 3300048929 Bacteria 6569
901 Ga0496126_0178301 3300048929 Bacteria 1806
902 Ga0501067_0074277 3300049583 Bacteria 1884
903 Ga0501068_0087351 3300049584 Bacteria 1920
904 Ga0501070_0000034 3300049586 Bacteria 128605
905 nmdc:mga00v17_221996_c1 3300050491 Bacteria 1223
906 nmdc:mga00v17_886910_c1 3300050491 Bacteria 565
907 nmdc:mga0yw44_9191_c1 3300050492 Bacteria 4974
908 nmdc:mga05p37_137915_c1 3300050507 Bacteria 2990
909 nmdc:mga05p37_2250218_c1 3300050507 Bacteria 504
910 nmdc:mga05p37_2754_c1 3300050507 Bacteria 20427
911 nmdc:mga05p37_292347_c1 3300050507 Bacteria 1939
912 nmdc:mga05p37_52031_c1 3300050507 Bacteria 5036
913 nmdc:mga05p37_719764_c1 3300050507 Bacteria 1106
914 nmdc:mga05p37_7324_c1 3300050507 Bacteria 13024
915 nmdc:mga09592_1041057_c1 3300050508 Bacteria 683
916 nmdc:mga09592_223530_c1 3300050508 Bacteria 1631
917 nmdc:mga09592_544133_c1 3300050508 Bacteria 997
918 nmdc:mga0qj67_648654_c1 3300050509 Bacteria 842
919 nmdc:mga06r32_1459976_c1 3300050510 Bacteria 625
920 nmdc:mga06r32_17228_c1 3300050510 Bacteria 6595
921 nmdc:mga06r32_188217_c1 3300050510 Bacteria 2051
922 nmdc:mga06r32_454065_c1 3300050510 Bacteria 1261
923 nmdc:mga06r32_80097_c1 3300050510 Bacteria 3178
924 nmdc:mga08y16_1141306_c1 3300050511 Bacteria 753
925 nmdc:mga08y16_11664_c1 3300050511 Bacteria 9234
926 nmdc:mga08y16_1299503_c1 3300050511 Bacteria 694
927 nmdc:mga08y16_20192_c1 3300050511 Bacteria 7032
928 nmdc:mga08y16_326534_c1 3300050511 Bacteria 1579
929 nmdc:mga08y16_53577_c1 3300050511 Bacteria 4218
930 nmdc:mga08y16_67612_c1 3300050511 Bacteria 3727
931 nmdc:mga0n895_1218388_c1 3300050512 Bacteria 726
932 nmdc:mga0n895_164404_c1 3300050512 Bacteria 2251
933 nmdc:mga0n895_19321_c1 3300050512 Bacteria 6331
934 nmdc:mga0n895_526213_c1 3300050512 Bacteria 1190
935 nmdc:mga0n895_81435_c1 3300050512 Bacteria 3226
936 nmdc:mga0n895_85910_c1 3300050512 Bacteria 3142
937 nmdc:mga0rr50_122528_c1 3300050513 Bacteria 2072
938 nmdc:mga0rr50_174797_c1 3300050513 Unclassified 1752
939 nmdc:mga0rr50_211069_c1 3300050513 Bacteria 1599
940 nmdc:mga0rr50_283552_c1 3300050513 Bacteria 1383
941 nmdc:mga0rr50_313721_c1 3300050513 Bacteria 1314
942 nmdc:mga0rr50_322291_c1 3300050513 Unclassified 1296
943 nmdc:mga0rr50_606182_c1 3300050513 Bacteria 934
944 nmdc:mga0rr50_93269_c1 3300050513 Unclassified 2349
945 nmdc:mga08x19_113065_c1 3300050514 Bacteria 1813
946 nmdc:mga08x19_20798_c1 3300050514 Bacteria 4045
947 nmdc:mga08x19_27814_c1 3300050514 Unclassified 3539
948 nmdc:mga08x19_279539_c1 3300050514 Bacteria 1156
949 nmdc:mga08x19_608098_c1 3300050514 Bacteria 775
950 nmdc:mga08x19_79412_c1 3300050514 Bacteria 2152
951 nmdc:mga08x19_94502_c1 3300050514 Bacteria 1977
952 nmdc:mga0a205_127892_c1 3300050515 Bacteria 1926
953 nmdc:mga0a205_131255_c1 3300050515 Unclassified 2405
954 nmdc:mga0a205_131805_c1 3300050515 Bacteria 2400
955 nmdc:mga0a205_256052_c1 3300050515 Bacteria 1629
956 nmdc:mga0a205_332620_c1 3300050515 Bacteria 1389
957 nmdc:mga0a205_651512_c1 3300050515 Bacteria 904
958 nmdc:mga0a205_66434_c1 3300050515 Bacteria 3485
959 nmdc:mga0a205_9925_c1 3300050515 Bacteria 8732
960 Ga0495601_0018231 3300053077 Bacteria 4269
961 Ga0495601_0165696 3300053077 Bacteria 1444
962 Ga0495601_0338717 3300053077 Bacteria 978
963 Ga0495601_0341615 3300053077 Bacteria 974
964 Ga0495612_0208171 3300053078 Bacteria 864
965 Ga0495595_0178776 3300053084 Bacteria 1052
966 Ga0495619_0038895 3300053085 Bacteria 3104
967 Ga0495619_0039646 3300053085 Bacteria 3075
968 Ga0495619_0242681 3300053085 Bacteria 1248
969 Ga0500559_0142437 3300053136 Bacteria 1123
970 Ga0500559_0573484 3300053136 Bacteria 513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_101712233 Ga0068859_1017122331 123
2 3300006931 Ga0097620_101712551 Ga0097620_1017125511 123
3 3300035724 Ga0373933_0231057 Ga0373933_0231057_164_583 137
4 3300036401 Ga0373937_0306813 Ga0373937_0306813_1046_1465 137
5 3300046463 Ga0495653_0151817 Ga0495653_0151817_982_1401 137
6 3300046511 Ga0495608_0734524 Ga0495608_0734524_73_492 137
7 3300046517 Ga0495630_0107982 Ga0495630_0107982_489_908 137
8 3300046529 Ga0495652_0054026 Ga0495652_0054026_1504_1923 137
9 3300046533 Ga0495640_0399522 Ga0495640_0399522_116_535 137
10 3300046642 Ga0495634_0019504 Ga0495634_0019504_3128_3547 137
11 3300047319 Ga0495674_1054530 Ga0495674_1054530_30_449 137
12 3300047322 Ga0495680_0074334 Ga0495680_0074334_20_439 137
13 3300047471 Ga0495684_0058752 Ga0495684_0058752_2351_2770 137
14 3300048907 Ga0496104_0411564 Ga0496104_0411564_385_798 137
15 3300048909 Ga0496106_0502341 Ga0496106_0502341_378_791 137
16 3300048917 Ga0496114_0222897 Ga0496114_0222897_142_555 137
17 3300048929 Ga0496126_0178301 Ga0496126_0178301_91_504 137
18 3300053078 Ga0495612_0208171 Ga0495612_0208171_144_563 137
19 3300053085 Ga0495619_0039646 Ga0495619_0039646_2595_3014 137
20 3300005549 Ga0070704_100804223 Ga0070704_1008042232 138
21 3300005468 Ga0070707_100275738 Ga0070707_1002757383 139
22 3300006847 Ga0075431_100780964 Ga0075431_1007809641 139
23 3300046543 Ga0495645_0804554 Ga0495645_0804554_29_451 140
24 3300005440 Ga0070705_100082374 Ga0070705_1000823742 141
25 3300013105 Ga0157369_10073440 Ga0157369_100734404 141
26 3300025910 Ga0207684_10437446 Ga0207684_104374462 141
27 3300046648 Ga0495611_0184241 Ga0495611_0184241_432_866 141
28 3300050513 nmdc:mga0rr50_313721_c1 nmdc:mga0rr50_313721_c1_134_571 141
29 3300053136 Ga0500559_0142437 Ga0500559_0142437_30_455 141
30 3300053136 Ga0500559_0573484 Ga0500559_0573484_23_448 141
31 3300002459 JGI24751J29686_10006875 JGI24751J29686_100068753 142
32 3300005331 Ga0070670_100019605 Ga0070670_1000196053 142
33 3300005337 Ga0070682_100752872 Ga0070682_1007528721 142
34 3300005434 Ga0070709_10039969 Ga0070709_100399693 142
35 3300005435 Ga0070714_100196265 Ga0070714_1001962652 142
36 3300005437 Ga0070710_10243334 Ga0070710_102433342 142
37 3300005437 Ga0070710_11233183 Ga0070710_112331831 142
38 3300005439 Ga0070711_100143253 Ga0070711_1001432532 142
39 3300005445 Ga0070708_100025182 Ga0070708_1000251822 142
40 3300005937 Ga0081455_10617997 Ga0081455_106179972 142
41 3300006163 Ga0070715_10032915 Ga0070715_100329152 142
42 3300006173 Ga0070716_100040061 Ga0070716_1000400612 142
43 3300006173 Ga0070716_100094475 Ga0070716_1000944751 142
44 3300006871 Ga0075434_100084830 Ga0075434_1000848302 142
45 3300006871 Ga0075434_101161390 Ga0075434_1011613902 142
46 3300006914 Ga0075436_100993512 Ga0075436_1009935122 142
47 3300007076 Ga0075435_100053053 Ga0075435_1000530534 142
48 3300007265 Ga0099794_10061960 Ga0099794_100619602 142
49 3300007265 Ga0099794_10149093 Ga0099794_101490931 142
50 3300007265 Ga0099794_10196163 Ga0099794_101961632 142
51 3300007788 Ga0099795_10055352 Ga0099795_100553523 142
52 3300007788 Ga0099795_10098025 Ga0099795_100980252 142
53 3300007788 Ga0099795_10144718 Ga0099795_101447181 142
54 3300009094 Ga0111539_10007869 Ga0111539_1000786917 142
55 3300009098 Ga0105245_11830501 Ga0105245_118305012 142
56 3300009147 Ga0114129_11189327 Ga0114129_111893271 142
57 3300009148 Ga0105243_10100578 Ga0105243_101005783 142
58 3300009177 Ga0105248_12042724 Ga0105248_120427241 142
59 3300010375 Ga0105239_10372244 Ga0105239_103722442 142
60 3300013104 Ga0157370_10756507 Ga0157370_107565072 142
61 3300013105 Ga0157369_10097558 Ga0157369_100975584 142
62 3300013297 Ga0157378_11301129 Ga0157378_113011292 142
63 3300013306 Ga0163162_12147973 Ga0163162_121479731 142
64 3300014325 Ga0163163_10202896 Ga0163163_102028962 142
65 3300014325 Ga0163163_11437779 Ga0163163_114377792 142
66 3300014326 Ga0157380_10604598 Ga0157380_106045982 142
67 3300014326 Ga0157380_11717158 Ga0157380_117171582 142
68 3300014968 Ga0157379_10191735 Ga0157379_101917352 142
69 3300025898 Ga0207692_10065337 Ga0207692_100653372 142
70 3300025905 Ga0207685_10012820 Ga0207685_100128202 142
71 3300025906 Ga0207699_10002909 Ga0207699_100029098 142
72 3300025922 Ga0207646_10021826 Ga0207646_100218263 142
73 3300025922 Ga0207646_10282620 Ga0207646_102826202 142
74 3300025927 Ga0207687_10493148 Ga0207687_104931482 142
