F487068

General Info

Members Datasets Scaffolds Average Seq Length
969 387 966 108

Family's Representative Sequence

Representative Sequence 3300028023|Ga0265357_1037029|Ga0265357_10370291
Length 129
Sequence MAPRQDERPPTRAPRTTGDDPRMQYLVSVIFDHAGLATPDEDAQIDVFNDRLVAEGHWVFAGGLAAPSSATVIDNRGEEALVTDGPFLESKEFIAGFWIIEAADLDVALRLAAEGSRACNRKVEVRPFQ

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
3 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
222 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
271 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
272 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
275 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
276 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
277 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
278 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
385 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 1.96
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 7.02
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10070788 3300001991 Bacteria 727
2 JGI25406J46586_10007697 3300003203 Bacteria 4899
3 JGI25406J46586_10033974 3300003203 Bacteria 1877
4 JGI25406J46586_10054974 3300003203 Bacteria 1313
5 JGI25406J46586_10266530 3300003203 Bacteria 505
6 JGI25407J50210_10008244 3300003373 Bacteria 2625
7 JGI25407J50210_10028107 3300003373 Bacteria 1459
8 JGI25407J50210_10036134 3300003373 Bacteria 1271
9 JGI25404J52841_10004206 3300003659 Bacteria 2897
10 Ga0055533_1000037 3300003756 Bacteria 255573
11 Ga0055525_1000213 3300003759 Bacteria 64854
12 Ga0055542_1018494 3300003762 Bacteria 1055
13 Ga0055541_1005331 3300003841 Bacteria 2253
14 Ga0070658_10038172 3300005327 Bacteria 3874
15 Ga0070658_10110206 3300005327 Bacteria 2280
16 Ga0070658_10389061 3300005327 Bacteria 1197
17 Ga0070676_11190679 3300005328 Bacteria 579
18 Ga0070683_100257006 3300005329 Bacteria 1661
19 Ga0070683_100333830 3300005329 Bacteria 1443
20 Ga0070683_100834527 3300005329 Bacteria 884
21 Ga0070690_100762603 3300005330 Bacteria 748
22 Ga0070670_100021001 3300005331 Bacteria 5614
23 Ga0070670_100734323 3300005331 Bacteria 889
24 Ga0068869_100038699 3300005334 Bacteria 3402
25 Ga0068869_101261612 3300005334 Bacteria 651
26 Ga0070666_10068916 3300005335 Bacteria 2404
27 Ga0070666_10192319 3300005335 Bacteria 1434
28 Ga0070680_100041120 3300005336 Bacteria 3747
29 Ga0070680_100965655 3300005336 Bacteria 735
30 Ga0070682_100013934 3300005337 Bacteria 4638
31 Ga0070682_100103697 3300005337 Bacteria 1882
32 Ga0070682_100237763 3300005337 Bacteria 1306
33 Ga0070682_100491589 3300005337 Bacteria 949
34 Ga0068868_100013469 3300005338 Bacteria 5995
35 Ga0068868_100272044 3300005338 Bacteria 1431
36 Ga0070660_100153526 3300005339 Bacteria 1852
37 Ga0070660_100407645 3300005339 Bacteria 1124
38 Ga0070689_100271638 3300005340 Bacteria 1404
39 Ga0070689_100324361 3300005340 Bacteria 1287
40 Ga0070691_10065995 3300005341 Bacteria 1748
41 Ga0070691_10070934 3300005341 Bacteria 1691
42 Ga0070691_10352567 3300005341 Bacteria 817
43 Ga0070661_100034530 3300005344 Bacteria 3667
44 Ga0070661_100124106 3300005344 Bacteria 1936
45 Ga0070661_100242129 3300005344 Bacteria 1389
46 Ga0070692_10008676 3300005345 Bacteria 4544
47 Ga0070692_10114790 3300005345 Bacteria 1494
48 Ga0070692_11310940 3300005345 Bacteria 520
49 Ga0070668_100001219 3300005347 Bacteria 18270
50 Ga0070668_100029634 3300005347 Bacteria 4157
51 Ga0070669_100396893 3300005353 Bacteria 1128
52 Ga0070675_100107645 3300005354 Bacteria 2354
53 Ga0070675_101321424 3300005354 Bacteria 664
54 Ga0070671_100090338 3300005355 Bacteria 2564
55 Ga0070671_100689781 3300005355 Bacteria 885
56 Ga0070674_101838431 3300005356 Bacteria 550
57 Ga0070673_100021977 3300005364 Bacteria 4636
58 Ga0070673_100601865 3300005364 Bacteria 1003
59 Ga0070688_100312121 3300005365 Bacteria 1140
60 Ga0070659_100129509 3300005366 Bacteria 2048
61 Ga0070659_101048986 3300005366 Bacteria 717
62 Ga0070667_100568503 3300005367 Bacteria 1043
63 Ga0070667_100851522 3300005367 Bacteria 848
64 Ga0070709_10001320 3300005434 Bacteria 13526
65 Ga0070709_10002306 3300005434 Bacteria 10363
66 Ga0070709_10004333 3300005434 Bacteria 7647
67 Ga0070709_10064843 3300005434 Bacteria 2337
68 Ga0070709_10182848 3300005434 Bacteria 1473
69 Ga0070709_10229937 3300005434 Bacteria 1326
70 Ga0070709_10323552 3300005434 Bacteria 1132
71 Ga0070714_100012295 3300005435 Bacteria 6829
72 Ga0070714_100022554 3300005435 Bacteria 5163
73 Ga0070714_100029108 3300005435 Bacteria 4589
74 Ga0070714_100059869 3300005435 Bacteria 3267
75 Ga0070714_100090938 3300005435 Bacteria 2673
76 Ga0070714_100104830 3300005435 Bacteria 2495
77 Ga0070714_100153299 3300005435 Bacteria 2078
78 Ga0070714_100219458 3300005435 Bacteria 1747
79 Ga0070714_100372001 3300005435 Bacteria 1346
80 Ga0070714_100428990 3300005435 Bacteria 1253
81 Ga0070714_100696060 3300005435 Bacteria 980
82 Ga0070714_100711519 3300005435 Bacteria 969
83 Ga0070714_100961255 3300005435 Bacteria 830
84 Ga0070713_100002321 3300005436 Bacteria 12397
85 Ga0070713_100002421 3300005436 Bacteria 12178
86 Ga0070713_100002943 3300005436 Bacteria 11165
87 Ga0070713_100010961 3300005436 Bacteria 6574
88 Ga0070713_100238136 3300005436 Bacteria 1656
89 Ga0070713_100351657 3300005436 Bacteria 1367
90 Ga0070713_100516385 3300005436 Bacteria 1128
91 Ga0070713_100628514 3300005436 Bacteria 1021
92 Ga0070713_100734896 3300005436 Bacteria 944
93 Ga0070713_101127378 3300005436 Bacteria 758
94 Ga0070713_101472790 3300005436 Bacteria 660
95 Ga0070710_10000512 3300005437 Bacteria 18260
96 Ga0070710_10004454 3300005437 Bacteria 6628
97 Ga0070710_10015851 3300005437 Bacteria 3822
98 Ga0070710_10020056 3300005437 Bacteria 3464
99 Ga0070710_10040118 3300005437 Bacteria 2579
100 Ga0070710_10272355 3300005437 Bacteria 1095
101 Ga0070710_10362240 3300005437 Bacteria 962
102 Ga0070710_11103210 3300005437 Bacteria 583
103 Ga0070701_10092096 3300005438 Bacteria 1663
104 Ga0070701_10433435 3300005438 Bacteria 840
105 Ga0070711_100005487 3300005439 Bacteria 7590
106 Ga0070711_100030809 3300005439 Bacteria 3555
107 Ga0070711_100333210 3300005439 Bacteria 1215
108 Ga0070711_101019874 3300005439 Bacteria 710
109 Ga0070705_100238911 3300005440 Bacteria 1268
110 Ga0070705_100494546 3300005440 Bacteria 927
111 Ga0070705_101717792 3300005440 Bacteria 531
112 Ga0070700_100451830 3300005441 Bacteria 978
113 Ga0070694_100632133 3300005444 Bacteria 865
114 Ga0070708_100168235 3300005445 Bacteria 2045
115 Ga0070708_100203384 3300005445 Bacteria 1854
116 Ga0070708_100406644 3300005445 Bacteria 1283
117 Ga0070708_100540501 3300005445 Bacteria 1099
118 Ga0070708_100553923 3300005445 Bacteria 1084
119 Ga0070708_101379914 3300005445 Bacteria 657
120 Ga0070663_100020607 3300005455 Bacteria 4366
121 Ga0070663_100461302 3300005455 Bacteria 1049
122 Ga0070663_100831430 3300005455 Bacteria 794
123 Ga0070678_100002644 3300005456 Bacteria 9864
124 Ga0070662_100241791 3300005457 Bacteria 1448
125 Ga0070681_10008574 3300005458 Bacteria 10016
126 Ga0070681_11005777 3300005458 Bacteria 753
127 Ga0070685_10155015 3300005466 Bacteria 1455
128 Ga0070685_10439352 3300005466 Bacteria 912
129 Ga0070685_11155686 3300005466 Bacteria 587
130 Ga0070706_100019205 3300005467 Bacteria 6306
131 Ga0070706_100039511 3300005467 Bacteria 4356
132 Ga0070706_100287487 3300005467 Bacteria 1534
133 Ga0070706_100900144 3300005467 Bacteria 818
134 Ga0070706_101013608 3300005467 Bacteria 765
135 Ga0070707_100039596 3300005468 Bacteria 4505
136 Ga0070707_100047729 3300005468 Bacteria 4099
137 Ga0070707_100050119 3300005468 Bacteria 4002
138 Ga0070707_100059782 3300005468 Bacteria 3655
139 Ga0070707_100125020 3300005468 Bacteria 2498
140 Ga0070707_100249130 3300005468 Bacteria 1728
141 Ga0070707_100538664 3300005468 Bacteria 1129
142 Ga0070707_100665894 3300005468 Bacteria 1004
143 Ga0070698_100020088 3300005471 Bacteria 7002
144 Ga0070698_100324738 3300005471 Bacteria 1470
145 Ga0070698_100481812 3300005471 Bacteria 1178
146 Ga0070698_101042316 3300005471 Bacteria 766
147 Ga0070698_101232670 3300005471 Bacteria 698
148 Ga0070698_101356314 3300005471 Bacteria 662
149 Ga0070698_101920449 3300005471 Bacteria 545
150 Ga0070698_102027617 3300005471 Bacteria 529
151 Ga0070699_100000785 3300005518 Bacteria 29304
152 Ga0070699_100011306 3300005518 Bacteria 7712
153 Ga0070699_100261279 3300005518 Bacteria 1548
154 Ga0070699_100449192 3300005518 Bacteria 1169
155 Ga0070699_100874746 3300005518 Bacteria 823
156 Ga0070679_100060095 3300005530 Bacteria 3787
157 Ga0070679_100300850 3300005530 Bacteria 1555
158 Ga0070679_100652936 3300005530 Bacteria 995
159 Ga0070679_101908226 3300005530 Bacteria 543
160 Ga0070684_100025136 3300005535 Bacteria 5002
161 Ga0070684_100145155 3300005535 Bacteria 2148
162 Ga0070684_100706754 3300005535 Bacteria 940
163 Ga0070684_101531187 3300005535 Bacteria 629
164 Ga0070684_102112453 3300005535 Bacteria 531
165 Ga0070697_100070896 3300005536 Bacteria 2858
166 Ga0070697_100071691 3300005536 Bacteria 2842
167 Ga0070697_100120123 3300005536 Bacteria 2198
168 Ga0070697_100143657 3300005536 Bacteria 2008
169 Ga0068853_100460018 3300005539 Bacteria 1197
170 Ga0068853_100498959 3300005539 Bacteria 1149
171 Ga0070672_100107279 3300005543 Bacteria 2273
172 Ga0070672_100252085 3300005543 Bacteria 1487
173 Ga0070686_100341183 3300005544 Bacteria 1123
174 Ga0070686_100347867 3300005544 Bacteria 1113
175 Ga0070695_100500009 3300005545 Bacteria 940
176 Ga0070695_101638621 3300005545 Bacteria 538
177 Ga0070693_100002564 3300005547 Bacteria 8374
178 Ga0070693_100081448 3300005547 Bacteria 1930
179 Ga0070665_100070048 3300005548 Bacteria 3513
180 Ga0070665_100896238 3300005548 Bacteria 900
181 Ga0070665_100934423 3300005548 Bacteria 880
182 Ga0070665_100996707 3300005548 Bacteria 850
183 Ga0070665_102257984 3300005548 Bacteria 547
184 Ga0070704_100596273 3300005549 Bacteria 970
185 Ga0070704_100669049 3300005549 Bacteria 918
186 Ga0070704_100993655 3300005549 Bacteria 759
187 Ga0068855_100191343 3300005563 Bacteria 2307
188 Ga0068855_100730427 3300005563 Bacteria 1057
189 Ga0068855_102346348 3300005563 Bacteria 533
190 Ga0070664_100007449 3300005564 Bacteria 8836
191 Ga0070664_100118621 3300005564 Bacteria 2315
192 Ga0070664_100156746 3300005564 Bacteria 2012
193 Ga0070664_100165261 3300005564 Bacteria 1960
194 Ga0070664_100429402 3300005564 Bacteria 1211
195 Ga0070664_101115443 3300005564 Bacteria 743
196 Ga0068857_100179978 3300005577 Bacteria 1924
197 Ga0068857_100349631 3300005577 Bacteria 1369
198 Ga0068857_100433760 3300005577 Bacteria 1227
199 Ga0068857_100560015 3300005577 Bacteria 1077
200 Ga0068857_100983861 3300005577 Bacteria 811
201 Ga0068857_101171335 3300005577 Bacteria 744
202 Ga0068854_100019574 3300005578 Bacteria 4565
203 Ga0068854_100037937 3300005578 Bacteria 3385
204 Ga0068854_101795402 3300005578 Bacteria 562
205 Ga0068856_100038257 3300005614 Bacteria 4709
206 Ga0068856_100095798 3300005614 Bacteria 2956
207 Ga0068856_100123853 3300005614 Bacteria 2587
208 Ga0068856_101916785 3300005614 Bacteria 603
209 Ga0068856_102148813 3300005614 Bacteria 568
210 Ga0068856_102352729 3300005614 Bacteria 540
211 Ga0070702_100002313 3300005615 Bacteria 8175
212 Ga0070702_100480488 3300005615 Bacteria 908
213 Ga0068852_100025476 3300005616 Bacteria 4793
214 Ga0068852_100050738 3300005616 Bacteria 3557
215 Ga0068859_100023228 3300005617 Bacteria 6223
216 Ga0068859_100642300 3300005617 Bacteria 1153
217 Ga0068859_101919104 3300005617 Bacteria 654
218 Ga0068864_100071138 3300005618 Bacteria 3028
219 Ga0068864_100968752 3300005618 Bacteria 842
220 Ga0068864_100991758 3300005618 Bacteria 833
221 Ga0068866_10909144 3300005718 Bacteria 620
222 Ga0068861_100341893 3300005719 Bacteria 1310
223 Ga0068861_100380552 3300005719 Bacteria 1247
224 Ga0068861_100903425 3300005719 Bacteria 836
225 Ga0068861_101112599 3300005719 Bacteria 760
226 Ga0068861_101177455 3300005719 Bacteria 740
227 Ga0068861_101689895 3300005719 Bacteria 626
228 Ga0068851_10016276 3300005834 Bacteria 3557
229 Ga0068851_10320146 3300005834 Bacteria 896
230 Ga0068870_10037323 3300005840 Bacteria 2504
231 Ga0068863_100022778 3300005841 Bacteria 5983
232 Ga0068863_100346517 3300005841 Bacteria 1446
233 Ga0068863_100354763 3300005841 Bacteria 1429
234 Ga0068863_100499707 3300005841 Bacteria 1197
235 Ga0068858_100161042 3300005842 Bacteria 2113
236 Ga0068858_100345094 3300005842 Bacteria 1425
237 Ga0068858_100462485 3300005842 Bacteria 1223
238 Ga0068862_100065634 3300005844 Bacteria 3127
239 Ga0068862_100392386 3300005844 Bacteria 1297
240 Ga0081455_10009212 3300005937 Bacteria 10173
241 Ga0081455_10014880 3300005937 Bacteria 7586
242 Ga0081455_10157084 3300005937 Bacteria 1747
243 Ga0081455_10332298 3300005937 Bacteria 1078
244 Ga0081455_10396517 3300005937 Bacteria 959
245 Ga0081538_10002082 3300005981 Bacteria 19934
246 Ga0081538_10002644 3300005981 Bacteria 17290
247 Ga0081538_10062235 3300005981 Bacteria 2130
248 Ga0081538_10086433 3300005981 Bacteria 1642
249 Ga0081538_10112191 3300005981 Bacteria 1335
250 Ga0081538_10152866 3300005981 Bacteria 1041
251 Ga0081540_1002533 3300005983 Bacteria 14823
252 Ga0081540_1097259 3300005983 Bacteria 1278
253 Ga0081539_10001085 3300005985 Bacteria 49445
254 Ga0081539_10001117 3300005985 Bacteria 48683
255 Ga0081539_10002987 3300005985 Bacteria 22140
256 Ga0081539_10036376 3300005985 Bacteria 2948
