F487068
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 387 | 966 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300028023|Ga0265357_1037029|Ga0265357_10370291 |
| Length | 129 |
| Sequence | MAPRQDERPPTRAPRTTGDDPRMQYLVSVIFDHAGLATPDEDAQIDVFNDRLVAEGHWVFAGGLAAPSSATVIDNRGEEALVTDGPFLESKEFIAGFWIIEAADLDVALRLAAEGSRACNRKVEVRPFQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 2 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 3 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 222 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 271 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 272 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 275 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 278 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 386 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 1.96 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0 |
| Rhizoplane | 7.02 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10070788 | 3300001991 | Bacteria | 727 |
| 2 | JGI25406J46586_10007697 | 3300003203 | Bacteria | 4899 |
| 3 | JGI25406J46586_10033974 | 3300003203 | Bacteria | 1877 |
| 4 | JGI25406J46586_10054974 | 3300003203 | Bacteria | 1313 |
| 5 | JGI25406J46586_10266530 | 3300003203 | Bacteria | 505 |
| 6 | JGI25407J50210_10008244 | 3300003373 | Bacteria | 2625 |
| 7 | JGI25407J50210_10028107 | 3300003373 | Bacteria | 1459 |
| 8 | JGI25407J50210_10036134 | 3300003373 | Bacteria | 1271 |
| 9 | JGI25404J52841_10004206 | 3300003659 | Bacteria | 2897 |
| 10 | Ga0055533_1000037 | 3300003756 | Bacteria | 255573 |
| 11 | Ga0055525_1000213 | 3300003759 | Bacteria | 64854 |
| 12 | Ga0055542_1018494 | 3300003762 | Bacteria | 1055 |
| 13 | Ga0055541_1005331 | 3300003841 | Bacteria | 2253 |
| 14 | Ga0070658_10038172 | 3300005327 | Bacteria | 3874 |
| 15 | Ga0070658_10110206 | 3300005327 | Bacteria | 2280 |
| 16 | Ga0070658_10389061 | 3300005327 | Bacteria | 1197 |
| 17 | Ga0070676_11190679 | 3300005328 | Bacteria | 579 |
| 18 | Ga0070683_100257006 | 3300005329 | Bacteria | 1661 |
| 19 | Ga0070683_100333830 | 3300005329 | Bacteria | 1443 |
| 20 | Ga0070683_100834527 | 3300005329 | Bacteria | 884 |
| 21 | Ga0070690_100762603 | 3300005330 | Bacteria | 748 |
| 22 | Ga0070670_100021001 | 3300005331 | Bacteria | 5614 |
| 23 | Ga0070670_100734323 | 3300005331 | Bacteria | 889 |
| 24 | Ga0068869_100038699 | 3300005334 | Bacteria | 3402 |
| 25 | Ga0068869_101261612 | 3300005334 | Bacteria | 651 |
| 26 | Ga0070666_10068916 | 3300005335 | Bacteria | 2404 |
| 27 | Ga0070666_10192319 | 3300005335 | Bacteria | 1434 |
| 28 | Ga0070680_100041120 | 3300005336 | Bacteria | 3747 |
| 29 | Ga0070680_100965655 | 3300005336 | Bacteria | 735 |
| 30 | Ga0070682_100013934 | 3300005337 | Bacteria | 4638 |
| 31 | Ga0070682_100103697 | 3300005337 | Bacteria | 1882 |
| 32 | Ga0070682_100237763 | 3300005337 | Bacteria | 1306 |
| 33 | Ga0070682_100491589 | 3300005337 | Bacteria | 949 |
| 34 | Ga0068868_100013469 | 3300005338 | Bacteria | 5995 |
| 35 | Ga0068868_100272044 | 3300005338 | Bacteria | 1431 |
| 36 | Ga0070660_100153526 | 3300005339 | Bacteria | 1852 |
| 37 | Ga0070660_100407645 | 3300005339 | Bacteria | 1124 |
| 38 | Ga0070689_100271638 | 3300005340 | Bacteria | 1404 |
| 39 | Ga0070689_100324361 | 3300005340 | Bacteria | 1287 |
| 40 | Ga0070691_10065995 | 3300005341 | Bacteria | 1748 |
| 41 | Ga0070691_10070934 | 3300005341 | Bacteria | 1691 |
| 42 | Ga0070691_10352567 | 3300005341 | Bacteria | 817 |
| 43 | Ga0070661_100034530 | 3300005344 | Bacteria | 3667 |
| 44 | Ga0070661_100124106 | 3300005344 | Bacteria | 1936 |
| 45 | Ga0070661_100242129 | 3300005344 | Bacteria | 1389 |
| 46 | Ga0070692_10008676 | 3300005345 | Bacteria | 4544 |
| 47 | Ga0070692_10114790 | 3300005345 | Bacteria | 1494 |
| 48 | Ga0070692_11310940 | 3300005345 | Bacteria | 520 |
| 49 | Ga0070668_100001219 | 3300005347 | Bacteria | 18270 |
| 50 | Ga0070668_100029634 | 3300005347 | Bacteria | 4157 |
| 51 | Ga0070669_100396893 | 3300005353 | Bacteria | 1128 |
| 52 | Ga0070675_100107645 | 3300005354 | Bacteria | 2354 |
| 53 | Ga0070675_101321424 | 3300005354 | Bacteria | 664 |
| 54 | Ga0070671_100090338 | 3300005355 | Bacteria | 2564 |
| 55 | Ga0070671_100689781 | 3300005355 | Bacteria | 885 |
| 56 | Ga0070674_101838431 | 3300005356 | Bacteria | 550 |
| 57 | Ga0070673_100021977 | 3300005364 | Bacteria | 4636 |
| 58 | Ga0070673_100601865 | 3300005364 | Bacteria | 1003 |
| 59 | Ga0070688_100312121 | 3300005365 | Bacteria | 1140 |
| 60 | Ga0070659_100129509 | 3300005366 | Bacteria | 2048 |
| 61 | Ga0070659_101048986 | 3300005366 | Bacteria | 717 |
| 62 | Ga0070667_100568503 | 3300005367 | Bacteria | 1043 |
| 63 | Ga0070667_100851522 | 3300005367 | Bacteria | 848 |
| 64 | Ga0070709_10001320 | 3300005434 | Bacteria | 13526 |
| 65 | Ga0070709_10002306 | 3300005434 | Bacteria | 10363 |
| 66 | Ga0070709_10004333 | 3300005434 | Bacteria | 7647 |
| 67 | Ga0070709_10064843 | 3300005434 | Bacteria | 2337 |
| 68 | Ga0070709_10182848 | 3300005434 | Bacteria | 1473 |
| 69 | Ga0070709_10229937 | 3300005434 | Bacteria | 1326 |
| 70 | Ga0070709_10323552 | 3300005434 | Bacteria | 1132 |
| 71 | Ga0070714_100012295 | 3300005435 | Bacteria | 6829 |
| 72 | Ga0070714_100022554 | 3300005435 | Bacteria | 5163 |
| 73 | Ga0070714_100029108 | 3300005435 | Bacteria | 4589 |
| 74 | Ga0070714_100059869 | 3300005435 | Bacteria | 3267 |
| 75 | Ga0070714_100090938 | 3300005435 | Bacteria | 2673 |
| 76 | Ga0070714_100104830 | 3300005435 | Bacteria | 2495 |
| 77 | Ga0070714_100153299 | 3300005435 | Bacteria | 2078 |
| 78 | Ga0070714_100219458 | 3300005435 | Bacteria | 1747 |
| 79 | Ga0070714_100372001 | 3300005435 | Bacteria | 1346 |
| 80 | Ga0070714_100428990 | 3300005435 | Bacteria | 1253 |
| 81 | Ga0070714_100696060 | 3300005435 | Bacteria | 980 |
| 82 | Ga0070714_100711519 | 3300005435 | Bacteria | 969 |
| 83 | Ga0070714_100961255 | 3300005435 | Bacteria | 830 |
| 84 | Ga0070713_100002321 | 3300005436 | Bacteria | 12397 |
| 85 | Ga0070713_100002421 | 3300005436 | Bacteria | 12178 |
| 86 | Ga0070713_100002943 | 3300005436 | Bacteria | 11165 |
| 87 | Ga0070713_100010961 | 3300005436 | Bacteria | 6574 |
| 88 | Ga0070713_100238136 | 3300005436 | Bacteria | 1656 |
| 89 | Ga0070713_100351657 | 3300005436 | Bacteria | 1367 |
| 90 | Ga0070713_100516385 | 3300005436 | Bacteria | 1128 |
| 91 | Ga0070713_100628514 | 3300005436 | Bacteria | 1021 |
| 92 | Ga0070713_100734896 | 3300005436 | Bacteria | 944 |
| 93 | Ga0070713_101127378 | 3300005436 | Bacteria | 758 |
| 94 | Ga0070713_101472790 | 3300005436 | Bacteria | 660 |
| 95 | Ga0070710_10000512 | 3300005437 | Bacteria | 18260 |
| 96 | Ga0070710_10004454 | 3300005437 | Bacteria | 6628 |
| 97 | Ga0070710_10015851 | 3300005437 | Bacteria | 3822 |
| 98 | Ga0070710_10020056 | 3300005437 | Bacteria | 3464 |
| 99 | Ga0070710_10040118 | 3300005437 | Bacteria | 2579 |
| 100 | Ga0070710_10272355 | 3300005437 | Bacteria | 1095 |
| 101 | Ga0070710_10362240 | 3300005437 | Bacteria | 962 |
| 102 | Ga0070710_11103210 | 3300005437 | Bacteria | 583 |
| 103 | Ga0070701_10092096 | 3300005438 | Bacteria | 1663 |
| 104 | Ga0070701_10433435 | 3300005438 | Bacteria | 840 |
| 105 | Ga0070711_100005487 | 3300005439 | Bacteria | 7590 |
| 106 | Ga0070711_100030809 | 3300005439 | Bacteria | 3555 |
| 107 | Ga0070711_100333210 | 3300005439 | Bacteria | 1215 |
| 108 | Ga0070711_101019874 | 3300005439 | Bacteria | 710 |
| 109 | Ga0070705_100238911 | 3300005440 | Bacteria | 1268 |
| 110 | Ga0070705_100494546 | 3300005440 | Bacteria | 927 |
| 111 | Ga0070705_101717792 | 3300005440 | Bacteria | 531 |
| 112 | Ga0070700_100451830 | 3300005441 | Bacteria | 978 |
| 113 | Ga0070694_100632133 | 3300005444 | Bacteria | 865 |
| 114 | Ga0070708_100168235 | 3300005445 | Bacteria | 2045 |
| 115 | Ga0070708_100203384 | 3300005445 | Bacteria | 1854 |
| 116 | Ga0070708_100406644 | 3300005445 | Bacteria | 1283 |
| 117 | Ga0070708_100540501 | 3300005445 | Bacteria | 1099 |
| 118 | Ga0070708_100553923 | 3300005445 | Bacteria | 1084 |
| 119 | Ga0070708_101379914 | 3300005445 | Bacteria | 657 |
| 120 | Ga0070663_100020607 | 3300005455 | Bacteria | 4366 |
| 121 | Ga0070663_100461302 | 3300005455 | Bacteria | 1049 |
| 122 | Ga0070663_100831430 | 3300005455 | Bacteria | 794 |
| 123 | Ga0070678_100002644 | 3300005456 | Bacteria | 9864 |
| 124 | Ga0070662_100241791 | 3300005457 | Bacteria | 1448 |
| 125 | Ga0070681_10008574 | 3300005458 | Bacteria | 10016 |
| 126 | Ga0070681_11005777 | 3300005458 | Bacteria | 753 |
| 127 | Ga0070685_10155015 | 3300005466 | Bacteria | 1455 |
| 128 | Ga0070685_10439352 | 3300005466 | Bacteria | 912 |
| 129 | Ga0070685_11155686 | 3300005466 | Bacteria | 587 |
| 130 | Ga0070706_100019205 | 3300005467 | Bacteria | 6306 |
| 131 | Ga0070706_100039511 | 3300005467 | Bacteria | 4356 |
| 132 | Ga0070706_100287487 | 3300005467 | Bacteria | 1534 |
| 133 | Ga0070706_100900144 | 3300005467 | Bacteria | 818 |
| 134 | Ga0070706_101013608 | 3300005467 | Bacteria | 765 |
| 135 | Ga0070707_100039596 | 3300005468 | Bacteria | 4505 |
| 136 | Ga0070707_100047729 | 3300005468 | Bacteria | 4099 |
| 137 | Ga0070707_100050119 | 3300005468 | Bacteria | 4002 |
| 138 | Ga0070707_100059782 | 3300005468 | Bacteria | 3655 |
| 139 | Ga0070707_100125020 | 3300005468 | Bacteria | 2498 |
| 140 | Ga0070707_100249130 | 3300005468 | Bacteria | 1728 |
| 141 | Ga0070707_100538664 | 3300005468 | Bacteria | 1129 |
| 142 | Ga0070707_100665894 | 3300005468 | Bacteria | 1004 |
| 143 | Ga0070698_100020088 | 3300005471 | Bacteria | 7002 |
| 144 | Ga0070698_100324738 | 3300005471 | Bacteria | 1470 |
| 145 | Ga0070698_100481812 | 3300005471 | Bacteria | 1178 |
| 146 | Ga0070698_101042316 | 3300005471 | Bacteria | 766 |
| 147 | Ga0070698_101232670 | 3300005471 | Bacteria | 698 |
| 148 | Ga0070698_101356314 | 3300005471 | Bacteria | 662 |
| 149 | Ga0070698_101920449 | 3300005471 | Bacteria | 545 |
| 150 | Ga0070698_102027617 | 3300005471 | Bacteria | 529 |
| 151 | Ga0070699_100000785 | 3300005518 | Bacteria | 29304 |
| 152 | Ga0070699_100011306 | 3300005518 | Bacteria | 7712 |
| 153 | Ga0070699_100261279 | 3300005518 | Bacteria | 1548 |
| 154 | Ga0070699_100449192 | 3300005518 | Bacteria | 1169 |
| 155 | Ga0070699_100874746 | 3300005518 | Bacteria | 823 |
| 156 | Ga0070679_100060095 | 3300005530 | Bacteria | 3787 |
| 157 | Ga0070679_100300850 | 3300005530 | Bacteria | 1555 |
| 158 | Ga0070679_100652936 | 3300005530 | Bacteria | 995 |
| 159 | Ga0070679_101908226 | 3300005530 | Bacteria | 543 |
| 160 | Ga0070684_100025136 | 3300005535 | Bacteria | 5002 |
| 161 | Ga0070684_100145155 | 3300005535 | Bacteria | 2148 |
| 162 | Ga0070684_100706754 | 3300005535 | Bacteria | 940 |
| 163 | Ga0070684_101531187 | 3300005535 | Bacteria | 629 |
| 164 | Ga0070684_102112453 | 3300005535 | Bacteria | 531 |
| 165 | Ga0070697_100070896 | 3300005536 | Bacteria | 2858 |
| 166 | Ga0070697_100071691 | 3300005536 | Bacteria | 2842 |
| 167 | Ga0070697_100120123 | 3300005536 | Bacteria | 2198 |
| 168 | Ga0070697_100143657 | 3300005536 | Bacteria | 2008 |
| 169 | Ga0068853_100460018 | 3300005539 | Bacteria | 1197 |
| 170 | Ga0068853_100498959 | 3300005539 | Bacteria | 1149 |
| 171 | Ga0070672_100107279 | 3300005543 | Bacteria | 2273 |
| 172 | Ga0070672_100252085 | 3300005543 | Bacteria | 1487 |
| 173 | Ga0070686_100341183 | 3300005544 | Bacteria | 1123 |
| 174 | Ga0070686_100347867 | 3300005544 | Bacteria | 1113 |
| 175 | Ga0070695_100500009 | 3300005545 | Bacteria | 940 |
| 176 | Ga0070695_101638621 | 3300005545 | Bacteria | 538 |
| 177 | Ga0070693_100002564 | 3300005547 | Bacteria | 8374 |
| 178 | Ga0070693_100081448 | 3300005547 | Bacteria | 1930 |
| 179 | Ga0070665_100070048 | 3300005548 | Bacteria | 3513 |
| 180 | Ga0070665_100896238 | 3300005548 | Bacteria | 900 |
| 181 | Ga0070665_100934423 | 3300005548 | Bacteria | 880 |
| 182 | Ga0070665_100996707 | 3300005548 | Bacteria | 850 |
| 183 | Ga0070665_102257984 | 3300005548 | Bacteria | 547 |
| 184 | Ga0070704_100596273 | 3300005549 | Bacteria | 970 |
| 185 | Ga0070704_100669049 | 3300005549 | Bacteria | 918 |
| 186 | Ga0070704_100993655 | 3300005549 | Bacteria | 759 |
| 187 | Ga0068855_100191343 | 3300005563 | Bacteria | 2307 |
| 188 | Ga0068855_100730427 | 3300005563 | Bacteria | 1057 |
| 189 | Ga0068855_102346348 | 3300005563 | Bacteria | 533 |
| 190 | Ga0070664_100007449 | 3300005564 | Bacteria | 8836 |
| 191 | Ga0070664_100118621 | 3300005564 | Bacteria | 2315 |
| 192 | Ga0070664_100156746 | 3300005564 | Bacteria | 2012 |
| 193 | Ga0070664_100165261 | 3300005564 | Bacteria | 1960 |
| 194 | Ga0070664_100429402 | 3300005564 | Bacteria | 1211 |
| 195 | Ga0070664_101115443 | 3300005564 | Bacteria | 743 |
| 196 | Ga0068857_100179978 | 3300005577 | Bacteria | 1924 |
| 197 | Ga0068857_100349631 | 3300005577 | Bacteria | 1369 |
| 198 | Ga0068857_100433760 | 3300005577 | Bacteria | 1227 |
| 199 | Ga0068857_100560015 | 3300005577 | Bacteria | 1077 |
| 200 | Ga0068857_100983861 | 3300005577 | Bacteria | 811 |
| 201 | Ga0068857_101171335 | 3300005577 | Bacteria | 744 |
| 202 | Ga0068854_100019574 | 3300005578 | Bacteria | 4565 |
| 203 | Ga0068854_100037937 | 3300005578 | Bacteria | 3385 |
| 204 | Ga0068854_101795402 | 3300005578 | Bacteria | 562 |
| 205 | Ga0068856_100038257 | 3300005614 | Bacteria | 4709 |
| 206 | Ga0068856_100095798 | 3300005614 | Bacteria | 2956 |
| 207 | Ga0068856_100123853 | 3300005614 | Bacteria | 2587 |
| 208 | Ga0068856_101916785 | 3300005614 | Bacteria | 603 |
| 209 | Ga0068856_102148813 | 3300005614 | Bacteria | 568 |
| 210 | Ga0068856_102352729 | 3300005614 | Bacteria | 540 |
| 211 | Ga0070702_100002313 | 3300005615 | Bacteria | 8175 |
| 212 | Ga0070702_100480488 | 3300005615 | Bacteria | 908 |
| 213 | Ga0068852_100025476 | 3300005616 | Bacteria | 4793 |
| 214 | Ga0068852_100050738 | 3300005616 | Bacteria | 3557 |
| 215 | Ga0068859_100023228 | 3300005617 | Bacteria | 6223 |
| 216 | Ga0068859_100642300 | 3300005617 | Bacteria | 1153 |
| 217 | Ga0068859_101919104 | 3300005617 | Bacteria | 654 |
| 218 | Ga0068864_100071138 | 3300005618 | Bacteria | 3028 |
| 219 | Ga0068864_100968752 | 3300005618 | Bacteria | 842 |
| 220 | Ga0068864_100991758 | 3300005618 | Bacteria | 833 |
| 221 | Ga0068866_10909144 | 3300005718 | Bacteria | 620 |
| 222 | Ga0068861_100341893 | 3300005719 | Bacteria | 1310 |
| 223 | Ga0068861_100380552 | 3300005719 | Bacteria | 1247 |
| 224 | Ga0068861_100903425 | 3300005719 | Bacteria | 836 |
| 225 | Ga0068861_101112599 | 3300005719 | Bacteria | 760 |
| 226 | Ga0068861_101177455 | 3300005719 | Bacteria | 740 |
| 227 | Ga0068861_101689895 | 3300005719 | Bacteria | 626 |
| 228 | Ga0068851_10016276 | 3300005834 | Bacteria | 3557 |
| 229 | Ga0068851_10320146 | 3300005834 | Bacteria | 896 |
| 230 | Ga0068870_10037323 | 3300005840 | Bacteria | 2504 |
| 231 | Ga0068863_100022778 | 3300005841 | Bacteria | 5983 |
| 232 | Ga0068863_100346517 | 3300005841 | Bacteria | 1446 |
| 233 | Ga0068863_100354763 | 3300005841 | Bacteria | 1429 |
| 234 | Ga0068863_100499707 | 3300005841 | Bacteria | 1197 |
| 235 | Ga0068858_100161042 | 3300005842 | Bacteria | 2113 |
| 236 | Ga0068858_100345094 | 3300005842 | Bacteria | 1425 |
| 237 | Ga0068858_100462485 | 3300005842 | Bacteria | 1223 |
| 238 | Ga0068862_100065634 | 3300005844 | Bacteria | 3127 |
| 239 | Ga0068862_100392386 | 3300005844 | Bacteria | 1297 |
| 240 | Ga0081455_10009212 | 3300005937 | Bacteria | 10173 |
| 241 | Ga0081455_10014880 | 3300005937 | Bacteria | 7586 |
| 242 | Ga0081455_10157084 | 3300005937 | Bacteria | 1747 |
| 243 | Ga0081455_10332298 | 3300005937 | Bacteria | 1078 |
| 244 | Ga0081455_10396517 | 3300005937 | Bacteria | 959 |
| 245 | Ga0081538_10002082 | 3300005981 | Bacteria | 19934 |
| 246 | Ga0081538_10002644 | 3300005981 | Bacteria | 17290 |
| 247 | Ga0081538_10062235 | 3300005981 | Bacteria | 2130 |
| 248 | Ga0081538_10086433 | 3300005981 | Bacteria | 1642 |
| 249 | Ga0081538_10112191 | 3300005981 | Bacteria | 1335 |
| 250 | Ga0081538_10152866 | 3300005981 | Bacteria | 1041 |
| 251 | Ga0081540_1002533 | 3300005983 | Bacteria | 14823 |
| 252 | Ga0081540_1097259 | 3300005983 | Bacteria | 1278 |
| 253 | Ga0081539_10001085 | 3300005985 | Bacteria | 49445 |
| 254 | Ga0081539_10001117 | 3300005985 | Bacteria | 48683 |