75 3300025928 Ga0207700_10006843 Ga0207700_100068435 142
76 3300025929 Ga0207664_10015814 Ga0207664_100158145 142
77 3300026078 Ga0207702_10104943 Ga0207702_101049432 142
78 3300031712 Ga0265342_10187349 Ga0265342_101873492 142
79 3300035085 Ga0373929_0185795 Ga0373929_0185795_110_547 142
80 3300035121 Ga0373960_0159118 Ga0373960_0159118_74_511 142
81 3300035171 Ga0373946_0227262 Ga0373946_0227262_233_673 142
82 3300035207 Ga0373942_0131230 Ga0373942_0131230_144_584 142
83 3300035242 Ga0373962_0116412 Ga0373962_0116412_86_523 142
84 3300035691 Ga0373931_0069434 Ga0373931_0069434_31_468 142
85 3300035691 Ga0373931_0255414 Ga0373931_0255414_46_477 142
86 3300035691 Ga0373931_0639409 Ga0373931_0639409_246_686 142
87 3300035692 Ga0373935_0229495 Ga0373935_0229495_287_727 142
88 3300035724 Ga0373933_0159426 Ga0373933_0159426_715_1155 142
89 3300036401 Ga0373937_0737286 Ga0373937_0737286_421_861 142
90 3300037068 Ga0373925_0956935 Ga0373925_0956935_23_463 142
91 3300037068 Ga0373925_1376889 Ga0373925_1376889_120_557 142
92 3300037312 Ga0395899_0002229 Ga0395899_0002229_8144_8581 142
93 3300037418 Ga0395900_0003555 Ga0395900_0003555_1911_2351 142
94 3300037418 Ga0395900_0005158 Ga0395900_0005158_7429_7866 142
95 3300037466 Ga0395898_0000060 Ga0395898_0000060_146136_146576 142
96 3300037466 Ga0395898_0001657 Ga0395898_0001657_1669_2106 142
97 3300037471 Ga0395905_0000949 Ga0395905_0000949_7953_8390 142
98 3300038443 Ga0395901_0002577 Ga0395901_0002577_13308_13745 142
99 3300038996 Ga0242420_080981 Ga0242420_080981_215_655 142
100 3300046452 Ga0495617_155320 Ga0495617_155320_224_661 142
101 3300046453 Ga0495627_186857 Ga0495627_186857_111_548 142
102 3300046454 Ga0495592_0072343 Ga0495592_0072343_619_1056 142
103 3300046459 Ga0495629_0579325 Ga0495629_0579325_41_481 142
104 3300046462 Ga0495651_0589249 Ga0495651_0589249_158_595 142
105 3300046463 Ga0495653_0069288 Ga0495653_0069288_1563_2000 142
106 3300046463 Ga0495653_0311448 Ga0495653_0311448_195_635 142
107 3300046472 Ga0495580_0033697 Ga0495580_0033697_3079_3516 142
108 3300046476 Ga0495662_0002907 Ga0495662_0002907_5667_6104 142
109 3300046477 Ga0495664_0013980 Ga0495664_0013980_2530_2967 142
110 3300046491 Ga0495584_0215131 Ga0495584_0215131_383_820 142
111 3300046492 Ga0495585_0078383 Ga0495585_0078383_835_1314 142
112 3300046492 Ga0495585_0365049 Ga0495585_0365049_61_498 142
113 3300046501 Ga0495607_0066220 Ga0495607_0066220_1172_1609 142
114 3300046501 Ga0495607_0067040 Ga0495607_0067040_270_749 142
115 3300046501 Ga0495607_0170121 Ga0495607_0170121_528_965 142
116 3300046501 Ga0495607_0318687 Ga0495607_0318687_258_695 142
117 3300046511 Ga0495608_0022297 Ga0495608_0022297_2444_2881 142
118 3300046511 Ga0495608_0030021 Ga0495608_0030021_1075_1515 142
119 3300046514 Ga0495618_0095291 Ga0495618_0095291_561_1001 142
120 3300046516 Ga0495628_0091068 Ga0495628_0091068_240_677 142
121 3300046517 Ga0495630_0201800 Ga0495630_0201800_419_856 142
122 3300046520 Ga0495637_0182363 Ga0495637_0182363_225_662 142
123 3300046523 Ga0495644_0123397 Ga0495644_0123397_269_706 142
124 3300046525 Ga0495663_0321263 Ga0495663_0321263_49_486 142
125 3300046526 Ga0495666_0026974 Ga0495666_0026974_240_677 142
126 3300046528 Ga0495642_0077281 Ga0495642_0077281_213_650 142
127 3300046529 Ga0495652_0012109 Ga0495652_0012109_12_449 142
128 3300046531 Ga0495665_0038339 Ga0495665_0038339_965_1402 142
129 3300046533 Ga0495640_0038011 Ga0495640_0038011_2534_2971 142
130 3300046535 Ga0495586_0010003 Ga0495586_0010003_4343_4780 142
131 3300046536 Ga0495587_0160939 Ga0495587_0160939_195_635 142
132 3300046536 Ga0495587_0174632 Ga0495587_0174632_771_1208 142
133 3300046537 Ga0495598_0005026 Ga0495598_0005026_361_840 142
134 3300046538 Ga0495609_0087100 Ga0495609_0087100_200_637 142
135 3300046539 Ga0495621_0314256 Ga0495621_0314256_89_526 142
136 3300046543 Ga0495645_0053497 Ga0495645_0053497_2316_2753 142
137 3300046558 Ga0495633_0044106 Ga0495633_0044106_352_789 142
138 3300046559 Ga0495667_0039220 Ga0495667_0039220_1765_2202 142
139 3300046559 Ga0495667_0124133 Ga0495667_0124133_783_1223 142
140 3300046615 Ga0495656_0342654 Ga0495656_0342654_14_451 142
141 3300046616 Ga0495668_0772609 Ga0495668_0772609_53_490 142
142 3300046642 Ga0495634_0175117 Ga0495634_0175117_12_449 142
143 3300046648 Ga0495611_0408590 Ga0495611_0408590_48_485 142
144 3300046663 Ga0495635_0075980 Ga0495635_0075980_1853_2290 142
145 3300046663 Ga0495635_0133620 Ga0495635_0133620_1174_1614 142
146 3300046664 Ga0495659_0042672 Ga0495659_0042672_213_650 142
147 3300046664 Ga0495659_0165906 Ga0495659_0165906_56_493 142
148 3300046675 Ga0495657_0012580 Ga0495657_0012580_4067_4504 142
149 3300046675 Ga0495657_0045056 Ga0495657_0045056_746_1186 142
150 3300046678 Ga0495599_0046300 Ga0495599_0046300_727_1164 142
151 3300046678 Ga0495599_0392567 Ga0495599_0392567_266_706 142
152 3300046679 Ga0495623_0187429 Ga0495623_0187429_158_595 142
153 3300046680 Ga0495646_0014574 Ga0495646_0014574_3940_4377 142
154 3300046684 Ga0495669_0491004 Ga0495669_0491004_139_576 142
155 3300046689 Ga0495613_0006059 Ga0495613_0006059_7841_8278 142
156 3300046690 Ga0495624_0500757 Ga0495624_0500757_267_707 142
157 3300046691 Ga0495670_0257525 Ga0495670_0257525_276_713 142
158 3300046692 Ga0495671_0266351 Ga0495671_0266351_247_684 142
159 3300046809 Ga0495600_0098167 Ga0495600_0098167_1233_1670 142
160 3300046809 Ga0495600_0222518 Ga0495600_0222518_26_466 142
161 3300047315 Ga0495581_0051716 Ga0495581_0051716_896_1333 142
162 3300047317 Ga0495604_0130563 Ga0495604_0130563_158_595 142
163 3300047318 Ga0495636_0011678 Ga0495636_0011678_887_1366 142
164 3300047319 Ga0495674_0051797 Ga0495674_0051797_2815_3255 142
165 3300047319 Ga0495674_0065464 Ga0495674_0065464_1118_1555 142
166 3300047321 Ga0495676_0164973 Ga0495676_0164973_1091_1522 142
167 3300047321 Ga0495676_0549454 Ga0495676_0549454_212_649 142
168 3300047321 Ga0495676_0654403 Ga0495676_0654403_75_515 142
169 3300047322 Ga0495680_0125668 Ga0495680_0125668_1359_1799 142
170 3300047444 Ga0495675_0088931 Ga0495675_0088931_195_632 142
171 3300047445 Ga0495677_0030518 Ga0495677_0030518_1311_1892 142
172 3300047471 Ga0495684_0008224 Ga0495684_0008224_2893_3333 142
173 3300047471 Ga0495684_0932892 Ga0495684_0932892_12_449 142
174 3300047673 Ga0495593_0024361 Ga0495593_0024361_2374_2811 142
175 3300048088 Ga0495602_0676530 Ga0495602_0676530_158_595 142
176 3300048090 Ga0495615_0290372 Ga0495615_0290372_43_480 142
177 3300048904 Ga0496101_0127586 Ga0496101_0127586_1027_1467 142
178 3300048905 Ga0496102_0193032 Ga0496102_0193032_856_1305 142
179 3300048905 Ga0496102_0391201 Ga0496102_0391201_662_1099 142
180 3300048905 Ga0496102_0956078 Ga0496102_0956078_314_751 142
181 3300048906 Ga0496103_0281742 Ga0496103_0281742_489_926 142
182 3300048907 Ga0496104_0010875 Ga0496104_0010875_769_1209 142
183 3300048908 Ga0496105_0093253 Ga0496105_0093253_1211_1651 142
184 3300048915 Ga0496112_0164403 Ga0496112_0164403_667_1107 142
185 3300048918 Ga0496115_0011105 Ga0496115_0011105_5643_6083 142
186 3300048926 Ga0496123_0057222 Ga0496123_0057222_688_1122 142
187 3300049586 Ga0501070_0000034 Ga0501070_0000034_81522_81956 142
188 3300050491 nmdc:mga00v17_886910_c1 nmdc:mga00v17_886910_c1_117_554 142
189 3300050507 nmdc:mga05p37_2250218_c1 nmdc:mga05p37_2250218_c1_23_460 142
190 3300050507 nmdc:mga05p37_292347_c1 nmdc:mga05p37_292347_c1_479_913 142
191 3300050507 nmdc:mga05p37_7324_c1 nmdc:mga05p37_7324_c1_4121_4558 142
192 3300050508 nmdc:mga09592_1041057_c1 nmdc:mga09592_1041057_c1_229_666 142
193 3300050508 nmdc:mga09592_223530_c1 nmdc:mga09592_223530_c1_818_1255 142
194 3300050509 nmdc:mga0qj67_648654_c1 nmdc:mga0qj67_648654_c1_122_559 142
195 3300050510 nmdc:mga06r32_1459976_c1 nmdc:mga06r32_1459976_c1_57_497 142
196 3300050510 nmdc:mga06r32_188217_c1 nmdc:mga06r32_188217_c1_1295_1732 142
197 3300050510 nmdc:mga06r32_454065_c1 nmdc:mga06r32_454065_c1_514_951 142
198 3300050510 nmdc:mga06r32_80097_c1 nmdc:mga06r32_80097_c1_595_1032 142
199 3300050511 nmdc:mga08y16_1141306_c1 nmdc:mga08y16_1141306_c1_37_474 142