257 Ga0070717_10003459 3300006028 Bacteria 11303
258 Ga0070717_10009025 3300006028 Bacteria 7484
259 Ga0070717_10056856 3300006028 Bacteria 3233
260 Ga0070717_10064331 3300006028 Bacteria 3046
261 Ga0070717_10089852 3300006028 Bacteria 2591
262 Ga0070717_10169817 3300006028 Bacteria 1896
263 Ga0070717_10198306 3300006028 Bacteria 1757
264 Ga0070717_10294558 3300006028 Bacteria 1441
265 Ga0070717_10316645 3300006028 Bacteria 1389
266 Ga0070717_10985185 3300006028 Bacteria 768
267 Ga0070717_11845222 3300006028 Bacteria 546
268 Ga0070717_11854350 3300006028 Bacteria 544
269 Ga0075365_10344220 3300006038 Bacteria 1051
270 Ga0075432_10002349 3300006058 Bacteria 6307
271 Ga0075432_10010170 3300006058 Bacteria 3193
272 Ga0070715_10186259 3300006163 Bacteria 1045
273 Ga0070716_100008325 3300006173 Bacteria 5143
274 Ga0070716_100108502 3300006173 Bacteria 1715
275 Ga0070716_100114543 3300006173 Bacteria 1677
276 Ga0070716_100198001 3300006173 Bacteria 1333
277 Ga0070716_100363275 3300006173 Bacteria 1029
278 Ga0070716_101296165 3300006173 Bacteria 589
279 Ga0070712_100002212 3300006175 Bacteria 11961
280 Ga0070712_100087131 3300006175 Bacteria 2277
281 Ga0070712_100141398 3300006175 Bacteria 1837
282 Ga0070712_100470430 3300006175 Bacteria 1049
283 Ga0070712_100495388 3300006175 Bacteria 1023
284 Ga0070712_100503532 3300006175 Bacteria 1015
285 Ga0070712_100984037 3300006175 Bacteria 729
286 Ga0070712_101830300 3300006175 Bacteria 532
287 Ga0097621_100260033 3300006237 Bacteria 1522
288 Ga0097621_100467964 3300006237 Bacteria 1138
289 Ga0097621_100656297 3300006237 Bacteria 963
290 Ga0097621_101318538 3300006237 Bacteria 682
291 Ga0068871_100044951 3300006358 Bacteria 3553
292 Ga0068871_100161655 3300006358 Bacteria 1916
293 Ga0068871_100359498 3300006358 Bacteria 1289
294 Ga0075428_100006141 3300006844 Bacteria 13369
295 Ga0075428_100025139 3300006844 Bacteria 6588
296 Ga0075428_100499622 3300006844 Bacteria 1301
297 Ga0075428_100509187 3300006844 Bacteria 1288
298 Ga0075428_100850765 3300006844 Bacteria 968
299 Ga0075430_100005217 3300006846 Bacteria 10953
300 Ga0075430_100020698 3300006846 Bacteria 5595
301 Ga0075430_100933851 3300006846 Bacteria 715
302 Ga0075431_100005151 3300006847 Bacteria 12867
303 Ga0075431_100025330 3300006847 Bacteria 6081
304 Ga0075431_100574965 3300006847 Bacteria 1113
305 Ga0075433_10006286 3300006852 Bacteria 9380
306 Ga0075433_10018598 3300006852 Bacteria 5779
307 Ga0075434_100001130 3300006871 Bacteria 21976
308 Ga0075434_100015099 3300006871 Bacteria 7397
309 Ga0075434_100994798 3300006871 Bacteria 853
310 Ga0075434_101012518 3300006871 Bacteria 845
311 Ga0075429_100006139 3300006880 Bacteria 10387
312 Ga0075429_100036319 3300006880 Bacteria 4285
313 Ga0068865_100927542 3300006881 Bacteria 759
314 Ga0075436_100002659 3300006914 Bacteria 12280
315 Ga0075436_100034378 3300006914 Bacteria 3495
316 Ga0075436_100190533 3300006914 Bacteria 1451
317 Ga0097620_100023228 3300006931 Bacteria 6223
318 Ga0097620_100642299 3300006931 Bacteria 1153
319 Ga0097620_101919696 3300006931 Bacteria 654
320 Ga0075435_100000977 3300007076 Bacteria 18090
321 Ga0075435_100226059 3300007076 Bacteria 1590
322 Ga0075435_100362666 3300007076 Bacteria 1243
323 Ga0075435_100557574 3300007076 Bacteria 993
324 Ga0075435_101056396 3300007076 Bacteria 710
325 Ga0099794_10230590 3300007265 Bacteria 953
326 Ga0099795_10219596 3300007788 Bacteria 808
327 Ga0099795_10445883 3300007788 Bacteria 595
328 Ga0099795_10488559 3300007788 Bacteria 572
329 Ga0105251_10061484 3300009011 Bacteria 1765
330 Ga0105251_10285873 3300009011 Bacteria 746
331 Ga0105240_10124436 3300009093 Bacteria 3101
332 Ga0105240_10839503 3300009093 Bacteria 992
333 Ga0105240_11848787 3300009093 Bacteria 629
334 Ga0111539_10000779 3300009094 Bacteria 41442
335 Ga0111539_10057760 3300009094 Bacteria 4607
336 Ga0111539_13358644 3300009094 Bacteria 515
337 Ga0105245_10050634 3300009098 Bacteria 3723
338 Ga0105245_10055174 3300009098 Bacteria 3569
339 Ga0105245_10072031 3300009098 Bacteria 3139
340 Ga0105247_10137577 3300009101 Bacteria 1597
341 Ga0105247_10371112 3300009101 Bacteria 1012
342 Ga0105247_10539465 3300009101 Bacteria 856
343 Ga0114129_10007655 3300009147 Bacteria 15375
344 Ga0114129_10069746 3300009147 Bacteria 4900
345 Ga0114129_10404869 3300009147 Bacteria 1797
346 Ga0114129_11520637 3300009147 Bacteria 822
347 Ga0114129_12234326 3300009147 Bacteria 658
348 Ga0105243_10075772 3300009148 Bacteria 2731
349 Ga0105243_10869678 3300009148 Bacteria 894
350 Ga0105243_11493335 3300009148 Bacteria 699
351 Ga0105243_12692594 3300009148 Bacteria 537
352 Ga0105241_10009288 3300009174 Bacteria 7228
353 Ga0105242_10870066 3300009176 Bacteria 898
354 Ga0105248_10136816 3300009177 Bacteria 2764
355 Ga0105248_10217530 3300009177 Bacteria 2151
356 Ga0105248_10325588 3300009177 Bacteria 1731
357 Ga0105248_11531913 3300009177 Bacteria 755
358 Ga0105248_11612690 3300009177 Bacteria 735
359 Ga0105248_13343083 3300009177 Bacteria 510
360 Ga0105237_10141495 3300009545 Bacteria 2400
361 Ga0105237_10490653 3300009545 Bacteria 1235
362 Ga0105238_10068794 3300009551 Bacteria 3542
363 Ga0105238_10249503 3300009551 Bacteria 1753
364 Ga0105238_10480863 3300009551 Bacteria 1241
365 Ga0105238_11845401 3300009551 Bacteria 637
366 Ga0105249_10470897 3300009553 Bacteria 1298
367 Ga0105249_12300581 3300009553 Bacteria 612
368 Ga0099796_10058857 3300010159 Bacteria 1356
369 Ga0105239_10238858 3300010375 Bacteria 2039
370 Ga0105239_10279513 3300010375 Bacteria 1879
371 Ga0105239_11810169 3300010375 Bacteria 708
372 Ga0105239_12555441 3300010375 Bacteria 595
373 Ga0105246_10058429 3300011119 Bacteria 2672
374 Ga0105246_10519190 3300011119 Bacteria 1015
375 Ga0157342_1031332 3300012507 Bacteria 671
376 Ga0157373_10005783 3300013100 Bacteria 9264
377 Ga0157373_10057034 3300013100 Bacteria 2771
378 Ga0157373_10164244 3300013100 Bacteria 1562
379 Ga0157371_10043385 3300013102 Bacteria 3204
380 Ga0157370_10035208 3300013104 Bacteria 4869
381 Ga0157370_10089752 3300013104 Bacteria 2887
382 Ga0157370_10432114 3300013104 Bacteria 1211
383 Ga0157370_11178794 3300013104 Bacteria 691
384 Ga0157369_10036784 3300013105 Bacteria 5362
385 Ga0157369_10064667 3300013105 Bacteria 3939
386 Ga0157369_10297344 3300013105 Bacteria 1680
387 Ga0157369_10620706 3300013105 Bacteria 1115
388 Ga0157369_10682308 3300013105 Bacteria 1058
389 Ga0157369_10838386 3300013105 Bacteria 944
390 Ga0157369_11023262 3300013105 Bacteria 845
391 Ga0157369_12550043 3300013105 Bacteria 517
392 Ga0157374_10028564 3300013296 Bacteria 5040
393 Ga0157374_10034562 3300013296 Bacteria 4618
394 Ga0157374_10568542 3300013296 Bacteria 1142
395 Ga0157374_10580423 3300013296 Bacteria 1130
396 Ga0157374_11831739 3300013296 Bacteria 632
397 Ga0157378_11328338 3300013297 Bacteria 761
398 Ga0157378_11504629 3300013297 Bacteria 718
399 Ga0157378_12773851 3300013297 Bacteria 542
400 Ga0163162_10153877 3300013306 Bacteria 2418
401 Ga0163162_11231091 3300013306 Bacteria 850
402 Ga0163162_11715788 3300013306 Bacteria 717
403 Ga0163162_11943863 3300013306 Bacteria 674
404 Ga0157372_10269736 3300013307 Bacteria 1977
405 Ga0157372_10279594 3300013307 Bacteria 1940
406 Ga0157372_10472484 3300013307 Bacteria 1462
407 Ga0157372_12132496 3300013307 Bacteria 644
408 Ga0157372_12156609 3300013307 Bacteria 640
409 Ga0157372_12336230 3300013307 Bacteria 614
410 Ga0157375_10041515 3300013308 Bacteria 4443
411 Ga0157375_10044820 3300013308 Bacteria 4301
412 Ga0157375_10269535 3300013308 Bacteria 1864
413 Ga0157375_10325653 3300013308 Bacteria 1701
414 Ga0157375_10433247 3300013308 Bacteria 1481
415 Ga0157375_10672843 3300013308 Bacteria 1190
416 Ga0163163_10020825 3300014325 Bacteria 6182
417 Ga0163163_10106198 3300014325 Bacteria 2834
418 Ga0163163_10158736 3300014325 Bacteria 2306
419 Ga0163163_13003767 3300014325 Bacteria 526
420 Ga0157380_10273263 3300014326 Bacteria 1542
421 Ga0157380_11001833 3300014326 Bacteria 869
422 Ga0182008_10301872 3300014497 Bacteria 838
423 Ga0157377_10006356 3300014745 Bacteria 5629
424 Ga0157377_10036159 3300014745 Bacteria 2715
425 Ga0157377_10372821 3300014745 Bacteria 964
426 Ga0157379_10150724 3300014968 Bacteria 2097
427 Ga0157379_10294462 3300014968 Bacteria 1478
428 Ga0157379_10690650 3300014968 Bacteria 957
429 Ga0157376_10149631 3300014969 Bacteria 2104
430 Ga0157376_10171726 3300014969 Bacteria 1975
431 Ga0157376_11279097 3300014969 Bacteria 763
432 Ga0157376_11305789 3300014969 Bacteria 756
433 Ga0197907_10183059 3300020069 Bacteria 781
434 Ga0197907_10763580 3300020069 Bacteria 1166
435 Ga0206356_11299412 3300020070 Bacteria 1494
436 Ga0206356_11645124 3300020070 Bacteria 799
437 Ga0206352_10448073 3300020078 Bacteria 1195
438 Ga0206354_10623429 3300020081 Bacteria 3272
439 Ga0206354_10680820 3300020081 Bacteria 589
440 Ga0206353_10190738 3300020082 Bacteria 1974
441 Ga0206353_10279819 3300020082 Bacteria 556
442 Ga0206353_11190550 3300020082 Bacteria 766
443 Ga0206353_11823412 3300020082 Bacteria 801
444 Ga0154015_1041837 3300020610 Bacteria 851
445 Ga0213875_10141861 3300021388 Bacteria 1125
446 Ga0213875_10152876 3300021388 Bacteria 1082
447 Ga0224712_10053320 3300022467 Bacteria 1583
448 Ga0224712_10346946 3300022467 Bacteria 701
449 Ga0224712_10432143 3300022467 Bacteria 630
450 Ga0224712_10486256 3300022467 Bacteria 595
451 Ga0209566_100047 3300025225 Bacteria 243995
452 Ga0209674_100001 3300025226 Bacteria 4013750
453 Ga0209563_100001 3300025230 Bacteria 4013775
454 Ga0209677_100001 3300025253 Bacteria 4013787
455 Ga0209148_1017874 3300025254 Bacteria 1197
456 Ga0207656_10004717 3300025321 Bacteria 4780
457 Ga0207713_1192436 3300025735 Bacteria 630
458 Ga0207653_10040605 3300025885 Bacteria 1526
459 Ga0207692_10001320 3300025898 Bacteria 9238
460 Ga0207692_10008171 3300025898 Bacteria 4323
461 Ga0207692_10014042 3300025898 Bacteria 3490
462 Ga0207692_10139056 3300025898 Bacteria 1380
463 Ga0207692_10308976 3300025898 Bacteria 964
464 Ga0207692_10543912 3300025898 Bacteria 741
465 Ga0207692_11002583 3300025898 Bacteria 551
466 Ga0207642_10106362 3300025899 Bacteria 1420
467 Ga0207710_10056367 3300025900 Bacteria 1773
468 Ga0207710_10265878 3300025900 Bacteria 860
469 Ga0207688_10034897 3300025901 Bacteria 2786
470 Ga0207688_10211840 3300025901 Bacteria 1164
471 Ga0207680_10073482 3300025903 Bacteria 2126
472 Ga0207680_10228460 3300025903 Bacteria 1278
473 Ga0207647_10151859 3300025904 Bacteria 1353
474 Ga0207647_10153438 3300025904 Bacteria 1345
475 Ga0207685_10627028 3300025905 Bacteria 579
476 Ga0207699_10000150 3300025906 Bacteria 45175
477 Ga0207699_10000258 3300025906 Bacteria 29195
478 Ga0207699_10027274 3300025906 Bacteria 3160
479 Ga0207699_10063013 3300025906 Bacteria 2238
480 Ga0207699_10123094 3300025906 Bacteria 1680
481 Ga0207699_11227137 3300025906 Bacteria 555
482 Ga0207645_10230490 3300025907 Bacteria 1222
483 Ga0207645_10375428 3300025907 Bacteria 954
484 Ga0207645_10810261 3300025907 Bacteria 637
485 Ga0207643_10001537 3300025908 Bacteria 13174
486 Ga0207643_10035540 3300025908 Bacteria 2794
487 Ga0207705_10022571 3300025909 Bacteria 4488
488 Ga0207705_10793801 3300025909 Bacteria 735
489 Ga0207705_11528815 3300025909 Bacteria 505
490 Ga0207684_10008759 3300025910 Bacteria 8982
491 Ga0207684_10016494 3300025910 Bacteria 6343
492 Ga0207684_10729071 3300025910 Bacteria 841
493 Ga0207684_10896393 3300025910 Bacteria 746
494 Ga0207654_10019819 3300025911 Bacteria 3557
495 Ga0207707_10111086 3300025912 Bacteria 2396
496 Ga0207707_10526153 3300025912 Bacteria 1007
497 Ga0207707_11061030 3300025912 Bacteria 662
498 Ga0207695_10621075 3300025913 Bacteria 962
499 Ga0207671_10093394 3300025914 Bacteria 2269
500 Ga0207671_10621688 3300025914 Bacteria 861
501 Ga0207671_11512637 3300025914 Bacteria 518
502 Ga0207693_10003060 3300025915 Bacteria 14436
503 Ga0207693_10019403 3300025915 Bacteria 5408
504 Ga0207693_10025702 3300025915 Bacteria 4666
505 Ga0207693_10083599 3300025915 Bacteria 2501
506 Ga0207693_10328894 3300025915 Bacteria 1196
507 Ga0207693_11338969 3300025915 Bacteria 534
508 Ga0207663_10002856 3300025916 Bacteria 8348
509 Ga0207663_10006047 3300025916 Bacteria 6153
510 Ga0207663_10022592 3300025916 Bacteria 3598
511 Ga0207663_10677728 3300025916 Bacteria 815
512 Ga0207663_11409615 3300025916 Bacteria 561
513 Ga0207660_10963190 3300025917 Bacteria 696
514 Ga0207660_11661673 3300025917 Bacteria 514
515 Ga0207662_10074461 3300025918 Bacteria 2061
516 Ga0207657_10009474 3300025919 Bacteria 9784
517 Ga0207657_10062340 3300025919 Bacteria 3193
518 Ga0207657_10128400 3300025919 Bacteria 2080
519 Ga0207657_10421494 3300025919 Bacteria 1049
520 Ga0207649_10004621 3300025920 Bacteria 7458
521 Ga0207649_10524981 3300025920 Bacteria 903
522 Ga0207652_10035081 3300025921 Bacteria 4232
523 Ga0207652_10254175 3300025921 Bacteria 1585
524 Ga0207652_10301013 3300025921 Bacteria 1447
525 Ga0207652_10572801 3300025921 Bacteria 1014
526 Ga0207652_10674011 3300025921 Bacteria 924
527 Ga0207652_11154078 3300025921 Bacteria 676
528 Ga0207646_10071910 3300025922 Bacteria 3089
529 Ga0207646_10120426 3300025922 Bacteria 2358
530 Ga0207646_10689470 3300025922 Bacteria 914
531 Ga0207646_10837273 3300025922 Bacteria 818
532 Ga0207681_10252375 3300025923 Bacteria 1378
533 Ga0207681_10273771 3300025923 Bacteria 1326
534 Ga0207681_10793905 3300025923 Bacteria 791
535 Ga0207694_10054897 3300025924 Bacteria 3092
536 Ga0207694_10206262 3300025924 Bacteria 1600