| 255 | Ga0081539_10002987 | 3300005985 | Bacteria | 22140 |
| 256 | Ga0081539_10036376 | 3300005985 | Bacteria | 2948 |
| 257 | Ga0070717_10003459 | 3300006028 | Bacteria | 11303 |
| 258 | Ga0070717_10009025 | 3300006028 | Bacteria | 7484 |
| 259 | Ga0070717_10056856 | 3300006028 | Bacteria | 3233 |
| 260 | Ga0070717_10064331 | 3300006028 | Bacteria | 3046 |
| 261 | Ga0070717_10089852 | 3300006028 | Bacteria | 2591 |
| 262 | Ga0070717_10169817 | 3300006028 | Bacteria | 1896 |
| 263 | Ga0070717_10198306 | 3300006028 | Bacteria | 1757 |
| 264 | Ga0070717_10294558 | 3300006028 | Bacteria | 1441 |
| 265 | Ga0070717_10316645 | 3300006028 | Bacteria | 1389 |
| 266 | Ga0070717_10985185 | 3300006028 | Bacteria | 768 |
| 267 | Ga0070717_11845222 | 3300006028 | Bacteria | 546 |
| 268 | Ga0070717_11854350 | 3300006028 | Bacteria | 544 |
| 269 | Ga0075365_10344220 | 3300006038 | Bacteria | 1051 |
| 270 | Ga0075432_10002349 | 3300006058 | Bacteria | 6307 |
| 271 | Ga0075432_10010170 | 3300006058 | Bacteria | 3193 |
| 272 | Ga0070715_10186259 | 3300006163 | Bacteria | 1045 |
| 273 | Ga0070716_100008325 | 3300006173 | Bacteria | 5143 |
| 274 | Ga0070716_100108502 | 3300006173 | Bacteria | 1715 |
| 275 | Ga0070716_100114543 | 3300006173 | Bacteria | 1677 |
| 276 | Ga0070716_100198001 | 3300006173 | Bacteria | 1333 |
| 277 | Ga0070716_100363275 | 3300006173 | Bacteria | 1029 |
| 278 | Ga0070716_101296165 | 3300006173 | Bacteria | 589 |
| 279 | Ga0070712_100002212 | 3300006175 | Bacteria | 11961 |
| 280 | Ga0070712_100087131 | 3300006175 | Bacteria | 2277 |
| 281 | Ga0070712_100141398 | 3300006175 | Bacteria | 1837 |
| 282 | Ga0070712_100470430 | 3300006175 | Bacteria | 1049 |
| 283 | Ga0070712_100495388 | 3300006175 | Bacteria | 1023 |
| 284 | Ga0070712_100503532 | 3300006175 | Bacteria | 1015 |
| 285 | Ga0070712_100984037 | 3300006175 | Bacteria | 729 |
| 286 | Ga0070712_101830300 | 3300006175 | Bacteria | 532 |
| 287 | Ga0097621_100260033 | 3300006237 | Bacteria | 1522 |
| 288 | Ga0097621_100467964 | 3300006237 | Bacteria | 1138 |
| 289 | Ga0097621_100656297 | 3300006237 | Bacteria | 963 |
| 290 | Ga0097621_101318538 | 3300006237 | Bacteria | 682 |
| 291 | Ga0068871_100044951 | 3300006358 | Bacteria | 3553 |
| 292 | Ga0068871_100161655 | 3300006358 | Bacteria | 1916 |
| 293 | Ga0068871_100359498 | 3300006358 | Bacteria | 1289 |
| 294 | Ga0075428_100006141 | 3300006844 | Bacteria | 13369 |
| 295 | Ga0075428_100025139 | 3300006844 | Bacteria | 6588 |
| 296 | Ga0075428_100499622 | 3300006844 | Bacteria | 1301 |
| 297 | Ga0075428_100509187 | 3300006844 | Bacteria | 1288 |
| 298 | Ga0075428_100850765 | 3300006844 | Bacteria | 968 |
| 299 | Ga0075430_100005217 | 3300006846 | Bacteria | 10953 |
| 300 | Ga0075430_100020698 | 3300006846 | Bacteria | 5595 |
| 301 | Ga0075430_100933851 | 3300006846 | Bacteria | 715 |
| 302 | Ga0075431_100005151 | 3300006847 | Bacteria | 12867 |
| 303 | Ga0075431_100025330 | 3300006847 | Bacteria | 6081 |
| 304 | Ga0075431_100574965 | 3300006847 | Bacteria | 1113 |
| 305 | Ga0075433_10006286 | 3300006852 | Bacteria | 9380 |
| 306 | Ga0075433_10018598 | 3300006852 | Bacteria | 5779 |
| 307 | Ga0075434_100001130 | 3300006871 | Bacteria | 21976 |
| 308 | Ga0075434_100015099 | 3300006871 | Bacteria | 7397 |
| 309 | Ga0075434_100994798 | 3300006871 | Bacteria | 853 |
| 310 | Ga0075434_101012518 | 3300006871 | Bacteria | 845 |
| 311 | Ga0075429_100006139 | 3300006880 | Bacteria | 10387 |
| 312 | Ga0075429_100036319 | 3300006880 | Bacteria | 4285 |
| 313 | Ga0068865_100927542 | 3300006881 | Bacteria | 759 |
| 314 | Ga0075436_100002659 | 3300006914 | Bacteria | 12280 |
| 315 | Ga0075436_100034378 | 3300006914 | Bacteria | 3495 |
| 316 | Ga0075436_100190533 | 3300006914 | Bacteria | 1451 |
| 317 | Ga0097620_100023228 | 3300006931 | Bacteria | 6223 |
| 318 | Ga0097620_100642299 | 3300006931 | Bacteria | 1153 |
| 319 | Ga0097620_101919696 | 3300006931 | Bacteria | 654 |
| 320 | Ga0075435_100000977 | 3300007076 | Bacteria | 18090 |
| 321 | Ga0075435_100226059 | 3300007076 | Bacteria | 1590 |
| 322 | Ga0075435_100362666 | 3300007076 | Bacteria | 1243 |
| 323 | Ga0075435_100557574 | 3300007076 | Bacteria | 993 |
| 324 | Ga0075435_101056396 | 3300007076 | Bacteria | 710 |
| 325 | Ga0099794_10230590 | 3300007265 | Bacteria | 953 |
| 326 | Ga0099795_10219596 | 3300007788 | Bacteria | 808 |
| 327 | Ga0099795_10445883 | 3300007788 | Bacteria | 595 |
| 328 | Ga0099795_10488559 | 3300007788 | Bacteria | 572 |
| 329 | Ga0105251_10061484 | 3300009011 | Bacteria | 1765 |
| 330 | Ga0105251_10285873 | 3300009011 | Bacteria | 746 |
| 331 | Ga0105240_10124436 | 3300009093 | Bacteria | 3101 |
| 332 | Ga0105240_10839503 | 3300009093 | Bacteria | 992 |
| 333 | Ga0105240_11848787 | 3300009093 | Bacteria | 629 |
| 334 | Ga0111539_10000779 | 3300009094 | Bacteria | 41442 |
| 335 | Ga0111539_10057760 | 3300009094 | Bacteria | 4607 |
| 336 | Ga0111539_13358644 | 3300009094 | Bacteria | 515 |
| 337 | Ga0105245_10050634 | 3300009098 | Bacteria | 3723 |
| 338 | Ga0105245_10055174 | 3300009098 | Bacteria | 3569 |
| 339 | Ga0105245_10072031 | 3300009098 | Bacteria | 3139 |
| 340 | Ga0105247_10137577 | 3300009101 | Bacteria | 1597 |
| 341 | Ga0105247_10371112 | 3300009101 | Bacteria | 1012 |
| 342 | Ga0105247_10539465 | 3300009101 | Bacteria | 856 |
| 343 | Ga0114129_10007655 | 3300009147 | Bacteria | 15375 |
| 344 | Ga0114129_10069746 | 3300009147 | Bacteria | 4900 |
| 345 | Ga0114129_10404869 | 3300009147 | Bacteria | 1797 |
| 346 | Ga0114129_11520637 | 3300009147 | Bacteria | 822 |
| 347 | Ga0114129_12234326 | 3300009147 | Bacteria | 658 |
| 348 | Ga0105243_10075772 | 3300009148 | Bacteria | 2731 |
| 349 | Ga0105243_10869678 | 3300009148 | Bacteria | 894 |
| 350 | Ga0105243_11493335 | 3300009148 | Bacteria | 699 |
| 351 | Ga0105243_12692594 | 3300009148 | Bacteria | 537 |
| 352 | Ga0105241_10009288 | 3300009174 | Bacteria | 7228 |
| 353 | Ga0105242_10870066 | 3300009176 | Bacteria | 898 |
| 354 | Ga0105248_10136816 | 3300009177 | Bacteria | 2764 |
| 355 | Ga0105248_10217530 | 3300009177 | Bacteria | 2151 |
| 356 | Ga0105248_10325588 | 3300009177 | Bacteria | 1731 |
| 357 | Ga0105248_11531913 | 3300009177 | Bacteria | 755 |
| 358 | Ga0105248_11612690 | 3300009177 | Bacteria | 735 |
| 359 | Ga0105248_13343083 | 3300009177 | Bacteria | 510 |
| 360 | Ga0105237_10141495 | 3300009545 | Bacteria | 2400 |
| 361 | Ga0105237_10490653 | 3300009545 | Bacteria | 1235 |
| 362 | Ga0105238_10068794 | 3300009551 | Bacteria | 3542 |
| 363 | Ga0105238_10249503 | 3300009551 | Bacteria | 1753 |
| 364 | Ga0105238_10480863 | 3300009551 | Bacteria | 1241 |
| 365 | Ga0105238_11845401 | 3300009551 | Bacteria | 637 |
| 366 | Ga0105249_10470897 | 3300009553 | Bacteria | 1298 |
| 367 | Ga0105249_12300581 | 3300009553 | Bacteria | 612 |
| 368 | Ga0099796_10058857 | 3300010159 | Bacteria | 1356 |
| 369 | Ga0105239_10238858 | 3300010375 | Bacteria | 2039 |
| 370 | Ga0105239_10279513 | 3300010375 | Bacteria | 1879 |
| 371 | Ga0105239_11810169 | 3300010375 | Bacteria | 708 |
| 372 | Ga0105239_12555441 | 3300010375 | Bacteria | 595 |
| 373 | Ga0105246_10058429 | 3300011119 | Bacteria | 2672 |
| 374 | Ga0105246_10519190 | 3300011119 | Bacteria | 1015 |
| 375 | Ga0157342_1031332 | 3300012507 | Bacteria | 671 |
| 376 | Ga0157373_10005783 | 3300013100 | Bacteria | 9264 |
| 377 | Ga0157373_10057034 | 3300013100 | Bacteria | 2771 |
| 378 | Ga0157373_10164244 | 3300013100 | Bacteria | 1562 |
| 379 | Ga0157371_10043385 | 3300013102 | Bacteria | 3204 |
| 380 | Ga0157370_10035208 | 3300013104 | Bacteria | 4869 |
| 381 | Ga0157370_10089752 | 3300013104 | Bacteria | 2887 |
| 382 | Ga0157370_10432114 | 3300013104 | Bacteria | 1211 |
| 383 | Ga0157370_11178794 | 3300013104 | Bacteria | 691 |
| 384 | Ga0157369_10036784 | 3300013105 | Bacteria | 5362 |
| 385 | Ga0157369_10064667 | 3300013105 | Bacteria | 3939 |
| 386 | Ga0157369_10297344 | 3300013105 | Bacteria | 1680 |
| 387 | Ga0157369_10620706 | 3300013105 | Bacteria | 1115 |
| 388 | Ga0157369_10682308 | 3300013105 | Bacteria | 1058 |
| 389 | Ga0157369_10838386 | 3300013105 | Bacteria | 944 |
| 390 | Ga0157369_11023262 | 3300013105 | Bacteria | 845 |
| 391 | Ga0157369_12550043 | 3300013105 | Bacteria | 517 |
| 392 | Ga0157374_10028564 | 3300013296 | Bacteria | 5040 |
| 393 | Ga0157374_10034562 | 3300013296 | Bacteria | 4618 |
| 394 | Ga0157374_10568542 | 3300013296 | Bacteria | 1142 |
| 395 | Ga0157374_10580423 | 3300013296 | Bacteria | 1130 |
| 396 | Ga0157374_11831739 | 3300013296 | Bacteria | 632 |
| 397 | Ga0157378_11328338 | 3300013297 | Bacteria | 761 |
| 398 | Ga0157378_11504629 | 3300013297 | Bacteria | 718 |
| 399 | Ga0157378_12773851 | 3300013297 | Bacteria | 542 |
| 400 | Ga0163162_10153877 | 3300013306 | Bacteria | 2418 |
| 401 | Ga0163162_11231091 | 3300013306 | Bacteria | 850 |
| 402 | Ga0163162_11715788 | 3300013306 | Bacteria | 717 |
| 403 | Ga0163162_11943863 | 3300013306 | Bacteria | 674 |
| 404 | Ga0157372_10269736 | 3300013307 | Bacteria | 1977 |
| 405 | Ga0157372_10279594 | 3300013307 | Bacteria | 1940 |
| 406 | Ga0157372_10472484 | 3300013307 | Bacteria | 1462 |
| 407 | Ga0157372_12132496 | 3300013307 | Bacteria | 644 |
| 408 | Ga0157372_12156609 | 3300013307 | Bacteria | 640 |
| 409 | Ga0157372_12336230 | 3300013307 | Bacteria | 614 |
| 410 | Ga0157375_10041515 | 3300013308 | Bacteria | 4443 |
| 411 | Ga0157375_10044820 | 3300013308 | Bacteria | 4301 |
| 412 | Ga0157375_10269535 | 3300013308 | Bacteria | 1864 |
| 413 | Ga0157375_10325653 | 3300013308 | Bacteria | 1701 |
| 414 | Ga0157375_10433247 | 3300013308 | Bacteria | 1481 |
| 415 | Ga0157375_10672843 | 3300013308 | Bacteria | 1190 |
| 416 | Ga0163163_10020825 | 3300014325 | Bacteria | 6182 |
| 417 | Ga0163163_10106198 | 3300014325 | Bacteria | 2834 |
| 418 | Ga0163163_10158736 | 3300014325 | Bacteria | 2306 |
| 419 | Ga0163163_13003767 | 3300014325 | Bacteria | 526 |
| 420 | Ga0157380_10273263 | 3300014326 | Bacteria | 1542 |
| 421 | Ga0157380_11001833 | 3300014326 | Bacteria | 869 |
| 422 | Ga0182008_10301872 | 3300014497 | Bacteria | 838 |
| 423 | Ga0157377_10006356 | 3300014745 | Bacteria | 5629 |
| 424 | Ga0157377_10036159 | 3300014745 | Bacteria | 2715 |
| 425 | Ga0157377_10372821 | 3300014745 | Bacteria | 964 |
| 426 | Ga0157379_10150724 | 3300014968 | Bacteria | 2097 |
| 427 | Ga0157379_10294462 | 3300014968 | Bacteria | 1478 |
| 428 | Ga0157379_10690650 | 3300014968 | Bacteria | 957 |
| 429 | Ga0157376_10149631 | 3300014969 | Bacteria | 2104 |
| 430 | Ga0157376_10171726 | 3300014969 | Bacteria | 1975 |
| 431 | Ga0157376_11279097 | 3300014969 | Bacteria | 763 |
| 432 | Ga0157376_11305789 | 3300014969 | Bacteria | 756 |
| 433 | Ga0197907_10183059 | 3300020069 | Bacteria | 781 |
| 434 | Ga0197907_10763580 | 3300020069 | Bacteria | 1166 |
| 435 | Ga0206356_11299412 | 3300020070 | Bacteria | 1494 |
| 436 | Ga0206356_11645124 | 3300020070 | Bacteria | 799 |
| 437 | Ga0206352_10448073 | 3300020078 | Bacteria | 1195 |
| 438 | Ga0206354_10623429 | 3300020081 | Bacteria | 3272 |
| 439 | Ga0206354_10680820 | 3300020081 | Bacteria | 589 |
| 440 | Ga0206353_10190738 | 3300020082 | Bacteria | 1974 |
| 441 | Ga0206353_10279819 | 3300020082 | Bacteria | 556 |
| 442 | Ga0206353_11190550 | 3300020082 | Bacteria | 766 |
| 443 | Ga0206353_11823412 | 3300020082 | Bacteria | 801 |
| 444 | Ga0154015_1041837 | 3300020610 | Bacteria | 851 |
| 445 | Ga0213875_10141861 | 3300021388 | Bacteria | 1125 |
| 446 | Ga0213875_10152876 | 3300021388 | Bacteria | 1082 |
| 447 | Ga0224712_10053320 | 3300022467 | Bacteria | 1583 |
| 448 | Ga0224712_10346946 | 3300022467 | Bacteria | 701 |
| 449 | Ga0224712_10432143 | 3300022467 | Bacteria | 630 |
| 450 | Ga0224712_10486256 | 3300022467 | Bacteria | 595 |
| 451 | Ga0209566_100047 | 3300025225 | Bacteria | 243995 |
| 452 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 453 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 454 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 455 | Ga0209148_1017874 | 3300025254 | Bacteria | 1197 |
| 456 | Ga0207656_10004717 | 3300025321 | Bacteria | 4780 |
| 457 | Ga0207713_1192436 | 3300025735 | Bacteria | 630 |
| 458 | Ga0207653_10040605 | 3300025885 | Bacteria | 1526 |
| 459 | Ga0207692_10001320 | 3300025898 | Bacteria | 9238 |
| 460 | Ga0207692_10008171 | 3300025898 | Bacteria | 4323 |
| 461 | Ga0207692_10014042 | 3300025898 | Bacteria | 3490 |
| 462 | Ga0207692_10139056 | 3300025898 | Bacteria | 1380 |
| 463 | Ga0207692_10308976 | 3300025898 | Bacteria | 964 |
| 464 | Ga0207692_10543912 | 3300025898 | Bacteria | 741 |
| 465 | Ga0207692_11002583 | 3300025898 | Bacteria | 551 |
| 466 | Ga0207642_10106362 | 3300025899 | Bacteria | 1420 |
| 467 | Ga0207710_10056367 | 3300025900 | Bacteria | 1773 |
| 468 | Ga0207710_10265878 | 3300025900 | Bacteria | 860 |
| 469 | Ga0207688_10034897 | 3300025901 | Bacteria | 2786 |
| 470 | Ga0207688_10211840 | 3300025901 | Bacteria | 1164 |
| 471 | Ga0207680_10073482 | 3300025903 | Bacteria | 2126 |
| 472 | Ga0207680_10228460 | 3300025903 | Bacteria | 1278 |
| 473 | Ga0207647_10151859 | 3300025904 | Bacteria | 1353 |
| 474 | Ga0207647_10153438 | 3300025904 | Bacteria | 1345 |
| 475 | Ga0207685_10627028 | 3300025905 | Bacteria | 579 |
| 476 | Ga0207699_10000150 | 3300025906 | Bacteria | 45175 |
| 477 | Ga0207699_10000258 | 3300025906 | Bacteria | 29195 |
| 478 | Ga0207699_10027274 | 3300025906 | Bacteria | 3160 |
| 479 | Ga0207699_10063013 | 3300025906 | Bacteria | 2238 |
| 480 | Ga0207699_10123094 | 3300025906 | Bacteria | 1680 |
| 481 | Ga0207699_11227137 | 3300025906 | Bacteria | 555 |
| 482 | Ga0207645_10230490 | 3300025907 | Bacteria | 1222 |
| 483 | Ga0207645_10375428 | 3300025907 | Bacteria | 954 |
| 484 | Ga0207645_10810261 | 3300025907 | Bacteria | 637 |
| 485 | Ga0207643_10001537 | 3300025908 | Bacteria | 13174 |
| 486 | Ga0207643_10035540 | 3300025908 | Bacteria | 2794 |
| 487 | Ga0207705_10022571 | 3300025909 | Bacteria | 4488 |
| 488 | Ga0207705_10793801 | 3300025909 | Bacteria | 735 |
| 489 | Ga0207705_11528815 | 3300025909 | Bacteria | 505 |
| 490 | Ga0207684_10008759 | 3300025910 | Bacteria | 8982 |
| 491 | Ga0207684_10016494 | 3300025910 | Bacteria | 6343 |
| 492 | Ga0207684_10729071 | 3300025910 | Bacteria | 841 |
| 493 | Ga0207684_10896393 | 3300025910 | Bacteria | 746 |
| 494 | Ga0207654_10019819 | 3300025911 | Bacteria | 3557 |
| 495 | Ga0207707_10111086 | 3300025912 | Bacteria | 2396 |
| 496 | Ga0207707_10526153 | 3300025912 | Bacteria | 1007 |
| 497 | Ga0207707_11061030 | 3300025912 | Bacteria | 662 |
| 498 | Ga0207695_10621075 | 3300025913 | Bacteria | 962 |
| 499 | Ga0207671_10093394 | 3300025914 | Bacteria | 2269 |
| 500 | Ga0207671_10621688 | 3300025914 | Bacteria | 861 |
| 501 | Ga0207671_11512637 | 3300025914 | Bacteria | 518 |
| 502 | Ga0207693_10003060 | 3300025915 | Bacteria | 14436 |
| 503 | Ga0207693_10019403 | 3300025915 | Bacteria | 5408 |
| 504 | Ga0207693_10025702 | 3300025915 | Bacteria | 4666 |
| 505 | Ga0207693_10083599 | 3300025915 | Bacteria | 2501 |
| 506 | Ga0207693_10328894 | 3300025915 | Bacteria | 1196 |
| 507 | Ga0207693_11338969 | 3300025915 | Bacteria | 534 |
| 508 | Ga0207663_10002856 | 3300025916 | Bacteria | 8348 |
| 509 | Ga0207663_10006047 | 3300025916 | Bacteria | 6153 |
| 510 | Ga0207663_10022592 | 3300025916 | Bacteria | 3598 |
| 511 | Ga0207663_10677728 | 3300025916 | Bacteria | 815 |
| 512 | Ga0207663_11409615 | 3300025916 | Bacteria | 561 |
| 513 | Ga0207660_10963190 | 3300025917 | Bacteria | 696 |
| 514 | Ga0207660_11661673 | 3300025917 | Bacteria | 514 |
| 515 | Ga0207662_10074461 | 3300025918 | Bacteria | 2061 |
| 516 | Ga0207657_10009474 | 3300025919 | Bacteria | 9784 |
| 517 | Ga0207657_10062340 | 3300025919 | Bacteria | 3193 |
| 518 | Ga0207657_10128400 | 3300025919 | Bacteria | 2080 |
| 519 | Ga0207657_10421494 | 3300025919 | Bacteria | 1049 |
| 520 | Ga0207649_10004621 | 3300025920 | Bacteria | 7458 |
| 521 | Ga0207649_10524981 | 3300025920 | Bacteria | 903 |
| 522 | Ga0207652_10035081 | 3300025921 | Bacteria | 4232 |
| 523 | Ga0207652_10254175 | 3300025921 | Bacteria | 1585 |
| 524 | Ga0207652_10301013 | 3300025921 | Bacteria | 1447 |
| 525 | Ga0207652_10572801 | 3300025921 | Bacteria | 1014 |
| 526 | Ga0207652_10674011 | 3300025921 | Bacteria | 924 |