200 3300050511 nmdc:mga08y16_11664_c1 nmdc:mga08y16_11664_c1_7029_7466 142
201 3300050511 nmdc:mga08y16_1299503_c1 nmdc:mga08y16_1299503_c1_86_523 142
202 3300050511 nmdc:mga08y16_53577_c1 nmdc:mga08y16_53577_c1_1529_1963 142
203 3300050512 nmdc:mga0n895_1218388_c1 nmdc:mga0n895_1218388_c1_218_652 142
204 3300050512 nmdc:mga0n895_164404_c1 nmdc:mga0n895_164404_c1_199_636 142
205 3300050512 nmdc:mga0n895_526213_c1 nmdc:mga0n895_526213_c1_89_526 142
206 3300050513 nmdc:mga0rr50_606182_c1 nmdc:mga0rr50_606182_c1_38_466 142
207 3300050515 nmdc:mga0a205_332620_c1 nmdc:mga0a205_332620_c1_211_648 142
208 3300050515 nmdc:mga0a205_9925_c1 nmdc:mga0a205_9925_c1_4322_4759 142
209 3300053077 Ga0495601_0165696 Ga0495601_0165696_699_1136 142
210 3300053077 Ga0495601_0338717 Ga0495601_0338717_488_919 142
211 3300053077 Ga0495601_0341615 Ga0495601_0341615_260_700 142
212 3300053085 Ga0495619_0038895 Ga0495619_0038895_789_1226 142
213 3300005330 Ga0070690_100373933 Ga0070690_1003739332 143
214 3300005336 Ga0070680_100078719 Ga0070680_1000787193 143
215 3300005445 Ga0070708_100597147 Ga0070708_1005971472 143
216 3300005467 Ga0070706_100517004 Ga0070706_1005170041 143
217 3300005467 Ga0070706_100611951 Ga0070706_1006119512 143
218 3300005468 Ga0070707_100928908 Ga0070707_1009289082 143
219 3300005471 Ga0070698_100661976 Ga0070698_1006619762 143
220 3300005518 Ga0070699_100000805 Ga0070699_10000080520 143
221 3300005530 Ga0070679_100503126 Ga0070679_1005031262 143
222 3300005546 Ga0070696_100083788 Ga0070696_1000837882 143
223 3300005549 Ga0070704_100013491 Ga0070704_1000134911 143
224 3300005718 Ga0068866_10130013 Ga0068866_101300132 143
225 3300006871 Ga0075434_101314150 Ga0075434_1013141502 143
226 3300006914 Ga0075436_100067414 Ga0075436_1000674143 143
227 3300006914 Ga0075436_100099996 Ga0075436_1000999963 143
228 3300006914 Ga0075436_100346388 Ga0075436_1003463881 143
229 3300007076 Ga0075435_101162429 Ga0075435_1011624292 143
230 3300009148 Ga0105243_10074659 Ga0105243_100746592 143
231 3300009148 Ga0105243_10173929 Ga0105243_101739292 143
232 3300009174 Ga0105241_11333572 Ga0105241_113335721 143
233 3300013297 Ga0157378_10331098 Ga0157378_103310982 143
234 3300025910 Ga0207684_10291849 Ga0207684_102918491 143
235 3300025935 Ga0207709_10191329 Ga0207709_101913292 143
236 3300046500 Ga0495596_0041253 Ga0495596_0041253_1149_1589 143
237 3300046537 Ga0495598_0125918 Ga0495598_0125918_147_587 143
238 3300048905 Ga0496102_0968848 Ga0496102_0968848_50_481 143
239 3300048905 Ga0496102_1266692 Ga0496102_1266692_198_629 143
240 3300048906 Ga0496103_0027742 Ga0496103_0027742_2117_2548 143
241 3300048908 Ga0496105_0150162 Ga0496105_0150162_1078_1509 143
242 3300048909 Ga0496106_0127153 Ga0496106_0127153_1555_1986 143
243 3300048910 Ga0496107_0224933 Ga0496107_0224933_903_1334 143
244 3300050514 nmdc:mga08x19_113065_c1 nmdc:mga08x19_113065_c1_933_1376 143
245 3300050514 nmdc:mga08x19_279539_c1 nmdc:mga08x19_279539_c1_404_847 143
246 3300001976 JGI24752J21851_1060663 JGI24752J21851_10606631 144
247 3300002155 JGI24033J26618_1055161 JGI24033J26618_10551611 144
248 3300003760 Ga0055527_1000032 Ga0055527_100003239 144
249 3300003760 Ga0055527_1000091 Ga0055527_100009139 144
250 3300003762 Ga0055542_1000216 Ga0055542_100021639 144
251 3300003763 Ga0055529_1000234 Ga0055529_100023439 144
252 3300005295 Ga0065707_10283270 Ga0065707_102832702 144
253 3300005329 Ga0070683_100025354 Ga0070683_1000253548 144
254 3300005329 Ga0070683_100725288 Ga0070683_1007252881 144
255 3300005330 Ga0070690_100240978 Ga0070690_1002409783 144
256 3300005331 Ga0070670_100674356 Ga0070670_1006743562 144
257 3300005334 Ga0068869_100667522 Ga0068869_1006675222 144
258 3300005338 Ga0068868_101187130 Ga0068868_1011871301 144
259 3300005338 Ga0068868_101235638 Ga0068868_1012356381 144
260 3300005340 Ga0070689_101909920 Ga0070689_1019099201 144
261 3300005341 Ga0070691_10484955 Ga0070691_104849551 144
262 3300005343 Ga0070687_100339295 Ga0070687_1003392951 144
263 3300005345 Ga0070692_10031015 Ga0070692_100310154 144
264 3300005345 Ga0070692_10039551 Ga0070692_100395512 144
265 3300005345 Ga0070692_10908690 Ga0070692_109086901 144
266 3300005347 Ga0070668_100684008 Ga0070668_1006840081 144
267 3300005347 Ga0070668_101371733 Ga0070668_1013717331 144
268 3300005354 Ga0070675_100857826 Ga0070675_1008578262 144
269 3300005355 Ga0070671_100068116 Ga0070671_1000681164 144
270 3300005356 Ga0070674_100061623 Ga0070674_1000616232 144
271 3300005356 Ga0070674_100136395 Ga0070674_1001363952 144
272 3300005356 Ga0070674_100175523 Ga0070674_1001755232 144
273 3300005356 Ga0070674_100445367 Ga0070674_1004453672 144
274 3300005364 Ga0070673_100531478 Ga0070673_1005314782 144
275 3300005366 Ga0070659_100625674 Ga0070659_1006256742 144
276 3300005366 Ga0070659_101299038 Ga0070659_1012990381 144
277 3300005406 Ga0070703_10003635 Ga0070703_100036354 144
278 3300005435 Ga0070714_100033116 Ga0070714_1000331162 144
279 3300005435 Ga0070714_100065607 Ga0070714_1000656072 144
280 3300005435 Ga0070714_100156418 Ga0070714_1001564183 144
281 3300005435 Ga0070714_100265212 Ga0070714_1002652123 144
282 3300005435 Ga0070714_100378226 Ga0070714_1003782262 144
283 3300005435 Ga0070714_100818319 Ga0070714_1008183192 144
284 3300005435 Ga0070714_100996912 Ga0070714_1009969122 144
285 3300005435 Ga0070714_102361509 Ga0070714_1023615091 144
286 3300005436 Ga0070713_100086693 Ga0070713_1000866933 144
287 3300005436 Ga0070713_100244894 Ga0070713_1002448941 144
288 3300005436 Ga0070713_100253594 Ga0070713_1002535942 144
289 3300005436 Ga0070713_100680425 Ga0070713_1006804252 144
290 3300005436 Ga0070713_101214766 Ga0070713_1012147661 144
291 3300005438 Ga0070701_10122361 Ga0070701_101223611 144
292 3300005438 Ga0070701_10305595 Ga0070701_103055951 144
293 3300005438 Ga0070701_10907399 Ga0070701_109073991 144
294 3300005440 Ga0070705_100007053 Ga0070705_1000070532 144
295 3300005440 Ga0070705_100112137 Ga0070705_1001121373 144
296 3300005440 Ga0070705_100320949 Ga0070705_1003209491 144
297 3300005440 Ga0070705_100560240 Ga0070705_1005602402 144
298 3300005441 Ga0070700_100113325 Ga0070700_1001133252 144
299 3300005441 Ga0070700_100410536 Ga0070700_1004105362 144
300 3300005441 Ga0070700_100495448 Ga0070700_1004954482 144
301 3300005441 Ga0070700_101286267 Ga0070700_1012862671 144
302 3300005444 Ga0070694_100032696 Ga0070694_1000326963 144
303 3300005444 Ga0070694_100081245 Ga0070694_1000812453 144
304 3300005444 Ga0070694_100086445 Ga0070694_1000864453 144
305 3300005444 Ga0070694_100092380 Ga0070694_1000923802 144
306 3300005444 Ga0070694_100793940 Ga0070694_1007939401 144
307 3300005445 Ga0070708_100001281 Ga0070708_10000128115 144
308 3300005445 Ga0070708_100001720 Ga0070708_1000017204 144
309 3300005445 Ga0070708_100002506 Ga0070708_10000250611 144
310 3300005445 Ga0070708_100016020 Ga0070708_1000160206 144
311 3300005445 Ga0070708_100019788 Ga0070708_1000197883 144
312 3300005445 Ga0070708_100031340 Ga0070708_1000313402 144
313 3300005445 Ga0070708_100036593 Ga0070708_1000365935 144
314 3300005445 Ga0070708_100058163 Ga0070708_1000581633 144
315 3300005445 Ga0070708_100069824 Ga0070708_1000698243 144
316 3300005445 Ga0070708_100093904 Ga0070708_1000939042 144
317 3300005445 Ga0070708_100111438 Ga0070708_1001114383 144
318 3300005445 Ga0070708_100116352 Ga0070708_1001163521 144
319 3300005445 Ga0070708_100116556 Ga0070708_1001165563 144
320 3300005445 Ga0070708_100123730 Ga0070708_1001237303 144
321 3300005445 Ga0070708_100148423 Ga0070708_1001484231 144
322 3300005445 Ga0070708_100169282 Ga0070708_1001692822 144
323 3300005445 Ga0070708_100326565 Ga0070708_1003265653 144
324 3300005445 Ga0070708_100329136 Ga0070708_1003291362 144
325 3300005445 Ga0070708_100378973 Ga0070708_1003789732 144
326 3300005445 Ga0070708_100481776 Ga0070708_1004817762 144
327 3300005445 Ga0070708_100482530 Ga0070708_1004825302 144
328 3300005445 Ga0070708_100664196 Ga0070708_1006641963 144
329 3300005445 Ga0070708_101137298 Ga0070708_1011372981 144
330 3300005445 Ga0070708_101481238 Ga0070708_1014812382 144
331 3300005445 Ga0070708_101647589 Ga0070708_1016475891 144