537 Ga0207650_10006488 3300025925 Bacteria 7973
538 Ga0207650_10693905 3300025925 Bacteria 860
539 Ga0207659_10019293 3300025926 Bacteria 4485
540 Ga0207659_11091678 3300025926 Bacteria 687
541 Ga0207659_11918544 3300025926 Bacteria 502
542 Ga0207687_10016939 3300025927 Bacteria 4789
543 Ga0207687_10042788 3300025927 Bacteria 3118
544 Ga0207687_10858755 3300025927 Bacteria 776
545 Ga0207700_10000342 3300025928 Bacteria 27369
546 Ga0207700_10003386 3300025928 Bacteria 9257
547 Ga0207700_10031252 3300025928 Bacteria 3780
548 Ga0207700_10123271 3300025928 Bacteria 2104
549 Ga0207700_10179195 3300025928 Bacteria 1773
550 Ga0207700_10184697 3300025928 Bacteria 1748
551 Ga0207700_10194187 3300025928 Bacteria 1707
552 Ga0207700_10243232 3300025928 Bacteria 1534
553 Ga0207700_10320985 3300025928 Bacteria 1342
554 Ga0207700_10364186 3300025928 Bacteria 1261
555 Ga0207700_10479384 3300025928 Bacteria 1099
556 Ga0207700_10841780 3300025928 Bacteria 821
557 Ga0207664_10000764 3300025929 Bacteria 21818
558 Ga0207664_10007272 3300025929 Bacteria 7679
559 Ga0207664_10039694 3300025929 Bacteria 3655
560 Ga0207664_10045733 3300025929 Bacteria 3434
561 Ga0207664_10061944 3300025929 Bacteria 2987
562 Ga0207664_10115218 3300025929 Bacteria 2241
563 Ga0207664_10117186 3300025929 Bacteria 2223
564 Ga0207664_10223114 3300025929 Bacteria 1635
565 Ga0207664_10288999 3300025929 Bacteria 1440
566 Ga0207664_10413801 3300025929 Bacteria 1200
567 Ga0207664_11226882 3300025929 Bacteria 668
568 Ga0207644_10024643 3300025931 Bacteria 4131
569 Ga0207690_10014586 3300025932 Bacteria 4746
570 Ga0207690_10478164 3300025932 Bacteria 1005
571 Ga0207706_10152212 3300025933 Bacteria 2034
572 Ga0207686_10562842 3300025934 Bacteria 893
573 Ga0207686_11065082 3300025934 Bacteria 658
574 Ga0207709_10585553 3300025935 Bacteria 882
575 Ga0207709_10599745 3300025935 Bacteria 872
576 Ga0207709_11409206 3300025935 Bacteria 577
577 Ga0207670_10174912 3300025936 Bacteria 1612
578 Ga0207670_11065395 3300025936 Bacteria 682
579 Ga0207669_10363868 3300025937 Bacteria 1122
580 Ga0207704_10532470 3300025938 Bacteria 952
581 Ga0207665_10218483 3300025939 Bacteria 1396
582 Ga0207665_10458653 3300025939 Bacteria 979
583 Ga0207665_11248921 3300025939 Bacteria 592
584 Ga0207691_10036168 3300025940 Bacteria 4576
585 Ga0207691_10075071 3300025940 Bacteria 3049
586 Ga0207691_10643026 3300025940 Bacteria 896
587 Ga0207691_11357509 3300025940 Bacteria 585
588 Ga0207711_10369020 3300025941 Bacteria 1331
589 Ga0207711_11124943 3300025941 Bacteria 726
590 Ga0207689_10016618 3300025942 Bacteria 6227
591 Ga0207689_10448093 3300025942 Bacteria 1079
592 Ga0207661_10019221 3300025944 Bacteria 5089
593 Ga0207661_11001128 3300025944 Bacteria 770
594 Ga0207679_10016528 3300025945 Bacteria 4903
595 Ga0207679_10157455 3300025945 Bacteria 1856
596 Ga0207679_10364232 3300025945 Bacteria 1263
597 Ga0207679_10651961 3300025945 Bacteria 952
598 Ga0207667_11459050 3300025949 Bacteria 656
599 Ga0207651_10070300 3300025960 Bacteria 2476
600 Ga0207651_10559166 3300025960 Bacteria 996
601 Ga0207712_11213505 3300025961 Bacteria 673
602 Ga0207712_11325125 3300025961 Bacteria 644
603 Ga0207668_10000895 3300025972 Bacteria 18002
604 Ga0207668_10010000 3300025972 Bacteria 5709
605 Ga0207640_10444255 3300025981 Bacteria 1067
606 Ga0207640_10480978 3300025981 Bacteria 1030
607 Ga0207677_10006553 3300026023 Bacteria 6391
608 Ga0207677_10274146 3300026023 Bacteria 1382
609 Ga0207703_10165713 3300026035 Bacteria 1939
610 Ga0207703_10829429 3300026035 Bacteria 884
611 Ga0207639_10036197 3300026041 Bacteria 3656
612 Ga0207639_10195969 3300026041 Bacteria 1729
613 Ga0207639_10438602 3300026041 Bacteria 1184
614 Ga0207639_10556795 3300026041 Bacteria 1053
615 Ga0207639_10960221 3300026041 Bacteria 800
616 Ga0207639_11869906 3300026041 Bacteria 561
617 Ga0207678_10000245 3300026067 Bacteria 49012
618 Ga0207678_10157578 3300026067 Bacteria 1939
619 Ga0207678_11197887 3300026067 Bacteria 672
620 Ga0207678_11579235 3300026067 Bacteria 578
621 Ga0207708_10445960 3300026075 Bacteria 1077
622 Ga0207702_10016545 3300026078 Bacteria 6103
623 Ga0207702_10050305 3300026078 Bacteria 3518
624 Ga0207702_10052561 3300026078 Bacteria 3448
625 Ga0207702_10052806 3300026078 Bacteria 3440
626 Ga0207702_10058099 3300026078 Bacteria 3291
627 Ga0207702_12424536 3300026078 Bacteria 512
628 Ga0207641_10113474 3300026088 Bacteria 2406
629 Ga0207641_10953715 3300026088 Bacteria 853
630 Ga0207641_11197486 3300026088 Bacteria 759
631 Ga0207676_10008877 3300026095 Bacteria 7149
632 Ga0207676_10142071 3300026095 Bacteria 2056
633 Ga0207676_10935420 3300026095 Bacteria 852
634 Ga0207676_11856005 3300026095 Bacteria 601
635 Ga0207674_10012064 3300026116 Bacteria 9679
636 Ga0207674_10031256 3300026116 Bacteria 5594
637 Ga0207674_10178177 3300026116 Bacteria 2077
638 Ga0207674_10436541 3300026116 Bacteria 1265
639 Ga0207674_10795259 3300026116 Bacteria 913
640 Ga0207674_12054716 3300026116 Bacteria 536
641 Ga0207675_100330310 3300026118 Bacteria 1490
642 Ga0207675_100613426 3300026118 Bacteria 1092
643 Ga0207675_100635861 3300026118 Bacteria 1072
644 Ga0207683_10001108 3300026121 Bacteria 24536
645 Ga0207683_10002188 3300026121 Bacteria 17182
646 Ga0207683_10346109 3300026121 Bacteria 1364
647 Ga0207683_10564555 3300026121 Bacteria 1052
648 Ga0207683_10582773 3300026121 Bacteria 1035
649 Ga0207683_10865970 3300026121 Bacteria 839
650 Ga0207683_11462997 3300026121 Bacteria 631
651 Ga0207698_10155078 3300026142 Bacteria 1994
652 Ga0207698_10539641 3300026142 Bacteria 1141
653 Ga0207428_10000872 3300027907 Bacteria 33910
654 Ga0207428_10018040 3300027907 Bacteria 6043
655 Ga0265357_1037029 3300028023 Bacteria 567
656 Ga0268266_10193198 3300028379 Bacteria 1859
657 Ga0268266_10338500 3300028379 Bacteria 1412
658 Ga0268266_10819094 3300028379 Bacteria 899
659 Ga0268266_11210826 3300028379 Bacteria 730
660 Ga0268265_10064370 3300028380 Bacteria 2824
661 Ga0268265_10182625 3300028380 Bacteria 1804
662 Ga0268265_11823000 3300028380 Bacteria 615
663 Ga0268264_10094658 3300028381 Bacteria 2583
664 Ga0268264_10253131 3300028381 Bacteria 1637
665 Ga0268264_11108413 3300028381 Bacteria 800
666 Ga0307515_10022180 3300028794 Bacteria 11207
667 Ga0307515_10285349 3300028794 Bacteria 1353
668 Ga0316178_1102303 3300030735 Bacteria 1565
669 Ga0265773_1010594 3300031018 Bacteria 780
670 Ga0265760_10390584 3300031090 Bacteria 501
671 Ga0307513_10008238 3300031456 Bacteria 13371
672 Ga0307513_10602461 3300031456 Bacteria 808
673 Ga0307513_10777132 3300031456 Bacteria 663
674 Ga0307408_100719299 3300031548 Bacteria 899
675 Ga0307408_101028285 3300031548 Bacteria 761
676 Ga0307408_101410270 3300031548 Bacteria 656
677 Ga0307508_10288622 3300031616 Bacteria 1234
678 Ga0307508_10456993 3300031616 Bacteria 870
679 Ga0307405_11518224 3300031731 Bacteria 589
680 Ga0307405_12112871 3300031731 Bacteria 506
681 Ga0307413_10739660 3300031824 Bacteria 821
682 Ga0307410_10356321 3300031852 Bacteria 1170
683 Ga0307410_10504610 3300031852 Bacteria 996
684 Ga0307410_11415513 3300031852 Bacteria 611
685 Ga0307406_10111297 3300031901 Bacteria 1886
686 Ga0307406_10470331 3300031901 Bacteria 1013
687 Ga0307407_10110133 3300031903 Bacteria 1727
688 Ga0307407_10739812 3300031903 Bacteria 744
689 Ga0307412_11287458 3300031911 Bacteria 658
690 Ga0307409_100017750 3300031995 Bacteria 4756
691 Ga0307409_100318710 3300031995 Bacteria 1454
692 Ga0307409_100469177 3300031995 Bacteria 1219
693 Ga0307409_101057342 3300031995 Bacteria 832
694 Ga0307409_101126369 3300031995 Bacteria 806
695 Ga0307416_100208352 3300032002 Bacteria 1862
696 Ga0307416_102670420 3300032002 Bacteria 596
697 Ga0307416_102720673 3300032002 Bacteria 591
698 Ga0307414_10389790 3300032004 Bacteria 1207
699 Ga0307415_100002122 3300032126 Bacteria 9819
700 Ga0307415_100061895 3300032126 Bacteria 2593
701 Ga0307415_100277007 3300032126 Bacteria 1377
702 Ga0307415_100904689 3300032126 Bacteria 814
703 Ga0307415_102017049 3300032126 Bacteria 562
704 Ga0307415_102017557 3300032126 Bacteria 562
705 Ga0373950_0016362 3300034818 Bacteria 1268
706 Ga0373959_0032774 3300034820 Bacteria 1057
707 Ga0373929_0247748 3300035085 Bacteria 516
708 Ga0373934_0027878 3300035086 Bacteria 2197
709 Ga0373940_0039014 3300035088 Bacteria 1299
710 Ga0373944_0352253 3300035089 Bacteria 560
711 Ga0373951_0095711 3300035091 Bacteria 784
712 Ga0373923_0179781 3300035111 Bacteria 972
713 Ga0373932_0281845 3300035112 Bacteria 615
714 Ga0373939_0339072 3300035114 Bacteria 609
715 Ga0373941_0075651 3300035115 Bacteria 1127
716 Ga0373956_0159207 3300035119 Bacteria 1064
717 Ga0373943_0982618 3300035170 Bacteria 506
718 Ga0373942_0001721 3300035207 Bacteria 5562
719 Ga0373961_0427073 3300035241 Bacteria 513
720 Ga0373924_0135961 3300035410 Bacteria 1071
721 Ga0373931_0040996 3300035691 Bacteria 2431
722 Ga0373935_0077170 3300035692 Bacteria 2159
723 Ga0373935_0581480 3300035692 Bacteria 818
724 Ga0373935_1224792 3300035692 Bacteria 560
725 Ga0373935_1226145 3300035692 Bacteria 559
726 Ga0373927_1022312 3300035695 Bacteria 545
727 Ga0373947_1021438 3300035725 Bacteria 564
728 Ga0373937_0314138 3300036401 Bacteria 1482
729 Ga0373937_1126203 3300036401 Bacteria 733
730 Ga0373937_1506366 3300036401 Bacteria 620
731 Ga0372808_069496 3300036459 Bacteria 509
732 Ga0373925_0368795 3300037068 Bacteria 1168
733 Ga0373925_0837743 3300037068 Bacteria 758
734 Ga0395899_0013581 3300037312 Bacteria 6226
735 Ga0395899_0014951 3300037312 Bacteria 5920
736 Ga0395900_0049920 3300037418 Bacteria 4310
737 Ga0395898_0037998 3300037466 Bacteria 4773
738 Ga0395898_1575792 3300037466 Bacteria 581
739 Ga0395905_0007193 3300037471 Bacteria 11111
740 Ga0395905_1094791 3300037471 Bacteria 700
741 Ga0436364_0929084 3300037853 Bacteria 1476
742 Ga0436364_1111965 3300037853 Bacteria 1479
743 Ga0395901_0061037 3300038443 Bacteria 3923
744 Ga0436363_0965767 3300039450 Bacteria 588
745 Ga0439465_0302602 3300041413 Bacteria 599
746 Ga0451798_1080448 3300041458 Bacteria 522
747 Ga0451807_2259115 3300041486 Bacteria 601
748 Ga0451833_0052121 3300041491 Bacteria 597
749 Ga0451849_1294102 3300041505 Bacteria 689
750 Ga0451855_1267667 3300041511 Bacteria 857
751 Ga0451853_2986788 3300041512 Bacteria 558
752 Ga0451853_4096721 3300041512 Bacteria 1095
753 Ga0439459_0032746 3300042438 Bacteria 1067
754 Ga0439440_0217444 3300042993 Bacteria 572
755 Ga0466969_0047458 3300044656 Bacteria 2126
756 Ga0466969_0507543 3300044656 Bacteria 551
757 Ga0466972_0105183 3300044658 Bacteria 1335
758 Ga0453683_0894406 3300044673 Bacteria 587
759 Ga0466966_0263232 3300044684 Bacteria 1038
760 Ga0466961_0593977 3300044693 Bacteria 666
761 Ga0466963_0328042 3300044694 Bacteria 1077
762 Ga0466963_0852064 3300044694 Bacteria 642
763 Ga0466970_0006912 3300044765 Bacteria 5681
764 Ga0466970_0015863 3300044765 Bacteria 3878
765 Ga0466957_0156633 3300044842 Bacteria 1477
766 Ga0466960_0087663 3300044901 Bacteria 1581
767 Ga0466959_0305087 3300045049 Bacteria 1090
768 Ga0466959_0450790 3300045049 Bacteria 872
769 Ga0466958_0716806 3300045836 Bacteria 652
770 Ga0466958_0976286 3300045836 Bacteria 553
771 Ga0466967_1652822 3300045976 Bacteria 638
772 Ga0495592_0258794 3300046454 Bacteria 1147
773 Ga0495653_0199216 3300046463 Bacteria 1360
774 Ga0495639_0170963 3300046475 Bacteria 1055
775 Ga0495639_0246501 3300046475 Bacteria 883
776 Ga0495662_0184232 3300046476 Bacteria 1029
777 Ga0495662_0211569 3300046476 Bacteria 956
778 Ga0495662_0367777 3300046476 Bacteria 706
779 Ga0495664_0075929 3300046477 Bacteria 2011
780 Ga0495584_0523798 3300046491 Bacteria 604
781 Ga0495585_0023230 3300046492 Bacteria 3559
782 Ga0495594_0016486 3300046499 Bacteria 3893
783 Ga0495596_0197550 3300046500 Bacteria 782
784 Ga0495616_0219375 3300046513 Bacteria 829
785 Ga0495628_0081651 3300046516 Bacteria 2511
786 Ga0495628_0372461 3300046516 Bacteria 1047
787 Ga0495628_0430548 3300046516 Bacteria 960
788 Ga0495630_0526150 3300046517 Bacteria 907
789 Ga0495644_0367286 3300046523 Bacteria 568
790 Ga0495648_0167645 3300046524 Bacteria 1129
791 Ga0495666_0165238 3300046526 Bacteria 1025
792 Ga0495666_0288750 3300046526 Bacteria 743
793 Ga0495642_0141476 3300046528 Bacteria 1039
794 Ga0495652_0586302 3300046529 Bacteria 762
795 Ga0495640_0929569 3300046533 Bacteria 514
796 Ga0495645_0042793 3300046543 Bacteria 3303
797 Ga0495645_0365805 3300046543 Bacteria 926
798 Ga0495633_0320305 3300046558 Bacteria 704
799 Ga0495633_0414750 3300046558 Bacteria 609
800 Ga0495667_0335436 3300046559 Bacteria 956
801 Ga0495667_0622134 3300046559 Bacteria 672
802 Ga0495656_0430514 3300046615 Bacteria 693
803 Ga0495625_0115890 3300046660 Bacteria 1828
804 Ga0495635_0326208 3300046663 Bacteria 1027
805 Ga0495659_0161986 3300046664 Bacteria 904
806 Ga0495657_0001424 3300046675 Bacteria 20694
807 Ga0495657_0256406 3300046675 Bacteria 1052
808 Ga0495646_0182430 3300046680 Bacteria 1151
809 Ga0495658_0285175 3300046683 Bacteria 1043
810 Ga0495613_0242915 3300046689 Bacteria 1258
811 Ga0495624_0243226 3300046690 Bacteria 1089
812 Ga0495624_0416269 3300046690 Bacteria 806
813 Ga0495671_0332672 3300046692 Bacteria 729
814 Ga0495589_0395302 3300046794 Bacteria 635
815 Ga0495581_0199359 3300047315 Bacteria 1171
816 Ga0495674_0095521 3300047319 Bacteria 2534
817 Ga0495674_0771931 3300047319 Bacteria 749
818 Ga0495676_0941417 3300047321 Bacteria 552
819 Ga0495680_0387585 3300047322 Bacteria 967