| 527 | Ga0207652_11154078 | 3300025921 | Bacteria | 676 |
| 528 | Ga0207646_10071910 | 3300025922 | Bacteria | 3089 |
| 529 | Ga0207646_10120426 | 3300025922 | Bacteria | 2358 |
| 530 | Ga0207646_10689470 | 3300025922 | Bacteria | 914 |
| 531 | Ga0207646_10837273 | 3300025922 | Bacteria | 818 |
| 532 | Ga0207681_10252375 | 3300025923 | Bacteria | 1378 |
| 533 | Ga0207681_10273771 | 3300025923 | Bacteria | 1326 |
| 534 | Ga0207681_10793905 | 3300025923 | Bacteria | 791 |
| 535 | Ga0207694_10054897 | 3300025924 | Bacteria | 3092 |
| 536 | Ga0207694_10206262 | 3300025924 | Bacteria | 1600 |
| 537 | Ga0207650_10006488 | 3300025925 | Bacteria | 7973 |
| 538 | Ga0207650_10693905 | 3300025925 | Bacteria | 860 |
| 539 | Ga0207659_10019293 | 3300025926 | Bacteria | 4485 |
| 540 | Ga0207659_11091678 | 3300025926 | Bacteria | 687 |
| 541 | Ga0207659_11918544 | 3300025926 | Bacteria | 502 |
| 542 | Ga0207687_10016939 | 3300025927 | Bacteria | 4789 |
| 543 | Ga0207687_10042788 | 3300025927 | Bacteria | 3118 |
| 544 | Ga0207687_10858755 | 3300025927 | Bacteria | 776 |
| 545 | Ga0207700_10000342 | 3300025928 | Bacteria | 27369 |
| 546 | Ga0207700_10003386 | 3300025928 | Bacteria | 9257 |
| 547 | Ga0207700_10031252 | 3300025928 | Bacteria | 3780 |
| 548 | Ga0207700_10123271 | 3300025928 | Bacteria | 2104 |
| 549 | Ga0207700_10179195 | 3300025928 | Bacteria | 1773 |
| 550 | Ga0207700_10184697 | 3300025928 | Bacteria | 1748 |
| 551 | Ga0207700_10194187 | 3300025928 | Bacteria | 1707 |
| 552 | Ga0207700_10243232 | 3300025928 | Bacteria | 1534 |
| 553 | Ga0207700_10320985 | 3300025928 | Bacteria | 1342 |
| 554 | Ga0207700_10364186 | 3300025928 | Bacteria | 1261 |
| 555 | Ga0207700_10479384 | 3300025928 | Bacteria | 1099 |
| 556 | Ga0207700_10841780 | 3300025928 | Bacteria | 821 |
| 557 | Ga0207664_10000764 | 3300025929 | Bacteria | 21818 |
| 558 | Ga0207664_10007272 | 3300025929 | Bacteria | 7679 |
| 559 | Ga0207664_10039694 | 3300025929 | Bacteria | 3655 |
| 560 | Ga0207664_10045733 | 3300025929 | Bacteria | 3434 |
| 561 | Ga0207664_10061944 | 3300025929 | Bacteria | 2987 |
| 562 | Ga0207664_10115218 | 3300025929 | Bacteria | 2241 |
| 563 | Ga0207664_10117186 | 3300025929 | Bacteria | 2223 |
| 564 | Ga0207664_10223114 | 3300025929 | Bacteria | 1635 |
| 565 | Ga0207664_10288999 | 3300025929 | Bacteria | 1440 |
| 566 | Ga0207664_10413801 | 3300025929 | Bacteria | 1200 |
| 567 | Ga0207664_11226882 | 3300025929 | Bacteria | 668 |
| 568 | Ga0207644_10024643 | 3300025931 | Bacteria | 4131 |
| 569 | Ga0207690_10014586 | 3300025932 | Bacteria | 4746 |
| 570 | Ga0207690_10478164 | 3300025932 | Bacteria | 1005 |
| 571 | Ga0207706_10152212 | 3300025933 | Bacteria | 2034 |
| 572 | Ga0207686_10562842 | 3300025934 | Bacteria | 893 |
| 573 | Ga0207686_11065082 | 3300025934 | Bacteria | 658 |
| 574 | Ga0207709_10585553 | 3300025935 | Bacteria | 882 |
| 575 | Ga0207709_10599745 | 3300025935 | Bacteria | 872 |
| 576 | Ga0207709_11409206 | 3300025935 | Bacteria | 577 |
| 577 | Ga0207670_10174912 | 3300025936 | Bacteria | 1612 |
| 578 | Ga0207670_11065395 | 3300025936 | Bacteria | 682 |
| 579 | Ga0207669_10363868 | 3300025937 | Bacteria | 1122 |
| 580 | Ga0207704_10532470 | 3300025938 | Bacteria | 952 |
| 581 | Ga0207665_10218483 | 3300025939 | Bacteria | 1396 |
| 582 | Ga0207665_10458653 | 3300025939 | Bacteria | 979 |
| 583 | Ga0207665_11248921 | 3300025939 | Bacteria | 592 |
| 584 | Ga0207691_10036168 | 3300025940 | Bacteria | 4576 |
| 585 | Ga0207691_10075071 | 3300025940 | Bacteria | 3049 |
| 586 | Ga0207691_10643026 | 3300025940 | Bacteria | 896 |
| 587 | Ga0207691_11357509 | 3300025940 | Bacteria | 585 |
| 588 | Ga0207711_10369020 | 3300025941 | Bacteria | 1331 |
| 589 | Ga0207711_11124943 | 3300025941 | Bacteria | 726 |
| 590 | Ga0207689_10016618 | 3300025942 | Bacteria | 6227 |
| 591 | Ga0207689_10448093 | 3300025942 | Bacteria | 1079 |
| 592 | Ga0207661_10019221 | 3300025944 | Bacteria | 5089 |
| 593 | Ga0207661_11001128 | 3300025944 | Bacteria | 770 |
| 594 | Ga0207679_10016528 | 3300025945 | Bacteria | 4903 |
| 595 | Ga0207679_10157455 | 3300025945 | Bacteria | 1856 |
| 596 | Ga0207679_10364232 | 3300025945 | Bacteria | 1263 |
| 597 | Ga0207679_10651961 | 3300025945 | Bacteria | 952 |
| 598 | Ga0207667_11459050 | 3300025949 | Bacteria | 656 |
| 599 | Ga0207651_10070300 | 3300025960 | Bacteria | 2476 |
| 600 | Ga0207651_10559166 | 3300025960 | Bacteria | 996 |
| 601 | Ga0207712_11213505 | 3300025961 | Bacteria | 673 |
| 602 | Ga0207712_11325125 | 3300025961 | Bacteria | 644 |
| 603 | Ga0207668_10000895 | 3300025972 | Bacteria | 18002 |
| 604 | Ga0207668_10010000 | 3300025972 | Bacteria | 5709 |
| 605 | Ga0207640_10444255 | 3300025981 | Bacteria | 1067 |
| 606 | Ga0207640_10480978 | 3300025981 | Bacteria | 1030 |
| 607 | Ga0207677_10006553 | 3300026023 | Bacteria | 6391 |
| 608 | Ga0207677_10274146 | 3300026023 | Bacteria | 1382 |
| 609 | Ga0207703_10165713 | 3300026035 | Bacteria | 1939 |
| 610 | Ga0207703_10829429 | 3300026035 | Bacteria | 884 |
| 611 | Ga0207639_10036197 | 3300026041 | Bacteria | 3656 |
| 612 | Ga0207639_10195969 | 3300026041 | Bacteria | 1729 |
| 613 | Ga0207639_10438602 | 3300026041 | Bacteria | 1184 |
| 614 | Ga0207639_10556795 | 3300026041 | Bacteria | 1053 |
| 615 | Ga0207639_10960221 | 3300026041 | Bacteria | 800 |
| 616 | Ga0207639_11869906 | 3300026041 | Bacteria | 561 |
| 617 | Ga0207678_10000245 | 3300026067 | Bacteria | 49012 |
| 618 | Ga0207678_10157578 | 3300026067 | Bacteria | 1939 |
| 619 | Ga0207678_11197887 | 3300026067 | Bacteria | 672 |
| 620 | Ga0207678_11579235 | 3300026067 | Bacteria | 578 |
| 621 | Ga0207708_10445960 | 3300026075 | Bacteria | 1077 |
| 622 | Ga0207702_10016545 | 3300026078 | Bacteria | 6103 |
| 623 | Ga0207702_10050305 | 3300026078 | Bacteria | 3518 |
| 624 | Ga0207702_10052561 | 3300026078 | Bacteria | 3448 |
| 625 | Ga0207702_10052806 | 3300026078 | Bacteria | 3440 |
| 626 | Ga0207702_10058099 | 3300026078 | Bacteria | 3291 |
| 627 | Ga0207702_12424536 | 3300026078 | Bacteria | 512 |
| 628 | Ga0207641_10113474 | 3300026088 | Bacteria | 2406 |
| 629 | Ga0207641_10953715 | 3300026088 | Bacteria | 853 |
| 630 | Ga0207641_11197486 | 3300026088 | Bacteria | 759 |
| 631 | Ga0207676_10008877 | 3300026095 | Bacteria | 7149 |
| 632 | Ga0207676_10142071 | 3300026095 | Bacteria | 2056 |
| 633 | Ga0207676_10935420 | 3300026095 | Bacteria | 852 |
| 634 | Ga0207676_11856005 | 3300026095 | Bacteria | 601 |
| 635 | Ga0207674_10012064 | 3300026116 | Bacteria | 9679 |
| 636 | Ga0207674_10031256 | 3300026116 | Bacteria | 5594 |
| 637 | Ga0207674_10178177 | 3300026116 | Bacteria | 2077 |
| 638 | Ga0207674_10436541 | 3300026116 | Bacteria | 1265 |
| 639 | Ga0207674_10795259 | 3300026116 | Bacteria | 913 |
| 640 | Ga0207674_12054716 | 3300026116 | Bacteria | 536 |
| 641 | Ga0207675_100330310 | 3300026118 | Bacteria | 1490 |
| 642 | Ga0207675_100613426 | 3300026118 | Bacteria | 1092 |
| 643 | Ga0207675_100635861 | 3300026118 | Bacteria | 1072 |
| 644 | Ga0207683_10001108 | 3300026121 | Bacteria | 24536 |
| 645 | Ga0207683_10002188 | 3300026121 | Bacteria | 17182 |
| 646 | Ga0207683_10346109 | 3300026121 | Bacteria | 1364 |
| 647 | Ga0207683_10564555 | 3300026121 | Bacteria | 1052 |
| 648 | Ga0207683_10582773 | 3300026121 | Bacteria | 1035 |
| 649 | Ga0207683_10865970 | 3300026121 | Bacteria | 839 |
| 650 | Ga0207683_11462997 | 3300026121 | Bacteria | 631 |
| 651 | Ga0207698_10155078 | 3300026142 | Bacteria | 1994 |
| 652 | Ga0207698_10539641 | 3300026142 | Bacteria | 1141 |
| 653 | Ga0207428_10000872 | 3300027907 | Bacteria | 33910 |
| 654 | Ga0207428_10018040 | 3300027907 | Bacteria | 6043 |
| 655 | Ga0265357_1037029 | 3300028023 | Bacteria | 567 |
| 656 | Ga0268266_10193198 | 3300028379 | Bacteria | 1859 |
| 657 | Ga0268266_10338500 | 3300028379 | Bacteria | 1412 |
| 658 | Ga0268266_10819094 | 3300028379 | Bacteria | 899 |
| 659 | Ga0268266_11210826 | 3300028379 | Bacteria | 730 |
| 660 | Ga0268265_10064370 | 3300028380 | Bacteria | 2824 |
| 661 | Ga0268265_10182625 | 3300028380 | Bacteria | 1804 |
| 662 | Ga0268265_11823000 | 3300028380 | Bacteria | 615 |
| 663 | Ga0268264_10094658 | 3300028381 | Bacteria | 2583 |
| 664 | Ga0268264_10253131 | 3300028381 | Bacteria | 1637 |
| 665 | Ga0268264_11108413 | 3300028381 | Bacteria | 800 |
| 666 | Ga0307515_10022180 | 3300028794 | Bacteria | 11207 |
| 667 | Ga0307515_10285349 | 3300028794 | Bacteria | 1353 |
| 668 | Ga0316178_1102303 | 3300030735 | Bacteria | 1565 |
| 669 | Ga0265773_1010594 | 3300031018 | Bacteria | 780 |
| 670 | Ga0265760_10390584 | 3300031090 | Bacteria | 501 |
| 671 | Ga0307513_10008238 | 3300031456 | Bacteria | 13371 |
| 672 | Ga0307513_10602461 | 3300031456 | Bacteria | 808 |
| 673 | Ga0307513_10777132 | 3300031456 | Bacteria | 663 |
| 674 | Ga0307408_100719299 | 3300031548 | Bacteria | 899 |
| 675 | Ga0307408_101028285 | 3300031548 | Bacteria | 761 |
| 676 | Ga0307408_101410270 | 3300031548 | Bacteria | 656 |
| 677 | Ga0307508_10288622 | 3300031616 | Bacteria | 1234 |
| 678 | Ga0307508_10456993 | 3300031616 | Bacteria | 870 |
| 679 | Ga0307405_11518224 | 3300031731 | Bacteria | 589 |
| 680 | Ga0307405_12112871 | 3300031731 | Bacteria | 506 |
| 681 | Ga0307413_10739660 | 3300031824 | Bacteria | 821 |
| 682 | Ga0307410_10356321 | 3300031852 | Bacteria | 1170 |
| 683 | Ga0307410_10504610 | 3300031852 | Bacteria | 996 |
| 684 | Ga0307410_11415513 | 3300031852 | Bacteria | 611 |
| 685 | Ga0307406_10111297 | 3300031901 | Bacteria | 1886 |
| 686 | Ga0307406_10470331 | 3300031901 | Bacteria | 1013 |
| 687 | Ga0307407_10110133 | 3300031903 | Bacteria | 1727 |
| 688 | Ga0307407_10739812 | 3300031903 | Bacteria | 744 |
| 689 | Ga0307412_11287458 | 3300031911 | Bacteria | 658 |
| 690 | Ga0307409_100017750 | 3300031995 | Bacteria | 4756 |
| 691 | Ga0307409_100318710 | 3300031995 | Bacteria | 1454 |
| 692 | Ga0307409_100469177 | 3300031995 | Bacteria | 1219 |
| 693 | Ga0307409_101057342 | 3300031995 | Bacteria | 832 |
| 694 | Ga0307409_101126369 | 3300031995 | Bacteria | 806 |
| 695 | Ga0307416_100208352 | 3300032002 | Bacteria | 1862 |
| 696 | Ga0307416_102670420 | 3300032002 | Bacteria | 596 |
| 697 | Ga0307416_102720673 | 3300032002 | Bacteria | 591 |
| 698 | Ga0307414_10389790 | 3300032004 | Bacteria | 1207 |
| 699 | Ga0307415_100002122 | 3300032126 | Bacteria | 9819 |
| 700 | Ga0307415_100061895 | 3300032126 | Bacteria | 2593 |
| 701 | Ga0307415_100277007 | 3300032126 | Bacteria | 1377 |
| 702 | Ga0307415_100904689 | 3300032126 | Bacteria | 814 |
| 703 | Ga0307415_102017049 | 3300032126 | Bacteria | 562 |
| 704 | Ga0307415_102017557 | 3300032126 | Bacteria | 562 |
| 705 | Ga0373950_0016362 | 3300034818 | Bacteria | 1268 |
| 706 | Ga0373959_0032774 | 3300034820 | Bacteria | 1057 |
| 707 | Ga0373929_0247748 | 3300035085 | Bacteria | 516 |
| 708 | Ga0373934_0027878 | 3300035086 | Bacteria | 2197 |
| 709 | Ga0373940_0039014 | 3300035088 | Bacteria | 1299 |
| 710 | Ga0373944_0352253 | 3300035089 | Bacteria | 560 |
| 711 | Ga0373951_0095711 | 3300035091 | Bacteria | 784 |
| 712 | Ga0373923_0179781 | 3300035111 | Bacteria | 972 |
| 713 | Ga0373932_0281845 | 3300035112 | Bacteria | 615 |
| 714 | Ga0373939_0339072 | 3300035114 | Bacteria | 609 |
| 715 | Ga0373941_0075651 | 3300035115 | Bacteria | 1127 |
| 716 | Ga0373956_0159207 | 3300035119 | Bacteria | 1064 |
| 717 | Ga0373943_0982618 | 3300035170 | Bacteria | 506 |
| 718 | Ga0373942_0001721 | 3300035207 | Bacteria | 5562 |
| 719 | Ga0373961_0427073 | 3300035241 | Bacteria | 513 |
| 720 | Ga0373924_0135961 | 3300035410 | Bacteria | 1071 |
| 721 | Ga0373931_0040996 | 3300035691 | Bacteria | 2431 |
| 722 | Ga0373935_0077170 | 3300035692 | Bacteria | 2159 |
| 723 | Ga0373935_0581480 | 3300035692 | Bacteria | 818 |
| 724 | Ga0373935_1224792 | 3300035692 | Bacteria | 560 |
| 725 | Ga0373935_1226145 | 3300035692 | Bacteria | 559 |
| 726 | Ga0373927_1022312 | 3300035695 | Bacteria | 545 |
| 727 | Ga0373947_1021438 | 3300035725 | Bacteria | 564 |
| 728 | Ga0373937_0314138 | 3300036401 | Bacteria | 1482 |
| 729 | Ga0373937_1126203 | 3300036401 | Bacteria | 733 |
| 730 | Ga0373937_1506366 | 3300036401 | Bacteria | 620 |
| 731 | Ga0372808_069496 | 3300036459 | Bacteria | 509 |
| 732 | Ga0373925_0368795 | 3300037068 | Bacteria | 1168 |
| 733 | Ga0373925_0837743 | 3300037068 | Bacteria | 758 |
| 734 | Ga0395899_0013581 | 3300037312 | Bacteria | 6226 |
| 735 | Ga0395899_0014951 | 3300037312 | Bacteria | 5920 |
| 736 | Ga0395900_0049920 | 3300037418 | Bacteria | 4310 |
| 737 | Ga0395898_0037998 | 3300037466 | Bacteria | 4773 |
| 738 | Ga0395898_1575792 | 3300037466 | Bacteria | 581 |
| 739 | Ga0395905_0007193 | 3300037471 | Bacteria | 11111 |
| 740 | Ga0395905_1094791 | 3300037471 | Bacteria | 700 |
| 741 | Ga0436364_0929084 | 3300037853 | Bacteria | 1476 |
| 742 | Ga0436364_1111965 | 3300037853 | Bacteria | 1479 |
| 743 | Ga0395901_0061037 | 3300038443 | Bacteria | 3923 |
| 744 | Ga0436363_0965767 | 3300039450 | Bacteria | 588 |
| 745 | Ga0439465_0302602 | 3300041413 | Bacteria | 599 |
| 746 | Ga0451798_1080448 | 3300041458 | Bacteria | 522 |
| 747 | Ga0451807_2259115 | 3300041486 | Bacteria | 601 |
| 748 | Ga0451833_0052121 | 3300041491 | Bacteria | 597 |
| 749 | Ga0451849_1294102 | 3300041505 | Bacteria | 689 |
| 750 | Ga0451855_1267667 | 3300041511 | Bacteria | 857 |
| 751 | Ga0451853_2986788 | 3300041512 | Bacteria | 558 |
| 752 | Ga0451853_4096721 | 3300041512 | Bacteria | 1095 |
| 753 | Ga0439459_0032746 | 3300042438 | Bacteria | 1067 |
| 754 | Ga0439440_0217444 | 3300042993 | Bacteria | 572 |
| 755 | Ga0466969_0047458 | 3300044656 | Bacteria | 2126 |
| 756 | Ga0466969_0507543 | 3300044656 | Bacteria | 551 |
| 757 | Ga0466972_0105183 | 3300044658 | Bacteria | 1335 |
| 758 | Ga0453683_0894406 | 3300044673 | Bacteria | 587 |
| 759 | Ga0466966_0263232 | 3300044684 | Bacteria | 1038 |
| 760 | Ga0466961_0593977 | 3300044693 | Bacteria | 666 |
| 761 | Ga0466963_0328042 | 3300044694 | Bacteria | 1077 |
| 762 | Ga0466963_0852064 | 3300044694 | Bacteria | 642 |
| 763 | Ga0466970_0006912 | 3300044765 | Bacteria | 5681 |
| 764 | Ga0466970_0015863 | 3300044765 | Bacteria | 3878 |
| 765 | Ga0466957_0156633 | 3300044842 | Bacteria | 1477 |
| 766 | Ga0466960_0087663 | 3300044901 | Bacteria | 1581 |
| 767 | Ga0466959_0305087 | 3300045049 | Bacteria | 1090 |
| 768 | Ga0466959_0450790 | 3300045049 | Bacteria | 872 |
| 769 | Ga0466958_0716806 | 3300045836 | Bacteria | 652 |
| 770 | Ga0466958_0976286 | 3300045836 | Bacteria | 553 |
| 771 | Ga0466967_1652822 | 3300045976 | Bacteria | 638 |
| 772 | Ga0495592_0258794 | 3300046454 | Bacteria | 1147 |
| 773 | Ga0495653_0199216 | 3300046463 | Bacteria | 1360 |
| 774 | Ga0495639_0170963 | 3300046475 | Bacteria | 1055 |
| 775 | Ga0495639_0246501 | 3300046475 | Bacteria | 883 |
| 776 | Ga0495662_0184232 | 3300046476 | Bacteria | 1029 |
| 777 | Ga0495662_0211569 | 3300046476 | Bacteria | 956 |
| 778 | Ga0495662_0367777 | 3300046476 | Bacteria | 706 |
| 779 | Ga0495664_0075929 | 3300046477 | Bacteria | 2011 |
| 780 | Ga0495584_0523798 | 3300046491 | Bacteria | 604 |
| 781 | Ga0495585_0023230 | 3300046492 | Bacteria | 3559 |
| 782 | Ga0495594_0016486 | 3300046499 | Bacteria | 3893 |
| 783 | Ga0495596_0197550 | 3300046500 | Bacteria | 782 |
| 784 | Ga0495616_0219375 | 3300046513 | Bacteria | 829 |
| 785 | Ga0495628_0081651 | 3300046516 | Bacteria | 2511 |
| 786 | Ga0495628_0372461 | 3300046516 | Bacteria | 1047 |
| 787 | Ga0495628_0430548 | 3300046516 | Bacteria | 960 |
| 788 | Ga0495630_0526150 | 3300046517 | Bacteria | 907 |
| 789 | Ga0495644_0367286 | 3300046523 | Bacteria | 568 |
| 790 | Ga0495648_0167645 | 3300046524 | Bacteria | 1129 |
| 791 | Ga0495666_0165238 | 3300046526 | Bacteria | 1025 |
| 792 | Ga0495666_0288750 | 3300046526 | Bacteria | 743 |
| 793 | Ga0495642_0141476 | 3300046528 | Bacteria | 1039 |
| 794 | Ga0495652_0586302 | 3300046529 | Bacteria | 762 |
| 795 | Ga0495640_0929569 | 3300046533 | Bacteria | 514 |
| 796 | Ga0495645_0042793 | 3300046543 | Bacteria | 3303 |
| 797 | Ga0495645_0365805 | 3300046543 | Bacteria | 926 |
| 798 | Ga0495633_0320305 | 3300046558 | Bacteria | 704 |
| 799 | Ga0495633_0414750 | 3300046558 | Bacteria | 609 |
| 800 | Ga0495667_0335436 | 3300046559 | Bacteria | 956 |
| 801 | Ga0495667_0622134 | 3300046559 | Bacteria | 672 |