332 3300005455 Ga0070663_101249291 Ga0070663_1012492912 144
333 3300005456 Ga0070678_100025557 Ga0070678_1000255575 144
334 3300005456 Ga0070678_100896143 Ga0070678_1008961432 144
335 3300005456 Ga0070678_101357755 Ga0070678_1013577552 144
336 3300005457 Ga0070662_100225858 Ga0070662_1002258582 144
337 3300005457 Ga0070662_100583459 Ga0070662_1005834591 144
338 3300005459 Ga0068867_100294243 Ga0068867_1002942432 144
339 3300005459 Ga0068867_100640943 Ga0068867_1006409431 144
340 3300005459 Ga0068867_101305548 Ga0068867_1013055482 144
341 3300005467 Ga0070706_100000355 Ga0070706_1000003557 144
342 3300005467 Ga0070706_100000937 Ga0070706_1000009374 144
343 3300005467 Ga0070706_100001208 Ga0070706_10000120825 144
344 3300005467 Ga0070706_100001868 Ga0070706_1000018688 144
345 3300005467 Ga0070706_100003296 Ga0070706_1000032963 144
346 3300005467 Ga0070706_100004086 Ga0070706_10000408611 144
347 3300005467 Ga0070706_100005466 Ga0070706_10000546612 144
348 3300005467 Ga0070706_100008455 Ga0070706_1000084556 144
349 3300005467 Ga0070706_100009642 Ga0070706_1000096425 144
350 3300005467 Ga0070706_100017130 Ga0070706_1000171305 144
351 3300005467 Ga0070706_100023927 Ga0070706_1000239274 144
352 3300005467 Ga0070706_100024051 Ga0070706_1000240512 144
353 3300005467 Ga0070706_100029036 Ga0070706_1000290362 144
354 3300005467 Ga0070706_100043904 Ga0070706_1000439042 144
355 3300005467 Ga0070706_100070652 Ga0070706_1000706522 144
356 3300005467 Ga0070706_100089062 Ga0070706_1000890622 144
357 3300005467 Ga0070706_100105028 Ga0070706_1001050282 144
358 3300005467 Ga0070706_100114210 Ga0070706_1001142102 144
359 3300005467 Ga0070706_100121291 Ga0070706_1001212914 144
360 3300005467 Ga0070706_100155284 Ga0070706_1001552843 144
361 3300005467 Ga0070706_100194968 Ga0070706_1001949682 144
362 3300005467 Ga0070706_100256929 Ga0070706_1002569292 144
363 3300005467 Ga0070706_100321619 Ga0070706_1003216192 144
364 3300005467 Ga0070706_100760183 Ga0070706_1007601832 144
365 3300005467 Ga0070706_100979686 Ga0070706_1009796861 144
366 3300005467 Ga0070706_101192515 Ga0070706_1011925152 144
367 3300005468 Ga0070707_100000762 Ga0070707_10000076215 144
368 3300005468 Ga0070707_100000793 Ga0070707_1000007937 144
369 3300005468 Ga0070707_100003826 Ga0070707_10000382611 144
370 3300005468 Ga0070707_100006232 Ga0070707_1000062322 144
371 3300005468 Ga0070707_100008729 Ga0070707_1000087294 144
372 3300005468 Ga0070707_100010515 Ga0070707_1000105156 144
373 3300005468 Ga0070707_100017247 Ga0070707_1000172475 144
374 3300005468 Ga0070707_100018505 Ga0070707_1000185054 144
375 3300005468 Ga0070707_100020220 Ga0070707_1000202205 144
376 3300005468 Ga0070707_100034004 Ga0070707_1000340043 144
377 3300005468 Ga0070707_100037785 Ga0070707_1000377852 144
378 3300005468 Ga0070707_100052540 Ga0070707_1000525403 144
379 3300005468 Ga0070707_100067641 Ga0070707_1000676412 144
380 3300005468 Ga0070707_100068793 Ga0070707_1000687932 144
381 3300005468 Ga0070707_100073346 Ga0070707_1000733462 144
382 3300005468 Ga0070707_100102269 Ga0070707_1001022693 144
383 3300005468 Ga0070707_100103892 Ga0070707_1001038924 144
384 3300005468 Ga0070707_100119600 Ga0070707_1001196002 144
385 3300005468 Ga0070707_100204939 Ga0070707_1002049393 144
386 3300005468 Ga0070707_100210348 Ga0070707_1002103483 144
387 3300005468 Ga0070707_100211856 Ga0070707_1002118562 144
388 3300005468 Ga0070707_100263776 Ga0070707_1002637763 144
389 3300005468 Ga0070707_100275584 Ga0070707_1002755842 144
390 3300005468 Ga0070707_100283545 Ga0070707_1002835452 144
391 3300005468 Ga0070707_100288035 Ga0070707_1002880353 144
392 3300005468 Ga0070707_100296061 Ga0070707_1002960612 144
393 3300005468 Ga0070707_100494691 Ga0070707_1004946912 144
394 3300005468 Ga0070707_100520646 Ga0070707_1005206463 144
395 3300005468 Ga0070707_100698561 Ga0070707_1006985611 144
396 3300005468 Ga0070707_100723383 Ga0070707_1007233832 144
397 3300005468 Ga0070707_100738781 Ga0070707_1007387812 144
398 3300005468 Ga0070707_100835976 Ga0070707_1008359761 144
399 3300005468 Ga0070707_100891925 Ga0070707_1008919252 144
400 3300005468 Ga0070707_100954612 Ga0070707_1009546122 144
401 3300005468 Ga0070707_101018576 Ga0070707_1010185762 144
402 3300005468 Ga0070707_101273599 Ga0070707_1012735992 144
403 3300005468 Ga0070707_101370771 Ga0070707_1013707712 144
404 3300005468 Ga0070707_101378656 Ga0070707_1013786562 144
405 3300005468 Ga0070707_101687330 Ga0070707_1016873301 144
406 3300005471 Ga0070698_100000448 Ga0070698_10000044817 144
407 3300005471 Ga0070698_100001509 Ga0070698_1000015091 144
408 3300005471 Ga0070698_100004279 Ga0070698_10000427911 144
409 3300005471 Ga0070698_100005770 Ga0070698_1000057705 144
410 3300005471 Ga0070698_100015160 Ga0070698_1000151604 144
411 3300005471 Ga0070698_100018758 Ga0070698_1000187585 144
412 3300005471 Ga0070698_100020451 Ga0070698_1000204515 144
413 3300005471 Ga0070698_100027998 Ga0070698_1000279984 144
414 3300005471 Ga0070698_100030365 Ga0070698_1000303654 144
415 3300005471 Ga0070698_100034878 Ga0070698_1000348784 144
416 3300005471 Ga0070698_100047358 Ga0070698_1000473582 144
417 3300005471 Ga0070698_100072371 Ga0070698_1000723715 144
418 3300005471 Ga0070698_100072567 Ga0070698_1000725673 144
419 3300005471 Ga0070698_100083498 Ga0070698_1000834983 144
420 3300005471 Ga0070698_100124437 Ga0070698_1001244373 144
421 3300005471 Ga0070698_100161743 Ga0070698_1001617432 144
422 3300005471 Ga0070698_100176031 Ga0070698_1001760312 144
423 3300005471 Ga0070698_100225157 Ga0070698_1002251573 144
424 3300005471 Ga0070698_100288059 Ga0070698_1002880592 144
425 3300005471 Ga0070698_100297529 Ga0070698_1002975292 144
426 3300005471 Ga0070698_100333414 Ga0070698_1003334142 144
427 3300005471 Ga0070698_100337157 Ga0070698_1003371572 144
428 3300005471 Ga0070698_100476027 Ga0070698_1004760272 144
429 3300005471 Ga0070698_100507252 Ga0070698_1005072521 144
430 3300005471 Ga0070698_100694404 Ga0070698_1006944042 144
431 3300005471 Ga0070698_100706197 Ga0070698_1007061971 144
432 3300005471 Ga0070698_100823749 Ga0070698_1008237492 144
433 3300005471 Ga0070698_100984801 Ga0070698_1009848011 144
434 3300005471 Ga0070698_101543788 Ga0070698_1015437881 144
435 3300005518 Ga0070699_100000806 Ga0070699_10000080622 144
436 3300005518 Ga0070699_100001002 Ga0070699_10000100223 144
437 3300005518 Ga0070699_100002301 Ga0070699_1000023013 144
438 3300005518 Ga0070699_100002562 Ga0070699_1000025626 144
439 3300005518 Ga0070699_100027236 Ga0070699_1000272365 144
440 3300005518 Ga0070699_100034048 Ga0070699_1000340483 144
441 3300005518 Ga0070699_100072460 Ga0070699_1000724603 144
442 3300005518 Ga0070699_100073844 Ga0070699_1000738443 144
443 3300005518 Ga0070699_100113091 Ga0070699_1001130911 144
444 3300005518 Ga0070699_100142317 Ga0070699_1001423173 144
445 3300005518 Ga0070699_100157927 Ga0070699_1001579274 144
446 3300005518 Ga0070699_100160050 Ga0070699_1001600503 144
447 3300005518 Ga0070699_100162891 Ga0070699_1001628912 144
448 3300005518 Ga0070699_100209132 Ga0070699_1002091323 144
449 3300005518 Ga0070699_100245449 Ga0070699_1002454492 144
450 3300005518 Ga0070699_100252521 Ga0070699_1002525213 144
451 3300005518 Ga0070699_100262920 Ga0070699_1002629201 144
452 3300005518 Ga0070699_100278332 Ga0070699_1002783322 144
453 3300005518 Ga0070699_100374023 Ga0070699_1003740231 144
454 3300005518 Ga0070699_100428107 Ga0070699_1004281072 144
455 3300005518 Ga0070699_100614139 Ga0070699_1006141392 144
456 3300005518 Ga0070699_100703201 Ga0070699_1007032012 144
457 3300005518 Ga0070699_100843735 Ga0070699_1008437351 144
458 3300005518 Ga0070699_100910556 Ga0070699_1009105562 144
459 3300005518 Ga0070699_100921109 Ga0070699_1009211091 144
460 3300005518 Ga0070699_101148150 Ga0070699_1011481501 144
461 3300005518 Ga0070699_101507130 Ga0070699_1015071301 144
462 3300005535 Ga0070684_100100508 Ga0070684_1001005083 144
463 3300005536 Ga0070697_100000001 Ga0070697_100000001653 144
464 3300005536 Ga0070697_100000091 Ga0070697_10000009179 144
465 3300005536 Ga0070697_100001138 Ga0070697_10000113817 144