820 Ga0495684_0504556 3300047471 Bacteria 831
821 Ga0495614_0628929 3300048089 Bacteria 517
822 Ga0495626_0314145 3300048091 Bacteria 617
823 Ga0496100_0080142 3300048903 Bacteria 2202
824 Ga0496100_0332086 3300048903 Bacteria 1144
825 Ga0496100_1641292 3300048903 Bacteria 508
826 Ga0496101_0023810 3300048904 Bacteria 4234
827 Ga0496101_0033677 3300048904 Bacteria 3615
828 Ga0496101_0055791 3300048904 Bacteria 2855
829 Ga0496101_0205505 3300048904 Bacteria 1524
830 Ga0496101_1314939 3300048904 Bacteria 565
831 Ga0496102_0024111 3300048905 Bacteria 5407
832 Ga0496102_0545693 3300048905 Bacteria 1082
833 Ga0496102_0933475 3300048905 Bacteria 789
834 Ga0496103_0053368 3300048906 Bacteria 2505
835 Ga0496104_0006727 3300048907 Bacteria 10123
836 Ga0496104_0069812 3300048907 Bacteria 3339
837 Ga0496104_0090841 3300048907 Bacteria 2918
838 Ga0496104_0100145 3300048907 Bacteria 2774
839 Ga0496104_0164333 3300048907 Bacteria 2128
840 Ga0496104_0622572 3300048907 Bacteria 989
841 Ga0496104_0837703 3300048907 Bacteria 825
842 Ga0496104_1807022 3300048907 Bacteria 513
843 Ga0496105_0015618 3300048908 Bacteria 6056
844 Ga0496105_0107384 3300048908 Bacteria 2304
845 Ga0496105_0120349 3300048908 Bacteria 2165
846 Ga0496105_0236473 3300048908 Bacteria 1483
847 Ga0496106_0008552 3300048909 Bacteria 7573
848 Ga0496106_0239793 3300048909 Bacteria 1449
849 Ga0496106_0319474 3300048909 Bacteria 1246
850 Ga0496106_1461730 3300048909 Bacteria 527
851 Ga0496107_0017925 3300048910 Bacteria 4984
852 Ga0496107_0073529 3300048910 Bacteria 2486
853 Ga0496108_0008688 3300048911 Bacteria 8237
854 Ga0496108_0028431 3300048911 Bacteria 4626
855 Ga0496108_0036570 3300048911 Bacteria 4086
856 Ga0496108_0780231 3300048911 Bacteria 825
857 Ga0496109_0220272 3300048912 Bacteria 1784
858 Ga0496109_0646757 3300048912 Bacteria 994
859 Ga0496109_0710562 3300048912 Bacteria 942
860 Ga0496109_0807854 3300048912 Bacteria 876
861 Ga0496109_0985474 3300048912 Bacteria 781
862 Ga0496109_0991424 3300048912 Bacteria 778
863 Ga0496109_1127471 3300048912 Bacteria 721
864 Ga0496110_0018573 3300048913 Bacteria 5831
865 Ga0496110_0045730 3300048913 Bacteria 3827
866 Ga0496110_0059806 3300048913 Bacteria 3359
867 Ga0496111_0012969 3300048914 Bacteria 5657
868 Ga0496111_0044827 3300048914 Bacteria 3179
869 Ga0496111_0046129 3300048914 Bacteria 3137
870 Ga0496111_0902794 3300048914 Bacteria 636
871 Ga0496112_0145827 3300048915 Bacteria 2335
872 Ga0496112_0266690 3300048915 Bacteria 1661
873 Ga0496112_0267068 3300048915 Bacteria 1660
874 Ga0496112_0453393 3300048915 Bacteria 1220
875 Ga0496112_0801616 3300048915 Bacteria 866
876 Ga0496112_1637721 3300048915 Bacteria 557
877 Ga0496113_0083246 3300048916 Bacteria 2455
878 Ga0496113_1156114 3300048916 Bacteria 605
879 Ga0496113_1446134 3300048916 Bacteria 531
880 Ga0496114_0013658 3300048917 Bacteria 6510
881 Ga0496114_0015453 3300048917 Bacteria 6140
882 Ga0496114_0131342 3300048917 Bacteria 2163
883 Ga0496114_0138857 3300048917 Bacteria 2103
884 Ga0496114_0266120 3300048917 Bacteria 1510
885 Ga0496114_1574418 3300048917 Bacteria 545
886 Ga0496115_0054837 3300048918 Bacteria 3201
887 Ga0496115_0136988 3300048918 Bacteria 2019
888 Ga0496115_0691260 3300048918 Bacteria 803
889 Ga0496121_0694921 3300048924 Bacteria 613
890 Ga0501031_0001300 3300049568 Bacteria 15305
891 Ga0501032_0002723 3300049569 Bacteria 13768
892 Ga0501033_0001012 3300049570 Bacteria 25531
893 Ga0501034_0005396 3300049571 Bacteria 13983
894 Ga0501036_0002936 3300049572 Bacteria 13536
895 Ga0501037_0000762 3300049573 Bacteria 24293
896 Ga0501038_0002530 3300049574 Bacteria 17043
897 Ga0501039_0001982 3300049575 Bacteria 15181
898 Ga0501039_0297632 3300049575 Bacteria 1269
899 Ga0501040_0708931 3300049576 Bacteria 728
900 Ga0501040_0974010 3300049576 Bacteria 615
901 Ga0501041_0080848 3300049577 Bacteria 2001
902 Ga0501042_0013258 3300049578 Bacteria 5610
903 Ga0501042_0048501 3300049578 Bacteria 3028
904 Ga0501043_0003230 3300049579 Bacteria 13454
905 Ga0501043_1237984 3300049579 Bacteria 523
906 Ga0501046_0001999 3300049580 Bacteria 19345
907 Ga0501047_0004101 3300049581 Bacteria 13707
908 Ga0501048_0002566 3300049582 Bacteria 13912
909 Ga0501048_0450463 3300049582 Bacteria 922
910 Ga0501048_0454274 3300049582 Bacteria 918
911 Ga0501069_0000857 3300049585 Bacteria 14424
912 Ga0501070_0002800 3300049586 Bacteria 15213
913 Ga0501070_0005891 3300049586 Bacteria 10453
914 Ga0501070_0675974 3300049586 Bacteria 818
915 Ga0501071_0053056 3300049587 Bacteria 2924
916 Ga0501073_0002456 3300049589 Bacteria 13848
917 Ga0501073_0143968 3300049589 Bacteria 1652
918 Ga0501074_0001540 3300049590 Bacteria 15583
919 Ga0501074_0323247 3300049590 Bacteria 1095
920 Ga0501074_0625861 3300049590 Bacteria 761
921 Ga0501075_0112298 3300049591 Bacteria 2072
922 Ga0501076_0007646 3300049592 Bacteria 7869
923 Ga0501076_0990914 3300049592 Bacteria 692
924 Ga0501077_0042956 3300049593 Bacteria 2873
925 Ga0501079_0183716 3300049741 Bacteria 1632
926 Ga0501080_0020280 3300049742 Bacteria 6151
927 Ga0501081_1423497 3300049743 Bacteria 526
928 Ga0501083_0027800 3300049744 Bacteria 3901
929 Ga0501035_0003643 3300049822 Bacteria 14691
930 Ga0501044_0002095 3300049823 Bacteria 22955
931 nmdc:mga0yw44_56291_c1 3300050492 Bacteria 2395
932 nmdc:mga05p37_121068_c1 3300050507 Bacteria 3215
933 nmdc:mga05p37_59067_c1 3300050507 Bacteria 4724
934 nmdc:mga05p37_760326_c1 3300050507 Bacteria 1067
935 nmdc:mga09592_51736_c1 3300050508 Bacteria 3466
936 nmdc:mga09592_64476_c1 3300050508 Bacteria 3102
937 nmdc:mga0qj67_44485_c1 3300050509 Bacteria 3500
938 nmdc:mga0qj67_82906_c1 3300050509 Bacteria 2571
939 nmdc:mga06r32_407571_c1 3300050510 Bacteria 1341
940 nmdc:mga06r32_64776_c1 3300050510 Bacteria 3525
941 nmdc:mga06r32_9872_c1 3300050510 Bacteria 8615
942 nmdc:mga08y16_1309_c1 3300050511 Bacteria 24769
943 nmdc:mga08y16_1611781_c1 3300050511 Bacteria 607
944 nmdc:mga08y16_276818_c1 3300050511 Bacteria 1732
945 nmdc:mga0n895_13485_c1 3300050512 Bacteria 7377
946 nmdc:mga0n895_173546_c1 3300050512 Bacteria 2187
947 nmdc:mga0n895_1943763_c1 3300050512 Bacteria 547
948 nmdc:mga0n895_249179_c1 3300050512 Bacteria 1802
949 nmdc:mga0n895_9256_c1 3300050512 Bacteria 8606
950 nmdc:mga0rr50_16203_c1 3300050513 Bacteria 4943
951 nmdc:mga0rr50_449481_c1 3300050513 Bacteria 1092
952 nmdc:mga0rr50_47287_c1 3300050513 Bacteria 3173
953 nmdc:mga0rr50_56656_c1 3300050513 Bacteria 2929
954 nmdc:mga08x19_1036300_c1 3300050514 Bacteria 583
955 nmdc:mga08x19_20394_c1 3300050514 Bacteria 4081
956 nmdc:mga08x19_5497_c1 3300050514 Bacteria 7496
957 nmdc:mga0a205_30761_c1 3300050515 Bacteria 5142
958 nmdc:mga0a205_358_c1 3300050515 Bacteria 34529
959 Ga0495619_0015246 3300053085 Bacteria 4860
960 Ga0500555_000074 3300053103 Bacteria 48939
961 Ga0500573_0399679 3300053140 Bacteria 651
962 Ga0501084_0002138 3300054114 Bacteria 15787
963 Ga0501084_0791390 3300054114 Bacteria 799
964 Ga0501084_1220617 3300054114 Bacteria 631
965 Ga0501082_0585623 3300060353 Bacteria 976
966 Ga0501082_1238504 3300060353 Bacteria 652

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_11155686 Ga0070685_111556861 104
2 iso_pu_bacteria 2515154088 2515497768 104
3 3300009177 Ga0105248_11531913 Ga0105248_115319131 105
4 3300048917 Ga0496114_1574418 Ga0496114_1574418_14_334 105
5 3300025923 Ga0207681_10793905 Ga0207681_107939052 106
6 3300025929 Ga0207664_11226882 Ga0207664_112268821 106
7 3300031456 Ga0307513_10602461 Ga0307513_106024612 106
8 3300037312 Ga0395899_0014951 Ga0395899_0014951_624_944 106
9 3300037418 Ga0395900_0049920 Ga0395900_0049920_2366_2686 106
10 3300037466 Ga0395898_0037998 Ga0395898_0037998_86_406 106
11 3300037471 Ga0395905_0007193 Ga0395905_0007193_7931_8251 106
12 3300038443 Ga0395901_0061037 Ga0395901_0061037_2338_2658 106
13 3300044842 Ga0466957_0156633 Ga0466957_0156633_122_445 106
14 3300048907 Ga0496104_0837703 Ga0496104_0837703_331_657 106
15 iso_pu_bacteria 2643221694 2644524563 106
16 iso_pu_bacteria 2643221722 2644668662 106
17 3300001991 JGI24743J22301_10070788 JGI24743J22301_100707882 107
18 3300003203 JGI25406J46586_10007697 JGI25406J46586_100076977 107
19 3300003203 JGI25406J46586_10033974 JGI25406J46586_100339742 107
20 3300003203 JGI25406J46586_10054974 JGI25406J46586_100549742 107
21 3300003203 JGI25406J46586_10266530 JGI25406J46586_102665301 107
22 3300003373 JGI25407J50210_10008244 JGI25407J50210_100082442 107
23 3300003373 JGI25407J50210_10028107 JGI25407J50210_100281072 107
24 3300003373 JGI25407J50210_10036134 JGI25407J50210_100361342 107
25 3300003659 JGI25404J52841_10004206 JGI25404J52841_100042063 107
26 3300003756 Ga0055533_1000037 Ga0055533_1000037246 107
27 3300003759 Ga0055525_1000213 Ga0055525_100021313 107
28 3300003762 Ga0055542_1018494 Ga0055542_10184941 107
29 3300003841 Ga0055541_1005331 Ga0055541_10053313 107
30 3300005327 Ga0070658_10038172 Ga0070658_100381725 107
31 3300005327 Ga0070658_10110206 Ga0070658_101102063 107
32 3300005327 Ga0070658_10389061 Ga0070658_103890612 107
33 3300005328 Ga0070676_11190679 Ga0070676_111906792 107
34 3300005329 Ga0070683_100257006 Ga0070683_1002570062 107
35 3300005329 Ga0070683_100333830 Ga0070683_1003338302 107
36 3300005329 Ga0070683_100834527 Ga0070683_1008345272 107
37 3300005330 Ga0070690_100762603 Ga0070690_1007626032 107
38 3300005331 Ga0070670_100021001 Ga0070670_1000210011 107
39 3300005331 Ga0070670_100734323 Ga0070670_1007343232 107
40 3300005334 Ga0068869_100038699 Ga0068869_1000386994 107
41 3300005334 Ga0068869_101261612 Ga0068869_1012616121 107
42 3300005335 Ga0070666_10068916 Ga0070666_100689162 107
43 3300005335 Ga0070666_10192319 Ga0070666_101923192 107
44 3300005336 Ga0070680_100041120 Ga0070680_1000411202 107
45 3300005336 Ga0070680_100965655 Ga0070680_1009656551 107
46 3300005337 Ga0070682_100013934 Ga0070682_1000139343 107
47 3300005337 Ga0070682_100103697 Ga0070682_1001036972 107
48 3300005337 Ga0070682_100237763 Ga0070682_1002377632 107
49 3300005337 Ga0070682_100491589 Ga0070682_1004915892 107
50 3300005338 Ga0068868_100013469 Ga0068868_1000134694 107
51 3300005338 Ga0068868_100272044 Ga0068868_1002720442 107
52 3300005339 Ga0070660_100153526 Ga0070660_1001535263 107
53 3300005339 Ga0070660_100407645 Ga0070660_1004076452 107
54 3300005340 Ga0070689_100271638 Ga0070689_1002716382 107
55 3300005340 Ga0070689_100324361 Ga0070689_1003243612 107
56 3300005341 Ga0070691_10065995 Ga0070691_100659952 107
57 3300005341 Ga0070691_10070934 Ga0070691_100709342 107
58 3300005341 Ga0070691_10352567 Ga0070691_103525672 107
59 3300005344 Ga0070661_100034530 Ga0070661_1000345303 107
60 3300005344 Ga0070661_100124106 Ga0070661_1001241063 107
61 3300005344 Ga0070661_100242129 Ga0070661_1002421292 107
62 3300005345 Ga0070692_10008676 Ga0070692_100086764 107
63 3300005345 Ga0070692_10114790 Ga0070692_101147901 107
64 3300005345 Ga0070692_11310940 Ga0070692_113109401 107
65 3300005347 Ga0070668_100001219 Ga0070668_10000121910 107
66 3300005347 Ga0070668_100029634 Ga0070668_1000296342 107
67 3300005353 Ga0070669_100396893 Ga0070669_1003968932 107
68 3300005354 Ga0070675_100107645 Ga0070675_1001076452 107
69 3300005354 Ga0070675_101321424 Ga0070675_1013214241 107
70 3300005355 Ga0070671_100090338 Ga0070671_1000903382 107
71 3300005355 Ga0070671_100689781 Ga0070671_1006897812 107
72 3300005356 Ga0070674_101838431 Ga0070674_1018384312 107
73 3300005364 Ga0070673_100021977 Ga0070673_1000219774 107
74 3300005364 Ga0070673_100601865 Ga0070673_1006018652 107
75 3300005365 Ga0070688_100312121 Ga0070688_1003121212 107
76 3300005366 Ga0070659_100129509 Ga0070659_1001295093 107
77 3300005366 Ga0070659_101048986 Ga0070659_1010489861 107
78 3300005367 Ga0070667_100568503 Ga0070667_1005685032 107
79 3300005367 Ga0070667_100851522 Ga0070667_1008515222 107
80 3300005434 Ga0070709_10001320 Ga0070709_1000132010 107
81 3300005434 Ga0070709_10002306 Ga0070709_100023063 107
82 3300005434 Ga0070709_10004333 Ga0070709_100043332 107
83 3300005434 Ga0070709_10064843 Ga0070709_100648432 107
84 3300005434 Ga0070709_10182848 Ga0070709_101828482 107
85 3300005434 Ga0070709_10229937 Ga0070709_102299371 107
86 3300005434 Ga0070709_10323552 Ga0070709_103235521 107
87 3300005435 Ga0070714_100012295 Ga0070714_1000122953 107
88 3300005435 Ga0070714_100022554 Ga0070714_1000225544 107
89 3300005435 Ga0070714_100029108 Ga0070714_1000291084 107
90 3300005435 Ga0070714_100059869 Ga0070714_1000598693 107
91 3300005435 Ga0070714_100090938 Ga0070714_1000909382 107
92 3300005435 Ga0070714_100104830 Ga0070714_1001048302 107
93 3300005435 Ga0070714_100153299 Ga0070714_1001532993 107
94 3300005435 Ga0070714_100219458 Ga0070714_1002194582 107
95 3300005435 Ga0070714_100372001 Ga0070714_1003720012 107
96 3300005435 Ga0070714_100428990 Ga0070714_1004289902 107
97 3300005435 Ga0070714_100696060 Ga0070714_1006960601 107
98 3300005435 Ga0070714_100711519 Ga0070714_1007115192 107
99 3300005435 Ga0070714_100961255 Ga0070714_1009612552 107
100 3300005436 Ga0070713_100002321 Ga0070713_1000023215 107
101 3300005436 Ga0070713_100002421 Ga0070713_10000242112 107
102 3300005436 Ga0070713_100002943 Ga0070713_1000029437 107
103 3300005436 Ga0070713_100010961 Ga0070713_1000109616 107
104 3300005436 Ga0070713_100238136 Ga0070713_1002381362 107
105 3300005436 Ga0070713_100351657 Ga0070713_1003516573 107
106 3300005436 Ga0070713_100516385 Ga0070713_1005163852 107
107 3300005436 Ga0070713_100628514 Ga0070713_1006285142 107