| 802 | Ga0495656_0430514 | 3300046615 | Bacteria | 693 |
| 803 | Ga0495625_0115890 | 3300046660 | Bacteria | 1828 |
| 804 | Ga0495635_0326208 | 3300046663 | Bacteria | 1027 |
| 805 | Ga0495659_0161986 | 3300046664 | Bacteria | 904 |
| 806 | Ga0495657_0001424 | 3300046675 | Bacteria | 20694 |
| 807 | Ga0495657_0256406 | 3300046675 | Bacteria | 1052 |
| 808 | Ga0495646_0182430 | 3300046680 | Bacteria | 1151 |
| 809 | Ga0495658_0285175 | 3300046683 | Bacteria | 1043 |
| 810 | Ga0495613_0242915 | 3300046689 | Bacteria | 1258 |
| 811 | Ga0495624_0243226 | 3300046690 | Bacteria | 1089 |
| 812 | Ga0495624_0416269 | 3300046690 | Bacteria | 806 |
| 813 | Ga0495671_0332672 | 3300046692 | Bacteria | 729 |
| 814 | Ga0495589_0395302 | 3300046794 | Bacteria | 635 |
| 815 | Ga0495581_0199359 | 3300047315 | Bacteria | 1171 |
| 816 | Ga0495674_0095521 | 3300047319 | Bacteria | 2534 |
| 817 | Ga0495674_0771931 | 3300047319 | Bacteria | 749 |
| 818 | Ga0495676_0941417 | 3300047321 | Bacteria | 552 |
| 819 | Ga0495680_0387585 | 3300047322 | Bacteria | 967 |
| 820 | Ga0495684_0504556 | 3300047471 | Bacteria | 831 |
| 821 | Ga0495614_0628929 | 3300048089 | Bacteria | 517 |
| 822 | Ga0495626_0314145 | 3300048091 | Bacteria | 617 |
| 823 | Ga0496100_0080142 | 3300048903 | Bacteria | 2202 |
| 824 | Ga0496100_0332086 | 3300048903 | Bacteria | 1144 |
| 825 | Ga0496100_1641292 | 3300048903 | Bacteria | 508 |
| 826 | Ga0496101_0023810 | 3300048904 | Bacteria | 4234 |
| 827 | Ga0496101_0033677 | 3300048904 | Bacteria | 3615 |
| 828 | Ga0496101_0055791 | 3300048904 | Bacteria | 2855 |
| 829 | Ga0496101_0205505 | 3300048904 | Bacteria | 1524 |
| 830 | Ga0496101_1314939 | 3300048904 | Bacteria | 565 |
| 831 | Ga0496102_0024111 | 3300048905 | Bacteria | 5407 |
| 832 | Ga0496102_0545693 | 3300048905 | Bacteria | 1082 |
| 833 | Ga0496102_0933475 | 3300048905 | Bacteria | 789 |
| 834 | Ga0496103_0053368 | 3300048906 | Bacteria | 2505 |
| 835 | Ga0496104_0006727 | 3300048907 | Bacteria | 10123 |
| 836 | Ga0496104_0069812 | 3300048907 | Bacteria | 3339 |
| 837 | Ga0496104_0090841 | 3300048907 | Bacteria | 2918 |
| 838 | Ga0496104_0100145 | 3300048907 | Bacteria | 2774 |
| 839 | Ga0496104_0164333 | 3300048907 | Bacteria | 2128 |
| 840 | Ga0496104_0622572 | 3300048907 | Bacteria | 989 |
| 841 | Ga0496104_0837703 | 3300048907 | Bacteria | 825 |
| 842 | Ga0496104_1807022 | 3300048907 | Bacteria | 513 |
| 843 | Ga0496105_0015618 | 3300048908 | Bacteria | 6056 |
| 844 | Ga0496105_0107384 | 3300048908 | Bacteria | 2304 |
| 845 | Ga0496105_0120349 | 3300048908 | Bacteria | 2165 |
| 846 | Ga0496105_0236473 | 3300048908 | Bacteria | 1483 |
| 847 | Ga0496106_0008552 | 3300048909 | Bacteria | 7573 |
| 848 | Ga0496106_0239793 | 3300048909 | Bacteria | 1449 |
| 849 | Ga0496106_0319474 | 3300048909 | Bacteria | 1246 |
| 850 | Ga0496106_1461730 | 3300048909 | Bacteria | 527 |
| 851 | Ga0496107_0017925 | 3300048910 | Bacteria | 4984 |
| 852 | Ga0496107_0073529 | 3300048910 | Bacteria | 2486 |
| 853 | Ga0496108_0008688 | 3300048911 | Bacteria | 8237 |
| 854 | Ga0496108_0028431 | 3300048911 | Bacteria | 4626 |
| 855 | Ga0496108_0036570 | 3300048911 | Bacteria | 4086 |
| 856 | Ga0496108_0780231 | 3300048911 | Bacteria | 825 |
| 857 | Ga0496109_0220272 | 3300048912 | Bacteria | 1784 |
| 858 | Ga0496109_0646757 | 3300048912 | Bacteria | 994 |
| 859 | Ga0496109_0710562 | 3300048912 | Bacteria | 942 |
| 860 | Ga0496109_0807854 | 3300048912 | Bacteria | 876 |
| 861 | Ga0496109_0985474 | 3300048912 | Bacteria | 781 |
| 862 | Ga0496109_0991424 | 3300048912 | Bacteria | 778 |
| 863 | Ga0496109_1127471 | 3300048912 | Bacteria | 721 |
| 864 | Ga0496110_0018573 | 3300048913 | Bacteria | 5831 |
| 865 | Ga0496110_0045730 | 3300048913 | Bacteria | 3827 |
| 866 | Ga0496110_0059806 | 3300048913 | Bacteria | 3359 |
| 867 | Ga0496111_0012969 | 3300048914 | Bacteria | 5657 |
| 868 | Ga0496111_0044827 | 3300048914 | Bacteria | 3179 |
| 869 | Ga0496111_0046129 | 3300048914 | Bacteria | 3137 |
| 870 | Ga0496111_0902794 | 3300048914 | Bacteria | 636 |
| 871 | Ga0496112_0145827 | 3300048915 | Bacteria | 2335 |
| 872 | Ga0496112_0266690 | 3300048915 | Bacteria | 1661 |
| 873 | Ga0496112_0267068 | 3300048915 | Bacteria | 1660 |
| 874 | Ga0496112_0453393 | 3300048915 | Bacteria | 1220 |
| 875 | Ga0496112_0801616 | 3300048915 | Bacteria | 866 |
| 876 | Ga0496112_1637721 | 3300048915 | Bacteria | 557 |
| 877 | Ga0496113_0083246 | 3300048916 | Bacteria | 2455 |
| 878 | Ga0496113_1156114 | 3300048916 | Bacteria | 605 |
| 879 | Ga0496113_1446134 | 3300048916 | Bacteria | 531 |
| 880 | Ga0496114_0013658 | 3300048917 | Bacteria | 6510 |
| 881 | Ga0496114_0015453 | 3300048917 | Bacteria | 6140 |
| 882 | Ga0496114_0131342 | 3300048917 | Bacteria | 2163 |
| 883 | Ga0496114_0138857 | 3300048917 | Bacteria | 2103 |
| 884 | Ga0496114_0266120 | 3300048917 | Bacteria | 1510 |
| 885 | Ga0496114_1574418 | 3300048917 | Bacteria | 545 |
| 886 | Ga0496115_0054837 | 3300048918 | Bacteria | 3201 |
| 887 | Ga0496115_0136988 | 3300048918 | Bacteria | 2019 |
| 888 | Ga0496115_0691260 | 3300048918 | Bacteria | 803 |
| 889 | Ga0496121_0694921 | 3300048924 | Bacteria | 613 |
| 890 | Ga0501031_0001300 | 3300049568 | Bacteria | 15305 |
| 891 | Ga0501032_0002723 | 3300049569 | Bacteria | 13768 |
| 892 | Ga0501033_0001012 | 3300049570 | Bacteria | 25531 |
| 893 | Ga0501034_0005396 | 3300049571 | Bacteria | 13983 |
| 894 | Ga0501036_0002936 | 3300049572 | Bacteria | 13536 |
| 895 | Ga0501037_0000762 | 3300049573 | Bacteria | 24293 |
| 896 | Ga0501038_0002530 | 3300049574 | Bacteria | 17043 |
| 897 | Ga0501039_0001982 | 3300049575 | Bacteria | 15181 |
| 898 | Ga0501039_0297632 | 3300049575 | Bacteria | 1269 |
| 899 | Ga0501040_0708931 | 3300049576 | Bacteria | 728 |
| 900 | Ga0501040_0974010 | 3300049576 | Bacteria | 615 |
| 901 | Ga0501041_0080848 | 3300049577 | Bacteria | 2001 |
| 902 | Ga0501042_0013258 | 3300049578 | Bacteria | 5610 |
| 903 | Ga0501042_0048501 | 3300049578 | Bacteria | 3028 |
| 904 | Ga0501043_0003230 | 3300049579 | Bacteria | 13454 |
| 905 | Ga0501043_1237984 | 3300049579 | Bacteria | 523 |
| 906 | Ga0501046_0001999 | 3300049580 | Bacteria | 19345 |
| 907 | Ga0501047_0004101 | 3300049581 | Bacteria | 13707 |
| 908 | Ga0501048_0002566 | 3300049582 | Bacteria | 13912 |
| 909 | Ga0501048_0450463 | 3300049582 | Bacteria | 922 |
| 910 | Ga0501048_0454274 | 3300049582 | Bacteria | 918 |
| 911 | Ga0501069_0000857 | 3300049585 | Bacteria | 14424 |
| 912 | Ga0501070_0002800 | 3300049586 | Bacteria | 15213 |
| 913 | Ga0501070_0005891 | 3300049586 | Bacteria | 10453 |
| 914 | Ga0501070_0675974 | 3300049586 | Bacteria | 818 |
| 915 | Ga0501071_0053056 | 3300049587 | Bacteria | 2924 |
| 916 | Ga0501073_0002456 | 3300049589 | Bacteria | 13848 |
| 917 | Ga0501073_0143968 | 3300049589 | Bacteria | 1652 |
| 918 | Ga0501074_0001540 | 3300049590 | Bacteria | 15583 |
| 919 | Ga0501074_0323247 | 3300049590 | Bacteria | 1095 |
| 920 | Ga0501074_0625861 | 3300049590 | Bacteria | 761 |
| 921 | Ga0501075_0112298 | 3300049591 | Bacteria | 2072 |
| 922 | Ga0501076_0007646 | 3300049592 | Bacteria | 7869 |
| 923 | Ga0501076_0990914 | 3300049592 | Bacteria | 692 |
| 924 | Ga0501077_0042956 | 3300049593 | Bacteria | 2873 |
| 925 | Ga0501079_0183716 | 3300049741 | Bacteria | 1632 |
| 926 | Ga0501080_0020280 | 3300049742 | Bacteria | 6151 |
| 927 | Ga0501081_1423497 | 3300049743 | Bacteria | 526 |
| 928 | Ga0501083_0027800 | 3300049744 | Bacteria | 3901 |
| 929 | Ga0501035_0003643 | 3300049822 | Bacteria | 14691 |
| 930 | Ga0501044_0002095 | 3300049823 | Bacteria | 22955 |
| 931 | nmdc:mga0yw44_56291_c1 | 3300050492 | Bacteria | 2395 |
| 932 | nmdc:mga05p37_121068_c1 | 3300050507 | Bacteria | 3215 |
| 933 | nmdc:mga05p37_59067_c1 | 3300050507 | Bacteria | 4724 |
| 934 | nmdc:mga05p37_760326_c1 | 3300050507 | Bacteria | 1067 |
| 935 | nmdc:mga09592_51736_c1 | 3300050508 | Bacteria | 3466 |
| 936 | nmdc:mga09592_64476_c1 | 3300050508 | Bacteria | 3102 |
| 937 | nmdc:mga0qj67_44485_c1 | 3300050509 | Bacteria | 3500 |
| 938 | nmdc:mga0qj67_82906_c1 | 3300050509 | Bacteria | 2571 |
| 939 | nmdc:mga06r32_407571_c1 | 3300050510 | Bacteria | 1341 |
| 940 | nmdc:mga06r32_64776_c1 | 3300050510 | Bacteria | 3525 |
| 941 | nmdc:mga06r32_9872_c1 | 3300050510 | Bacteria | 8615 |
| 942 | nmdc:mga08y16_1309_c1 | 3300050511 | Bacteria | 24769 |
| 943 | nmdc:mga08y16_1611781_c1 | 3300050511 | Bacteria | 607 |
| 944 | nmdc:mga08y16_276818_c1 | 3300050511 | Bacteria | 1732 |
| 945 | nmdc:mga0n895_13485_c1 | 3300050512 | Bacteria | 7377 |
| 946 | nmdc:mga0n895_173546_c1 | 3300050512 | Bacteria | 2187 |
| 947 | nmdc:mga0n895_1943763_c1 | 3300050512 | Bacteria | 547 |
| 948 | nmdc:mga0n895_249179_c1 | 3300050512 | Bacteria | 1802 |
| 949 | nmdc:mga0n895_9256_c1 | 3300050512 | Bacteria | 8606 |
| 950 | nmdc:mga0rr50_16203_c1 | 3300050513 | Bacteria | 4943 |
| 951 | nmdc:mga0rr50_449481_c1 | 3300050513 | Bacteria | 1092 |
| 952 | nmdc:mga0rr50_47287_c1 | 3300050513 | Bacteria | 3173 |
| 953 | nmdc:mga0rr50_56656_c1 | 3300050513 | Bacteria | 2929 |
| 954 | nmdc:mga08x19_1036300_c1 | 3300050514 | Bacteria | 583 |
| 955 | nmdc:mga08x19_20394_c1 | 3300050514 | Bacteria | 4081 |
| 956 | nmdc:mga08x19_5497_c1 | 3300050514 | Bacteria | 7496 |
| 957 | nmdc:mga0a205_30761_c1 | 3300050515 | Bacteria | 5142 |
| 958 | nmdc:mga0a205_358_c1 | 3300050515 | Bacteria | 34529 |
| 959 | Ga0495619_0015246 | 3300053085 | Bacteria | 4860 |
| 960 | Ga0500555_000074 | 3300053103 | Bacteria | 48939 |
| 961 | Ga0500573_0399679 | 3300053140 | Bacteria | 651 |
| 962 | Ga0501084_0002138 | 3300054114 | Bacteria | 15787 |
| 963 | Ga0501084_0791390 | 3300054114 | Bacteria | 799 |
| 964 | Ga0501084_1220617 | 3300054114 | Bacteria | 631 |
| 965 | Ga0501082_0585623 | 3300060353 | Bacteria | 976 |
| 966 | Ga0501082_1238504 | 3300060353 | Bacteria | 652 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005466 | Ga0070685_11155686 | Ga0070685_111556861 | 104 |
| 2 | iso_pu_bacteria | 2515154088 | 2515497768 | 104 |
| 3 | 3300009177 | Ga0105248_11531913 | Ga0105248_115319131 | 105 |
| 4 | 3300048917 | Ga0496114_1574418 | Ga0496114_1574418_14_334 | 105 |
| 5 | 3300025923 | Ga0207681_10793905 | Ga0207681_107939052 | 106 |
| 6 | 3300025929 | Ga0207664_11226882 | Ga0207664_112268821 | 106 |
| 7 | 3300031456 | Ga0307513_10602461 | Ga0307513_106024612 | 106 |
| 8 | 3300037312 | Ga0395899_0014951 | Ga0395899_0014951_624_944 | 106 |
| 9 | 3300037418 | Ga0395900_0049920 | Ga0395900_0049920_2366_2686 | 106 |
| 10 | 3300037466 | Ga0395898_0037998 | Ga0395898_0037998_86_406 | 106 |
| 11 | 3300037471 | Ga0395905_0007193 | Ga0395905_0007193_7931_8251 | 106 |
| 12 | 3300038443 | Ga0395901_0061037 | Ga0395901_0061037_2338_2658 | 106 |
| 13 | 3300044842 | Ga0466957_0156633 | Ga0466957_0156633_122_445 | 106 |
| 14 | 3300048907 | Ga0496104_0837703 | Ga0496104_0837703_331_657 | 106 |
| 15 | iso_pu_bacteria | 2643221694 | 2644524563 | 106 |
| 16 | iso_pu_bacteria | 2643221722 | 2644668662 | 106 |
| 17 | 3300001991 | JGI24743J22301_10070788 | JGI24743J22301_100707882 | 107 |
| 18 | 3300003203 | JGI25406J46586_10007697 | JGI25406J46586_100076977 | 107 |
| 19 | 3300003203 | JGI25406J46586_10033974 | JGI25406J46586_100339742 | 107 |
| 20 | 3300003203 | JGI25406J46586_10054974 | JGI25406J46586_100549742 | 107 |
| 21 | 3300003203 | JGI25406J46586_10266530 | JGI25406J46586_102665301 | 107 |
| 22 | 3300003373 | JGI25407J50210_10008244 | JGI25407J50210_100082442 | 107 |
| 23 | 3300003373 | JGI25407J50210_10028107 | JGI25407J50210_100281072 | 107 |
| 24 | 3300003373 | JGI25407J50210_10036134 | JGI25407J50210_100361342 | 107 |
| 25 | 3300003659 | JGI25404J52841_10004206 | JGI25404J52841_100042063 | 107 |
| 26 | 3300003756 | Ga0055533_1000037 | Ga0055533_1000037246 | 107 |
| 27 | 3300003759 | Ga0055525_1000213 | Ga0055525_100021313 | 107 |
| 28 | 3300003762 | Ga0055542_1018494 | Ga0055542_10184941 | 107 |
| 29 | 3300003841 | Ga0055541_1005331 | Ga0055541_10053313 | 107 |
| 30 | 3300005327 | Ga0070658_10038172 | Ga0070658_100381725 | 107 |
| 31 | 3300005327 | Ga0070658_10110206 | Ga0070658_101102063 | 107 |
| 32 | 3300005327 | Ga0070658_10389061 | Ga0070658_103890612 | 107 |
| 33 | 3300005328 | Ga0070676_11190679 | Ga0070676_111906792 | 107 |
| 34 | 3300005329 | Ga0070683_100257006 | Ga0070683_1002570062 | 107 |
| 35 | 3300005329 | Ga0070683_100333830 | Ga0070683_1003338302 | 107 |
| 36 | 3300005329 | Ga0070683_100834527 | Ga0070683_1008345272 | 107 |
| 37 | 3300005330 | Ga0070690_100762603 | Ga0070690_1007626032 | 107 |
| 38 | 3300005331 | Ga0070670_100021001 | Ga0070670_1000210011 | 107 |
| 39 | 3300005331 | Ga0070670_100734323 | Ga0070670_1007343232 | 107 |
| 40 | 3300005334 | Ga0068869_100038699 | Ga0068869_1000386994 | 107 |
| 41 | 3300005334 | Ga0068869_101261612 | Ga0068869_1012616121 | 107 |
| 42 | 3300005335 | Ga0070666_10068916 | Ga0070666_100689162 | 107 |
| 43 | 3300005335 | Ga0070666_10192319 | Ga0070666_101923192 | 107 |
| 44 | 3300005336 | Ga0070680_100041120 | Ga0070680_1000411202 | 107 |
| 45 | 3300005336 | Ga0070680_100965655 | Ga0070680_1009656551 | 107 |
| 46 | 3300005337 | Ga0070682_100013934 | Ga0070682_1000139343 | 107 |
| 47 | 3300005337 | Ga0070682_100103697 | Ga0070682_1001036972 | 107 |
| 48 | 3300005337 | Ga0070682_100237763 | Ga0070682_1002377632 | 107 |
| 49 | 3300005337 | Ga0070682_100491589 | Ga0070682_1004915892 | 107 |
| 50 | 3300005338 | Ga0068868_100013469 | Ga0068868_1000134694 | 107 |
| 51 | 3300005338 | Ga0068868_100272044 | Ga0068868_1002720442 | 107 |
| 52 | 3300005339 | Ga0070660_100153526 | Ga0070660_1001535263 | 107 |
| 53 | 3300005339 | Ga0070660_100407645 | Ga0070660_1004076452 | 107 |
| 54 | 3300005340 | Ga0070689_100271638 | Ga0070689_1002716382 | 107 |
| 55 | 3300005340 | Ga0070689_100324361 | Ga0070689_1003243612 | 107 |
| 56 | 3300005341 | Ga0070691_10065995 | Ga0070691_100659952 | 107 |
| 57 | 3300005341 | Ga0070691_10070934 | Ga0070691_100709342 | 107 |
| 58 | 3300005341 | Ga0070691_10352567 | Ga0070691_103525672 | 107 |
| 59 | 3300005344 | Ga0070661_100034530 | Ga0070661_1000345303 | 107 |
| 60 | 3300005344 | Ga0070661_100124106 | Ga0070661_1001241063 | 107 |
| 61 | 3300005344 | Ga0070661_100242129 | Ga0070661_1002421292 | 107 |
| 62 | 3300005345 | Ga0070692_10008676 | Ga0070692_100086764 | 107 |
| 63 | 3300005345 | Ga0070692_10114790 | Ga0070692_101147901 | 107 |
| 64 | 3300005345 | Ga0070692_11310940 | Ga0070692_113109401 | 107 |
| 65 | 3300005347 | Ga0070668_100001219 | Ga0070668_10000121910 | 107 |
| 66 | 3300005347 | Ga0070668_100029634 | Ga0070668_1000296342 | 107 |
| 67 | 3300005353 | Ga0070669_100396893 | Ga0070669_1003968932 | 107 |
| 68 | 3300005354 | Ga0070675_100107645 | Ga0070675_1001076452 | 107 |
| 69 | 3300005354 | Ga0070675_101321424 | Ga0070675_1013214241 | 107 |
| 70 | 3300005355 | Ga0070671_100090338 | Ga0070671_1000903382 | 107 |
| 71 | 3300005355 | Ga0070671_100689781 | Ga0070671_1006897812 | 107 |
| 72 | 3300005356 | Ga0070674_101838431 | Ga0070674_1018384312 | 107 |
| 73 | 3300005364 | Ga0070673_100021977 | Ga0070673_1000219774 | 107 |
| 74 | 3300005364 | Ga0070673_100601865 | Ga0070673_1006018652 | 107 |
| 75 | 3300005365 | Ga0070688_100312121 | Ga0070688_1003121212 | 107 |
| 76 | 3300005366 | Ga0070659_100129509 | Ga0070659_1001295093 | 107 |
| 77 | 3300005366 | Ga0070659_101048986 | Ga0070659_1010489861 | 107 |
| 78 | 3300005367 | Ga0070667_100568503 | Ga0070667_1005685032 | 107 |
| 79 | 3300005367 | Ga0070667_100851522 | Ga0070667_1008515222 | 107 |
| 80 | 3300005434 | Ga0070709_10001320 | Ga0070709_1000132010 | 107 |
| 81 | 3300005434 | Ga0070709_10002306 | Ga0070709_100023063 | 107 |
| 82 | 3300005434 | Ga0070709_10004333 | Ga0070709_100043332 | 107 |
| 83 | 3300005434 | Ga0070709_10064843 | Ga0070709_100648432 | 107 |
| 84 | 3300005434 | Ga0070709_10182848 | Ga0070709_101828482 | 107 |
| 85 | 3300005434 | Ga0070709_10229937 | Ga0070709_102299371 | 107 |
| 86 | 3300005434 | Ga0070709_10323552 | Ga0070709_103235521 | 107 |
| 87 | 3300005435 | Ga0070714_100012295 | Ga0070714_1000122953 | 107 |
| 88 | 3300005435 | Ga0070714_100022554 | Ga0070714_1000225544 | 107 |
| 89 | 3300005435 | Ga0070714_100029108 | Ga0070714_1000291084 | 107 |
| 90 | 3300005435 | Ga0070714_100059869 | Ga0070714_1000598693 | 107 |