466 3300005536 Ga0070697_100003405 Ga0070697_10000340512 144
467 3300005536 Ga0070697_100013735 Ga0070697_1000137355 144
468 3300005536 Ga0070697_100014014 Ga0070697_1000140147 144
469 3300005536 Ga0070697_100035202 Ga0070697_1000352023 144
470 3300005536 Ga0070697_100113143 Ga0070697_1001131433 144
471 3300005536 Ga0070697_100118383 Ga0070697_1001183832 144
472 3300005536 Ga0070697_100157200 Ga0070697_1001572003 144
473 3300005536 Ga0070697_100163034 Ga0070697_1001630342 144
474 3300005536 Ga0070697_100250655 Ga0070697_1002506552 144
475 3300005536 Ga0070697_100364974 Ga0070697_1003649742 144
476 3300005536 Ga0070697_100366744 Ga0070697_1003667442 144
477 3300005536 Ga0070697_100453299 Ga0070697_1004532992 144
478 3300005536 Ga0070697_100752019 Ga0070697_1007520192 144
479 3300005536 Ga0070697_100784801 Ga0070697_1007848012 144
480 3300005536 Ga0070697_100805120 Ga0070697_1008051202 144
481 3300005545 Ga0070695_100042084 Ga0070695_1000420843 144
482 3300005545 Ga0070695_100089868 Ga0070695_1000898683 144
483 3300005545 Ga0070695_100176422 Ga0070695_1001764221 144
484 3300005545 Ga0070695_100282030 Ga0070695_1002820302 144
485 3300005545 Ga0070695_100407124 Ga0070695_1004071242 144
486 3300005545 Ga0070695_101714729 Ga0070695_1017147291 144
487 3300005546 Ga0070696_100119666 Ga0070696_1001196662 144
488 3300005546 Ga0070696_100151302 Ga0070696_1001513022 144
489 3300005546 Ga0070696_100176578 Ga0070696_1001765782 144
490 3300005546 Ga0070696_100508343 Ga0070696_1005083432 144
491 3300005546 Ga0070696_101044899 Ga0070696_1010448992 144
492 3300005546 Ga0070696_101564741 Ga0070696_1015647411 144
493 3300005546 Ga0070696_101618710 Ga0070696_1016187101 144
494 3300005549 Ga0070704_100004211 Ga0070704_1000042114 144
495 3300005549 Ga0070704_100004802 Ga0070704_10000480210 144
496 3300005549 Ga0070704_100057432 Ga0070704_1000574322 144
497 3300005549 Ga0070704_100273876 Ga0070704_1002738762 144
498 3300005549 Ga0070704_100378470 Ga0070704_1003784702 144
499 3300005549 Ga0070704_100614087 Ga0070704_1006140872 144
500 3300005549 Ga0070704_100867811 Ga0070704_1008678112 144
501 3300005577 Ga0068857_100034650 Ga0068857_1000346502 144
502 3300005577 Ga0068857_100157245 Ga0068857_1001572454 144
503 3300005577 Ga0068857_100234623 Ga0068857_1002346232 144
504 3300005578 Ga0068854_100075271 Ga0068854_1000752712 144
505 3300005614 Ga0068856_100871248 Ga0068856_1008712482 144
506 3300005616 Ga0068852_100376358 Ga0068852_1003763581 144
507 3300005618 Ga0068864_100116724 Ga0068864_1001167243 144
508 3300005618 Ga0068864_100354344 Ga0068864_1003543442 144
509 3300005618 Ga0068864_100477933 Ga0068864_1004779332 144
510 3300005719 Ga0068861_100009800 Ga0068861_1000098009 144
511 3300005719 Ga0068861_100232452 Ga0068861_1002324523 144
512 3300005719 Ga0068861_100595320 Ga0068861_1005953202 144
513 3300005840 Ga0068870_10909465 Ga0068870_109094651 144
514 3300005840 Ga0068870_11078851 Ga0068870_110788511 144
515 3300005841 Ga0068863_100537165 Ga0068863_1005371652 144
516 3300005841 Ga0068863_101728879 Ga0068863_1017288791 144
517 3300005841 Ga0068863_101831051 Ga0068863_1018310512 144
518 3300005842 Ga0068858_100114858 Ga0068858_1001148581 144
519 3300005985 Ga0081539_10002337 Ga0081539_100023372 144
520 3300006028 Ga0070717_10000078 Ga0070717_1000007842 144
521 3300006028 Ga0070717_10005470 Ga0070717_100054704 144
522 3300006028 Ga0070717_10009434 Ga0070717_100094346 144
523 3300006028 Ga0070717_10034108 Ga0070717_100341083 144
524 3300006028 Ga0070717_10051517 Ga0070717_100515173 144
525 3300006028 Ga0070717_10065336 Ga0070717_100653362 144
526 3300006028 Ga0070717_10092109 Ga0070717_100921093 144
527 3300006028 Ga0070717_10129914 Ga0070717_101299143 144
528 3300006028 Ga0070717_10391375 Ga0070717_103913752 144
529 3300006028 Ga0070717_10682940 Ga0070717_106829402 144
530 3300006028 Ga0070717_11753211 Ga0070717_117532111 144
531 3300006038 Ga0075365_10127565 Ga0075365_101275651 144
532 3300006058 Ga0075432_10031665 Ga0075432_100316652 144
533 3300006163 Ga0070715_10218674 Ga0070715_102186742 144
534 3300006173 Ga0070716_100004566 Ga0070716_1000045663 144
535 3300006173 Ga0070716_100030432 Ga0070716_1000304323 144
536 3300006173 Ga0070716_100054229 Ga0070716_1000542293 144
537 3300006173 Ga0070716_100311114 Ga0070716_1003111142 144
538 3300006173 Ga0070716_100868124 Ga0070716_1008681241 144
539 3300006175 Ga0070712_100004266 Ga0070712_1000042662 144
540 3300006175 Ga0070712_100069668 Ga0070712_1000696682 144
541 3300006175 Ga0070712_100094999 Ga0070712_1000949993 144
542 3300006175 Ga0070712_100189248 Ga0070712_1001892481 144
543 3300006175 Ga0070712_100367796 Ga0070712_1003677962 144
544 3300006175 Ga0070712_100852126 Ga0070712_1008521262 144
545 3300006358 Ga0068871_100250162 Ga0068871_1002501623 144
546 3300006358 Ga0068871_101367791 Ga0068871_1013677911 144
547 3300006844 Ga0075428_100014419 Ga0075428_10001441912 144
548 3300006844 Ga0075428_100248935 Ga0075428_1002489352 144
549 3300006844 Ga0075428_100330118 Ga0075428_1003301182 144
550 3300006844 Ga0075428_100810221 Ga0075428_1008102212 144
551 3300006844 Ga0075428_101510144 Ga0075428_1015101441 144
552 3300006846 Ga0075430_100175215 Ga0075430_1001752153 144
553 3300006847 Ga0075431_100210148 Ga0075431_1002101482 144
554 3300006847 Ga0075431_100403679 Ga0075431_1004036792 144
555 3300006847 Ga0075431_100779647 Ga0075431_1007796471 144
556 3300006847 Ga0075431_101199765 Ga0075431_1011997651 144
557 3300006852 Ga0075433_10032631 Ga0075433_100326312 144
558 3300006852 Ga0075433_10291039 Ga0075433_102910392 144
559 3300006852 Ga0075433_10371449 Ga0075433_103714492 144
560 3300006852 Ga0075433_11294707 Ga0075433_112947071 144
561 3300006852 Ga0075433_11974890 Ga0075433_119748901 144
562 3300006871 Ga0075434_100015933 Ga0075434_1000159333 144
563 3300006871 Ga0075434_100021534 Ga0075434_1000215342 144
564 3300006871 Ga0075434_100230026 Ga0075434_1002300262 144
565 3300006871 Ga0075434_100234879 Ga0075434_1002348792 144
566 3300006871 Ga0075434_100548534 Ga0075434_1005485342 144
567 3300006871 Ga0075434_101592477 Ga0075434_1015924772 144
568 3300006871 Ga0075434_101685726 Ga0075434_1016857261 144
569 3300006871 Ga0075434_102078831 Ga0075434_1020788311 144
570 3300006880 Ga0075429_101359648 Ga0075429_1013596481 144
571 3300006881 Ga0068865_100237916 Ga0068865_1002379162 144
572 3300006881 Ga0068865_100381844 Ga0068865_1003818442 144
573 3300006881 Ga0068865_100415425 Ga0068865_1004154252 144
574 3300006881 Ga0068865_100782138 Ga0068865_1007821381 144
575 3300006914 Ga0075436_100031969 Ga0075436_1000319694 144
576 3300006914 Ga0075436_100053527 Ga0075436_1000535272 144
577 3300006914 Ga0075436_100146037 Ga0075436_1001460372 144
578 3300006914 Ga0075436_100326720 Ga0075436_1003267202 144
579 3300006914 Ga0075436_100437866 Ga0075436_1004378662 144
580 3300006914 Ga0075436_100499728 Ga0075436_1004997281 144
581 3300006914 Ga0075436_100569326 Ga0075436_1005693262 144
582 3300006931 Ga0097620_100699736 Ga0097620_1006997362 144
583 3300007076 Ga0075435_100035672 Ga0075435_1000356721 144
584 3300007076 Ga0075435_100093290 Ga0075435_1000932903 144
585 3300007076 Ga0075435_100260853 Ga0075435_1002608532 144
586 3300007076 Ga0075435_100453835 Ga0075435_1004538352 144
587 3300007076 Ga0075435_100464997 Ga0075435_1004649972 144
588 3300007076 Ga0075435_100469068 Ga0075435_1004690682 144
589 3300007265 Ga0099794_10009761 Ga0099794_100097612 144
590 3300009011 Ga0105251_10121122 Ga0105251_101211222 144
591 3300009094 Ga0111539_10089009 Ga0111539_100890092 144
592 3300009094 Ga0111539_10220914 Ga0111539_102209142 144
593 3300009094 Ga0111539_10521842 Ga0111539_105218422 144
594 3300009098 Ga0105245_10060620 Ga0105245_100606204 144
595 3300009098 Ga0105245_10658782 Ga0105245_106587822 144
596 3300009098 Ga0105245_10898693 Ga0105245_108986932 144
597 3300009098 Ga0105245_10907345 Ga0105245_109073451 144
598 3300009101 Ga0105247_10379024 Ga0105247_103790242 144
599 3300009147 Ga0114129_10007918 Ga0114129_100079183 144
600 3300009147 Ga0114129_10072023 Ga0114129_100720234 144
601 3300009147 Ga0114129_10185240 Ga0114129_101852402 144