108 3300005436 Ga0070713_100734896 Ga0070713_1007348962 107
109 3300005436 Ga0070713_101127378 Ga0070713_1011273781 107
110 3300005436 Ga0070713_101472790 Ga0070713_1014727901 107
111 3300005437 Ga0070710_10000512 Ga0070710_100005129 107
112 3300005437 Ga0070710_10004454 Ga0070710_100044542 107
113 3300005437 Ga0070710_10015851 Ga0070710_100158514 107
114 3300005437 Ga0070710_10020056 Ga0070710_100200565 107
115 3300005437 Ga0070710_10040118 Ga0070710_100401183 107
116 3300005437 Ga0070710_10272355 Ga0070710_102723552 107
117 3300005437 Ga0070710_10362240 Ga0070710_103622401 107
118 3300005437 Ga0070710_11103210 Ga0070710_111032101 107
119 3300005438 Ga0070701_10092096 Ga0070701_100920963 107
120 3300005438 Ga0070701_10433435 Ga0070701_104334352 107
121 3300005439 Ga0070711_100005487 Ga0070711_1000054872 107
122 3300005439 Ga0070711_100030809 Ga0070711_1000308094 107
123 3300005439 Ga0070711_100333210 Ga0070711_1003332102 107
124 3300005439 Ga0070711_101019874 Ga0070711_1010198742 107
125 3300005440 Ga0070705_100238911 Ga0070705_1002389111 107
126 3300005440 Ga0070705_100494546 Ga0070705_1004945462 107
127 3300005440 Ga0070705_101717792 Ga0070705_1017177922 107
128 3300005441 Ga0070700_100451830 Ga0070700_1004518302 107
129 3300005444 Ga0070694_100632133 Ga0070694_1006321331 107
130 3300005445 Ga0070708_100168235 Ga0070708_1001682351 107
131 3300005445 Ga0070708_100203384 Ga0070708_1002033842 107
132 3300005445 Ga0070708_100406644 Ga0070708_1004066442 107
133 3300005445 Ga0070708_100540501 Ga0070708_1005405011 107
134 3300005445 Ga0070708_100553923 Ga0070708_1005539232 107
135 3300005445 Ga0070708_101379914 Ga0070708_1013799142 107
136 3300005455 Ga0070663_100020607 Ga0070663_1000206074 107
137 3300005455 Ga0070663_100461302 Ga0070663_1004613022 107
138 3300005455 Ga0070663_100831430 Ga0070663_1008314302 107
139 3300005456 Ga0070678_100002644 Ga0070678_1000026445 107
140 3300005457 Ga0070662_100241791 Ga0070662_1002417912 107
141 3300005458 Ga0070681_10008574 Ga0070681_100085743 107
142 3300005458 Ga0070681_11005777 Ga0070681_110057772 107
143 3300005466 Ga0070685_10155015 Ga0070685_101550151 107
144 3300005466 Ga0070685_10439352 Ga0070685_104393522 107
145 3300005467 Ga0070706_100019205 Ga0070706_1000192058 107
146 3300005467 Ga0070706_100039511 Ga0070706_1000395112 107
147 3300005467 Ga0070706_100287487 Ga0070706_1002874872 107
148 3300005467 Ga0070706_100900144 Ga0070706_1009001442 107
149 3300005467 Ga0070706_101013608 Ga0070706_1010136082 107
150 3300005468 Ga0070707_100039596 Ga0070707_1000395962 107
151 3300005468 Ga0070707_100047729 Ga0070707_1000477292 107
152 3300005468 Ga0070707_100050119 Ga0070707_1000501192 107
153 3300005468 Ga0070707_100059782 Ga0070707_1000597823 107
154 3300005468 Ga0070707_100125020 Ga0070707_1001250202 107
155 3300005468 Ga0070707_100249130 Ga0070707_1002491302 107
156 3300005468 Ga0070707_100538664 Ga0070707_1005386642 107
157 3300005468 Ga0070707_100665894 Ga0070707_1006658942 107
158 3300005471 Ga0070698_100020088 Ga0070698_1000200882 107
159 3300005471 Ga0070698_100324738 Ga0070698_1003247382 107
160 3300005471 Ga0070698_100481812 Ga0070698_1004818122 107
161 3300005471 Ga0070698_101042316 Ga0070698_1010423162 107
162 3300005471 Ga0070698_101232670 Ga0070698_1012326702 107
163 3300005471 Ga0070698_101356314 Ga0070698_1013563141 107
164 3300005471 Ga0070698_101920449 Ga0070698_1019204491 107
165 3300005471 Ga0070698_102027617 Ga0070698_1020276172 107
166 3300005518 Ga0070699_100000785 Ga0070699_10000078518 107
167 3300005518 Ga0070699_100011306 Ga0070699_1000113069 107
168 3300005518 Ga0070699_100261279 Ga0070699_1002612793 107
169 3300005518 Ga0070699_100449192 Ga0070699_1004491922 107
170 3300005518 Ga0070699_100874746 Ga0070699_1008747462 107
171 3300005530 Ga0070679_100060095 Ga0070679_1000600954 107
172 3300005530 Ga0070679_100300850 Ga0070679_1003008502 107
173 3300005530 Ga0070679_100652936 Ga0070679_1006529362 107
174 3300005530 Ga0070679_101908226 Ga0070679_1019082262 107
175 3300005535 Ga0070684_100025136 Ga0070684_1000251367 107
176 3300005535 Ga0070684_100145155 Ga0070684_1001451552 107
177 3300005535 Ga0070684_100706754 Ga0070684_1007067542 107
178 3300005535 Ga0070684_101531187 Ga0070684_1015311872 107
179 3300005535 Ga0070684_102112453 Ga0070684_1021124531 107
180 3300005536 Ga0070697_100070896 Ga0070697_1000708963 107
181 3300005536 Ga0070697_100071691 Ga0070697_1000716915 107
182 3300005536 Ga0070697_100120123 Ga0070697_1001201232 107
183 3300005536 Ga0070697_100143657 Ga0070697_1001436573 107
184 3300005539 Ga0068853_100460018 Ga0068853_1004600182 107
185 3300005539 Ga0068853_100498959 Ga0068853_1004989591 107
186 3300005543 Ga0070672_100107279 Ga0070672_1001072792 107
187 3300005543 Ga0070672_100252085 Ga0070672_1002520852 107
188 3300005544 Ga0070686_100341183 Ga0070686_1003411831 107
189 3300005544 Ga0070686_100347867 Ga0070686_1003478672 107
190 3300005545 Ga0070695_100500009 Ga0070695_1005000092 107
191 3300005545 Ga0070695_101638621 Ga0070695_1016386211 107
192 3300005547 Ga0070693_100002564 Ga0070693_1000025644 107
193 3300005547 Ga0070693_100081448 Ga0070693_1000814482 107
194 3300005548 Ga0070665_100070048 Ga0070665_1000700483 107
195 3300005548 Ga0070665_100896238 Ga0070665_1008962382 107
196 3300005548 Ga0070665_100934423 Ga0070665_1009344232 107
197 3300005548 Ga0070665_100996707 Ga0070665_1009967072 107
198 3300005548 Ga0070665_102257984 Ga0070665_1022579841 107
199 3300005549 Ga0070704_100596273 Ga0070704_1005962732 107
200 3300005549 Ga0070704_100669049 Ga0070704_1006690492 107
201 3300005549 Ga0070704_100993655 Ga0070704_1009936552 107
202 3300005563 Ga0068855_100191343 Ga0068855_1001913432 107
203 3300005563 Ga0068855_100730427 Ga0068855_1007304272 107
204 3300005563 Ga0068855_102346348 Ga0068855_1023463481 107
205 3300005564 Ga0070664_100007449 Ga0070664_1000074497 107
206 3300005564 Ga0070664_100118621 Ga0070664_1001186212 107
207 3300005564 Ga0070664_100156746 Ga0070664_1001567463 107
208 3300005564 Ga0070664_100165261 Ga0070664_1001652612 107
209 3300005564 Ga0070664_100429402 Ga0070664_1004294022 107
210 3300005564 Ga0070664_101115443 Ga0070664_1011154432 107
211 3300005577 Ga0068857_100179978 Ga0068857_1001799782 107
212 3300005577 Ga0068857_100349631 Ga0068857_1003496312 107
213 3300005577 Ga0068857_100433760 Ga0068857_1004337602 107
214 3300005577 Ga0068857_100560015 Ga0068857_1005600152 107
215 3300005577 Ga0068857_100983861 Ga0068857_1009838611 107
216 3300005577 Ga0068857_101171335 Ga0068857_1011713352 107
217 3300005578 Ga0068854_100019574 Ga0068854_1000195743 107
218 3300005578 Ga0068854_100037937 Ga0068854_1000379374 107
219 3300005578 Ga0068854_101795402 Ga0068854_1017954021 107
220 3300005614 Ga0068856_100038257 Ga0068856_1000382576 107
221 3300005614 Ga0068856_100095798 Ga0068856_1000957982 107
222 3300005614 Ga0068856_100123853 Ga0068856_1001238534 107
223 3300005614 Ga0068856_101916785 Ga0068856_1019167852 107
224 3300005614 Ga0068856_102148813 Ga0068856_1021488131 107
225 3300005614 Ga0068856_102352729 Ga0068856_1023527291 107
226 3300005615 Ga0070702_100002313 Ga0070702_1000023134 107
227 3300005615 Ga0070702_100480488 Ga0070702_1004804882 107
228 3300005616 Ga0068852_100025476 Ga0068852_1000254762 107
229 3300005616 Ga0068852_100050738 Ga0068852_1000507383 107
230 3300005617 Ga0068859_100023228 Ga0068859_1000232288 107
231 3300005617 Ga0068859_100642300 Ga0068859_1006423002 107
232 3300005617 Ga0068859_101919104 Ga0068859_1019191042 107
233 3300005618 Ga0068864_100071138 Ga0068864_1000711382 107
234 3300005618 Ga0068864_100968752 Ga0068864_1009687522 107
235 3300005618 Ga0068864_100991758 Ga0068864_1009917582 107
236 3300005718 Ga0068866_10909144 Ga0068866_109091442 107
237 3300005719 Ga0068861_100341893 Ga0068861_1003418932 107
238 3300005719 Ga0068861_100380552 Ga0068861_1003805522 107
239 3300005719 Ga0068861_100903425 Ga0068861_1009034252 107
240 3300005719 Ga0068861_101112599 Ga0068861_1011125992 107
241 3300005719 Ga0068861_101177455 Ga0068861_1011774552 107
242 3300005719 Ga0068861_101689895 Ga0068861_1016898952 107
243 3300005834 Ga0068851_10016276 Ga0068851_100162761 107
244 3300005834 Ga0068851_10320146 Ga0068851_103201462 107
245 3300005840 Ga0068870_10037323 Ga0068870_100373234 107
246 3300005841 Ga0068863_100022778 Ga0068863_1000227784 107
247 3300005841 Ga0068863_100346517 Ga0068863_1003465172 107
248 3300005841 Ga0068863_100354763 Ga0068863_1003547632 107
249 3300005841 Ga0068863_100499707 Ga0068863_1004997071 107
250 3300005842 Ga0068858_100161042 Ga0068858_1001610423 107
251 3300005842 Ga0068858_100345094 Ga0068858_1003450941 107
252 3300005842 Ga0068858_100462485 Ga0068858_1004624852 107
253 3300005844 Ga0068862_100065634 Ga0068862_1000656344 107
254 3300005844 Ga0068862_100392386 Ga0068862_1003923862 107
255 3300005937 Ga0081455_10009212 Ga0081455_100092123 107
256 3300005937 Ga0081455_10014880 Ga0081455_100148803 107
257 3300005937 Ga0081455_10157084 Ga0081455_101570842 107
258 3300005937 Ga0081455_10332298 Ga0081455_103322982 107
259 3300005937 Ga0081455_10396517 Ga0081455_103965171 107
260 3300005981 Ga0081538_10002082 Ga0081538_100020822 107
261 3300005981 Ga0081538_10002644 Ga0081538_1000264412 107
262 3300005981 Ga0081538_10062235 Ga0081538_100622353 107
263 3300005981 Ga0081538_10086433 Ga0081538_100864333 107
264 3300005981 Ga0081538_10112191 Ga0081538_101121912 107
265 3300005981 Ga0081538_10152866 Ga0081538_101528662 107
266 3300005983 Ga0081540_1002533 Ga0081540_10025334 107
267 3300005983 Ga0081540_1097259 Ga0081540_10972591 107
268 3300005985 Ga0081539_10001085 Ga0081539_1000108548 107
269 3300005985 Ga0081539_10001117 Ga0081539_1000111746 107
270 3300005985 Ga0081539_10002987 Ga0081539_100029878 107
271 3300005985 Ga0081539_10036376 Ga0081539_100363763 107
272 3300006028 Ga0070717_10003459 Ga0070717_100034599 107
273 3300006028 Ga0070717_10009025 Ga0070717_100090257 107
274 3300006028 Ga0070717_10056856 Ga0070717_100568562 107
275 3300006028 Ga0070717_10064331 Ga0070717_100643314 107
276 3300006028 Ga0070717_10089852 Ga0070717_100898523 107
277 3300006028 Ga0070717_10169817 Ga0070717_101698173 107
278 3300006028 Ga0070717_10198306 Ga0070717_101983062 107
279 3300006028 Ga0070717_10294558 Ga0070717_102945581 107
280 3300006028 Ga0070717_10316645 Ga0070717_103166452 107
281 3300006028 Ga0070717_10985185 Ga0070717_109851852 107
282 3300006028 Ga0070717_11845222 Ga0070717_118452221 107
283 3300006028 Ga0070717_11854350 Ga0070717_118543501 107
284 3300006038 Ga0075365_10344220 Ga0075365_103442202 107
285 3300006058 Ga0075432_10002349 Ga0075432_100023495 107
286 3300006058 Ga0075432_10010170 Ga0075432_100101704 107
287 3300006163 Ga0070715_10186259 Ga0070715_101862592 107
288 3300006173 Ga0070716_100008325 Ga0070716_1000083257 107
289 3300006173 Ga0070716_100108502 Ga0070716_1001085022 107
290 3300006173 Ga0070716_100114543 Ga0070716_1001145432 107
291 3300006173 Ga0070716_100198001 Ga0070716_1001980012 107
292 3300006173 Ga0070716_100363275 Ga0070716_1003632752 107
293 3300006173 Ga0070716_101296165 Ga0070716_1012961651 107
294 3300006175 Ga0070712_100002212 Ga0070712_10000221214 107
295 3300006175 Ga0070712_100087131 Ga0070712_1000871314 107
296 3300006175 Ga0070712_100141398 Ga0070712_1001413982 107
297 3300006175 Ga0070712_100470430 Ga0070712_1004704302 107
298 3300006175 Ga0070712_100495388 Ga0070712_1004953882 107
299 3300006175 Ga0070712_100503532 Ga0070712_1005035322 107
300 3300006175 Ga0070712_100984037 Ga0070712_1009840372 107
301 3300006175 Ga0070712_101830300 Ga0070712_1018303001 107
302 3300006237 Ga0097621_100260033 Ga0097621_1002600332 107
303 3300006237 Ga0097621_100467964 Ga0097621_1004679642 107
304 3300006237 Ga0097621_100656297 Ga0097621_1006562972 107
305 3300006237 Ga0097621_101318538 Ga0097621_1013185381 107
306 3300006358 Ga0068871_100044951 Ga0068871_1000449512 107
307 3300006358 Ga0068871_100161655 Ga0068871_1001616553 107
308 3300006358 Ga0068871_100359498 Ga0068871_1003594981 107
309 3300006844 Ga0075428_100006141 Ga0075428_1000061416 107
310 3300006844 Ga0075428_100025139 Ga0075428_1000251394 107
311 3300006844 Ga0075428_100499622 Ga0075428_1004996222 107
312 3300006844 Ga0075428_100509187 Ga0075428_1005091871 107
313 3300006844 Ga0075428_100850765 Ga0075428_1008507652 107
314 3300006846 Ga0075430_100005217 Ga0075430_1000052176 107
315 3300006846 Ga0075430_100020698 Ga0075430_1000206983 107
316 3300006846 Ga0075430_100933851 Ga0075430_1009338511 107
317 3300006847 Ga0075431_100005151 Ga0075431_10000515112 107
318 3300006847 Ga0075431_100025330 Ga0075431_1000253301 107
319 3300006847 Ga0075431_100574965 Ga0075431_1005749652 107
320 3300006852 Ga0075433_10006286 Ga0075433_100062864 107
321 3300006852 Ga0075433_10018598 Ga0075433_100185985 107
322 3300006871 Ga0075434_100001130 Ga0075434_10000113029 107
323 3300006871 Ga0075434_100015099 Ga0075434_10001509911 107
324 3300006871 Ga0075434_100994798 Ga0075434_1009947982 107
325 3300006871 Ga0075434_101012518 Ga0075434_1010125182 107
326 3300006880 Ga0075429_100006139 Ga0075429_1000061392 107
327 3300006880 Ga0075429_100036319 Ga0075429_1000363196 107
328 3300006881 Ga0068865_100927542 Ga0068865_1009275421 107
329 3300006914 Ga0075436_100002659 Ga0075436_10000265913 107
330 3300006914 Ga0075436_100034378 Ga0075436_1000343782 107
331 3300006914 Ga0075436_100190533 Ga0075436_1001905332 107