| 91 | 3300005435 | Ga0070714_100090938 | Ga0070714_1000909382 | 107 |
| 92 | 3300005435 | Ga0070714_100104830 | Ga0070714_1001048302 | 107 |
| 93 | 3300005435 | Ga0070714_100153299 | Ga0070714_1001532993 | 107 |
| 94 | 3300005435 | Ga0070714_100219458 | Ga0070714_1002194582 | 107 |
| 95 | 3300005435 | Ga0070714_100372001 | Ga0070714_1003720012 | 107 |
| 96 | 3300005435 | Ga0070714_100428990 | Ga0070714_1004289902 | 107 |
| 97 | 3300005435 | Ga0070714_100696060 | Ga0070714_1006960601 | 107 |
| 98 | 3300005435 | Ga0070714_100711519 | Ga0070714_1007115192 | 107 |
| 99 | 3300005435 | Ga0070714_100961255 | Ga0070714_1009612552 | 107 |
| 100 | 3300005436 | Ga0070713_100002321 | Ga0070713_1000023215 | 107 |
| 101 | 3300005436 | Ga0070713_100002421 | Ga0070713_10000242112 | 107 |
| 102 | 3300005436 | Ga0070713_100002943 | Ga0070713_1000029437 | 107 |
| 103 | 3300005436 | Ga0070713_100010961 | Ga0070713_1000109616 | 107 |
| 104 | 3300005436 | Ga0070713_100238136 | Ga0070713_1002381362 | 107 |
| 105 | 3300005436 | Ga0070713_100351657 | Ga0070713_1003516573 | 107 |
| 106 | 3300005436 | Ga0070713_100516385 | Ga0070713_1005163852 | 107 |
| 107 | 3300005436 | Ga0070713_100628514 | Ga0070713_1006285142 | 107 |
| 108 | 3300005436 | Ga0070713_100734896 | Ga0070713_1007348962 | 107 |
| 109 | 3300005436 | Ga0070713_101127378 | Ga0070713_1011273781 | 107 |
| 110 | 3300005436 | Ga0070713_101472790 | Ga0070713_1014727901 | 107 |
| 111 | 3300005437 | Ga0070710_10000512 | Ga0070710_100005129 | 107 |
| 112 | 3300005437 | Ga0070710_10004454 | Ga0070710_100044542 | 107 |
| 113 | 3300005437 | Ga0070710_10015851 | Ga0070710_100158514 | 107 |
| 114 | 3300005437 | Ga0070710_10020056 | Ga0070710_100200565 | 107 |
| 115 | 3300005437 | Ga0070710_10040118 | Ga0070710_100401183 | 107 |
| 116 | 3300005437 | Ga0070710_10272355 | Ga0070710_102723552 | 107 |
| 117 | 3300005437 | Ga0070710_10362240 | Ga0070710_103622401 | 107 |
| 118 | 3300005437 | Ga0070710_11103210 | Ga0070710_111032101 | 107 |
| 119 | 3300005438 | Ga0070701_10092096 | Ga0070701_100920963 | 107 |
| 120 | 3300005438 | Ga0070701_10433435 | Ga0070701_104334352 | 107 |
| 121 | 3300005439 | Ga0070711_100005487 | Ga0070711_1000054872 | 107 |
| 122 | 3300005439 | Ga0070711_100030809 | Ga0070711_1000308094 | 107 |
| 123 | 3300005439 | Ga0070711_100333210 | Ga0070711_1003332102 | 107 |
| 124 | 3300005439 | Ga0070711_101019874 | Ga0070711_1010198742 | 107 |
| 125 | 3300005440 | Ga0070705_100238911 | Ga0070705_1002389111 | 107 |
| 126 | 3300005440 | Ga0070705_100494546 | Ga0070705_1004945462 | 107 |
| 127 | 3300005440 | Ga0070705_101717792 | Ga0070705_1017177922 | 107 |
| 128 | 3300005441 | Ga0070700_100451830 | Ga0070700_1004518302 | 107 |
| 129 | 3300005444 | Ga0070694_100632133 | Ga0070694_1006321331 | 107 |
| 130 | 3300005445 | Ga0070708_100168235 | Ga0070708_1001682351 | 107 |
| 131 | 3300005445 | Ga0070708_100203384 | Ga0070708_1002033842 | 107 |
| 132 | 3300005445 | Ga0070708_100406644 | Ga0070708_1004066442 | 107 |
| 133 | 3300005445 | Ga0070708_100540501 | Ga0070708_1005405011 | 107 |
| 134 | 3300005445 | Ga0070708_100553923 | Ga0070708_1005539232 | 107 |
| 135 | 3300005445 | Ga0070708_101379914 | Ga0070708_1013799142 | 107 |
| 136 | 3300005455 | Ga0070663_100020607 | Ga0070663_1000206074 | 107 |
| 137 | 3300005455 | Ga0070663_100461302 | Ga0070663_1004613022 | 107 |
| 138 | 3300005455 | Ga0070663_100831430 | Ga0070663_1008314302 | 107 |
| 139 | 3300005456 | Ga0070678_100002644 | Ga0070678_1000026445 | 107 |
| 140 | 3300005457 | Ga0070662_100241791 | Ga0070662_1002417912 | 107 |
| 141 | 3300005458 | Ga0070681_10008574 | Ga0070681_100085743 | 107 |
| 142 | 3300005458 | Ga0070681_11005777 | Ga0070681_110057772 | 107 |
| 143 | 3300005466 | Ga0070685_10155015 | Ga0070685_101550151 | 107 |
| 144 | 3300005466 | Ga0070685_10439352 | Ga0070685_104393522 | 107 |
| 145 | 3300005467 | Ga0070706_100019205 | Ga0070706_1000192058 | 107 |
| 146 | 3300005467 | Ga0070706_100039511 | Ga0070706_1000395112 | 107 |
| 147 | 3300005467 | Ga0070706_100287487 | Ga0070706_1002874872 | 107 |
| 148 | 3300005467 | Ga0070706_100900144 | Ga0070706_1009001442 | 107 |
| 149 | 3300005467 | Ga0070706_101013608 | Ga0070706_1010136082 | 107 |
| 150 | 3300005468 | Ga0070707_100039596 | Ga0070707_1000395962 | 107 |
| 151 | 3300005468 | Ga0070707_100047729 | Ga0070707_1000477292 | 107 |
| 152 | 3300005468 | Ga0070707_100050119 | Ga0070707_1000501192 | 107 |
| 153 | 3300005468 | Ga0070707_100059782 | Ga0070707_1000597823 | 107 |
| 154 | 3300005468 | Ga0070707_100125020 | Ga0070707_1001250202 | 107 |
| 155 | 3300005468 | Ga0070707_100249130 | Ga0070707_1002491302 | 107 |
| 156 | 3300005468 | Ga0070707_100538664 | Ga0070707_1005386642 | 107 |
| 157 | 3300005468 | Ga0070707_100665894 | Ga0070707_1006658942 | 107 |
| 158 | 3300005471 | Ga0070698_100020088 | Ga0070698_1000200882 | 107 |
| 159 | 3300005471 | Ga0070698_100324738 | Ga0070698_1003247382 | 107 |
| 160 | 3300005471 | Ga0070698_100481812 | Ga0070698_1004818122 | 107 |
| 161 | 3300005471 | Ga0070698_101042316 | Ga0070698_1010423162 | 107 |
| 162 | 3300005471 | Ga0070698_101232670 | Ga0070698_1012326702 | 107 |
| 163 | 3300005471 | Ga0070698_101356314 | Ga0070698_1013563141 | 107 |
| 164 | 3300005471 | Ga0070698_101920449 | Ga0070698_1019204491 | 107 |
| 165 | 3300005471 | Ga0070698_102027617 | Ga0070698_1020276172 | 107 |
| 166 | 3300005518 | Ga0070699_100000785 | Ga0070699_10000078518 | 107 |
| 167 | 3300005518 | Ga0070699_100011306 | Ga0070699_1000113069 | 107 |
| 168 | 3300005518 | Ga0070699_100261279 | Ga0070699_1002612793 | 107 |
| 169 | 3300005518 | Ga0070699_100449192 | Ga0070699_1004491922 | 107 |
| 170 | 3300005518 | Ga0070699_100874746 | Ga0070699_1008747462 | 107 |
| 171 | 3300005530 | Ga0070679_100060095 | Ga0070679_1000600954 | 107 |
| 172 | 3300005530 | Ga0070679_100300850 | Ga0070679_1003008502 | 107 |
| 173 | 3300005530 | Ga0070679_100652936 | Ga0070679_1006529362 | 107 |
| 174 | 3300005530 | Ga0070679_101908226 | Ga0070679_1019082262 | 107 |
| 175 | 3300005535 | Ga0070684_100025136 | Ga0070684_1000251367 | 107 |
| 176 | 3300005535 | Ga0070684_100145155 | Ga0070684_1001451552 | 107 |
| 177 | 3300005535 | Ga0070684_100706754 | Ga0070684_1007067542 | 107 |
| 178 | 3300005535 | Ga0070684_101531187 | Ga0070684_1015311872 | 107 |
| 179 | 3300005535 | Ga0070684_102112453 | Ga0070684_1021124531 | 107 |
| 180 | 3300005536 | Ga0070697_100070896 | Ga0070697_1000708963 | 107 |
| 181 | 3300005536 | Ga0070697_100071691 | Ga0070697_1000716915 | 107 |
| 182 | 3300005536 | Ga0070697_100120123 | Ga0070697_1001201232 | 107 |
| 183 | 3300005536 | Ga0070697_100143657 | Ga0070697_1001436573 | 107 |
| 184 | 3300005539 | Ga0068853_100460018 | Ga0068853_1004600182 | 107 |
| 185 | 3300005539 | Ga0068853_100498959 | Ga0068853_1004989591 | 107 |
| 186 | 3300005543 | Ga0070672_100107279 | Ga0070672_1001072792 | 107 |
| 187 | 3300005543 | Ga0070672_100252085 | Ga0070672_1002520852 | 107 |
| 188 | 3300005544 | Ga0070686_100341183 | Ga0070686_1003411831 | 107 |
| 189 | 3300005544 | Ga0070686_100347867 | Ga0070686_1003478672 | 107 |
| 190 | 3300005545 | Ga0070695_100500009 | Ga0070695_1005000092 | 107 |
| 191 | 3300005545 | Ga0070695_101638621 | Ga0070695_1016386211 | 107 |
| 192 | 3300005547 | Ga0070693_100002564 | Ga0070693_1000025644 | 107 |
| 193 | 3300005547 | Ga0070693_100081448 | Ga0070693_1000814482 | 107 |
| 194 | 3300005548 | Ga0070665_100070048 | Ga0070665_1000700483 | 107 |
| 195 | 3300005548 | Ga0070665_100896238 | Ga0070665_1008962382 | 107 |
| 196 | 3300005548 | Ga0070665_100934423 | Ga0070665_1009344232 | 107 |
| 197 | 3300005548 | Ga0070665_100996707 | Ga0070665_1009967072 | 107 |
| 198 | 3300005548 | Ga0070665_102257984 | Ga0070665_1022579841 | 107 |
| 199 | 3300005549 | Ga0070704_100596273 | Ga0070704_1005962732 | 107 |
| 200 | 3300005549 | Ga0070704_100669049 | Ga0070704_1006690492 | 107 |
| 201 | 3300005549 | Ga0070704_100993655 | Ga0070704_1009936552 | 107 |
| 202 | 3300005563 | Ga0068855_100191343 | Ga0068855_1001913432 | 107 |
| 203 | 3300005563 | Ga0068855_100730427 | Ga0068855_1007304272 | 107 |
| 204 | 3300005563 | Ga0068855_102346348 | Ga0068855_1023463481 | 107 |
| 205 | 3300005564 | Ga0070664_100007449 | Ga0070664_1000074497 | 107 |
| 206 | 3300005564 | Ga0070664_100118621 | Ga0070664_1001186212 | 107 |
| 207 | 3300005564 | Ga0070664_100156746 | Ga0070664_1001567463 | 107 |
| 208 | 3300005564 | Ga0070664_100165261 | Ga0070664_1001652612 | 107 |
| 209 | 3300005564 | Ga0070664_100429402 | Ga0070664_1004294022 | 107 |
| 210 | 3300005564 | Ga0070664_101115443 | Ga0070664_1011154432 | 107 |
| 211 | 3300005577 | Ga0068857_100179978 | Ga0068857_1001799782 | 107 |
| 212 | 3300005577 | Ga0068857_100349631 | Ga0068857_1003496312 | 107 |
| 213 | 3300005577 | Ga0068857_100433760 | Ga0068857_1004337602 | 107 |
| 214 | 3300005577 | Ga0068857_100560015 | Ga0068857_1005600152 | 107 |
| 215 | 3300005577 | Ga0068857_100983861 | Ga0068857_1009838611 | 107 |
| 216 | 3300005577 | Ga0068857_101171335 | Ga0068857_1011713352 | 107 |
| 217 | 3300005578 | Ga0068854_100019574 | Ga0068854_1000195743 | 107 |
| 218 | 3300005578 | Ga0068854_100037937 | Ga0068854_1000379374 | 107 |
| 219 | 3300005578 | Ga0068854_101795402 | Ga0068854_1017954021 | 107 |
| 220 | 3300005614 | Ga0068856_100038257 | Ga0068856_1000382576 | 107 |
| 221 | 3300005614 | Ga0068856_100095798 | Ga0068856_1000957982 | 107 |
| 222 | 3300005614 | Ga0068856_100123853 | Ga0068856_1001238534 | 107 |
| 223 | 3300005614 | Ga0068856_101916785 | Ga0068856_1019167852 | 107 |
| 224 | 3300005614 | Ga0068856_102148813 | Ga0068856_1021488131 | 107 |
| 225 | 3300005614 | Ga0068856_102352729 | Ga0068856_1023527291 | 107 |
| 226 | 3300005615 | Ga0070702_100002313 | Ga0070702_1000023134 | 107 |
| 227 | 3300005615 | Ga0070702_100480488 | Ga0070702_1004804882 | 107 |
| 228 | 3300005616 | Ga0068852_100025476 | Ga0068852_1000254762 | 107 |
| 229 | 3300005616 | Ga0068852_100050738 | Ga0068852_1000507383 | 107 |
| 230 | 3300005617 | Ga0068859_100023228 | Ga0068859_1000232288 | 107 |
| 231 | 3300005617 | Ga0068859_100642300 | Ga0068859_1006423002 | 107 |
| 232 | 3300005617 | Ga0068859_101919104 | Ga0068859_1019191042 | 107 |
| 233 | 3300005618 | Ga0068864_100071138 | Ga0068864_1000711382 | 107 |
| 234 | 3300005618 | Ga0068864_100968752 | Ga0068864_1009687522 | 107 |
| 235 | 3300005618 | Ga0068864_100991758 | Ga0068864_1009917582 | 107 |
| 236 | 3300005718 | Ga0068866_10909144 | Ga0068866_109091442 | 107 |
| 237 | 3300005719 | Ga0068861_100341893 | Ga0068861_1003418932 | 107 |
| 238 | 3300005719 | Ga0068861_100380552 | Ga0068861_1003805522 | 107 |
| 239 | 3300005719 | Ga0068861_100903425 | Ga0068861_1009034252 | 107 |
| 240 | 3300005719 | Ga0068861_101112599 | Ga0068861_1011125992 | 107 |
| 241 | 3300005719 | Ga0068861_101177455 | Ga0068861_1011774552 | 107 |
| 242 | 3300005719 | Ga0068861_101689895 | Ga0068861_1016898952 | 107 |
| 243 | 3300005834 | Ga0068851_10016276 | Ga0068851_100162761 | 107 |
| 244 | 3300005834 | Ga0068851_10320146 | Ga0068851_103201462 | 107 |
| 245 | 3300005840 | Ga0068870_10037323 | Ga0068870_100373234 | 107 |
| 246 | 3300005841 | Ga0068863_100022778 | Ga0068863_1000227784 | 107 |
| 247 | 3300005841 | Ga0068863_100346517 | Ga0068863_1003465172 | 107 |
| 248 | 3300005841 | Ga0068863_100354763 | Ga0068863_1003547632 | 107 |
| 249 | 3300005841 | Ga0068863_100499707 | Ga0068863_1004997071 | 107 |
| 250 | 3300005842 | Ga0068858_100161042 | Ga0068858_1001610423 | 107 |
| 251 | 3300005842 | Ga0068858_100345094 | Ga0068858_1003450941 | 107 |
| 252 | 3300005842 | Ga0068858_100462485 | Ga0068858_1004624852 | 107 |
| 253 | 3300005844 | Ga0068862_100065634 | Ga0068862_1000656344 | 107 |
| 254 | 3300005844 | Ga0068862_100392386 | Ga0068862_1003923862 | 107 |
| 255 | 3300005937 | Ga0081455_10009212 | Ga0081455_100092123 | 107 |
| 256 | 3300005937 | Ga0081455_10014880 | Ga0081455_100148803 | 107 |
| 257 | 3300005937 | Ga0081455_10157084 | Ga0081455_101570842 | 107 |
| 258 | 3300005937 | Ga0081455_10332298 | Ga0081455_103322982 | 107 |
| 259 | 3300005937 | Ga0081455_10396517 | Ga0081455_103965171 | 107 |
| 260 | 3300005981 | Ga0081538_10002082 | Ga0081538_100020822 | 107 |
| 261 | 3300005981 | Ga0081538_10002644 | Ga0081538_1000264412 | 107 |
| 262 | 3300005981 | Ga0081538_10062235 | Ga0081538_100622353 | 107 |
| 263 | 3300005981 | Ga0081538_10086433 | Ga0081538_100864333 | 107 |
| 264 | 3300005981 | Ga0081538_10112191 | Ga0081538_101121912 | 107 |
| 265 | 3300005981 | Ga0081538_10152866 | Ga0081538_101528662 | 107 |
| 266 | 3300005983 | Ga0081540_1002533 | Ga0081540_10025334 | 107 |
| 267 | 3300005983 | Ga0081540_1097259 | Ga0081540_10972591 | 107 |
| 268 | 3300005985 | Ga0081539_10001085 | Ga0081539_1000108548 | 107 |
| 269 | 3300005985 | Ga0081539_10001117 | Ga0081539_1000111746 | 107 |
| 270 | 3300005985 | Ga0081539_10002987 | Ga0081539_100029878 | 107 |
| 271 | 3300005985 | Ga0081539_10036376 | Ga0081539_100363763 | 107 |
| 272 | 3300006028 | Ga0070717_10003459 | Ga0070717_100034599 | 107 |
| 273 | 3300006028 | Ga0070717_10009025 | Ga0070717_100090257 | 107 |
| 274 | 3300006028 | Ga0070717_10056856 | Ga0070717_100568562 | 107 |
| 275 | 3300006028 | Ga0070717_10064331 | Ga0070717_100643314 | 107 |
| 276 | 3300006028 | Ga0070717_10089852 | Ga0070717_100898523 | 107 |
| 277 | 3300006028 | Ga0070717_10169817 | Ga0070717_101698173 | 107 |
| 278 | 3300006028 | Ga0070717_10198306 | Ga0070717_101983062 | 107 |
| 279 | 3300006028 | Ga0070717_10294558 | Ga0070717_102945581 | 107 |
| 280 | 3300006028 | Ga0070717_10316645 | Ga0070717_103166452 | 107 |
| 281 | 3300006028 | Ga0070717_10985185 | Ga0070717_109851852 | 107 |
| 282 | 3300006028 | Ga0070717_11845222 | Ga0070717_118452221 | 107 |
| 283 | 3300006028 | Ga0070717_11854350 | Ga0070717_118543501 | 107 |
| 284 | 3300006038 | Ga0075365_10344220 | Ga0075365_103442202 | 107 |
| 285 | 3300006058 | Ga0075432_10002349 | Ga0075432_100023495 | 107 |
| 286 | 3300006058 | Ga0075432_10010170 | Ga0075432_100101704 | 107 |
| 287 | 3300006163 | Ga0070715_10186259 | Ga0070715_101862592 | 107 |
| 288 | 3300006173 | Ga0070716_100008325 | Ga0070716_1000083257 | 107 |
| 289 | 3300006173 | Ga0070716_100108502 | Ga0070716_1001085022 | 107 |
| 290 | 3300006173 | Ga0070716_100114543 | Ga0070716_1001145432 | 107 |
| 291 | 3300006173 | Ga0070716_100198001 | Ga0070716_1001980012 | 107 |
| 292 | 3300006173 | Ga0070716_100363275 | Ga0070716_1003632752 | 107 |
| 293 | 3300006173 | Ga0070716_101296165 | Ga0070716_1012961651 | 107 |
| 294 | 3300006175 | Ga0070712_100002212 | Ga0070712_10000221214 | 107 |
| 295 | 3300006175 | Ga0070712_100087131 | Ga0070712_1000871314 | 107 |
| 296 | 3300006175 | Ga0070712_100141398 | Ga0070712_1001413982 | 107 |
| 297 | 3300006175 | Ga0070712_100470430 | Ga0070712_1004704302 | 107 |
| 298 | 3300006175 | Ga0070712_100495388 | Ga0070712_1004953882 | 107 |
| 299 | 3300006175 | Ga0070712_100503532 | Ga0070712_1005035322 | 107 |
| 300 | 3300006175 | Ga0070712_100984037 | Ga0070712_1009840372 | 107 |
| 301 | 3300006175 | Ga0070712_101830300 | Ga0070712_1018303001 | 107 |
| 302 | 3300006237 | Ga0097621_100260033 | Ga0097621_1002600332 | 107 |
| 303 | 3300006237 | Ga0097621_100467964 | Ga0097621_1004679642 | 107 |
| 304 | 3300006237 | Ga0097621_100656297 | Ga0097621_1006562972 | 107 |
| 305 | 3300006237 | Ga0097621_101318538 | Ga0097621_1013185381 | 107 |
| 306 | 3300006358 | Ga0068871_100044951 | Ga0068871_1000449512 | 107 |
| 307 | 3300006358 | Ga0068871_100161655 | Ga0068871_1001616553 | 107 |
| 308 | 3300006358 | Ga0068871_100359498 | Ga0068871_1003594981 | 107 |
| 309 | 3300006844 | Ga0075428_100006141 | Ga0075428_1000061416 | 107 |
| 310 | 3300006844 | Ga0075428_100025139 | Ga0075428_1000251394 | 107 |
| 311 | 3300006844 | Ga0075428_100499622 | Ga0075428_1004996222 | 107 |
| 312 | 3300006844 | Ga0075428_100509187 | Ga0075428_1005091871 | 107 |
| 313 | 3300006844 | Ga0075428_100850765 | Ga0075428_1008507652 | 107 |
| 314 | 3300006846 | Ga0075430_100005217 | Ga0075430_1000052176 | 107 |
| 315 | 3300006846 | Ga0075430_100020698 | Ga0075430_1000206983 | 107 |
| 316 | 3300006846 | Ga0075430_100933851 | Ga0075430_1009338511 | 107 |
| 317 | 3300006847 | Ga0075431_100005151 | Ga0075431_10000515112 | 107 |
| 318 | 3300006847 | Ga0075431_100025330 | Ga0075431_1000253301 | 107 |