602 3300009147 Ga0114129_10264924 Ga0114129_102649243 144
603 3300009147 Ga0114129_10351522 Ga0114129_103515222 144
604 3300009147 Ga0114129_10361615 Ga0114129_103616152 144
605 3300009147 Ga0114129_10919516 Ga0114129_109195161 144
606 3300009147 Ga0114129_11069609 Ga0114129_110696092 144
607 3300009147 Ga0114129_11722820 Ga0114129_117228201 144
608 3300009148 Ga0105243_10062331 Ga0105243_100623312 144
609 3300009148 Ga0105243_10366092 Ga0105243_103660923 144
610 3300009148 Ga0105243_10565969 Ga0105243_105659692 144
611 3300009174 Ga0105241_11642247 Ga0105241_116422471 144
612 3300009176 Ga0105242_10036378 Ga0105242_100363785 144
613 3300009176 Ga0105242_10064171 Ga0105242_100641714 144
614 3300009176 Ga0105242_10186921 Ga0105242_101869211 144
615 3300009176 Ga0105242_10463724 Ga0105242_104637242 144
616 3300009176 Ga0105242_10650216 Ga0105242_106502162 144
617 3300009176 Ga0105242_11752391 Ga0105242_117523911 144
618 3300009177 Ga0105248_10039370 Ga0105248_100393706 144
619 3300009553 Ga0105249_11305342 Ga0105249_113053421 144
620 3300010375 Ga0105239_10079574 Ga0105239_100795743 144
621 3300011119 Ga0105246_10147894 Ga0105246_101478942 144
622 3300011119 Ga0105246_10420980 Ga0105246_104209802 144
623 3300011119 Ga0105246_10835859 Ga0105246_108358591 144
624 3300013296 Ga0157374_10498194 Ga0157374_104981942 144
625 3300013296 Ga0157374_10516932 Ga0157374_105169322 144
626 3300013297 Ga0157378_10008857 Ga0157378_100088576 144
627 3300013297 Ga0157378_10069094 Ga0157378_100690945 144
628 3300013297 Ga0157378_10095271 Ga0157378_100952713 144
629 3300013297 Ga0157378_11304838 Ga0157378_113048382 144
630 3300013297 Ga0157378_12059674 Ga0157378_120596741 144
631 3300013306 Ga0163162_10056620 Ga0163162_100566202 144
632 3300013306 Ga0163162_11273827 Ga0163162_112738271 144
633 3300013306 Ga0163162_12707613 Ga0163162_127076131 144
634 3300013307 Ga0157372_10682861 Ga0157372_106828611 144
635 3300013308 Ga0157375_10165078 Ga0157375_101650784 144
636 3300013308 Ga0157375_10303229 Ga0157375_103032292 144
637 3300013308 Ga0157375_10403236 Ga0157375_104032362 144
638 3300013308 Ga0157375_10808797 Ga0157375_108087972 144
639 3300014325 Ga0163163_10775761 Ga0163163_107757612 144
640 3300014325 Ga0163163_11291165 Ga0163163_112911651 144
641 3300014326 Ga0157380_10210813 Ga0157380_102108133 144
642 3300014326 Ga0157380_12404822 Ga0157380_124048221 144
643 3300014326 Ga0157380_12438336 Ga0157380_124383361 144
644 3300014745 Ga0157377_10141281 Ga0157377_101412812 144
645 3300014745 Ga0157377_10374686 Ga0157377_103746862 144
646 3300014968 Ga0157379_10346741 Ga0157379_103467412 144
647 3300014968 Ga0157379_11222073 Ga0157379_112220732 144
648 3300014968 Ga0157379_11372113 Ga0157379_113721131 144
649 3300014968 Ga0157379_11482785 Ga0157379_114827852 144
650 3300014969 Ga0157376_10049673 Ga0157376_100496735 144
651 3300014969 Ga0157376_12833348 Ga0157376_128333481 144
652 3300017792 Ga0163161_10088071 Ga0163161_100880712 144
653 3300024225 Ga0224572_1006688 Ga0224572_10066882 144
654 3300024227 Ga0228598_1013894 Ga0228598_10138941 144
655 3300025228 Ga0209672_100006 Ga0209672_100006119 144
656 3300025229 Ga0209147_100370 Ga0209147_1003703 144
657 3300025242 Ga0209258_101558 Ga0209258_1015584 144
658 3300025254 Ga0209148_1000152 Ga0209148_100015239 144
659 3300025272 Ga0209455_1000134 Ga0209455_100013439 144
660 3300025885 Ga0207653_10020950 Ga0207653_100209503 144
661 3300025898 Ga0207692_10193998 Ga0207692_101939982 144
662 3300025899 Ga0207642_10136974 Ga0207642_101369742 144
663 3300025904 Ga0207647_10046513 Ga0207647_100465134 144
664 3300025905 Ga0207685_10032117 Ga0207685_100321172 144
665 3300025905 Ga0207685_10161047 Ga0207685_101610472 144
666 3300025905 Ga0207685_10298442 Ga0207685_102984421 144
667 3300025910 Ga0207684_10000006 Ga0207684_10000006658 144
668 3300025910 Ga0207684_10000084 Ga0207684_10000084180 144
669 3300025910 Ga0207684_10000583 Ga0207684_1000058312 144
670 3300025910 Ga0207684_10000970 Ga0207684_100009703 144
671 3300025910 Ga0207684_10000988 Ga0207684_100009884 144
672 3300025910 Ga0207684_10001237 Ga0207684_100012375 144
673 3300025910 Ga0207684_10001698 Ga0207684_1000169824 144
674 3300025910 Ga0207684_10003801 Ga0207684_100038014 144
675 3300025910 Ga0207684_10004915 Ga0207684_100049154 144
676 3300025910 Ga0207684_10005817 Ga0207684_100058176 144
677 3300025910 Ga0207684_10007853 Ga0207684_100078536 144
678 3300025910 Ga0207684_10014884 Ga0207684_100148845 144
679 3300025910 Ga0207684_10022460 Ga0207684_100224602 144
680 3300025910 Ga0207684_10041420 Ga0207684_100414202 144
681 3300025910 Ga0207684_10121985 Ga0207684_101219852 144
682 3300025910 Ga0207684_10175478 Ga0207684_101754783 144
683 3300025910 Ga0207684_10221687 Ga0207684_102216872 144
684 3300025910 Ga0207684_10290721 Ga0207684_102907212 144
685 3300025910 Ga0207684_10344372 Ga0207684_103443721 144
686 3300025910 Ga0207684_10351918 Ga0207684_103519182 144
687 3300025910 Ga0207684_10454937 Ga0207684_104549372 144
688 3300025910 Ga0207684_10585385 Ga0207684_105853852 144
689 3300025910 Ga0207684_10683430 Ga0207684_106834302 144
690 3300025910 Ga0207684_10686997 Ga0207684_106869971 144
691 3300025910 Ga0207684_10901021 Ga0207684_109010211 144
692 3300025910 Ga0207684_11205167 Ga0207684_112051672 144
693 3300025913 Ga0207695_11284909 Ga0207695_112849091 144
694 3300025915 Ga0207693_10022761 Ga0207693_100227612 144
695 3300025915 Ga0207693_10054771 Ga0207693_100547713 144
696 3300025915 Ga0207693_10055489 Ga0207693_100554893 144
697 3300025915 Ga0207693_10104924 Ga0207693_101049242 144
698 3300025915 Ga0207693_10116021 Ga0207693_101160212 144
699 3300025916 Ga0207663_10026630 Ga0207663_100266302 144
700 3300025917 Ga0207660_10546659 Ga0207660_105466592 144
701 3300025918 Ga0207662_10250330 Ga0207662_102503302 144
702 3300025922 Ga0207646_10000031 Ga0207646_10000031180 144
703 3300025922 Ga0207646_10000033 Ga0207646_10000033105 144
704 3300025922 Ga0207646_10000063 Ga0207646_1000006318 144
705 3300025922 Ga0207646_10000218 Ga0207646_1000021830 144
706 3300025922 Ga0207646_10000746 Ga0207646_1000074639 144
707 3300025922 Ga0207646_10001161 Ga0207646_1000116125 144
708 3300025922 Ga0207646_10001607 Ga0207646_100016075 144
709 3300025922 Ga0207646_10001916 Ga0207646_1000191619 144
710 3300025922 Ga0207646_10002200 Ga0207646_1000220019 144
711 3300025922 Ga0207646_10024235 Ga0207646_100242352 144
712 3300025922 Ga0207646_10025800 Ga0207646_100258004 144
713 3300025922 Ga0207646_10026423 Ga0207646_100264233 144
714 3300025922 Ga0207646_10032134 Ga0207646_100321343 144
715 3300025922 Ga0207646_10034230 Ga0207646_100342304 144
716 3300025922 Ga0207646_10037181 Ga0207646_100371817 144
717 3300025922 Ga0207646_10037700 Ga0207646_100377003 144
718 3300025922 Ga0207646_10045604 Ga0207646_100456043 144
719 3300025922 Ga0207646_10055797 Ga0207646_100557972 144
720 3300025922 Ga0207646_10063357 Ga0207646_100633572 144
721 3300025922 Ga0207646_10067041 Ga0207646_100670412 144
722 3300025922 Ga0207646_10069049 Ga0207646_100690493 144
723 3300025922 Ga0207646_10114490 Ga0207646_101144902 144
724 3300025922 Ga0207646_10139665 Ga0207646_101396653 144
725 3300025922 Ga0207646_10142933 Ga0207646_101429332 144
726 3300025922 Ga0207646_10177334 Ga0207646_101773343 144
727 3300025922 Ga0207646_10248607 Ga0207646_102486072 144
728 3300025922 Ga0207646_10252825 Ga0207646_102528252 144
729 3300025922 Ga0207646_10275126 Ga0207646_102751263 144
730 3300025922 Ga0207646_10356479 Ga0207646_103564792 144
731 3300025922 Ga0207646_10367298 Ga0207646_103672982 144
732 3300025922 Ga0207646_10460877 Ga0207646_104608771 144
733 3300025922 Ga0207646_10587629 Ga0207646_105876291 144
734 3300025922 Ga0207646_10758200 Ga0207646_107582001 144
735 3300025922 Ga0207646_10902467 Ga0207646_109024671 144
736 3300025922 Ga0207646_11680241 Ga0207646_116802411 144
737 3300025925 Ga0207650_10213733 Ga0207650_102137331 144
738 3300025925 Ga0207650_10375661 Ga0207650_103756613 144
739 3300025926 Ga0207659_10578244 Ga0207659_105782442 144
740 3300025927 Ga0207687_10302967 Ga0207687_103029672 144