332 3300006931 Ga0097620_100023228 Ga0097620_1000232288 107
333 3300006931 Ga0097620_100642299 Ga0097620_1006422992 107
334 3300006931 Ga0097620_101919696 Ga0097620_1019196961 107
335 3300007076 Ga0075435_100000977 Ga0075435_1000009772 107
336 3300007076 Ga0075435_100226059 Ga0075435_1002260591 107
337 3300007076 Ga0075435_100362666 Ga0075435_1003626662 107
338 3300007076 Ga0075435_100557574 Ga0075435_1005575742 107
339 3300007076 Ga0075435_101056396 Ga0075435_1010563961 107
340 3300007265 Ga0099794_10230590 Ga0099794_102305902 107
341 3300007788 Ga0099795_10219596 Ga0099795_102195961 107
342 3300007788 Ga0099795_10445883 Ga0099795_104458831 107
343 3300007788 Ga0099795_10488559 Ga0099795_104885591 107
344 3300009011 Ga0105251_10061484 Ga0105251_100614841 107
345 3300009011 Ga0105251_10285873 Ga0105251_102858732 107
346 3300009093 Ga0105240_10124436 Ga0105240_101244364 107
347 3300009093 Ga0105240_10839503 Ga0105240_108395032 107
348 3300009093 Ga0105240_11848787 Ga0105240_118487872 107
349 3300009094 Ga0111539_10000779 Ga0111539_1000077926 107
350 3300009094 Ga0111539_10057760 Ga0111539_100577603 107
351 3300009094 Ga0111539_13358644 Ga0111539_133586441 107
352 3300009098 Ga0105245_10050634 Ga0105245_100506343 107
353 3300009098 Ga0105245_10055174 Ga0105245_100551744 107
354 3300009098 Ga0105245_10072031 Ga0105245_100720312 107
355 3300009101 Ga0105247_10137577 Ga0105247_101375772 107
356 3300009101 Ga0105247_10371112 Ga0105247_103711122 107
357 3300009101 Ga0105247_10539465 Ga0105247_105394652 107
358 3300009147 Ga0114129_10007655 Ga0114129_1000765510 107
359 3300009147 Ga0114129_10069746 Ga0114129_100697467 107
360 3300009147 Ga0114129_10404869 Ga0114129_104048692 107
361 3300009147 Ga0114129_11520637 Ga0114129_115206372 107
362 3300009147 Ga0114129_12234326 Ga0114129_122343261 107
363 3300009148 Ga0105243_10075772 Ga0105243_100757724 107
364 3300009148 Ga0105243_10869678 Ga0105243_108696781 107
365 3300009148 Ga0105243_11493335 Ga0105243_114933351 107
366 3300009148 Ga0105243_12692594 Ga0105243_126925941 107
367 3300009174 Ga0105241_10009288 Ga0105241_100092882 107
368 3300009176 Ga0105242_10870066 Ga0105242_108700662 107
369 3300009177 Ga0105248_10136816 Ga0105248_101368164 107
370 3300009177 Ga0105248_10217530 Ga0105248_102175302 107
371 3300009177 Ga0105248_10325588 Ga0105248_103255883 107
372 3300009177 Ga0105248_11612690 Ga0105248_116126902 107
373 3300009177 Ga0105248_13343083 Ga0105248_133430832 107
374 3300009545 Ga0105237_10141495 Ga0105237_101414952 107
375 3300009545 Ga0105237_10490653 Ga0105237_104906532 107
376 3300009551 Ga0105238_10068794 Ga0105238_100687945 107
377 3300009551 Ga0105238_10249503 Ga0105238_102495032 107
378 3300009551 Ga0105238_10480863 Ga0105238_104808632 107
379 3300009551 Ga0105238_11845401 Ga0105238_118454011 107
380 3300009553 Ga0105249_10470897 Ga0105249_104708972 107
381 3300009553 Ga0105249_12300581 Ga0105249_123005811 107
382 3300010159 Ga0099796_10058857 Ga0099796_100588572 107
383 3300010375 Ga0105239_10238858 Ga0105239_102388582 107
384 3300010375 Ga0105239_10279513 Ga0105239_102795132 107
385 3300010375 Ga0105239_11810169 Ga0105239_118101692 107
386 3300010375 Ga0105239_12555441 Ga0105239_125554411 107
387 3300011119 Ga0105246_10058429 Ga0105246_100584292 107
388 3300011119 Ga0105246_10519190 Ga0105246_105191902 107
389 3300012507 Ga0157342_1031332 Ga0157342_10313321 107
390 3300013100 Ga0157373_10005783 Ga0157373_1000578310 107
391 3300013100 Ga0157373_10057034 Ga0157373_100570344 107
392 3300013100 Ga0157373_10164244 Ga0157373_101642442 107
393 3300013102 Ga0157371_10043385 Ga0157371_100433853 107
394 3300013104 Ga0157370_10035208 Ga0157370_100352084 107
395 3300013104 Ga0157370_10089752 Ga0157370_100897523 107
396 3300013104 Ga0157370_10432114 Ga0157370_104321142 107
397 3300013104 Ga0157370_11178794 Ga0157370_111787941 107
398 3300013105 Ga0157369_10036784 Ga0157369_100367848 107
399 3300013105 Ga0157369_10064667 Ga0157369_100646672 107
400 3300013105 Ga0157369_10297344 Ga0157369_102973442 107
401 3300013105 Ga0157369_10620706 Ga0157369_106207062 107
402 3300013105 Ga0157369_10682308 Ga0157369_106823081 107
403 3300013105 Ga0157369_10838386 Ga0157369_108383862 107
404 3300013105 Ga0157369_11023262 Ga0157369_110232622 107
405 3300013105 Ga0157369_12550043 Ga0157369_125500431 107
406 3300013296 Ga0157374_10028564 Ga0157374_100285644 107
407 3300013296 Ga0157374_10034562 Ga0157374_100345622 107
408 3300013296 Ga0157374_10568542 Ga0157374_105685422 107
409 3300013296 Ga0157374_10580423 Ga0157374_105804232 107
410 3300013296 Ga0157374_11831739 Ga0157374_118317391 107
411 3300013297 Ga0157378_11328338 Ga0157378_113283381 107
412 3300013297 Ga0157378_11504629 Ga0157378_115046292 107
413 3300013297 Ga0157378_12773851 Ga0157378_127738512 107
414 3300013306 Ga0163162_10153877 Ga0163162_101538772 107
415 3300013306 Ga0163162_11231091 Ga0163162_112310912 107
416 3300013306 Ga0163162_11715788 Ga0163162_117157881 107
417 3300013306 Ga0163162_11943863 Ga0163162_119438632 107
418 3300013307 Ga0157372_10269736 Ga0157372_102697362 107
419 3300013307 Ga0157372_10279594 Ga0157372_102795942 107
420 3300013307 Ga0157372_10472484 Ga0157372_104724842 107
421 3300013307 Ga0157372_12132496 Ga0157372_121324962 107
422 3300013307 Ga0157372_12156609 Ga0157372_121566092 107
423 3300013307 Ga0157372_12336230 Ga0157372_123362301 107
424 3300013308 Ga0157375_10041515 Ga0157375_100415153 107
425 3300013308 Ga0157375_10044820 Ga0157375_100448202 107
426 3300013308 Ga0157375_10269535 Ga0157375_102695352 107
427 3300013308 Ga0157375_10325653 Ga0157375_103256532 107
428 3300013308 Ga0157375_10433247 Ga0157375_104332472 107
429 3300013308 Ga0157375_10672843 Ga0157375_106728432 107
430 3300014325 Ga0163163_10020825 Ga0163163_100208255 107
431 3300014325 Ga0163163_10106198 Ga0163163_101061982 107
432 3300014325 Ga0163163_10158736 Ga0163163_101587362 107
433 3300014325 Ga0163163_13003767 Ga0163163_130037672 107
434 3300014326 Ga0157380_10273263 Ga0157380_102732632 107
435 3300014326 Ga0157380_11001833 Ga0157380_110018332 107
436 3300014497 Ga0182008_10301872 Ga0182008_103018722 107
437 3300014745 Ga0157377_10006356 Ga0157377_100063564 107
438 3300014745 Ga0157377_10036159 Ga0157377_100361592 107
439 3300014745 Ga0157377_10372821 Ga0157377_103728211 107
440 3300014968 Ga0157379_10150724 Ga0157379_101507242 107
441 3300014968 Ga0157379_10294462 Ga0157379_102944622 107
442 3300014968 Ga0157379_10690650 Ga0157379_106906502 107
443 3300014969 Ga0157376_10149631 Ga0157376_101496312 107
444 3300014969 Ga0157376_10171726 Ga0157376_101717263 107
445 3300014969 Ga0157376_11279097 Ga0157376_112790972 107
446 3300014969 Ga0157376_11305789 Ga0157376_113057892 107
447 3300020069 Ga0197907_10183059 Ga0197907_101830591 107
448 3300020069 Ga0197907_10763580 Ga0197907_107635802 107
449 3300020070 Ga0206356_11299412 Ga0206356_112994122 107
450 3300020070 Ga0206356_11645124 Ga0206356_116451241 107
451 3300020078 Ga0206352_10448073 Ga0206352_104480732 107
452 3300020081 Ga0206354_10623429 Ga0206354_106234294 107
453 3300020081 Ga0206354_10680820 Ga0206354_106808201 107
454 3300020082 Ga0206353_10190738 Ga0206353_101907381 107
455 3300020082 Ga0206353_10279819 Ga0206353_102798192 107
456 3300020082 Ga0206353_11190550 Ga0206353_111905502 107
457 3300020082 Ga0206353_11823412 Ga0206353_118234122 107
458 3300020610 Ga0154015_1041837 Ga0154015_10418371 107
459 3300021388 Ga0213875_10141861 Ga0213875_101418612 107
460 3300021388 Ga0213875_10152876 Ga0213875_101528761 107
461 3300022467 Ga0224712_10053320 Ga0224712_100533202 107
462 3300022467 Ga0224712_10346946 Ga0224712_103469461 107
463 3300022467 Ga0224712_10432143 Ga0224712_104321431 107
464 3300022467 Ga0224712_10486256 Ga0224712_104862562 107
465 3300025225 Ga0209566_100047 Ga0209566_100047202 107
466 3300025226 Ga0209674_100001 Ga0209674_1000012395 107
467 3300025230 Ga0209563_100001 Ga0209563_1000012395 107
468 3300025253 Ga0209677_100001 Ga0209677_1000012395 107
469 3300025254 Ga0209148_1017874 Ga0209148_10178742 107
470 3300025321 Ga0207656_10004717 Ga0207656_100047174 107
471 3300025735 Ga0207713_1192436 Ga0207713_11924362 107
472 3300025885 Ga0207653_10040605 Ga0207653_100406051 107
473 3300025898 Ga0207692_10001320 Ga0207692_100013204 107
474 3300025898 Ga0207692_10008171 Ga0207692_100081714 107
475 3300025898 Ga0207692_10014042 Ga0207692_100140423 107
476 3300025898 Ga0207692_10139056 Ga0207692_101390562 107
477 3300025898 Ga0207692_10308976 Ga0207692_103089762 107
478 3300025898 Ga0207692_10543912 Ga0207692_105439121 107
479 3300025898 Ga0207692_11002583 Ga0207692_110025832 107
480 3300025899 Ga0207642_10106362 Ga0207642_101063622 107
481 3300025900 Ga0207710_10056367 Ga0207710_100563673 107
482 3300025900 Ga0207710_10265878 Ga0207710_102658781 107
483 3300025901 Ga0207688_10034897 Ga0207688_100348974 107
484 3300025901 Ga0207688_10211840 Ga0207688_102118402 107
485 3300025903 Ga0207680_10073482 Ga0207680_100734822 107
486 3300025903 Ga0207680_10228460 Ga0207680_102284602 107
487 3300025904 Ga0207647_10151859 Ga0207647_101518592 107
488 3300025904 Ga0207647_10153438 Ga0207647_101534382 107
489 3300025905 Ga0207685_10627028 Ga0207685_106270281 107
490 3300025906 Ga0207699_10000150 Ga0207699_1000015030 107
491 3300025906 Ga0207699_10000258 Ga0207699_100002584 107
492 3300025906 Ga0207699_10027274 Ga0207699_100272742 107
493 3300025906 Ga0207699_10063013 Ga0207699_100630132 107
494 3300025906 Ga0207699_10123094 Ga0207699_101230942 107
495 3300025906 Ga0207699_11227137 Ga0207699_112271371 107
496 3300025907 Ga0207645_10230490 Ga0207645_102304902 107
497 3300025907 Ga0207645_10375428 Ga0207645_103754282 107
498 3300025907 Ga0207645_10810261 Ga0207645_108102611 107
499 3300025908 Ga0207643_10001537 Ga0207643_100015374 107
500 3300025908 Ga0207643_10035540 Ga0207643_100355402 107
501 3300025909 Ga0207705_10022571 Ga0207705_100225713 107
502 3300025909 Ga0207705_10793801 Ga0207705_107938012 107
503 3300025909 Ga0207705_11528815 Ga0207705_115288152 107
504 3300025910 Ga0207684_10008759 Ga0207684_100087598 107
505 3300025910 Ga0207684_10016494 Ga0207684_100164946 107
506 3300025910 Ga0207684_10729071 Ga0207684_107290712 107
507 3300025910 Ga0207684_10896393 Ga0207684_108963932 107
508 3300025911 Ga0207654_10019819 Ga0207654_100198192 107
509 3300025912 Ga0207707_10111086 Ga0207707_101110863 107
510 3300025912 Ga0207707_10526153 Ga0207707_105261532 107
511 3300025912 Ga0207707_11061030 Ga0207707_110610302 107
512 3300025913 Ga0207695_10621075 Ga0207695_106210752 107
513 3300025914 Ga0207671_10093394 Ga0207671_100933942 107
514 3300025914 Ga0207671_10621688 Ga0207671_106216881 107
515 3300025914 Ga0207671_11512637 Ga0207671_115126371 107
516 3300025915 Ga0207693_10003060 Ga0207693_1000306016 107
517 3300025915 Ga0207693_10019403 Ga0207693_100194036 107
518 3300025915 Ga0207693_10025702 Ga0207693_100257024 107
519 3300025915 Ga0207693_10083599 Ga0207693_100835991 107
520 3300025915 Ga0207693_10328894 Ga0207693_103288942 107
521 3300025915 Ga0207693_11338969 Ga0207693_113389692 107
522 3300025916 Ga0207663_10002856 Ga0207663_100028564 107
523 3300025916 Ga0207663_10006047 Ga0207663_100060473 107
524 3300025916 Ga0207663_10022592 Ga0207663_100225922 107
525 3300025916 Ga0207663_10677728 Ga0207663_106777282 107
526 3300025916 Ga0207663_11409615 Ga0207663_114096151 107
527 3300025917 Ga0207660_10963190 Ga0207660_109631901 107
528 3300025917 Ga0207660_11661673 Ga0207660_116616731 107
529 3300025918 Ga0207662_10074461 Ga0207662_100744613 107
530 3300025919 Ga0207657_10009474 Ga0207657_100094749 107
531 3300025919 Ga0207657_10062340 Ga0207657_100623402 107
532 3300025919 Ga0207657_10128400 Ga0207657_101284002 107
533 3300025919 Ga0207657_10421494 Ga0207657_104214943 107
534 3300025920 Ga0207649_10004621 Ga0207649_100046214 107
535 3300025920 Ga0207649_10524981 Ga0207649_105249812 107
536 3300025921 Ga0207652_10035081 Ga0207652_100350814 107
537 3300025921 Ga0207652_10254175 Ga0207652_102541752 107
538 3300025921 Ga0207652_10301013 Ga0207652_103010132 107
539 3300025921 Ga0207652_10572801 Ga0207652_105728012 107
540 3300025921 Ga0207652_10674011 Ga0207652_106740112 107
541 3300025921 Ga0207652_11154078 Ga0207652_111540782 107
542 3300025922 Ga0207646_10071910 Ga0207646_100719103 107
543 3300025922 Ga0207646_10120426 Ga0207646_101204262 107
544 3300025922 Ga0207646_10689470 Ga0207646_106894702 107
545 3300025922 Ga0207646_10837273 Ga0207646_108372732 107
546 3300025923 Ga0207681_10252375 Ga0207681_102523752 107
547 3300025923 Ga0207681_10273771 Ga0207681_102737712 107
548 3300025924 Ga0207694_10054897 Ga0207694_100548972 107
549 3300025924 Ga0207694_10206262 Ga0207694_102062622 107
550 3300025925 Ga0207650_10006488 Ga0207650_100064884 107
551 3300025925 Ga0207650_10693905 Ga0207650_106939052 107
552 3300025926 Ga0207659_10019293 Ga0207659_100192932 107
553 3300025926 Ga0207659_11091678 Ga0207659_110916782 107
554 3300025926 Ga0207659_11918544 Ga0207659_119185442 107
555 3300025927 Ga0207687_10016939 Ga0207687_100169394 107
556 3300025927 Ga0207687_10042788 Ga0207687_100427882 107
557 3300025927 Ga0207687_10858755 Ga0207687_108587551 107
558 3300025928 Ga0207700_10000342 Ga0207700_1000034229 107
559 3300025928 Ga0207700_10003386 Ga0207700_100033863 107
560 3300025928 Ga0207700_10031252 Ga0207700_100312524 107
561 3300025928 Ga0207700_10123271 Ga0207700_101232712 107
562 3300025928 Ga0207700_10179195 Ga0207700_101791952 107