| 319 | 3300006847 | Ga0075431_100574965 | Ga0075431_1005749652 | 107 |
| 320 | 3300006852 | Ga0075433_10006286 | Ga0075433_100062864 | 107 |
| 321 | 3300006852 | Ga0075433_10018598 | Ga0075433_100185985 | 107 |
| 322 | 3300006871 | Ga0075434_100001130 | Ga0075434_10000113029 | 107 |
| 323 | 3300006871 | Ga0075434_100015099 | Ga0075434_10001509911 | 107 |
| 324 | 3300006871 | Ga0075434_100994798 | Ga0075434_1009947982 | 107 |
| 325 | 3300006871 | Ga0075434_101012518 | Ga0075434_1010125182 | 107 |
| 326 | 3300006880 | Ga0075429_100006139 | Ga0075429_1000061392 | 107 |
| 327 | 3300006880 | Ga0075429_100036319 | Ga0075429_1000363196 | 107 |
| 328 | 3300006881 | Ga0068865_100927542 | Ga0068865_1009275421 | 107 |
| 329 | 3300006914 | Ga0075436_100002659 | Ga0075436_10000265913 | 107 |
| 330 | 3300006914 | Ga0075436_100034378 | Ga0075436_1000343782 | 107 |
| 331 | 3300006914 | Ga0075436_100190533 | Ga0075436_1001905332 | 107 |
| 332 | 3300006931 | Ga0097620_100023228 | Ga0097620_1000232288 | 107 |
| 333 | 3300006931 | Ga0097620_100642299 | Ga0097620_1006422992 | 107 |
| 334 | 3300006931 | Ga0097620_101919696 | Ga0097620_1019196961 | 107 |
| 335 | 3300007076 | Ga0075435_100000977 | Ga0075435_1000009772 | 107 |
| 336 | 3300007076 | Ga0075435_100226059 | Ga0075435_1002260591 | 107 |
| 337 | 3300007076 | Ga0075435_100362666 | Ga0075435_1003626662 | 107 |
| 338 | 3300007076 | Ga0075435_100557574 | Ga0075435_1005575742 | 107 |
| 339 | 3300007076 | Ga0075435_101056396 | Ga0075435_1010563961 | 107 |
| 340 | 3300007265 | Ga0099794_10230590 | Ga0099794_102305902 | 107 |
| 341 | 3300007788 | Ga0099795_10219596 | Ga0099795_102195961 | 107 |
| 342 | 3300007788 | Ga0099795_10445883 | Ga0099795_104458831 | 107 |
| 343 | 3300007788 | Ga0099795_10488559 | Ga0099795_104885591 | 107 |
| 344 | 3300009011 | Ga0105251_10061484 | Ga0105251_100614841 | 107 |
| 345 | 3300009011 | Ga0105251_10285873 | Ga0105251_102858732 | 107 |
| 346 | 3300009093 | Ga0105240_10124436 | Ga0105240_101244364 | 107 |
| 347 | 3300009093 | Ga0105240_10839503 | Ga0105240_108395032 | 107 |
| 348 | 3300009093 | Ga0105240_11848787 | Ga0105240_118487872 | 107 |
| 349 | 3300009094 | Ga0111539_10000779 | Ga0111539_1000077926 | 107 |
| 350 | 3300009094 | Ga0111539_10057760 | Ga0111539_100577603 | 107 |
| 351 | 3300009094 | Ga0111539_13358644 | Ga0111539_133586441 | 107 |
| 352 | 3300009098 | Ga0105245_10050634 | Ga0105245_100506343 | 107 |
| 353 | 3300009098 | Ga0105245_10055174 | Ga0105245_100551744 | 107 |
| 354 | 3300009098 | Ga0105245_10072031 | Ga0105245_100720312 | 107 |
| 355 | 3300009101 | Ga0105247_10137577 | Ga0105247_101375772 | 107 |
| 356 | 3300009101 | Ga0105247_10371112 | Ga0105247_103711122 | 107 |
| 357 | 3300009101 | Ga0105247_10539465 | Ga0105247_105394652 | 107 |
| 358 | 3300009147 | Ga0114129_10007655 | Ga0114129_1000765510 | 107 |
| 359 | 3300009147 | Ga0114129_10069746 | Ga0114129_100697467 | 107 |
| 360 | 3300009147 | Ga0114129_10404869 | Ga0114129_104048692 | 107 |
| 361 | 3300009147 | Ga0114129_11520637 | Ga0114129_115206372 | 107 |
| 362 | 3300009147 | Ga0114129_12234326 | Ga0114129_122343261 | 107 |
| 363 | 3300009148 | Ga0105243_10075772 | Ga0105243_100757724 | 107 |
| 364 | 3300009148 | Ga0105243_10869678 | Ga0105243_108696781 | 107 |
| 365 | 3300009148 | Ga0105243_11493335 | Ga0105243_114933351 | 107 |
| 366 | 3300009148 | Ga0105243_12692594 | Ga0105243_126925941 | 107 |
| 367 | 3300009174 | Ga0105241_10009288 | Ga0105241_100092882 | 107 |
| 368 | 3300009176 | Ga0105242_10870066 | Ga0105242_108700662 | 107 |
| 369 | 3300009177 | Ga0105248_10136816 | Ga0105248_101368164 | 107 |
| 370 | 3300009177 | Ga0105248_10217530 | Ga0105248_102175302 | 107 |
| 371 | 3300009177 | Ga0105248_10325588 | Ga0105248_103255883 | 107 |
| 372 | 3300009177 | Ga0105248_11612690 | Ga0105248_116126902 | 107 |
| 373 | 3300009177 | Ga0105248_13343083 | Ga0105248_133430832 | 107 |
| 374 | 3300009545 | Ga0105237_10141495 | Ga0105237_101414952 | 107 |
| 375 | 3300009545 | Ga0105237_10490653 | Ga0105237_104906532 | 107 |
| 376 | 3300009551 | Ga0105238_10068794 | Ga0105238_100687945 | 107 |
| 377 | 3300009551 | Ga0105238_10249503 | Ga0105238_102495032 | 107 |
| 378 | 3300009551 | Ga0105238_10480863 | Ga0105238_104808632 | 107 |
| 379 | 3300009551 | Ga0105238_11845401 | Ga0105238_118454011 | 107 |
| 380 | 3300009553 | Ga0105249_10470897 | Ga0105249_104708972 | 107 |
| 381 | 3300009553 | Ga0105249_12300581 | Ga0105249_123005811 | 107 |
| 382 | 3300010159 | Ga0099796_10058857 | Ga0099796_100588572 | 107 |
| 383 | 3300010375 | Ga0105239_10238858 | Ga0105239_102388582 | 107 |
| 384 | 3300010375 | Ga0105239_10279513 | Ga0105239_102795132 | 107 |
| 385 | 3300010375 | Ga0105239_11810169 | Ga0105239_118101692 | 107 |
| 386 | 3300010375 | Ga0105239_12555441 | Ga0105239_125554411 | 107 |
| 387 | 3300011119 | Ga0105246_10058429 | Ga0105246_100584292 | 107 |
| 388 | 3300011119 | Ga0105246_10519190 | Ga0105246_105191902 | 107 |
| 389 | 3300012507 | Ga0157342_1031332 | Ga0157342_10313321 | 107 |
| 390 | 3300013100 | Ga0157373_10005783 | Ga0157373_1000578310 | 107 |
| 391 | 3300013100 | Ga0157373_10057034 | Ga0157373_100570344 | 107 |
| 392 | 3300013100 | Ga0157373_10164244 | Ga0157373_101642442 | 107 |
| 393 | 3300013102 | Ga0157371_10043385 | Ga0157371_100433853 | 107 |
| 394 | 3300013104 | Ga0157370_10035208 | Ga0157370_100352084 | 107 |
| 395 | 3300013104 | Ga0157370_10089752 | Ga0157370_100897523 | 107 |
| 396 | 3300013104 | Ga0157370_10432114 | Ga0157370_104321142 | 107 |
| 397 | 3300013104 | Ga0157370_11178794 | Ga0157370_111787941 | 107 |
| 398 | 3300013105 | Ga0157369_10036784 | Ga0157369_100367848 | 107 |
| 399 | 3300013105 | Ga0157369_10064667 | Ga0157369_100646672 | 107 |
| 400 | 3300013105 | Ga0157369_10297344 | Ga0157369_102973442 | 107 |
| 401 | 3300013105 | Ga0157369_10620706 | Ga0157369_106207062 | 107 |
| 402 | 3300013105 | Ga0157369_10682308 | Ga0157369_106823081 | 107 |
| 403 | 3300013105 | Ga0157369_10838386 | Ga0157369_108383862 | 107 |
| 404 | 3300013105 | Ga0157369_11023262 | Ga0157369_110232622 | 107 |
| 405 | 3300013105 | Ga0157369_12550043 | Ga0157369_125500431 | 107 |
| 406 | 3300013296 | Ga0157374_10028564 | Ga0157374_100285644 | 107 |
| 407 | 3300013296 | Ga0157374_10034562 | Ga0157374_100345622 | 107 |
| 408 | 3300013296 | Ga0157374_10568542 | Ga0157374_105685422 | 107 |
| 409 | 3300013296 | Ga0157374_10580423 | Ga0157374_105804232 | 107 |
| 410 | 3300013296 | Ga0157374_11831739 | Ga0157374_118317391 | 107 |
| 411 | 3300013297 | Ga0157378_11328338 | Ga0157378_113283381 | 107 |
| 412 | 3300013297 | Ga0157378_11504629 | Ga0157378_115046292 | 107 |
| 413 | 3300013297 | Ga0157378_12773851 | Ga0157378_127738512 | 107 |
| 414 | 3300013306 | Ga0163162_10153877 | Ga0163162_101538772 | 107 |
| 415 | 3300013306 | Ga0163162_11231091 | Ga0163162_112310912 | 107 |
| 416 | 3300013306 | Ga0163162_11715788 | Ga0163162_117157881 | 107 |
| 417 | 3300013306 | Ga0163162_11943863 | Ga0163162_119438632 | 107 |
| 418 | 3300013307 | Ga0157372_10269736 | Ga0157372_102697362 | 107 |
| 419 | 3300013307 | Ga0157372_10279594 | Ga0157372_102795942 | 107 |
| 420 | 3300013307 | Ga0157372_10472484 | Ga0157372_104724842 | 107 |
| 421 | 3300013307 | Ga0157372_12132496 | Ga0157372_121324962 | 107 |
| 422 | 3300013307 | Ga0157372_12156609 | Ga0157372_121566092 | 107 |
| 423 | 3300013307 | Ga0157372_12336230 | Ga0157372_123362301 | 107 |
| 424 | 3300013308 | Ga0157375_10041515 | Ga0157375_100415153 | 107 |
| 425 | 3300013308 | Ga0157375_10044820 | Ga0157375_100448202 | 107 |
| 426 | 3300013308 | Ga0157375_10269535 | Ga0157375_102695352 | 107 |
| 427 | 3300013308 | Ga0157375_10325653 | Ga0157375_103256532 | 107 |
| 428 | 3300013308 | Ga0157375_10433247 | Ga0157375_104332472 | 107 |
| 429 | 3300013308 | Ga0157375_10672843 | Ga0157375_106728432 | 107 |
| 430 | 3300014325 | Ga0163163_10020825 | Ga0163163_100208255 | 107 |
| 431 | 3300014325 | Ga0163163_10106198 | Ga0163163_101061982 | 107 |
| 432 | 3300014325 | Ga0163163_10158736 | Ga0163163_101587362 | 107 |
| 433 | 3300014325 | Ga0163163_13003767 | Ga0163163_130037672 | 107 |
| 434 | 3300014326 | Ga0157380_10273263 | Ga0157380_102732632 | 107 |
| 435 | 3300014326 | Ga0157380_11001833 | Ga0157380_110018332 | 107 |
| 436 | 3300014497 | Ga0182008_10301872 | Ga0182008_103018722 | 107 |
| 437 | 3300014745 | Ga0157377_10006356 | Ga0157377_100063564 | 107 |
| 438 | 3300014745 | Ga0157377_10036159 | Ga0157377_100361592 | 107 |
| 439 | 3300014745 | Ga0157377_10372821 | Ga0157377_103728211 | 107 |
| 440 | 3300014968 | Ga0157379_10150724 | Ga0157379_101507242 | 107 |
| 441 | 3300014968 | Ga0157379_10294462 | Ga0157379_102944622 | 107 |
| 442 | 3300014968 | Ga0157379_10690650 | Ga0157379_106906502 | 107 |
| 443 | 3300014969 | Ga0157376_10149631 | Ga0157376_101496312 | 107 |
| 444 | 3300014969 | Ga0157376_10171726 | Ga0157376_101717263 | 107 |
| 445 | 3300014969 | Ga0157376_11279097 | Ga0157376_112790972 | 107 |
| 446 | 3300014969 | Ga0157376_11305789 | Ga0157376_113057892 | 107 |
| 447 | 3300020069 | Ga0197907_10183059 | Ga0197907_101830591 | 107 |
| 448 | 3300020069 | Ga0197907_10763580 | Ga0197907_107635802 | 107 |
| 449 | 3300020070 | Ga0206356_11299412 | Ga0206356_112994122 | 107 |
| 450 | 3300020070 | Ga0206356_11645124 | Ga0206356_116451241 | 107 |
| 451 | 3300020078 | Ga0206352_10448073 | Ga0206352_104480732 | 107 |
| 452 | 3300020081 | Ga0206354_10623429 | Ga0206354_106234294 | 107 |
| 453 | 3300020081 | Ga0206354_10680820 | Ga0206354_106808201 | 107 |
| 454 | 3300020082 | Ga0206353_10190738 | Ga0206353_101907381 | 107 |
| 455 | 3300020082 | Ga0206353_10279819 | Ga0206353_102798192 | 107 |
| 456 | 3300020082 | Ga0206353_11190550 | Ga0206353_111905502 | 107 |
| 457 | 3300020082 | Ga0206353_11823412 | Ga0206353_118234122 | 107 |
| 458 | 3300020610 | Ga0154015_1041837 | Ga0154015_10418371 | 107 |
| 459 | 3300021388 | Ga0213875_10141861 | Ga0213875_101418612 | 107 |
| 460 | 3300021388 | Ga0213875_10152876 | Ga0213875_101528761 | 107 |
| 461 | 3300022467 | Ga0224712_10053320 | Ga0224712_100533202 | 107 |
| 462 | 3300022467 | Ga0224712_10346946 | Ga0224712_103469461 | 107 |
| 463 | 3300022467 | Ga0224712_10432143 | Ga0224712_104321431 | 107 |
| 464 | 3300022467 | Ga0224712_10486256 | Ga0224712_104862562 | 107 |
| 465 | 3300025225 | Ga0209566_100047 | Ga0209566_100047202 | 107 |
| 466 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012395 | 107 |
| 467 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012395 | 107 |
| 468 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012395 | 107 |
| 469 | 3300025254 | Ga0209148_1017874 | Ga0209148_10178742 | 107 |
| 470 | 3300025321 | Ga0207656_10004717 | Ga0207656_100047174 | 107 |
| 471 | 3300025735 | Ga0207713_1192436 | Ga0207713_11924362 | 107 |
| 472 | 3300025885 | Ga0207653_10040605 | Ga0207653_100406051 | 107 |
| 473 | 3300025898 | Ga0207692_10001320 | Ga0207692_100013204 | 107 |
| 474 | 3300025898 | Ga0207692_10008171 | Ga0207692_100081714 | 107 |
| 475 | 3300025898 | Ga0207692_10014042 | Ga0207692_100140423 | 107 |
| 476 | 3300025898 | Ga0207692_10139056 | Ga0207692_101390562 | 107 |
| 477 | 3300025898 | Ga0207692_10308976 | Ga0207692_103089762 | 107 |
| 478 | 3300025898 | Ga0207692_10543912 | Ga0207692_105439121 | 107 |
| 479 | 3300025898 | Ga0207692_11002583 | Ga0207692_110025832 | 107 |
| 480 | 3300025899 | Ga0207642_10106362 | Ga0207642_101063622 | 107 |
| 481 | 3300025900 | Ga0207710_10056367 | Ga0207710_100563673 | 107 |
| 482 | 3300025900 | Ga0207710_10265878 | Ga0207710_102658781 | 107 |
| 483 | 3300025901 | Ga0207688_10034897 | Ga0207688_100348974 | 107 |
| 484 | 3300025901 | Ga0207688_10211840 | Ga0207688_102118402 | 107 |
| 485 | 3300025903 | Ga0207680_10073482 | Ga0207680_100734822 | 107 |
| 486 | 3300025903 | Ga0207680_10228460 | Ga0207680_102284602 | 107 |
| 487 | 3300025904 | Ga0207647_10151859 | Ga0207647_101518592 | 107 |
| 488 | 3300025904 | Ga0207647_10153438 | Ga0207647_101534382 | 107 |
| 489 | 3300025905 | Ga0207685_10627028 | Ga0207685_106270281 | 107 |
| 490 | 3300025906 | Ga0207699_10000150 | Ga0207699_1000015030 | 107 |
| 491 | 3300025906 | Ga0207699_10000258 | Ga0207699_100002584 | 107 |
| 492 | 3300025906 | Ga0207699_10027274 | Ga0207699_100272742 | 107 |
| 493 | 3300025906 | Ga0207699_10063013 | Ga0207699_100630132 | 107 |
| 494 | 3300025906 | Ga0207699_10123094 | Ga0207699_101230942 | 107 |
| 495 | 3300025906 | Ga0207699_11227137 | Ga0207699_112271371 | 107 |
| 496 | 3300025907 | Ga0207645_10230490 | Ga0207645_102304902 | 107 |
| 497 | 3300025907 | Ga0207645_10375428 | Ga0207645_103754282 | 107 |
| 498 | 3300025907 | Ga0207645_10810261 | Ga0207645_108102611 | 107 |
| 499 | 3300025908 | Ga0207643_10001537 | Ga0207643_100015374 | 107 |
| 500 | 3300025908 | Ga0207643_10035540 | Ga0207643_100355402 | 107 |
| 501 | 3300025909 | Ga0207705_10022571 | Ga0207705_100225713 | 107 |
| 502 | 3300025909 | Ga0207705_10793801 | Ga0207705_107938012 | 107 |
| 503 | 3300025909 | Ga0207705_11528815 | Ga0207705_115288152 | 107 |
| 504 | 3300025910 | Ga0207684_10008759 | Ga0207684_100087598 | 107 |
| 505 | 3300025910 | Ga0207684_10016494 | Ga0207684_100164946 | 107 |
| 506 | 3300025910 | Ga0207684_10729071 | Ga0207684_107290712 | 107 |
| 507 | 3300025910 | Ga0207684_10896393 | Ga0207684_108963932 | 107 |
| 508 | 3300025911 | Ga0207654_10019819 | Ga0207654_100198192 | 107 |
| 509 | 3300025912 | Ga0207707_10111086 | Ga0207707_101110863 | 107 |
| 510 | 3300025912 | Ga0207707_10526153 | Ga0207707_105261532 | 107 |
| 511 | 3300025912 | Ga0207707_11061030 | Ga0207707_110610302 | 107 |
| 512 | 3300025913 | Ga0207695_10621075 | Ga0207695_106210752 | 107 |
| 513 | 3300025914 | Ga0207671_10093394 | Ga0207671_100933942 | 107 |
| 514 | 3300025914 | Ga0207671_10621688 | Ga0207671_106216881 | 107 |
| 515 | 3300025914 | Ga0207671_11512637 | Ga0207671_115126371 | 107 |
| 516 | 3300025915 | Ga0207693_10003060 | Ga0207693_1000306016 | 107 |
| 517 | 3300025915 | Ga0207693_10019403 | Ga0207693_100194036 | 107 |
| 518 | 3300025915 | Ga0207693_10025702 | Ga0207693_100257024 | 107 |
| 519 | 3300025915 | Ga0207693_10083599 | Ga0207693_100835991 | 107 |
| 520 | 3300025915 | Ga0207693_10328894 | Ga0207693_103288942 | 107 |
| 521 | 3300025915 | Ga0207693_11338969 | Ga0207693_113389692 | 107 |
| 522 | 3300025916 | Ga0207663_10002856 | Ga0207663_100028564 | 107 |
| 523 | 3300025916 | Ga0207663_10006047 | Ga0207663_100060473 | 107 |
| 524 | 3300025916 | Ga0207663_10022592 | Ga0207663_100225922 | 107 |
| 525 | 3300025916 | Ga0207663_10677728 | Ga0207663_106777282 | 107 |
| 526 | 3300025916 | Ga0207663_11409615 | Ga0207663_114096151 | 107 |
| 527 | 3300025917 | Ga0207660_10963190 | Ga0207660_109631901 | 107 |
| 528 | 3300025917 | Ga0207660_11661673 | Ga0207660_116616731 | 107 |
| 529 | 3300025918 | Ga0207662_10074461 | Ga0207662_100744613 | 107 |
| 530 | 3300025919 | Ga0207657_10009474 | Ga0207657_100094749 | 107 |
| 531 | 3300025919 | Ga0207657_10062340 | Ga0207657_100623402 | 107 |
| 532 | 3300025919 | Ga0207657_10128400 | Ga0207657_101284002 | 107 |
| 533 | 3300025919 | Ga0207657_10421494 | Ga0207657_104214943 | 107 |
| 534 | 3300025920 | Ga0207649_10004621 | Ga0207649_100046214 | 107 |
| 535 | 3300025920 | Ga0207649_10524981 | Ga0207649_105249812 | 107 |
| 536 | 3300025921 | Ga0207652_10035081 | Ga0207652_100350814 | 107 |
| 537 | 3300025921 | Ga0207652_10254175 | Ga0207652_102541752 | 107 |
| 538 | 3300025921 | Ga0207652_10301013 | Ga0207652_103010132 | 107 |
| 539 | 3300025921 | Ga0207652_10572801 | Ga0207652_105728012 | 107 |
| 540 | 3300025921 | Ga0207652_10674011 | Ga0207652_106740112 | 107 |
| 541 | 3300025921 | Ga0207652_11154078 | Ga0207652_111540782 | 107 |
| 542 | 3300025922 | Ga0207646_10071910 | Ga0207646_100719103 | 107 |
| 543 | 3300025922 | Ga0207646_10120426 | Ga0207646_101204262 | 107 |
| 544 | 3300025922 | Ga0207646_10689470 | Ga0207646_106894702 | 107 |
| 545 | 3300025922 | Ga0207646_10837273 | Ga0207646_108372732 | 107 |
| 546 | 3300025923 | Ga0207681_10252375 | Ga0207681_102523752 | 107 |
| 547 | 3300025923 | Ga0207681_10273771 | Ga0207681_102737712 | 107 |
| 548 | 3300025924 | Ga0207694_10054897 | Ga0207694_100548972 | 107 |
| 549 | 3300025924 | Ga0207694_10206262 | Ga0207694_102062622 | 107 |
| 550 | 3300025925 | Ga0207650_10006488 | Ga0207650_100064884 | 107 |