741 3300025927 Ga0207687_11138409 Ga0207687_111384092 144
742 3300025927 Ga0207687_11212068 Ga0207687_112120681 144
743 3300025928 Ga0207700_10031452 Ga0207700_100314523 144
744 3300025928 Ga0207700_10202829 Ga0207700_102028293 144
745 3300025928 Ga0207700_10829382 Ga0207700_108293822 144
746 3300025929 Ga0207664_10019469 Ga0207664_100194696 144
747 3300025929 Ga0207664_10032019 Ga0207664_100320193 144
748 3300025929 Ga0207664_10032521 Ga0207664_100325215 144
749 3300025929 Ga0207664_10095880 Ga0207664_100958801 144
750 3300025929 Ga0207664_10263581 Ga0207664_102635812 144
751 3300025929 Ga0207664_11037786 Ga0207664_110377861 144
752 3300025929 Ga0207664_11045222 Ga0207664_110452221 144
753 3300025931 Ga0207644_10424783 Ga0207644_104247831 144
754 3300025932 Ga0207690_10328242 Ga0207690_103282422 144
755 3300025932 Ga0207690_10765447 Ga0207690_107654472 144
756 3300025933 Ga0207706_10527600 Ga0207706_105276001 144
757 3300025933 Ga0207706_10680600 Ga0207706_106806002 144
758 3300025933 Ga0207706_10857952 Ga0207706_108579522 144
759 3300025934 Ga0207686_10006047 Ga0207686_100060476 144
760 3300025935 Ga0207709_10061332 Ga0207709_100613322 144
761 3300025935 Ga0207709_10074201 Ga0207709_100742014 144
762 3300025935 Ga0207709_10192779 Ga0207709_101927792 144
763 3300025937 Ga0207669_10020784 Ga0207669_100207844 144
764 3300025937 Ga0207669_10239409 Ga0207669_102394092 144
765 3300025937 Ga0207669_10545223 Ga0207669_105452232 144
766 3300025938 Ga0207704_10139516 Ga0207704_101395162 144
767 3300025939 Ga0207665_10021842 Ga0207665_100218425 144
768 3300025939 Ga0207665_10026452 Ga0207665_100264523 144
769 3300025939 Ga0207665_10065715 Ga0207665_100657153 144
770 3300025939 Ga0207665_10117335 Ga0207665_101173352 144
771 3300025939 Ga0207665_10156542 Ga0207665_101565422 144
772 3300025941 Ga0207711_10273215 Ga0207711_102732152 144
773 3300025942 Ga0207689_10096197 Ga0207689_100961973 144
774 3300025944 Ga0207661_10052193 Ga0207661_100521931 144
775 3300025960 Ga0207651_11293948 Ga0207651_112939481 144
776 3300025960 Ga0207651_11736826 Ga0207651_117368262 144
777 3300025961 Ga0207712_10024455 Ga0207712_100244553 144
778 3300025961 Ga0207712_10175325 Ga0207712_101753253 144
779 3300025961 Ga0207712_10424986 Ga0207712_104249862 144
780 3300025981 Ga0207640_10264706 Ga0207640_102647062 144
781 3300025986 Ga0207658_10321818 Ga0207658_103218182 144
782 3300026023 Ga0207677_10294914 Ga0207677_102949142 144
783 3300026023 Ga0207677_10333263 Ga0207677_103332632 144
784 3300026035 Ga0207703_10048549 Ga0207703_100485495 144
785 3300026075 Ga0207708_10224470 Ga0207708_102244703 144
786 3300026075 Ga0207708_10306716 Ga0207708_103067162 144
787 3300026075 Ga0207708_10456355 Ga0207708_104563552 144
788 3300026075 Ga0207708_10922032 Ga0207708_109220322 144
789 3300026075 Ga0207708_11253233 Ga0207708_112532332 144
790 3300026075 Ga0207708_11757772 Ga0207708_117577721 144
791 3300026089 Ga0207648_10013776 Ga0207648_100137762 144
792 3300026089 Ga0207648_10387177 Ga0207648_103871771 144
793 3300026089 Ga0207648_11678580 Ga0207648_116785801 144
794 3300026095 Ga0207676_10227056 Ga0207676_102270562 144
795 3300026095 Ga0207676_10542781 Ga0207676_105427812 144
796 3300026095 Ga0207676_11165855 Ga0207676_111658552 144
797 3300026116 Ga0207674_10154834 Ga0207674_101548344 144
798 3300026116 Ga0207674_10249365 Ga0207674_102493652 144
799 3300026118 Ga0207675_100018630 Ga0207675_1000186303 144
800 3300026118 Ga0207675_100376962 Ga0207675_1003769622 144
801 3300026118 Ga0207675_101002978 Ga0207675_1010029781 144
802 3300026118 Ga0207675_101064474 Ga0207675_1010644741 144
803 3300026121 Ga0207683_10054598 Ga0207683_100545985 144
804 3300026121 Ga0207683_10176333 Ga0207683_101763332 144
805 3300026121 Ga0207683_10501124 Ga0207683_105011242 144
806 3300026121 Ga0207683_11245635 Ga0207683_112456351 144
807 3300026142 Ga0207698_12570365 Ga0207698_125703651 144
808 3300027671 Ga0209588_1000068 Ga0209588_10000685 144
809 3300027671 Ga0209588_1057541 Ga0209588_10575412 144
810 3300027907 Ga0207428_10005408 Ga0207428_1000540816 144
811 3300027907 Ga0207428_10006297 Ga0207428_100062976 144
812 3300027907 Ga0207428_10093794 Ga0207428_100937943 144
813 3300027907 Ga0207428_11219774 Ga0207428_112197741 144
814 3300028379 Ga0268266_11212788 Ga0268266_112127882 144
815 3300028556 Ga0265337_1001280 Ga0265337_100128010 144
816 3300028558 Ga0265326_10000946 Ga0265326_100009467 144
817 3300028563 Ga0265319_1001192 Ga0265319_10011928 144
818 3300028573 Ga0265334_10002226 Ga0265334_100022269 144
819 3300028653 Ga0265323_10017550 Ga0265323_100175504 144
820 3300028654 Ga0265322_10024912 Ga0265322_100249123 144
821 3300028666 Ga0265336_10006771 Ga0265336_100067714 144
822 3300028800 Ga0265338_10003705 Ga0265338_1000370515 144
823 3300029957 Ga0265324_10008561 Ga0265324_100085615 144
824 3300030760 Ga0265762_1026280 Ga0265762_10262802 144
825 3300031090 Ga0265760_10188056 Ga0265760_101880562 144
826 3300031238 Ga0265332_10002916 Ga0265332_100029165 144
827 3300031240 Ga0265320_10003514 Ga0265320_1000351410 144
828 3300031241 Ga0265325_10068831 Ga0265325_100688312 144
829 3300031241 Ga0265325_10547522 Ga0265325_105475221 144
830 3300031247 Ga0265340_10001257 Ga0265340_100012576 144
831 3300031249 Ga0265339_10005329 Ga0265339_100053298 144
832 3300031249 Ga0265339_10215050 Ga0265339_102150502 144
833 3300031250 Ga0265331_10165003 Ga0265331_101650031 144
834 3300031595 Ga0265313_10005391 Ga0265313_100053914 144
835 3300031711 Ga0265314_10014104 Ga0265314_100141042 144
836 3300031711 Ga0265314_10033265 Ga0265314_100332653 144
837 3300031712 Ga0265342_10004204 Ga0265342_100042044 144
838 3300031712 Ga0265342_10004500 Ga0265342_100045007 144
839 3300035113 Ga0373936_0100922 Ga0373936_0100922_755_1195 144
840 3300035170 Ga0373943_0123911 Ga0373943_0123911_475_915 144
841 3300035171 Ga0373946_0277237 Ga0373946_0277237_241_681 144
842 3300035410 Ga0373924_0124290 Ga0373924_0124290_221_661 144
843 3300035725 Ga0373947_0302389 Ga0373947_0302389_336_782 144
844 3300035725 Ga0373947_1153116 Ga0373947_1153116_59_511 144
845 3300036401 Ga0373937_0409024 Ga0373937_0409024_280_720 144
846 3300037068 Ga0373925_0019090 Ga0373925_0019090_3423_3875 144
847 3300037471 Ga0395905_0594055 Ga0395905_0594055_123_566 144
848 3300042876 Ga0451577_1259367 Ga0451577_1259367_34_486 144
849 3300046452 Ga0495617_267426 Ga0495617_267426_21_467 144
850 3300046453 Ga0495627_069833 Ga0495627_069833_403_846 144
851 3300046455 Ga0495603_0038524 Ga0495603_0038524_2208_2651 144
852 3300046455 Ga0495603_0455384 Ga0495603_0455384_220_663 144
853 3300046459 Ga0495629_0082498 Ga0495629_0082498_316_759 144
854 3300046462 Ga0495651_0227599 Ga0495651_0227599_677_1117 144
855 3300046463 Ga0495653_0114589 Ga0495653_0114589_901_1341 144
856 3300046463 Ga0495653_0209400 Ga0495653_0209400_187_630 144
857 3300046474 Ga0495605_0204601 Ga0495605_0204601_146_631 144
858 3300046475 Ga0495639_0109488 Ga0495639_0109488_302_745 144
859 3300046476 Ga0495662_0066859 Ga0495662_0066859_768_1211 144
860 3300046477 Ga0495664_0759899 Ga0495664_0759899_87_530 144
861 3300046491 Ga0495584_0309855 Ga0495584_0309855_162_602 144
862 3300046492 Ga0495585_0084220 Ga0495585_0084220_206_652 144
863 3300046499 Ga0495594_0827815 Ga0495594_0827815_19_462 144
864 3300046501 Ga0495607_0123121 Ga0495607_0123121_645_1091 144
865 3300046514 Ga0495618_0156238 Ga0495618_0156238_203_643 144
866 3300046514 Ga0495618_0461453 Ga0495618_0461453_47_490 144
867 3300046516 Ga0495628_0533023 Ga0495628_0533023_52_492 144
868 3300046516 Ga0495628_0885596 Ga0495628_0885596_85_528 144
869 3300046517 Ga0495630_0204261 Ga0495630_0204261_657_1100 144
870 3300046523 Ga0495644_0007487 Ga0495644_0007487_363_848 144
871 3300046523 Ga0495644_0057437 Ga0495644_0057437_928_1401 144
872 3300046525 Ga0495663_0042186 Ga0495663_0042186_157_603 144
873 3300046528 Ga0495642_0174042 Ga0495642_0174042_431_871 144
874 3300046530 Ga0495654_0404509 Ga0495654_0404509_43_489 144
875 3300046536 Ga0495587_0315844 Ga0495587_0315844_308_751 144