563 3300025928 Ga0207700_10184697 Ga0207700_101846972 107
564 3300025928 Ga0207700_10194187 Ga0207700_101941873 107
565 3300025928 Ga0207700_10243232 Ga0207700_102432322 107
566 3300025928 Ga0207700_10320985 Ga0207700_103209852 107
567 3300025928 Ga0207700_10364186 Ga0207700_103641862 107
568 3300025928 Ga0207700_10479384 Ga0207700_104793842 107
569 3300025928 Ga0207700_10841780 Ga0207700_108417802 107
570 3300025929 Ga0207664_10000764 Ga0207664_1000076410 107
571 3300025929 Ga0207664_10007272 Ga0207664_100072722 107
572 3300025929 Ga0207664_10039694 Ga0207664_100396945 107
573 3300025929 Ga0207664_10045733 Ga0207664_100457332 107
574 3300025929 Ga0207664_10061944 Ga0207664_100619444 107
575 3300025929 Ga0207664_10115218 Ga0207664_101152183 107
576 3300025929 Ga0207664_10117186 Ga0207664_101171862 107
577 3300025929 Ga0207664_10223114 Ga0207664_102231142 107
578 3300025929 Ga0207664_10288999 Ga0207664_102889992 107
579 3300025929 Ga0207664_10413801 Ga0207664_104138012 107
580 3300025931 Ga0207644_10024643 Ga0207644_100246434 107
581 3300025932 Ga0207690_10014586 Ga0207690_100145864 107
582 3300025932 Ga0207690_10478164 Ga0207690_104781642 107
583 3300025933 Ga0207706_10152212 Ga0207706_101522122 107
584 3300025934 Ga0207686_10562842 Ga0207686_105628422 107
585 3300025934 Ga0207686_11065082 Ga0207686_110650821 107
586 3300025935 Ga0207709_10585553 Ga0207709_105855532 107
587 3300025935 Ga0207709_10599745 Ga0207709_105997452 107
588 3300025935 Ga0207709_11409206 Ga0207709_114092062 107
589 3300025936 Ga0207670_10174912 Ga0207670_101749122 107
590 3300025936 Ga0207670_11065395 Ga0207670_110653951 107
591 3300025937 Ga0207669_10363868 Ga0207669_103638682 107
592 3300025938 Ga0207704_10532470 Ga0207704_105324702 107
593 3300025939 Ga0207665_10218483 Ga0207665_102184832 107
594 3300025939 Ga0207665_10458653 Ga0207665_104586532 107
595 3300025939 Ga0207665_11248921 Ga0207665_112489211 107
596 3300025940 Ga0207691_10036168 Ga0207691_100361682 107
597 3300025940 Ga0207691_10075071 Ga0207691_100750712 107
598 3300025940 Ga0207691_10643026 Ga0207691_106430262 107
599 3300025940 Ga0207691_11357509 Ga0207691_113575091 107
600 3300025941 Ga0207711_10369020 Ga0207711_103690202 107
601 3300025941 Ga0207711_11124943 Ga0207711_111249432 107
602 3300025942 Ga0207689_10016618 Ga0207689_100166184 107
603 3300025942 Ga0207689_10448093 Ga0207689_104480932 107
604 3300025944 Ga0207661_10019221 Ga0207661_100192215 107
605 3300025944 Ga0207661_11001128 Ga0207661_110011281 107
606 3300025945 Ga0207679_10016528 Ga0207679_100165282 107
607 3300025945 Ga0207679_10157455 Ga0207679_101574552 107
608 3300025945 Ga0207679_10364232 Ga0207679_103642321 107
609 3300025945 Ga0207679_10651961 Ga0207679_106519612 107
610 3300025949 Ga0207667_11459050 Ga0207667_114590501 107
611 3300025960 Ga0207651_10070300 Ga0207651_100703003 107
612 3300025960 Ga0207651_10559166 Ga0207651_105591662 107
613 3300025961 Ga0207712_11213505 Ga0207712_112135052 107
614 3300025961 Ga0207712_11325125 Ga0207712_113251252 107
615 3300025972 Ga0207668_10000895 Ga0207668_100008959 107
616 3300025972 Ga0207668_10010000 Ga0207668_100100005 107
617 3300025981 Ga0207640_10444255 Ga0207640_104442552 107
618 3300025981 Ga0207640_10480978 Ga0207640_104809782 107
619 3300026023 Ga0207677_10006553 Ga0207677_100065534 107
620 3300026023 Ga0207677_10274146 Ga0207677_102741462 107
621 3300026035 Ga0207703_10165713 Ga0207703_101657132 107
622 3300026035 Ga0207703_10829429 Ga0207703_108294292 107
623 3300026041 Ga0207639_10036197 Ga0207639_100361972 107
624 3300026041 Ga0207639_10195969 Ga0207639_101959693 107
625 3300026041 Ga0207639_10438602 Ga0207639_104386022 107
626 3300026041 Ga0207639_10556795 Ga0207639_105567952 107
627 3300026041 Ga0207639_10960221 Ga0207639_109602211 107
628 3300026041 Ga0207639_11869906 Ga0207639_118699062 107
629 3300026067 Ga0207678_10000245 Ga0207678_1000024538 107
630 3300026067 Ga0207678_10157578 Ga0207678_101575782 107
631 3300026067 Ga0207678_11197887 Ga0207678_111978871 107
632 3300026067 Ga0207678_11579235 Ga0207678_115792351 107
633 3300026075 Ga0207708_10445960 Ga0207708_104459602 107
634 3300026078 Ga0207702_10016545 Ga0207702_100165455 107
635 3300026078 Ga0207702_10050305 Ga0207702_100503054 107
636 3300026078 Ga0207702_10052561 Ga0207702_100525612 107
637 3300026078 Ga0207702_10052806 Ga0207702_100528065 107
638 3300026078 Ga0207702_10058099 Ga0207702_100580992 107
639 3300026078 Ga0207702_12424536 Ga0207702_124245361 107
640 3300026088 Ga0207641_10113474 Ga0207641_101134744 107
641 3300026088 Ga0207641_10953715 Ga0207641_109537152 107
642 3300026088 Ga0207641_11197486 Ga0207641_111974862 107
643 3300026095 Ga0207676_10008877 Ga0207676_1000887711 107
644 3300026095 Ga0207676_10142071 Ga0207676_101420712 107
645 3300026095 Ga0207676_10935420 Ga0207676_109354202 107
646 3300026095 Ga0207676_11856005 Ga0207676_118560051 107
647 3300026116 Ga0207674_10012064 Ga0207674_100120642 107
648 3300026116 Ga0207674_10031256 Ga0207674_100312562 107
649 3300026116 Ga0207674_10178177 Ga0207674_101781772 107
650 3300026116 Ga0207674_10436541 Ga0207674_104365412 107
651 3300026116 Ga0207674_10795259 Ga0207674_107952592 107
652 3300026116 Ga0207674_12054716 Ga0207674_120547161 107
653 3300026118 Ga0207675_100330310 Ga0207675_1003303101 107
654 3300026118 Ga0207675_100613426 Ga0207675_1006134262 107
655 3300026118 Ga0207675_100635861 Ga0207675_1006358612 107
656 3300026121 Ga0207683_10001108 Ga0207683_1000110821 107
657 3300026121 Ga0207683_10002188 Ga0207683_1000218813 107
658 3300026121 Ga0207683_10346109 Ga0207683_103461091 107
659 3300026121 Ga0207683_10564555 Ga0207683_105645552 107
660 3300026121 Ga0207683_10582773 Ga0207683_105827732 107
661 3300026121 Ga0207683_10865970 Ga0207683_108659701 107
662 3300026121 Ga0207683_11462997 Ga0207683_114629972 107
663 3300026142 Ga0207698_10155078 Ga0207698_101550783 107
664 3300026142 Ga0207698_10539641 Ga0207698_105396412 107
665 3300027907 Ga0207428_10000872 Ga0207428_1000087227 107
666 3300027907 Ga0207428_10018040 Ga0207428_100180404 107
667 3300028023 Ga0265357_1037029 Ga0265357_10370291 107
668 3300028379 Ga0268266_10193198 Ga0268266_101931983 107
669 3300028379 Ga0268266_10338500 Ga0268266_103385002 107
670 3300028379 Ga0268266_10819094 Ga0268266_108190942 107
671 3300028379 Ga0268266_11210826 Ga0268266_112108261 107
672 3300028380 Ga0268265_10064370 Ga0268265_100643702 107
673 3300028380 Ga0268265_10182625 Ga0268265_101826252 107
674 3300028380 Ga0268265_11823000 Ga0268265_118230002 107
675 3300028381 Ga0268264_10094658 Ga0268264_100946581 107
676 3300028381 Ga0268264_10253131 Ga0268264_102531311 107
677 3300028381 Ga0268264_11108413 Ga0268264_111084131 107
678 3300028794 Ga0307515_10022180 Ga0307515_100221807 107
679 3300028794 Ga0307515_10285349 Ga0307515_102853492 107
680 3300030735 Ga0316178_1102303 Ga0316178_11023032 107
681 3300031018 Ga0265773_1010594 Ga0265773_10105942 107
682 3300031090 Ga0265760_10390584 Ga0265760_103905841 107
683 3300031456 Ga0307513_10008238 Ga0307513_100082387 107
684 3300031456 Ga0307513_10777132 Ga0307513_107771321 107
685 3300031548 Ga0307408_100719299 Ga0307408_1007192992 107
686 3300031548 Ga0307408_101028285 Ga0307408_1010282852 107
687 3300031548 Ga0307408_101410270 Ga0307408_1014102701 107
688 3300031616 Ga0307508_10288622 Ga0307508_102886222 107
689 3300031616 Ga0307508_10456993 Ga0307508_104569932 107
690 3300031731 Ga0307405_11518224 Ga0307405_115182241 107
691 3300031731 Ga0307405_12112871 Ga0307405_121128711 107
692 3300031824 Ga0307413_10739660 Ga0307413_107396602 107
693 3300031852 Ga0307410_10356321 Ga0307410_103563212 107
694 3300031852 Ga0307410_10504610 Ga0307410_105046102 107
695 3300031852 Ga0307410_11415513 Ga0307410_114155132 107
696 3300031901 Ga0307406_10111297 Ga0307406_101112972 107
697 3300031901 Ga0307406_10470331 Ga0307406_104703312 107
698 3300031903 Ga0307407_10110133 Ga0307407_101101332 107
699 3300031903 Ga0307407_10739812 Ga0307407_107398122 107
700 3300031911 Ga0307412_11287458 Ga0307412_112874582 107
701 3300031995 Ga0307409_100017750 Ga0307409_1000177502 107
702 3300031995 Ga0307409_100318710 Ga0307409_1003187102 107
703 3300031995 Ga0307409_100469177 Ga0307409_1004691772 107
704 3300031995 Ga0307409_101057342 Ga0307409_1010573422 107
705 3300031995 Ga0307409_101126369 Ga0307409_1011263692 107
706 3300032002 Ga0307416_100208352 Ga0307416_1002083522 107
707 3300032002 Ga0307416_102670420 Ga0307416_1026704201 107
708 3300032002 Ga0307416_102720673 Ga0307416_1027206732 107
709 3300032004 Ga0307414_10389790 Ga0307414_103897902 107
710 3300032126 Ga0307415_100002122 Ga0307415_10000212210 107
711 3300032126 Ga0307415_100061895 Ga0307415_1000618952 107
712 3300032126 Ga0307415_100277007 Ga0307415_1002770072 107
713 3300032126 Ga0307415_100904689 Ga0307415_1009046891 107
714 3300032126 Ga0307415_102017049 Ga0307415_1020170491 107
715 3300032126 Ga0307415_102017557 Ga0307415_1020175571 107
716 3300034818 Ga0373950_0016362 Ga0373950_0016362_411_734 107
717 3300034820 Ga0373959_0032774 Ga0373959_0032774_54_377 107
718 3300035085 Ga0373929_0247748 Ga0373929_0247748_149_472 107
719 3300035086 Ga0373934_0027878 Ga0373934_0027878_1851_2174 107
720 3300035088 Ga0373940_0039014 Ga0373940_0039014_709_1032 107
721 3300035089 Ga0373944_0352253 Ga0373944_0352253_191_532 107
722 3300035091 Ga0373951_0095711 Ga0373951_0095711_142_465 107
723 3300035111 Ga0373923_0179781 Ga0373923_0179781_48_371 107
724 3300035112 Ga0373932_0281845 Ga0373932_0281845_264_587 107
725 3300035114 Ga0373939_0339072 Ga0373939_0339072_249_572 107
726 3300035115 Ga0373941_0075651 Ga0373941_0075651_529_852 107
727 3300035119 Ga0373956_0159207 Ga0373956_0159207_725_1048 107
728 3300035170 Ga0373943_0982618 Ga0373943_0982618_108_449 107
729 3300035207 Ga0373942_0001721 Ga0373942_0001721_368_691 107
730 3300035241 Ga0373961_0427073 Ga0373961_0427073_20_343 107
731 3300035410 Ga0373924_0135961 Ga0373924_0135961_32_355 107
732 3300035691 Ga0373931_0040996 Ga0373931_0040996_927_1250 107
733 3300035692 Ga0373935_0077170 Ga0373935_0077170_10_333 107
734 3300035692 Ga0373935_0581480 Ga0373935_0581480_278_601 107
735 3300035692 Ga0373935_1224792 Ga0373935_1224792_79_402 107
736 3300035692 Ga0373935_1226145 Ga0373935_1226145_119_442 107
737 3300035695 Ga0373927_1022312 Ga0373927_1022312_61_396 107
738 3300035725 Ga0373947_1021438 Ga0373947_1021438_210_533 107
739 3300036401 Ga0373937_0314138 Ga0373937_0314138_142_471 107
740 3300036401 Ga0373937_1126203 Ga0373937_1126203_205_528 107
741 3300036401 Ga0373937_1506366 Ga0373937_1506366_45_368 107
742 3300036459 Ga0372808_069496 Ga0372808_069496_129_458 107
743 3300037068 Ga0373925_0368795 Ga0373925_0368795_723_1046 107
744 3300037068 Ga0373925_0837743 Ga0373925_0837743_326_667 107
745 3300037312 Ga0395899_0013581 Ga0395899_0013581_1751_2077 107
746 3300037466 Ga0395898_1575792 Ga0395898_1575792_35_358 107
747 3300037471 Ga0395905_1094791 Ga0395905_1094791_149_472 107
748 3300037853 Ga0436364_0929084 Ga0436364_0929084_596_919 107
749 3300037853 Ga0436364_1111965 Ga0436364_1111965_323_652 107
750 3300039450 Ga0436363_0965767 Ga0436363_0965767_184_507 107
751 3300041413 Ga0439465_0302602 Ga0439465_0302602_120_443 107
752 3300041458 Ga0451798_1080448 Ga0451798_1080448_134_457 107
753 3300041486 Ga0451807_2259115 Ga0451807_2259115_27_455 107
754 3300041491 Ga0451833_0052121 Ga0451833_0052121_236_565 107
755 3300041505 Ga0451849_1294102 Ga0451849_1294102_25_348 107
756 3300041511 Ga0451855_1267667 Ga0451855_1267667_302_634 107
757 3300041512 Ga0451853_2986788 Ga0451853_2986788_140_463 107
758 3300041512 Ga0451853_4096721 Ga0451853_4096721_571_903 107
759 3300042438 Ga0439459_0032746 Ga0439459_0032746_714_1037 107
760 3300042993 Ga0439440_0217444 Ga0439440_0217444_135_458 107
761 3300044656 Ga0466969_0047458 Ga0466969_0047458_1228_1554 107
762 3300044656 Ga0466969_0507543 Ga0466969_0507543_150_473 107
763 3300044658 Ga0466972_0105183 Ga0466972_0105183_32_355 107
764 3300044673 Ga0453683_0894406 Ga0453683_0894406_34_363 107
765 3300044684 Ga0466966_0263232 Ga0466966_0263232_318_641 107
766 3300044693 Ga0466961_0593977 Ga0466961_0593977_297_620 107
767 3300044694 Ga0466963_0328042 Ga0466963_0328042_134_463 107
768 3300044694 Ga0466963_0852064 Ga0466963_0852064_240_572 107
769 3300044765 Ga0466970_0006912 Ga0466970_0006912_1071_1394 107
770 3300044765 Ga0466970_0015863 Ga0466970_0015863_1509_1835 107
771 3300044901 Ga0466960_0087663 Ga0466960_0087663_549_872 107
772 3300045049 Ga0466959_0305087 Ga0466959_0305087_570_893 107
773 3300045049 Ga0466959_0450790 Ga0466959_0450790_196_519 107
774 3300045836 Ga0466958_0716806 Ga0466958_0716806_141_464 107
775 3300045836 Ga0466958_0976286 Ga0466958_0976286_103_429 107
776 3300045976 Ga0466967_1652822 Ga0466967_1652822_263_586 107
777 3300046454 Ga0495592_0258794 Ga0495592_0258794_25_348 107
778 3300046463 Ga0495653_0199216 Ga0495653_0199216_484_807 107
779 3300046475 Ga0495639_0170963 Ga0495639_0170963_580_921 107
780 3300046475 Ga0495639_0246501 Ga0495639_0246501_454_780 107
781 3300046476 Ga0495662_0184232 Ga0495662_0184232_91_414 107
782 3300046476 Ga0495662_0211569 Ga0495662_0211569_29_370 107
783 3300046476 Ga0495662_0367777 Ga0495662_0367777_363_686 107
784 3300046477 Ga0495664_0075929 Ga0495664_0075929_570_893 107
785 3300046491 Ga0495584_0523798 Ga0495584_0523798_240_575 107
786 3300046492 Ga0495585_0023230 Ga0495585_0023230_1071_1400 107