| 551 | 3300025925 | Ga0207650_10693905 | Ga0207650_106939052 | 107 |
| 552 | 3300025926 | Ga0207659_10019293 | Ga0207659_100192932 | 107 |
| 553 | 3300025926 | Ga0207659_11091678 | Ga0207659_110916782 | 107 |
| 554 | 3300025926 | Ga0207659_11918544 | Ga0207659_119185442 | 107 |
| 555 | 3300025927 | Ga0207687_10016939 | Ga0207687_100169394 | 107 |
| 556 | 3300025927 | Ga0207687_10042788 | Ga0207687_100427882 | 107 |
| 557 | 3300025927 | Ga0207687_10858755 | Ga0207687_108587551 | 107 |
| 558 | 3300025928 | Ga0207700_10000342 | Ga0207700_1000034229 | 107 |
| 559 | 3300025928 | Ga0207700_10003386 | Ga0207700_100033863 | 107 |
| 560 | 3300025928 | Ga0207700_10031252 | Ga0207700_100312524 | 107 |
| 561 | 3300025928 | Ga0207700_10123271 | Ga0207700_101232712 | 107 |
| 562 | 3300025928 | Ga0207700_10179195 | Ga0207700_101791952 | 107 |
| 563 | 3300025928 | Ga0207700_10184697 | Ga0207700_101846972 | 107 |
| 564 | 3300025928 | Ga0207700_10194187 | Ga0207700_101941873 | 107 |
| 565 | 3300025928 | Ga0207700_10243232 | Ga0207700_102432322 | 107 |
| 566 | 3300025928 | Ga0207700_10320985 | Ga0207700_103209852 | 107 |
| 567 | 3300025928 | Ga0207700_10364186 | Ga0207700_103641862 | 107 |
| 568 | 3300025928 | Ga0207700_10479384 | Ga0207700_104793842 | 107 |
| 569 | 3300025928 | Ga0207700_10841780 | Ga0207700_108417802 | 107 |
| 570 | 3300025929 | Ga0207664_10000764 | Ga0207664_1000076410 | 107 |
| 571 | 3300025929 | Ga0207664_10007272 | Ga0207664_100072722 | 107 |
| 572 | 3300025929 | Ga0207664_10039694 | Ga0207664_100396945 | 107 |
| 573 | 3300025929 | Ga0207664_10045733 | Ga0207664_100457332 | 107 |
| 574 | 3300025929 | Ga0207664_10061944 | Ga0207664_100619444 | 107 |
| 575 | 3300025929 | Ga0207664_10115218 | Ga0207664_101152183 | 107 |
| 576 | 3300025929 | Ga0207664_10117186 | Ga0207664_101171862 | 107 |
| 577 | 3300025929 | Ga0207664_10223114 | Ga0207664_102231142 | 107 |
| 578 | 3300025929 | Ga0207664_10288999 | Ga0207664_102889992 | 107 |
| 579 | 3300025929 | Ga0207664_10413801 | Ga0207664_104138012 | 107 |
| 580 | 3300025931 | Ga0207644_10024643 | Ga0207644_100246434 | 107 |
| 581 | 3300025932 | Ga0207690_10014586 | Ga0207690_100145864 | 107 |
| 582 | 3300025932 | Ga0207690_10478164 | Ga0207690_104781642 | 107 |
| 583 | 3300025933 | Ga0207706_10152212 | Ga0207706_101522122 | 107 |
| 584 | 3300025934 | Ga0207686_10562842 | Ga0207686_105628422 | 107 |
| 585 | 3300025934 | Ga0207686_11065082 | Ga0207686_110650821 | 107 |
| 586 | 3300025935 | Ga0207709_10585553 | Ga0207709_105855532 | 107 |
| 587 | 3300025935 | Ga0207709_10599745 | Ga0207709_105997452 | 107 |
| 588 | 3300025935 | Ga0207709_11409206 | Ga0207709_114092062 | 107 |
| 589 | 3300025936 | Ga0207670_10174912 | Ga0207670_101749122 | 107 |
| 590 | 3300025936 | Ga0207670_11065395 | Ga0207670_110653951 | 107 |
| 591 | 3300025937 | Ga0207669_10363868 | Ga0207669_103638682 | 107 |
| 592 | 3300025938 | Ga0207704_10532470 | Ga0207704_105324702 | 107 |
| 593 | 3300025939 | Ga0207665_10218483 | Ga0207665_102184832 | 107 |
| 594 | 3300025939 | Ga0207665_10458653 | Ga0207665_104586532 | 107 |
| 595 | 3300025939 | Ga0207665_11248921 | Ga0207665_112489211 | 107 |
| 596 | 3300025940 | Ga0207691_10036168 | Ga0207691_100361682 | 107 |
| 597 | 3300025940 | Ga0207691_10075071 | Ga0207691_100750712 | 107 |
| 598 | 3300025940 | Ga0207691_10643026 | Ga0207691_106430262 | 107 |
| 599 | 3300025940 | Ga0207691_11357509 | Ga0207691_113575091 | 107 |
| 600 | 3300025941 | Ga0207711_10369020 | Ga0207711_103690202 | 107 |
| 601 | 3300025941 | Ga0207711_11124943 | Ga0207711_111249432 | 107 |
| 602 | 3300025942 | Ga0207689_10016618 | Ga0207689_100166184 | 107 |
| 603 | 3300025942 | Ga0207689_10448093 | Ga0207689_104480932 | 107 |
| 604 | 3300025944 | Ga0207661_10019221 | Ga0207661_100192215 | 107 |
| 605 | 3300025944 | Ga0207661_11001128 | Ga0207661_110011281 | 107 |
| 606 | 3300025945 | Ga0207679_10016528 | Ga0207679_100165282 | 107 |
| 607 | 3300025945 | Ga0207679_10157455 | Ga0207679_101574552 | 107 |
| 608 | 3300025945 | Ga0207679_10364232 | Ga0207679_103642321 | 107 |
| 609 | 3300025945 | Ga0207679_10651961 | Ga0207679_106519612 | 107 |
| 610 | 3300025949 | Ga0207667_11459050 | Ga0207667_114590501 | 107 |
| 611 | 3300025960 | Ga0207651_10070300 | Ga0207651_100703003 | 107 |
| 612 | 3300025960 | Ga0207651_10559166 | Ga0207651_105591662 | 107 |
| 613 | 3300025961 | Ga0207712_11213505 | Ga0207712_112135052 | 107 |
| 614 | 3300025961 | Ga0207712_11325125 | Ga0207712_113251252 | 107 |
| 615 | 3300025972 | Ga0207668_10000895 | Ga0207668_100008959 | 107 |
| 616 | 3300025972 | Ga0207668_10010000 | Ga0207668_100100005 | 107 |
| 617 | 3300025981 | Ga0207640_10444255 | Ga0207640_104442552 | 107 |
| 618 | 3300025981 | Ga0207640_10480978 | Ga0207640_104809782 | 107 |
| 619 | 3300026023 | Ga0207677_10006553 | Ga0207677_100065534 | 107 |
| 620 | 3300026023 | Ga0207677_10274146 | Ga0207677_102741462 | 107 |
| 621 | 3300026035 | Ga0207703_10165713 | Ga0207703_101657132 | 107 |
| 622 | 3300026035 | Ga0207703_10829429 | Ga0207703_108294292 | 107 |
| 623 | 3300026041 | Ga0207639_10036197 | Ga0207639_100361972 | 107 |
| 624 | 3300026041 | Ga0207639_10195969 | Ga0207639_101959693 | 107 |
| 625 | 3300026041 | Ga0207639_10438602 | Ga0207639_104386022 | 107 |
| 626 | 3300026041 | Ga0207639_10556795 | Ga0207639_105567952 | 107 |
| 627 | 3300026041 | Ga0207639_10960221 | Ga0207639_109602211 | 107 |
| 628 | 3300026041 | Ga0207639_11869906 | Ga0207639_118699062 | 107 |
| 629 | 3300026067 | Ga0207678_10000245 | Ga0207678_1000024538 | 107 |
| 630 | 3300026067 | Ga0207678_10157578 | Ga0207678_101575782 | 107 |
| 631 | 3300026067 | Ga0207678_11197887 | Ga0207678_111978871 | 107 |
| 632 | 3300026067 | Ga0207678_11579235 | Ga0207678_115792351 | 107 |
| 633 | 3300026075 | Ga0207708_10445960 | Ga0207708_104459602 | 107 |
| 634 | 3300026078 | Ga0207702_10016545 | Ga0207702_100165455 | 107 |
| 635 | 3300026078 | Ga0207702_10050305 | Ga0207702_100503054 | 107 |
| 636 | 3300026078 | Ga0207702_10052561 | Ga0207702_100525612 | 107 |
| 637 | 3300026078 | Ga0207702_10052806 | Ga0207702_100528065 | 107 |
| 638 | 3300026078 | Ga0207702_10058099 | Ga0207702_100580992 | 107 |
| 639 | 3300026078 | Ga0207702_12424536 | Ga0207702_124245361 | 107 |
| 640 | 3300026088 | Ga0207641_10113474 | Ga0207641_101134744 | 107 |
| 641 | 3300026088 | Ga0207641_10953715 | Ga0207641_109537152 | 107 |
| 642 | 3300026088 | Ga0207641_11197486 | Ga0207641_111974862 | 107 |
| 643 | 3300026095 | Ga0207676_10008877 | Ga0207676_1000887711 | 107 |
| 644 | 3300026095 | Ga0207676_10142071 | Ga0207676_101420712 | 107 |
| 645 | 3300026095 | Ga0207676_10935420 | Ga0207676_109354202 | 107 |
| 646 | 3300026095 | Ga0207676_11856005 | Ga0207676_118560051 | 107 |
| 647 | 3300026116 | Ga0207674_10012064 | Ga0207674_100120642 | 107 |
| 648 | 3300026116 | Ga0207674_10031256 | Ga0207674_100312562 | 107 |
| 649 | 3300026116 | Ga0207674_10178177 | Ga0207674_101781772 | 107 |
| 650 | 3300026116 | Ga0207674_10436541 | Ga0207674_104365412 | 107 |
| 651 | 3300026116 | Ga0207674_10795259 | Ga0207674_107952592 | 107 |
| 652 | 3300026116 | Ga0207674_12054716 | Ga0207674_120547161 | 107 |
| 653 | 3300026118 | Ga0207675_100330310 | Ga0207675_1003303101 | 107 |
| 654 | 3300026118 | Ga0207675_100613426 | Ga0207675_1006134262 | 107 |
| 655 | 3300026118 | Ga0207675_100635861 | Ga0207675_1006358612 | 107 |
| 656 | 3300026121 | Ga0207683_10001108 | Ga0207683_1000110821 | 107 |
| 657 | 3300026121 | Ga0207683_10002188 | Ga0207683_1000218813 | 107 |
| 658 | 3300026121 | Ga0207683_10346109 | Ga0207683_103461091 | 107 |
| 659 | 3300026121 | Ga0207683_10564555 | Ga0207683_105645552 | 107 |
| 660 | 3300026121 | Ga0207683_10582773 | Ga0207683_105827732 | 107 |
| 661 | 3300026121 | Ga0207683_10865970 | Ga0207683_108659701 | 107 |
| 662 | 3300026121 | Ga0207683_11462997 | Ga0207683_114629972 | 107 |
| 663 | 3300026142 | Ga0207698_10155078 | Ga0207698_101550783 | 107 |
| 664 | 3300026142 | Ga0207698_10539641 | Ga0207698_105396412 | 107 |
| 665 | 3300027907 | Ga0207428_10000872 | Ga0207428_1000087227 | 107 |
| 666 | 3300027907 | Ga0207428_10018040 | Ga0207428_100180404 | 107 |
| 667 | 3300028023 | Ga0265357_1037029 | Ga0265357_10370291 | 107 |
| 668 | 3300028379 | Ga0268266_10193198 | Ga0268266_101931983 | 107 |
| 669 | 3300028379 | Ga0268266_10338500 | Ga0268266_103385002 | 107 |
| 670 | 3300028379 | Ga0268266_10819094 | Ga0268266_108190942 | 107 |
| 671 | 3300028379 | Ga0268266_11210826 | Ga0268266_112108261 | 107 |
| 672 | 3300028380 | Ga0268265_10064370 | Ga0268265_100643702 | 107 |
| 673 | 3300028380 | Ga0268265_10182625 | Ga0268265_101826252 | 107 |
| 674 | 3300028380 | Ga0268265_11823000 | Ga0268265_118230002 | 107 |
| 675 | 3300028381 | Ga0268264_10094658 | Ga0268264_100946581 | 107 |
| 676 | 3300028381 | Ga0268264_10253131 | Ga0268264_102531311 | 107 |
| 677 | 3300028381 | Ga0268264_11108413 | Ga0268264_111084131 | 107 |
| 678 | 3300028794 | Ga0307515_10022180 | Ga0307515_100221807 | 107 |
| 679 | 3300028794 | Ga0307515_10285349 | Ga0307515_102853492 | 107 |
| 680 | 3300030735 | Ga0316178_1102303 | Ga0316178_11023032 | 107 |
| 681 | 3300031018 | Ga0265773_1010594 | Ga0265773_10105942 | 107 |
| 682 | 3300031090 | Ga0265760_10390584 | Ga0265760_103905841 | 107 |
| 683 | 3300031456 | Ga0307513_10008238 | Ga0307513_100082387 | 107 |
| 684 | 3300031456 | Ga0307513_10777132 | Ga0307513_107771321 | 107 |
| 685 | 3300031548 | Ga0307408_100719299 | Ga0307408_1007192992 | 107 |
| 686 | 3300031548 | Ga0307408_101028285 | Ga0307408_1010282852 | 107 |
| 687 | 3300031548 | Ga0307408_101410270 | Ga0307408_1014102701 | 107 |
| 688 | 3300031616 | Ga0307508_10288622 | Ga0307508_102886222 | 107 |
| 689 | 3300031616 | Ga0307508_10456993 | Ga0307508_104569932 | 107 |
| 690 | 3300031731 | Ga0307405_11518224 | Ga0307405_115182241 | 107 |
| 691 | 3300031731 | Ga0307405_12112871 | Ga0307405_121128711 | 107 |
| 692 | 3300031824 | Ga0307413_10739660 | Ga0307413_107396602 | 107 |
| 693 | 3300031852 | Ga0307410_10356321 | Ga0307410_103563212 | 107 |
| 694 | 3300031852 | Ga0307410_10504610 | Ga0307410_105046102 | 107 |
| 695 | 3300031852 | Ga0307410_11415513 | Ga0307410_114155132 | 107 |
| 696 | 3300031901 | Ga0307406_10111297 | Ga0307406_101112972 | 107 |
| 697 | 3300031901 | Ga0307406_10470331 | Ga0307406_104703312 | 107 |
| 698 | 3300031903 | Ga0307407_10110133 | Ga0307407_101101332 | 107 |
| 699 | 3300031903 | Ga0307407_10739812 | Ga0307407_107398122 | 107 |
| 700 | 3300031911 | Ga0307412_11287458 | Ga0307412_112874582 | 107 |
| 701 | 3300031995 | Ga0307409_100017750 | Ga0307409_1000177502 | 107 |
| 702 | 3300031995 | Ga0307409_100318710 | Ga0307409_1003187102 | 107 |
| 703 | 3300031995 | Ga0307409_100469177 | Ga0307409_1004691772 | 107 |
| 704 | 3300031995 | Ga0307409_101057342 | Ga0307409_1010573422 | 107 |
| 705 | 3300031995 | Ga0307409_101126369 | Ga0307409_1011263692 | 107 |
| 706 | 3300032002 | Ga0307416_100208352 | Ga0307416_1002083522 | 107 |
| 707 | 3300032002 | Ga0307416_102670420 | Ga0307416_1026704201 | 107 |
| 708 | 3300032002 | Ga0307416_102720673 | Ga0307416_1027206732 | 107 |
| 709 | 3300032004 | Ga0307414_10389790 | Ga0307414_103897902 | 107 |
| 710 | 3300032126 | Ga0307415_100002122 | Ga0307415_10000212210 | 107 |
| 711 | 3300032126 | Ga0307415_100061895 | Ga0307415_1000618952 | 107 |
| 712 | 3300032126 | Ga0307415_100277007 | Ga0307415_1002770072 | 107 |
| 713 | 3300032126 | Ga0307415_100904689 | Ga0307415_1009046891 | 107 |
| 714 | 3300032126 | Ga0307415_102017049 | Ga0307415_1020170491 | 107 |
| 715 | 3300032126 | Ga0307415_102017557 | Ga0307415_1020175571 | 107 |
| 716 | 3300034818 | Ga0373950_0016362 | Ga0373950_0016362_411_734 | 107 |
| 717 | 3300034820 | Ga0373959_0032774 | Ga0373959_0032774_54_377 | 107 |
| 718 | 3300035085 | Ga0373929_0247748 | Ga0373929_0247748_149_472 | 107 |
| 719 | 3300035086 | Ga0373934_0027878 | Ga0373934_0027878_1851_2174 | 107 |
| 720 | 3300035088 | Ga0373940_0039014 | Ga0373940_0039014_709_1032 | 107 |
| 721 | 3300035089 | Ga0373944_0352253 | Ga0373944_0352253_191_532 | 107 |
| 722 | 3300035091 | Ga0373951_0095711 | Ga0373951_0095711_142_465 | 107 |
| 723 | 3300035111 | Ga0373923_0179781 | Ga0373923_0179781_48_371 | 107 |
| 724 | 3300035112 | Ga0373932_0281845 | Ga0373932_0281845_264_587 | 107 |
| 725 | 3300035114 | Ga0373939_0339072 | Ga0373939_0339072_249_572 | 107 |
| 726 | 3300035115 | Ga0373941_0075651 | Ga0373941_0075651_529_852 | 107 |
| 727 | 3300035119 | Ga0373956_0159207 | Ga0373956_0159207_725_1048 | 107 |
| 728 | 3300035170 | Ga0373943_0982618 | Ga0373943_0982618_108_449 | 107 |
| 729 | 3300035207 | Ga0373942_0001721 | Ga0373942_0001721_368_691 | 107 |
| 730 | 3300035241 | Ga0373961_0427073 | Ga0373961_0427073_20_343 | 107 |
| 731 | 3300035410 | Ga0373924_0135961 | Ga0373924_0135961_32_355 | 107 |
| 732 | 3300035691 | Ga0373931_0040996 | Ga0373931_0040996_927_1250 | 107 |
| 733 | 3300035692 | Ga0373935_0077170 | Ga0373935_0077170_10_333 | 107 |
| 734 | 3300035692 | Ga0373935_0581480 | Ga0373935_0581480_278_601 | 107 |
| 735 | 3300035692 | Ga0373935_1224792 | Ga0373935_1224792_79_402 | 107 |
| 736 | 3300035692 | Ga0373935_1226145 | Ga0373935_1226145_119_442 | 107 |
| 737 | 3300035695 | Ga0373927_1022312 | Ga0373927_1022312_61_396 | 107 |
| 738 | 3300035725 | Ga0373947_1021438 | Ga0373947_1021438_210_533 | 107 |
| 739 | 3300036401 | Ga0373937_0314138 | Ga0373937_0314138_142_471 | 107 |
| 740 | 3300036401 | Ga0373937_1126203 | Ga0373937_1126203_205_528 | 107 |
| 741 | 3300036401 | Ga0373937_1506366 | Ga0373937_1506366_45_368 | 107 |
| 742 | 3300036459 | Ga0372808_069496 | Ga0372808_069496_129_458 | 107 |
| 743 | 3300037068 | Ga0373925_0368795 | Ga0373925_0368795_723_1046 | 107 |
| 744 | 3300037068 | Ga0373925_0837743 | Ga0373925_0837743_326_667 | 107 |
| 745 | 3300037312 | Ga0395899_0013581 | Ga0395899_0013581_1751_2077 | 107 |
| 746 | 3300037466 | Ga0395898_1575792 | Ga0395898_1575792_35_358 | 107 |
| 747 | 3300037471 | Ga0395905_1094791 | Ga0395905_1094791_149_472 | 107 |
| 748 | 3300037853 | Ga0436364_0929084 | Ga0436364_0929084_596_919 | 107 |
| 749 | 3300037853 | Ga0436364_1111965 | Ga0436364_1111965_323_652 | 107 |
| 750 | 3300039450 | Ga0436363_0965767 | Ga0436363_0965767_184_507 | 107 |
| 751 | 3300041413 | Ga0439465_0302602 | Ga0439465_0302602_120_443 | 107 |
| 752 | 3300041458 | Ga0451798_1080448 | Ga0451798_1080448_134_457 | 107 |
| 753 | 3300041486 | Ga0451807_2259115 | Ga0451807_2259115_27_455 | 107 |
| 754 | 3300041491 | Ga0451833_0052121 | Ga0451833_0052121_236_565 | 107 |
| 755 | 3300041505 | Ga0451849_1294102 | Ga0451849_1294102_25_348 | 107 |
| 756 | 3300041511 | Ga0451855_1267667 | Ga0451855_1267667_302_634 | 107 |
| 757 | 3300041512 | Ga0451853_2986788 | Ga0451853_2986788_140_463 | 107 |
| 758 | 3300041512 | Ga0451853_4096721 | Ga0451853_4096721_571_903 | 107 |
| 759 | 3300042438 | Ga0439459_0032746 | Ga0439459_0032746_714_1037 | 107 |
| 760 | 3300042993 | Ga0439440_0217444 | Ga0439440_0217444_135_458 | 107 |
| 761 | 3300044656 | Ga0466969_0047458 | Ga0466969_0047458_1228_1554 | 107 |
| 762 | 3300044656 | Ga0466969_0507543 | Ga0466969_0507543_150_473 | 107 |
| 763 | 3300044658 | Ga0466972_0105183 | Ga0466972_0105183_32_355 | 107 |
| 764 | 3300044673 | Ga0453683_0894406 | Ga0453683_0894406_34_363 | 107 |
| 765 | 3300044684 | Ga0466966_0263232 | Ga0466966_0263232_318_641 | 107 |
| 766 | 3300044693 | Ga0466961_0593977 | Ga0466961_0593977_297_620 | 107 |
| 767 | 3300044694 | Ga0466963_0328042 | Ga0466963_0328042_134_463 | 107 |
| 768 | 3300044694 | Ga0466963_0852064 | Ga0466963_0852064_240_572 | 107 |
| 769 | 3300044765 | Ga0466970_0006912 | Ga0466970_0006912_1071_1394 | 107 |
| 770 | 3300044765 | Ga0466970_0015863 | Ga0466970_0015863_1509_1835 | 107 |
| 771 | 3300044901 | Ga0466960_0087663 | Ga0466960_0087663_549_872 | 107 |
| 772 | 3300045049 | Ga0466959_0305087 | Ga0466959_0305087_570_893 | 107 |
| 773 | 3300045049 | Ga0466959_0450790 | Ga0466959_0450790_196_519 | 107 |
| 774 | 3300045836 | Ga0466958_0716806 | Ga0466958_0716806_141_464 | 107 |
| 775 | 3300045836 | Ga0466958_0976286 | Ga0466958_0976286_103_429 | 107 |
| 776 | 3300045976 | Ga0466967_1652822 | Ga0466967_1652822_263_586 | 107 |
| 777 | 3300046454 | Ga0495592_0258794 | Ga0495592_0258794_25_348 | 107 |