876 3300046537 Ga0495598_0271193 Ga0495598_0271193_13_453 144
877 3300046539 Ga0495621_0065667 Ga0495621_0065667_789_1235 144
878 3300046542 Ga0495597_0401702 Ga0495597_0401702_40_480 144
879 3300046558 Ga0495633_0352874 Ga0495633_0352874_211_654 144
880 3300046559 Ga0495667_0037816 Ga0495667_0037816_733_1173 144
881 3300046559 Ga0495667_0358315 Ga0495667_0358315_61_504 144
882 3300046615 Ga0495656_0015839 Ga0495656_0015839_597_1043 144
883 3300046615 Ga0495656_0055583 Ga0495656_0055583_611_1147 144
884 3300046616 Ga0495668_0435829 Ga0495668_0435829_201_647 144
885 3300046642 Ga0495634_0274119 Ga0495634_0274119_112_552 144
886 3300046642 Ga0495634_0359635 Ga0495634_0359635_61_504 144
887 3300046648 Ga0495611_0311491 Ga0495611_0311491_173_709 144
888 3300046648 Ga0495611_0492798 Ga0495611_0492798_32_478 144
889 3300046663 Ga0495635_0010045 Ga0495635_0010045_6054_6494 144
890 3300046664 Ga0495659_0107840 Ga0495659_0107840_560_1006 144
891 3300046665 Ga0495661_0172181 Ga0495661_0172181_32_472 144
892 3300046675 Ga0495657_0062362 Ga0495657_0062362_297_737 144
893 3300046683 Ga0495658_0561499 Ga0495658_0561499_236_679 144
894 3300046690 Ga0495624_0670535 Ga0495624_0670535_85_528 144
895 3300046691 Ga0495670_0002276 Ga0495670_0002276_1314_1799 144
896 3300046691 Ga0495670_0039216 Ga0495670_0039216_232_678 144
897 3300046794 Ga0495589_0081179 Ga0495589_0081179_1053_1499 144
898 3300046794 Ga0495589_0086660 Ga0495589_0086660_898_1341 144
899 3300046794 Ga0495589_0264253 Ga0495589_0264253_237_680 144
900 3300046810 Ga0495660_0412022 Ga0495660_0412022_58_504 144
901 3300047319 Ga0495674_0082204 Ga0495674_0082204_908_1351 144
902 3300047319 Ga0495674_1122333 Ga0495674_1122333_26_505 144
903 3300047321 Ga0495676_0194748 Ga0495676_0194748_148_591 144
904 3300047321 Ga0495676_0323811 Ga0495676_0323811_330_773 144
905 3300047322 Ga0495680_0195483 Ga0495680_0195483_242_682 144
906 3300047447 Ga0495685_113987 Ga0495685_113987_262_747 144
907 3300047471 Ga0495684_0304936 Ga0495684_0304936_160_600 144
908 3300048088 Ga0495602_0853821 Ga0495602_0853821_39_479 144
909 3300048091 Ga0495626_0264769 Ga0495626_0264769_67_513 144
910 3300048903 Ga0496100_0041492 Ga0496100_0041492_1864_2307 144
911 3300048903 Ga0496100_0077464 Ga0496100_0077464_1474_1908 144
912 3300048904 Ga0496101_0075154 Ga0496101_0075154_1464_1898 144
913 3300048904 Ga0496101_0861377 Ga0496101_0861377_251_691 144
914 3300048905 Ga0496102_0019678 Ga0496102_0019678_4713_5147 144
915 3300048905 Ga0496102_0798427 Ga0496102_0798427_365_808 144
916 3300048905 Ga0496102_1189017 Ga0496102_1189017_156_599 144
917 3300048908 Ga0496105_0298365 Ga0496105_0298365_481_915 144
918 3300048909 Ga0496106_0036049 Ga0496106_0036049_1611_2054 144
919 3300048909 Ga0496106_0051870 Ga0496106_0051870_1472_1906 144
920 3300048910 Ga0496107_0005090 Ga0496107_0005090_1666_2109 144
921 3300048910 Ga0496107_0144686 Ga0496107_0144686_1134_1568 144
922 3300048911 Ga0496108_0055149 Ga0496108_0055149_598_1032 144
923 3300048911 Ga0496108_1122195 Ga0496108_1122195_123_566 144
924 3300048912 Ga0496109_0378228 Ga0496109_0378228_657_1100 144
925 3300048913 Ga0496110_0176225 Ga0496110_0176225_610_1044 144
926 3300048914 Ga0496111_0036770 Ga0496111_0036770_987_1421 144
927 3300048914 Ga0496111_0166986 Ga0496111_0166986_586_1020 144
928 3300048915 Ga0496112_0274026 Ga0496112_0274026_678_1112 144
929 3300048916 Ga0496113_0592333 Ga0496113_0592333_254_694 144
930 3300048917 Ga0496114_0010401 Ga0496114_0010401_6779_7213 144
931 3300048918 Ga0496115_0591828 Ga0496115_0591828_428_868 144
932 3300048918 Ga0496115_0683825 Ga0496115_0683825_328_762 144
933 3300048918 Ga0496115_1335582 Ga0496115_1335582_67_510 144
934 3300048929 Ga0496126_0020033 Ga0496126_0020033_5296_5736 144
935 3300049583 Ga0501067_0074277 Ga0501067_0074277_88_531 144
936 3300049584 Ga0501068_0087351 Ga0501068_0087351_849_1289 144
937 3300050491 nmdc:mga00v17_221996_c1 nmdc:mga00v17_221996_c1_166_612 144
938 3300050492 nmdc:mga0yw44_9191_c1 nmdc:mga0yw44_9191_c1_2587_3021 144
939 3300050507 nmdc:mga05p37_137915_c1 nmdc:mga05p37_137915_c1_1877_2320 144
940 3300050507 nmdc:mga05p37_2754_c1 nmdc:mga05p37_2754_c1_3099_3542 144
941 3300050507 nmdc:mga05p37_52031_c1 nmdc:mga05p37_52031_c1_3490_3936 144
942 3300050507 nmdc:mga05p37_719764_c1 nmdc:mga05p37_719764_c1_168_608 144
943 3300050508 nmdc:mga09592_544133_c1 nmdc:mga09592_544133_c1_449_895 144
944 3300050510 nmdc:mga06r32_17228_c1 nmdc:mga06r32_17228_c1_3995_4435 144
945 3300050511 nmdc:mga08y16_20192_c1 nmdc:mga08y16_20192_c1_4432_4872 144
946 3300050511 nmdc:mga08y16_326534_c1 nmdc:mga08y16_326534_c1_83_517 144
947 3300050511 nmdc:mga08y16_67612_c1 nmdc:mga08y16_67612_c1_2551_2985 144
948 3300050512 nmdc:mga0n895_19321_c1 nmdc:mga0n895_19321_c1_246_689 144
949 3300050512 nmdc:mga0n895_81435_c1 nmdc:mga0n895_81435_c1_2198_2638 144
950 3300050512 nmdc:mga0n895_85910_c1 nmdc:mga0n895_85910_c1_462_902 144
951 3300050513 nmdc:mga0rr50_122528_c1 nmdc:mga0rr50_122528_c1_549_989 144
952 3300050513 nmdc:mga0rr50_174797_c1 nmdc:mga0rr50_174797_c1_582_1028 144
953 3300050513 nmdc:mga0rr50_211069_c1 nmdc:mga0rr50_211069_c1_385_837 144
954 3300050513 nmdc:mga0rr50_283552_c1 nmdc:mga0rr50_283552_c1_229_675 144
955 3300050513 nmdc:mga0rr50_322291_c1 nmdc:mga0rr50_322291_c1_675_1121 144
956 3300050513 nmdc:mga0rr50_93269_c1 nmdc:mga0rr50_93269_c1_911_1357 144
957 3300050514 nmdc:mga08x19_20798_c1 nmdc:mga08x19_20798_c1_3474_3914 144
958 3300050514 nmdc:mga08x19_27814_c1 nmdc:mga08x19_27814_c1_1667_2113 144
959 3300050514 nmdc:mga08x19_608098_c1 nmdc:mga08x19_608098_c1_303_749 144
960 3300050514 nmdc:mga08x19_79412_c1 nmdc:mga08x19_79412_c1_422_868 144
961 3300050514 nmdc:mga08x19_94502_c1 nmdc:mga08x19_94502_c1_1078_1524 144
962 3300050515 nmdc:mga0a205_127892_c1 nmdc:mga0a205_127892_c1_343_795 144
963 3300050515 nmdc:mga0a205_131255_c1 nmdc:mga0a205_131255_c1_129_575 144
964 3300050515 nmdc:mga0a205_131805_c1 nmdc:mga0a205_131805_c1_1242_1688 144
965 3300050515 nmdc:mga0a205_256052_c1 nmdc:mga0a205_256052_c1_21_461 144
966 3300050515 nmdc:mga0a205_651512_c1 nmdc:mga0a205_651512_c1_345_785 144
967 3300050515 nmdc:mga0a205_66434_c1 nmdc:mga0a205_66434_c1_248_688 144
968 3300053077 Ga0495601_0018231 Ga0495601_0018231_540_983 144
969 3300053084 Ga0495595_0178776 Ga0495595_0178776_512_955 144
970 3300053085 Ga0495619_0242681 Ga0495619_0242681_711_1154 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4k-assembly1.cif.gz_A crystal structure of sar1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant staphylococcus aureus (mrsa) 0.9162 68 121
1otf-assembly1.cif.gz_D 4-oxalocrotonate tautomerase-triclinic crystal form 0.9126 68 122
6fps-assembly3.cif.gz_P crystal structure of 4-oxalocrotonate tautomerase triple mutant l8y/m45y/f50a 0.9111 68 123
1bjp-assembly1.cif.gz_A crystal structure of 4-oxalocrotonate tautomerase inactivated by 2-oxo-3-pentynoate at 2.4 angstroms resolution 0.9081 68 122
8t9o-assembly1.cif.gz_D crystal structure of cf, a heterohexamer of the 4-oxalocrotonate tautomerase (4-ot) family 0.906 66 121
ID Description Score Start End Superfamily
2op8B00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9025 66 123 3.30.429.10
4fdxA00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8559 68 129 3.30.429.10
af_C6SWU3_1_117_3.30.429.10 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8471 1 121 3.30.429.10
3ry0B00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8465 68 131 3.30.429.10
3abfB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8423 68 121 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A495IFZ6-F1-model_v4 Phenylpyruvate tautomerase PptA (4-oxalocrotonate tautomerase family) 1.002 1 143
AF-A0A6I5X7Q5-F1-model_v4 4-oxalocrotonate tautomerase-like domain-containing protein 1.001 1 141 GO:0016853
AF-A0A3E0VJU1-F1-model_v4 4-oxalocrotonate tautomerase 0.9993 1 143
AF-A0A535A3C2-F1-model_v4 4-oxalocrotonate tautomerase 0.9985 1 143
AF-A0A4Y9R6N1-F1-model_v4 4-oxalocrotonate tautomerase 0.9978 3 141

Feature Viewer

pLDDT pTM Quality
95.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map