787 3300046499 Ga0495594_0016486 Ga0495594_0016486_2424_2759 107
788 3300046500 Ga0495596_0197550 Ga0495596_0197550_255_584 107
789 3300046513 Ga0495616_0219375 Ga0495616_0219375_237_560 107
790 3300046516 Ga0495628_0081651 Ga0495628_0081651_43_366 107
791 3300046516 Ga0495628_0372461 Ga0495628_0372461_457_780 107
792 3300046516 Ga0495628_0430548 Ga0495628_0430548_439_762 107
793 3300046517 Ga0495630_0526150 Ga0495630_0526150_231_554 107
794 3300046523 Ga0495644_0367286 Ga0495644_0367286_216_539 107
795 3300046524 Ga0495648_0167645 Ga0495648_0167645_481_804 107
796 3300046526 Ga0495666_0165238 Ga0495666_0165238_676_999 107
797 3300046526 Ga0495666_0288750 Ga0495666_0288750_369_692 107
798 3300046528 Ga0495642_0141476 Ga0495642_0141476_692_1027 107
799 3300046529 Ga0495652_0586302 Ga0495652_0586302_378_701 107
800 3300046533 Ga0495640_0929569 Ga0495640_0929569_163_489 107
801 3300046543 Ga0495645_0042793 Ga0495645_0042793_2696_3019 107
802 3300046543 Ga0495645_0365805 Ga0495645_0365805_536_859 107
803 3300046558 Ga0495633_0320305 Ga0495633_0320305_286_609 107
804 3300046558 Ga0495633_0414750 Ga0495633_0414750_121_444 107
805 3300046559 Ga0495667_0335436 Ga0495667_0335436_519_842 107
806 3300046559 Ga0495667_0622134 Ga0495667_0622134_37_360 107
807 3300046615 Ga0495656_0430514 Ga0495656_0430514_268_597 107
808 3300046660 Ga0495625_0115890 Ga0495625_0115890_814_1137 107
809 3300046663 Ga0495635_0326208 Ga0495635_0326208_173_496 107
810 3300046664 Ga0495659_0161986 Ga0495659_0161986_49_378 107
811 3300046675 Ga0495657_0001424 Ga0495657_0001424_4055_4378 107
812 3300046675 Ga0495657_0256406 Ga0495657_0256406_181_504 107
813 3300046680 Ga0495646_0182430 Ga0495646_0182430_553_876 107
814 3300046683 Ga0495658_0285175 Ga0495658_0285175_464_799 107
815 3300046689 Ga0495613_0242915 Ga0495613_0242915_745_1068 107
816 3300046690 Ga0495624_0243226 Ga0495624_0243226_716_1039 107
817 3300046690 Ga0495624_0416269 Ga0495624_0416269_156_482 107
818 3300046692 Ga0495671_0332672 Ga0495671_0332672_292_621 107
819 3300046794 Ga0495589_0395302 Ga0495589_0395302_141_476 107
820 3300047315 Ga0495581_0199359 Ga0495581_0199359_479_820 107
821 3300047319 Ga0495674_0095521 Ga0495674_0095521_923_1246 107
822 3300047319 Ga0495674_0771931 Ga0495674_0771931_57_380 107
823 3300047321 Ga0495676_0941417 Ga0495676_0941417_25_348 107
824 3300047322 Ga0495680_0387585 Ga0495680_0387585_212_535 107
825 3300047471 Ga0495684_0504556 Ga0495684_0504556_208_531 107
826 3300048089 Ga0495614_0628929 Ga0495614_0628929_168_497 107
827 3300048091 Ga0495626_0314145 Ga0495626_0314145_251_580 107
828 3300048903 Ga0496100_0080142 Ga0496100_0080142_1054_1377 107
829 3300048903 Ga0496100_0332086 Ga0496100_0332086_438_761 107
830 3300048903 Ga0496100_1641292 Ga0496100_1641292_57_386 107
831 3300048904 Ga0496101_0023810 Ga0496101_0023810_1977_2300 107
832 3300048904 Ga0496101_0033677 Ga0496101_0033677_2276_2599 107
833 3300048904 Ga0496101_0055791 Ga0496101_0055791_1192_1515 107
834 3300048904 Ga0496101_0205505 Ga0496101_0205505_74_403 107
835 3300048904 Ga0496101_1314939 Ga0496101_1314939_68_391 107
836 3300048905 Ga0496102_0024111 Ga0496102_0024111_1441_1764 107
837 3300048905 Ga0496102_0545693 Ga0496102_0545693_497_820 107
838 3300048905 Ga0496102_0933475 Ga0496102_0933475_444_773 107
839 3300048906 Ga0496103_0053368 Ga0496103_0053368_165_488 107
840 3300048907 Ga0496104_0006727 Ga0496104_0006727_6806_7129 107
841 3300048907 Ga0496104_0069812 Ga0496104_0069812_888_1217 107
842 3300048907 Ga0496104_0090841 Ga0496104_0090841_1653_1976 107
843 3300048907 Ga0496104_0100145 Ga0496104_0100145_955_1278 107
844 3300048907 Ga0496104_0164333 Ga0496104_0164333_1326_1649 107
845 3300048907 Ga0496104_0622572 Ga0496104_0622572_588_911 107
846 3300048907 Ga0496104_1807022 Ga0496104_1807022_123_452 107
847 3300048908 Ga0496105_0015618 Ga0496105_0015618_2487_2810 107
848 3300048908 Ga0496105_0107384 Ga0496105_0107384_356_679 107
849 3300048908 Ga0496105_0120349 Ga0496105_0120349_1329_1652 107
850 3300048908 Ga0496105_0236473 Ga0496105_0236473_280_603 107
851 3300048909 Ga0496106_0008552 Ga0496106_0008552_294_617 107
852 3300048909 Ga0496106_0239793 Ga0496106_0239793_578_901 107
853 3300048909 Ga0496106_0319474 Ga0496106_0319474_651_974 107
854 3300048909 Ga0496106_1461730 Ga0496106_1461730_43_366 107
855 3300048910 Ga0496107_0017925 Ga0496107_0017925_2918_3241 107
856 3300048910 Ga0496107_0073529 Ga0496107_0073529_942_1265 107
857 3300048911 Ga0496108_0008688 Ga0496108_0008688_3152_3475 107
858 3300048911 Ga0496108_0028431 Ga0496108_0028431_1078_1401 107
859 3300048911 Ga0496108_0036570 Ga0496108_0036570_3669_3998 107
860 3300048911 Ga0496108_0780231 Ga0496108_0780231_212_535 107
861 3300048912 Ga0496109_0220272 Ga0496109_0220272_68_391 107
862 3300048912 Ga0496109_0646757 Ga0496109_0646757_188_511 107
863 3300048912 Ga0496109_0710562 Ga0496109_0710562_279_602 107
864 3300048912 Ga0496109_0807854 Ga0496109_0807854_21_344 107
865 3300048912 Ga0496109_0985474 Ga0496109_0985474_432_755 107
866 3300048912 Ga0496109_0991424 Ga0496109_0991424_380_724 107
867 3300048912 Ga0496109_1127471 Ga0496109_1127471_215_544 107
868 3300048913 Ga0496110_0018573 Ga0496110_0018573_439_762 107
869 3300048913 Ga0496110_0045730 Ga0496110_0045730_1445_1768 107
870 3300048913 Ga0496110_0059806 Ga0496110_0059806_2594_2917 107
871 3300048914 Ga0496111_0012969 Ga0496111_0012969_2603_2926 107
872 3300048914 Ga0496111_0044827 Ga0496111_0044827_1859_2182 107
873 3300048914 Ga0496111_0046129 Ga0496111_0046129_2060_2383 107
874 3300048914 Ga0496111_0902794 Ga0496111_0902794_182_505 107
875 3300048915 Ga0496112_0145827 Ga0496112_0145827_901_1224 107
876 3300048915 Ga0496112_0266690 Ga0496112_0266690_1166_1489 107
877 3300048915 Ga0496112_0267068 Ga0496112_0267068_1227_1550 107
878 3300048915 Ga0496112_0453393 Ga0496112_0453393_459_782 107
879 3300048915 Ga0496112_0801616 Ga0496112_0801616_487_810 107
880 3300048915 Ga0496112_1637721 Ga0496112_1637721_67_396 107
881 3300048916 Ga0496113_0083246 Ga0496113_0083246_486_809 107
882 3300048916 Ga0496113_1156114 Ga0496113_1156114_268_591 107
883 3300048916 Ga0496113_1446134 Ga0496113_1446134_153_476 107
884 3300048917 Ga0496114_0013658 Ga0496114_0013658_1250_1573 107
885 3300048917 Ga0496114_0015453 Ga0496114_0015453_637_972 107
886 3300048917 Ga0496114_0131342 Ga0496114_0131342_383_715 107
887 3300048917 Ga0496114_0138857 Ga0496114_0138857_366_689 107
888 3300048917 Ga0496114_0266120 Ga0496114_0266120_49_378 107
889 3300048918 Ga0496115_0054837 Ga0496115_0054837_1368_1691 107
890 3300048918 Ga0496115_0136988 Ga0496115_0136988_529_852 107
891 3300048918 Ga0496115_0691260 Ga0496115_0691260_63_392 107
892 3300048924 Ga0496121_0694921 Ga0496121_0694921_23_352 107
893 3300049568 Ga0501031_0001300 Ga0501031_0001300_2359_2688 107
894 3300049569 Ga0501032_0002723 Ga0501032_0002723_2094_2423 107
895 3300049570 Ga0501033_0001012 Ga0501033_0001012_12617_12946 107
896 3300049571 Ga0501034_0005396 Ga0501034_0005396_11346_11675 107
897 3300049572 Ga0501036_0002936 Ga0501036_0002936_1961_2290 107
898 3300049573 Ga0501037_0000762 Ga0501037_0000762_11346_11675 107
899 3300049574 Ga0501038_0002530 Ga0501038_0002530_5369_5698 107
900 3300049575 Ga0501039_0001982 Ga0501039_0001982_11227_11556 107
901 3300049575 Ga0501039_0297632 Ga0501039_0297632_750_1082 107
902 3300049576 Ga0501040_0708931 Ga0501040_0708931_350_673 107
903 3300049576 Ga0501040_0974010 Ga0501040_0974010_16_348 107
904 3300049577 Ga0501041_0080848 Ga0501041_0080848_1509_1841 107
905 3300049578 Ga0501042_0013258 Ga0501042_0013258_3817_4140 107
906 3300049578 Ga0501042_0048501 Ga0501042_0048501_64_393 107
907 3300049579 Ga0501043_0003230 Ga0501043_0003230_2033_2362 107
908 3300049579 Ga0501043_1237984 Ga0501043_1237984_122_454 107
909 3300049580 Ga0501046_0001999 Ga0501046_0001999_7605_7934 107
910 3300049581 Ga0501047_0004101 Ga0501047_0004101_2033_2362 107
911 3300049582 Ga0501048_0002566 Ga0501048_0002566_2266_2595 107
912 3300049582 Ga0501048_0450463 Ga0501048_0450463_488_820 107
913 3300049582 Ga0501048_0454274 Ga0501048_0454274_114_437 107
914 3300049585 Ga0501069_0000857 Ga0501069_0000857_2081_2410 107
915 3300049586 Ga0501070_0002800 Ga0501070_0002800_3560_3889 107
916 3300049586 Ga0501070_0005891 Ga0501070_0005891_4747_5070 107
917 3300049586 Ga0501070_0675974 Ga0501070_0675974_370_702 107
918 3300049587 Ga0501071_0053056 Ga0501071_0053056_1760_2089 107
919 3300049589 Ga0501073_0002456 Ga0501073_0002456_11318_11647 107
920 3300049589 Ga0501073_0143968 Ga0501073_0143968_151_474 107
921 3300049590 Ga0501074_0001540 Ga0501074_0001540_11020_11349 107
922 3300049590 Ga0501074_0323247 Ga0501074_0323247_25_348 107
923 3300049590 Ga0501074_0625861 Ga0501074_0625861_296_628 107
924 3300049591 Ga0501075_0112298 Ga0501075_0112298_1386_1718 107
925 3300049592 Ga0501076_0007646 Ga0501076_0007646_6447_6779 107
926 3300049592 Ga0501076_0990914 Ga0501076_0990914_107_430 107
927 3300049593 Ga0501077_0042956 Ga0501077_0042956_1369_1701 107
928 3300049741 Ga0501079_0183716 Ga0501079_0183716_404_736 107
929 3300049742 Ga0501080_0020280 Ga0501080_0020280_1480_1809 107
930 3300049743 Ga0501081_1423497 Ga0501081_1423497_178_501 107
931 3300049744 Ga0501083_0027800 Ga0501083_0027800_3196_3525 107
932 3300049822 Ga0501035_0003643 Ga0501035_0003643_11346_11675 107
933 3300049823 Ga0501044_0002095 Ga0501044_0002095_11281_11610 107
934 3300050492 nmdc:mga0yw44_56291_c1 nmdc:mga0yw44_56291_c1_36_365 107
935 3300050507 nmdc:mga05p37_121068_c1 nmdc:mga05p37_121068_c1_618_950 107
936 3300050507 nmdc:mga05p37_59067_c1 nmdc:mga05p37_59067_c1_3406_3729 107
937 3300050507 nmdc:mga05p37_760326_c1 nmdc:mga05p37_760326_c1_41_364 107
938 3300050508 nmdc:mga09592_51736_c1 nmdc:mga09592_51736_c1_1937_2260 107
939 3300050508 nmdc:mga09592_64476_c1 nmdc:mga09592_64476_c1_194_526 107
940 3300050509 nmdc:mga0qj67_44485_c1 nmdc:mga0qj67_44485_c1_725_1057 107
941 3300050509 nmdc:mga0qj67_82906_c1 nmdc:mga0qj67_82906_c1_1795_2118 107
942 3300050510 nmdc:mga06r32_407571_c1 nmdc:mga06r32_407571_c1_900_1223 107
943 3300050510 nmdc:mga06r32_64776_c1 nmdc:mga06r32_64776_c1_2450_2782 107
944 3300050510 nmdc:mga06r32_9872_c1 nmdc:mga06r32_9872_c1_3796_4125 107
945 3300050511 nmdc:mga08y16_1309_c1 nmdc:mga08y16_1309_c1_7978_8301 107
946 3300050511 nmdc:mga08y16_1611781_c1 nmdc:mga08y16_1611781_c1_73_396 107
947 3300050511 nmdc:mga08y16_276818_c1 nmdc:mga08y16_276818_c1_984_1307 107
948 3300050512 nmdc:mga0n895_13485_c1 nmdc:mga0n895_13485_c1_744_1067 107
949 3300050512 nmdc:mga0n895_173546_c1 nmdc:mga0n895_173546_c1_838_1167 107
950 3300050512 nmdc:mga0n895_1943763_c1 nmdc:mga0n895_1943763_c1_168_491 107
951 3300050512 nmdc:mga0n895_249179_c1 nmdc:mga0n895_249179_c1_951_1274 107
952 3300050512 nmdc:mga0n895_9256_c1 nmdc:mga0n895_9256_c1_6499_6822 107
953 3300050513 nmdc:mga0rr50_16203_c1 nmdc:mga0rr50_16203_c1_1457_1780 107
954 3300050513 nmdc:mga0rr50_449481_c1 nmdc:mga0rr50_449481_c1_538_867 107
955 3300050513 nmdc:mga0rr50_47287_c1 nmdc:mga0rr50_47287_c1_351_674 107
956 3300050513 nmdc:mga0rr50_56656_c1 nmdc:mga0rr50_56656_c1_1873_2196 107
957 3300050514 nmdc:mga08x19_1036300_c1 nmdc:mga08x19_1036300_c1_224_547 107
958 3300050514 nmdc:mga08x19_20394_c1 nmdc:mga08x19_20394_c1_2784_3107 107
959 3300050514 nmdc:mga08x19_5497_c1 nmdc:mga08x19_5497_c1_3910_4233 107
960 3300050515 nmdc:mga0a205_30761_c1 nmdc:mga0a205_30761_c1_747_1070 107
961 3300050515 nmdc:mga0a205_358_c1 nmdc:mga0a205_358_c1_10686_11009 107
962 3300053085 Ga0495619_0015246 Ga0495619_0015246_1532_1873 107
963 3300053103 Ga0500555_000074 Ga0500555_000074_33568_33903 107
964 3300053140 Ga0500573_0399679 Ga0500573_0399679_175_507 107
965 3300054114 Ga0501084_0002138 Ga0501084_0002138_11034_11363 107
966 3300054114 Ga0501084_0791390 Ga0501084_0791390_455_787 107
967 3300054114 Ga0501084_1220617 Ga0501084_1220617_165_488 107
968 3300060353 Ga0501082_0585623 Ga0501082_0585623_57_380 107
969 3300060353 Ga0501082_1238504 Ga0501082_1238504_303_626 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

23

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8564 1 106
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8415 1 106
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.706 2 107
2nzc-assembly1.cif.gz_C the structure of uncharacterized protein tm1266 from thermotoga maritima. 0.6964 2 107
2ivm-assembly1.cif.gz_A crystal structure of a transcriptional regulator 0.6867 1 107
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8564 1 106 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8415 1 106 3.30.70.1060
af_A0A0R4IB99_228_352_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7366 75 99 2.30.29.30
af_Q9H254_2415_2531_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.735 73 98 2.30.29.30
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7105 2 104 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A6I1G324-F1-model_v4 YCII-related domain-containing protein 0.9807 16 107
AF-A0A1H8SN34-F1-model_v4 Uncharacterized conserved protein 0.9757 1 107
AF-A0A5D0TX26-F1-model_v4 YCII-related domain-containing protein 0.9736 16 107
AF-A0A1H8SN34-F1-model_v4 Uncharacterized conserved protein 0.9668 1 107
AF-A0A563E7U6-F1-model_v4 YCII-related domain-containing protein 0.9667 16 107

Feature Viewer

pLDDT pTM Quality
93.48 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map