| 778 | 3300046463 | Ga0495653_0199216 | Ga0495653_0199216_484_807 | 107 |
| 779 | 3300046475 | Ga0495639_0170963 | Ga0495639_0170963_580_921 | 107 |
| 780 | 3300046475 | Ga0495639_0246501 | Ga0495639_0246501_454_780 | 107 |
| 781 | 3300046476 | Ga0495662_0184232 | Ga0495662_0184232_91_414 | 107 |
| 782 | 3300046476 | Ga0495662_0211569 | Ga0495662_0211569_29_370 | 107 |
| 783 | 3300046476 | Ga0495662_0367777 | Ga0495662_0367777_363_686 | 107 |
| 784 | 3300046477 | Ga0495664_0075929 | Ga0495664_0075929_570_893 | 107 |
| 785 | 3300046491 | Ga0495584_0523798 | Ga0495584_0523798_240_575 | 107 |
| 786 | 3300046492 | Ga0495585_0023230 | Ga0495585_0023230_1071_1400 | 107 |
| 787 | 3300046499 | Ga0495594_0016486 | Ga0495594_0016486_2424_2759 | 107 |
| 788 | 3300046500 | Ga0495596_0197550 | Ga0495596_0197550_255_584 | 107 |
| 789 | 3300046513 | Ga0495616_0219375 | Ga0495616_0219375_237_560 | 107 |
| 790 | 3300046516 | Ga0495628_0081651 | Ga0495628_0081651_43_366 | 107 |
| 791 | 3300046516 | Ga0495628_0372461 | Ga0495628_0372461_457_780 | 107 |
| 792 | 3300046516 | Ga0495628_0430548 | Ga0495628_0430548_439_762 | 107 |
| 793 | 3300046517 | Ga0495630_0526150 | Ga0495630_0526150_231_554 | 107 |
| 794 | 3300046523 | Ga0495644_0367286 | Ga0495644_0367286_216_539 | 107 |
| 795 | 3300046524 | Ga0495648_0167645 | Ga0495648_0167645_481_804 | 107 |
| 796 | 3300046526 | Ga0495666_0165238 | Ga0495666_0165238_676_999 | 107 |
| 797 | 3300046526 | Ga0495666_0288750 | Ga0495666_0288750_369_692 | 107 |
| 798 | 3300046528 | Ga0495642_0141476 | Ga0495642_0141476_692_1027 | 107 |
| 799 | 3300046529 | Ga0495652_0586302 | Ga0495652_0586302_378_701 | 107 |
| 800 | 3300046533 | Ga0495640_0929569 | Ga0495640_0929569_163_489 | 107 |
| 801 | 3300046543 | Ga0495645_0042793 | Ga0495645_0042793_2696_3019 | 107 |
| 802 | 3300046543 | Ga0495645_0365805 | Ga0495645_0365805_536_859 | 107 |
| 803 | 3300046558 | Ga0495633_0320305 | Ga0495633_0320305_286_609 | 107 |
| 804 | 3300046558 | Ga0495633_0414750 | Ga0495633_0414750_121_444 | 107 |
| 805 | 3300046559 | Ga0495667_0335436 | Ga0495667_0335436_519_842 | 107 |
| 806 | 3300046559 | Ga0495667_0622134 | Ga0495667_0622134_37_360 | 107 |
| 807 | 3300046615 | Ga0495656_0430514 | Ga0495656_0430514_268_597 | 107 |
| 808 | 3300046660 | Ga0495625_0115890 | Ga0495625_0115890_814_1137 | 107 |
| 809 | 3300046663 | Ga0495635_0326208 | Ga0495635_0326208_173_496 | 107 |
| 810 | 3300046664 | Ga0495659_0161986 | Ga0495659_0161986_49_378 | 107 |
| 811 | 3300046675 | Ga0495657_0001424 | Ga0495657_0001424_4055_4378 | 107 |
| 812 | 3300046675 | Ga0495657_0256406 | Ga0495657_0256406_181_504 | 107 |
| 813 | 3300046680 | Ga0495646_0182430 | Ga0495646_0182430_553_876 | 107 |
| 814 | 3300046683 | Ga0495658_0285175 | Ga0495658_0285175_464_799 | 107 |
| 815 | 3300046689 | Ga0495613_0242915 | Ga0495613_0242915_745_1068 | 107 |
| 816 | 3300046690 | Ga0495624_0243226 | Ga0495624_0243226_716_1039 | 107 |
| 817 | 3300046690 | Ga0495624_0416269 | Ga0495624_0416269_156_482 | 107 |
| 818 | 3300046692 | Ga0495671_0332672 | Ga0495671_0332672_292_621 | 107 |
| 819 | 3300046794 | Ga0495589_0395302 | Ga0495589_0395302_141_476 | 107 |
| 820 | 3300047315 | Ga0495581_0199359 | Ga0495581_0199359_479_820 | 107 |
| 821 | 3300047319 | Ga0495674_0095521 | Ga0495674_0095521_923_1246 | 107 |
| 822 | 3300047319 | Ga0495674_0771931 | Ga0495674_0771931_57_380 | 107 |
| 823 | 3300047321 | Ga0495676_0941417 | Ga0495676_0941417_25_348 | 107 |
| 824 | 3300047322 | Ga0495680_0387585 | Ga0495680_0387585_212_535 | 107 |
| 825 | 3300047471 | Ga0495684_0504556 | Ga0495684_0504556_208_531 | 107 |
| 826 | 3300048089 | Ga0495614_0628929 | Ga0495614_0628929_168_497 | 107 |
| 827 | 3300048091 | Ga0495626_0314145 | Ga0495626_0314145_251_580 | 107 |
| 828 | 3300048903 | Ga0496100_0080142 | Ga0496100_0080142_1054_1377 | 107 |
| 829 | 3300048903 | Ga0496100_0332086 | Ga0496100_0332086_438_761 | 107 |
| 830 | 3300048903 | Ga0496100_1641292 | Ga0496100_1641292_57_386 | 107 |
| 831 | 3300048904 | Ga0496101_0023810 | Ga0496101_0023810_1977_2300 | 107 |
| 832 | 3300048904 | Ga0496101_0033677 | Ga0496101_0033677_2276_2599 | 107 |
| 833 | 3300048904 | Ga0496101_0055791 | Ga0496101_0055791_1192_1515 | 107 |
| 834 | 3300048904 | Ga0496101_0205505 | Ga0496101_0205505_74_403 | 107 |
| 835 | 3300048904 | Ga0496101_1314939 | Ga0496101_1314939_68_391 | 107 |
| 836 | 3300048905 | Ga0496102_0024111 | Ga0496102_0024111_1441_1764 | 107 |
| 837 | 3300048905 | Ga0496102_0545693 | Ga0496102_0545693_497_820 | 107 |
| 838 | 3300048905 | Ga0496102_0933475 | Ga0496102_0933475_444_773 | 107 |
| 839 | 3300048906 | Ga0496103_0053368 | Ga0496103_0053368_165_488 | 107 |
| 840 | 3300048907 | Ga0496104_0006727 | Ga0496104_0006727_6806_7129 | 107 |
| 841 | 3300048907 | Ga0496104_0069812 | Ga0496104_0069812_888_1217 | 107 |
| 842 | 3300048907 | Ga0496104_0090841 | Ga0496104_0090841_1653_1976 | 107 |
| 843 | 3300048907 | Ga0496104_0100145 | Ga0496104_0100145_955_1278 | 107 |
| 844 | 3300048907 | Ga0496104_0164333 | Ga0496104_0164333_1326_1649 | 107 |
| 845 | 3300048907 | Ga0496104_0622572 | Ga0496104_0622572_588_911 | 107 |
| 846 | 3300048907 | Ga0496104_1807022 | Ga0496104_1807022_123_452 | 107 |
| 847 | 3300048908 | Ga0496105_0015618 | Ga0496105_0015618_2487_2810 | 107 |
| 848 | 3300048908 | Ga0496105_0107384 | Ga0496105_0107384_356_679 | 107 |
| 849 | 3300048908 | Ga0496105_0120349 | Ga0496105_0120349_1329_1652 | 107 |
| 850 | 3300048908 | Ga0496105_0236473 | Ga0496105_0236473_280_603 | 107 |
| 851 | 3300048909 | Ga0496106_0008552 | Ga0496106_0008552_294_617 | 107 |
| 852 | 3300048909 | Ga0496106_0239793 | Ga0496106_0239793_578_901 | 107 |
| 853 | 3300048909 | Ga0496106_0319474 | Ga0496106_0319474_651_974 | 107 |
| 854 | 3300048909 | Ga0496106_1461730 | Ga0496106_1461730_43_366 | 107 |
| 855 | 3300048910 | Ga0496107_0017925 | Ga0496107_0017925_2918_3241 | 107 |
| 856 | 3300048910 | Ga0496107_0073529 | Ga0496107_0073529_942_1265 | 107 |
| 857 | 3300048911 | Ga0496108_0008688 | Ga0496108_0008688_3152_3475 | 107 |
| 858 | 3300048911 | Ga0496108_0028431 | Ga0496108_0028431_1078_1401 | 107 |
| 859 | 3300048911 | Ga0496108_0036570 | Ga0496108_0036570_3669_3998 | 107 |
| 860 | 3300048911 | Ga0496108_0780231 | Ga0496108_0780231_212_535 | 107 |
| 861 | 3300048912 | Ga0496109_0220272 | Ga0496109_0220272_68_391 | 107 |
| 862 | 3300048912 | Ga0496109_0646757 | Ga0496109_0646757_188_511 | 107 |
| 863 | 3300048912 | Ga0496109_0710562 | Ga0496109_0710562_279_602 | 107 |
| 864 | 3300048912 | Ga0496109_0807854 | Ga0496109_0807854_21_344 | 107 |
| 865 | 3300048912 | Ga0496109_0985474 | Ga0496109_0985474_432_755 | 107 |
| 866 | 3300048912 | Ga0496109_0991424 | Ga0496109_0991424_380_724 | 107 |
| 867 | 3300048912 | Ga0496109_1127471 | Ga0496109_1127471_215_544 | 107 |
| 868 | 3300048913 | Ga0496110_0018573 | Ga0496110_0018573_439_762 | 107 |
| 869 | 3300048913 | Ga0496110_0045730 | Ga0496110_0045730_1445_1768 | 107 |
| 870 | 3300048913 | Ga0496110_0059806 | Ga0496110_0059806_2594_2917 | 107 |
| 871 | 3300048914 | Ga0496111_0012969 | Ga0496111_0012969_2603_2926 | 107 |
| 872 | 3300048914 | Ga0496111_0044827 | Ga0496111_0044827_1859_2182 | 107 |
| 873 | 3300048914 | Ga0496111_0046129 | Ga0496111_0046129_2060_2383 | 107 |
| 874 | 3300048914 | Ga0496111_0902794 | Ga0496111_0902794_182_505 | 107 |
| 875 | 3300048915 | Ga0496112_0145827 | Ga0496112_0145827_901_1224 | 107 |
| 876 | 3300048915 | Ga0496112_0266690 | Ga0496112_0266690_1166_1489 | 107 |
| 877 | 3300048915 | Ga0496112_0267068 | Ga0496112_0267068_1227_1550 | 107 |
| 878 | 3300048915 | Ga0496112_0453393 | Ga0496112_0453393_459_782 | 107 |
| 879 | 3300048915 | Ga0496112_0801616 | Ga0496112_0801616_487_810 | 107 |
| 880 | 3300048915 | Ga0496112_1637721 | Ga0496112_1637721_67_396 | 107 |
| 881 | 3300048916 | Ga0496113_0083246 | Ga0496113_0083246_486_809 | 107 |
| 882 | 3300048916 | Ga0496113_1156114 | Ga0496113_1156114_268_591 | 107 |
| 883 | 3300048916 | Ga0496113_1446134 | Ga0496113_1446134_153_476 | 107 |
| 884 | 3300048917 | Ga0496114_0013658 | Ga0496114_0013658_1250_1573 | 107 |
| 885 | 3300048917 | Ga0496114_0015453 | Ga0496114_0015453_637_972 | 107 |
| 886 | 3300048917 | Ga0496114_0131342 | Ga0496114_0131342_383_715 | 107 |
| 887 | 3300048917 | Ga0496114_0138857 | Ga0496114_0138857_366_689 | 107 |
| 888 | 3300048917 | Ga0496114_0266120 | Ga0496114_0266120_49_378 | 107 |
| 889 | 3300048918 | Ga0496115_0054837 | Ga0496115_0054837_1368_1691 | 107 |
| 890 | 3300048918 | Ga0496115_0136988 | Ga0496115_0136988_529_852 | 107 |
| 891 | 3300048918 | Ga0496115_0691260 | Ga0496115_0691260_63_392 | 107 |
| 892 | 3300048924 | Ga0496121_0694921 | Ga0496121_0694921_23_352 | 107 |
| 893 | 3300049568 | Ga0501031_0001300 | Ga0501031_0001300_2359_2688 | 107 |
| 894 | 3300049569 | Ga0501032_0002723 | Ga0501032_0002723_2094_2423 | 107 |
| 895 | 3300049570 | Ga0501033_0001012 | Ga0501033_0001012_12617_12946 | 107 |
| 896 | 3300049571 | Ga0501034_0005396 | Ga0501034_0005396_11346_11675 | 107 |
| 897 | 3300049572 | Ga0501036_0002936 | Ga0501036_0002936_1961_2290 | 107 |
| 898 | 3300049573 | Ga0501037_0000762 | Ga0501037_0000762_11346_11675 | 107 |
| 899 | 3300049574 | Ga0501038_0002530 | Ga0501038_0002530_5369_5698 | 107 |
| 900 | 3300049575 | Ga0501039_0001982 | Ga0501039_0001982_11227_11556 | 107 |
| 901 | 3300049575 | Ga0501039_0297632 | Ga0501039_0297632_750_1082 | 107 |
| 902 | 3300049576 | Ga0501040_0708931 | Ga0501040_0708931_350_673 | 107 |
| 903 | 3300049576 | Ga0501040_0974010 | Ga0501040_0974010_16_348 | 107 |
| 904 | 3300049577 | Ga0501041_0080848 | Ga0501041_0080848_1509_1841 | 107 |
| 905 | 3300049578 | Ga0501042_0013258 | Ga0501042_0013258_3817_4140 | 107 |
| 906 | 3300049578 | Ga0501042_0048501 | Ga0501042_0048501_64_393 | 107 |
| 907 | 3300049579 | Ga0501043_0003230 | Ga0501043_0003230_2033_2362 | 107 |
| 908 | 3300049579 | Ga0501043_1237984 | Ga0501043_1237984_122_454 | 107 |
| 909 | 3300049580 | Ga0501046_0001999 | Ga0501046_0001999_7605_7934 | 107 |
| 910 | 3300049581 | Ga0501047_0004101 | Ga0501047_0004101_2033_2362 | 107 |
| 911 | 3300049582 | Ga0501048_0002566 | Ga0501048_0002566_2266_2595 | 107 |
| 912 | 3300049582 | Ga0501048_0450463 | Ga0501048_0450463_488_820 | 107 |
| 913 | 3300049582 | Ga0501048_0454274 | Ga0501048_0454274_114_437 | 107 |
| 914 | 3300049585 | Ga0501069_0000857 | Ga0501069_0000857_2081_2410 | 107 |
| 915 | 3300049586 | Ga0501070_0002800 | Ga0501070_0002800_3560_3889 | 107 |
| 916 | 3300049586 | Ga0501070_0005891 | Ga0501070_0005891_4747_5070 | 107 |
| 917 | 3300049586 | Ga0501070_0675974 | Ga0501070_0675974_370_702 | 107 |
| 918 | 3300049587 | Ga0501071_0053056 | Ga0501071_0053056_1760_2089 | 107 |
| 919 | 3300049589 | Ga0501073_0002456 | Ga0501073_0002456_11318_11647 | 107 |
| 920 | 3300049589 | Ga0501073_0143968 | Ga0501073_0143968_151_474 | 107 |
| 921 | 3300049590 | Ga0501074_0001540 | Ga0501074_0001540_11020_11349 | 107 |
| 922 | 3300049590 | Ga0501074_0323247 | Ga0501074_0323247_25_348 | 107 |
| 923 | 3300049590 | Ga0501074_0625861 | Ga0501074_0625861_296_628 | 107 |
| 924 | 3300049591 | Ga0501075_0112298 | Ga0501075_0112298_1386_1718 | 107 |
| 925 | 3300049592 | Ga0501076_0007646 | Ga0501076_0007646_6447_6779 | 107 |
| 926 | 3300049592 | Ga0501076_0990914 | Ga0501076_0990914_107_430 | 107 |
| 927 | 3300049593 | Ga0501077_0042956 | Ga0501077_0042956_1369_1701 | 107 |
| 928 | 3300049741 | Ga0501079_0183716 | Ga0501079_0183716_404_736 | 107 |
| 929 | 3300049742 | Ga0501080_0020280 | Ga0501080_0020280_1480_1809 | 107 |
| 930 | 3300049743 | Ga0501081_1423497 | Ga0501081_1423497_178_501 | 107 |
| 931 | 3300049744 | Ga0501083_0027800 | Ga0501083_0027800_3196_3525 | 107 |
| 932 | 3300049822 | Ga0501035_0003643 | Ga0501035_0003643_11346_11675 | 107 |
| 933 | 3300049823 | Ga0501044_0002095 | Ga0501044_0002095_11281_11610 | 107 |
| 934 | 3300050492 | nmdc:mga0yw44_56291_c1 | nmdc:mga0yw44_56291_c1_36_365 | 107 |
| 935 | 3300050507 | nmdc:mga05p37_121068_c1 | nmdc:mga05p37_121068_c1_618_950 | 107 |
| 936 | 3300050507 | nmdc:mga05p37_59067_c1 | nmdc:mga05p37_59067_c1_3406_3729 | 107 |
| 937 | 3300050507 | nmdc:mga05p37_760326_c1 | nmdc:mga05p37_760326_c1_41_364 | 107 |
| 938 | 3300050508 | nmdc:mga09592_51736_c1 | nmdc:mga09592_51736_c1_1937_2260 | 107 |
| 939 | 3300050508 | nmdc:mga09592_64476_c1 | nmdc:mga09592_64476_c1_194_526 | 107 |
| 940 | 3300050509 | nmdc:mga0qj67_44485_c1 | nmdc:mga0qj67_44485_c1_725_1057 | 107 |
| 941 | 3300050509 | nmdc:mga0qj67_82906_c1 | nmdc:mga0qj67_82906_c1_1795_2118 | 107 |
| 942 | 3300050510 | nmdc:mga06r32_407571_c1 | nmdc:mga06r32_407571_c1_900_1223 | 107 |
| 943 | 3300050510 | nmdc:mga06r32_64776_c1 | nmdc:mga06r32_64776_c1_2450_2782 | 107 |
| 944 | 3300050510 | nmdc:mga06r32_9872_c1 | nmdc:mga06r32_9872_c1_3796_4125 | 107 |
| 945 | 3300050511 | nmdc:mga08y16_1309_c1 | nmdc:mga08y16_1309_c1_7978_8301 | 107 |
| 946 | 3300050511 | nmdc:mga08y16_1611781_c1 | nmdc:mga08y16_1611781_c1_73_396 | 107 |
| 947 | 3300050511 | nmdc:mga08y16_276818_c1 | nmdc:mga08y16_276818_c1_984_1307 | 107 |
| 948 | 3300050512 | nmdc:mga0n895_13485_c1 | nmdc:mga0n895_13485_c1_744_1067 | 107 |
| 949 | 3300050512 | nmdc:mga0n895_173546_c1 | nmdc:mga0n895_173546_c1_838_1167 | 107 |
| 950 | 3300050512 | nmdc:mga0n895_1943763_c1 | nmdc:mga0n895_1943763_c1_168_491 | 107 |
| 951 | 3300050512 | nmdc:mga0n895_249179_c1 | nmdc:mga0n895_249179_c1_951_1274 | 107 |
| 952 | 3300050512 | nmdc:mga0n895_9256_c1 | nmdc:mga0n895_9256_c1_6499_6822 | 107 |
| 953 | 3300050513 | nmdc:mga0rr50_16203_c1 | nmdc:mga0rr50_16203_c1_1457_1780 | 107 |
| 954 | 3300050513 | nmdc:mga0rr50_449481_c1 | nmdc:mga0rr50_449481_c1_538_867 | 107 |
| 955 | 3300050513 | nmdc:mga0rr50_47287_c1 | nmdc:mga0rr50_47287_c1_351_674 | 107 |
| 956 | 3300050513 | nmdc:mga0rr50_56656_c1 | nmdc:mga0rr50_56656_c1_1873_2196 | 107 |
| 957 | 3300050514 | nmdc:mga08x19_1036300_c1 | nmdc:mga08x19_1036300_c1_224_547 | 107 |
| 958 | 3300050514 | nmdc:mga08x19_20394_c1 | nmdc:mga08x19_20394_c1_2784_3107 | 107 |
| 959 | 3300050514 | nmdc:mga08x19_5497_c1 | nmdc:mga08x19_5497_c1_3910_4233 | 107 |
| 960 | 3300050515 | nmdc:mga0a205_30761_c1 | nmdc:mga0a205_30761_c1_747_1070 | 107 |
| 961 | 3300050515 | nmdc:mga0a205_358_c1 | nmdc:mga0a205_358_c1_10686_11009 | 107 |
| 962 | 3300053085 | Ga0495619_0015246 | Ga0495619_0015246_1532_1873 | 107 |
| 963 | 3300053103 | Ga0500555_000074 | Ga0500555_000074_33568_33903 | 107 |
| 964 | 3300053140 | Ga0500573_0399679 | Ga0500573_0399679_175_507 | 107 |
| 965 | 3300054114 | Ga0501084_0002138 | Ga0501084_0002138_11034_11363 | 107 |
| 966 | 3300054114 | Ga0501084_0791390 | Ga0501084_0791390_455_787 | 107 |
| 967 | 3300054114 | Ga0501084_1220617 | Ga0501084_1220617_165_488 | 107 |
| 968 | 3300060353 | Ga0501082_0585623 | Ga0501082_0585623_57_380 | 107 |
| 969 | 3300060353 | Ga0501082_1238504 | Ga0501082_1238504_303_626 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8564 | 1 | 106 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8415 | 1 | 106 |
| 2qz8-assembly1.cif.gz_B-2 | crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) | 0.706 | 2 | 107 |
| 2nzc-assembly1.cif.gz_C | the structure of uncharacterized protein tm1266 from thermotoga maritima. | 0.6964 | 2 | 107 |
| 2ivm-assembly1.cif.gz_A | crystal structure of a transcriptional regulator | 0.6867 | 1 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8564 | 1 | 106 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8415 | 1 | 106 | 3.30.70.1060 |
| af_A0A0R4IB99_228_352_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7366 | 75 | 99 | 2.30.29.30 |
| af_Q9H254_2415_2531_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.735 | 73 | 98 | 2.30.29.30 |
| af_P71888_58_138_3.30.70.920 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7105 | 2 | 104 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1G324-F1-model_v4 | YCII-related domain-containing protein | 0.9807 | 16 | 107 |
|
| AF-A0A1H8SN34-F1-model_v4 | Uncharacterized conserved protein | 0.9757 | 1 | 107 |
|
| AF-A0A5D0TX26-F1-model_v4 | YCII-related domain-containing protein | 0.9736 | 16 | 107 |
|
| AF-A0A1H8SN34-F1-model_v4 | Uncharacterized conserved protein | 0.9668 | 1 | 107 |
|
| AF-A0A563E7U6-F1-model_v4 | YCII-related domain-containing protein | 0.9667 | 16 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar