F486997

General Info

Members Datasets Scaffolds Average Seq Length
966 382 966 112

Family's Representative Sequence

Representative Sequence 3300033527|Ga0316586_1033341|Ga0316586_10333412
Length 137
Sequence MPASVRPWRGTSWKNSNRLWVKVEYMPQIIFLPHEEICPEGAVIEANSGISICDAALSNGIEIEHACEKSCACTTCHVVVREGFDSLPEADETEEDLLDKAWGLEPESRLSCQALVGEEDLVIEIPKYTINMVSENH

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
210 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
211 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
238 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
242 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
243 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
244 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
245 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
246 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
247 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
248 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
249 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
368 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 3.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 1.76
Rhizoplane 1.45
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1984 2010549000 Bacteria 2592
2 SwRhRL2b_contig_2515474 2162886007 Bacteria 1433
3 SwRhRL2b_contig_3243000 2162886007 Bacteria 3417
4 JGI24739J22299_10003976 3300001989 Bacteria 5657
5 JGI24735J21928_10036514 3300002067 Bacteria 1441
6 JGI24738J21930_10008726 3300002075 Bacteria 2300
7 JGI25156J39149_1001614 3300002705 Bacteria 9217
8 JGI25165J46597_1002430 3300003214 Bacteria 6025
9 rootH1_10308890 3300003323 Bacteria 1272
10 Ga0055533_1000300 3300003756 Bacteria 24900
11 Ga0055533_1006544 3300003756 Bacteria 1703
12 Ga0055532_1000001 3300003758 Bacteria 1119836
13 Ga0055527_1000002 3300003760 Bacteria 830488
14 Ga0055527_1001325 3300003760 Bacteria 5345
15 Ga0055535_1000001 3300003761 Bacteria 1119836
16 Ga0055535_1002900 3300003761 Bacteria 5345
17 Ga0055542_1000001 3300003762 Bacteria 1119836
18 Ga0055529_1000001 3300003763 Bacteria 826680
19 Ga0055529_1005550 3300003763 Bacteria 1815
20 Ga0058692_1006038 3300003856 Bacteria 3377
21 Ga0058692_1061626 3300003856 Bacteria 590
22 Ga0065704_10000456 3300005289 Bacteria 20216
23 Ga0065704_10073661 3300005289 Bacteria 6913
24 Ga0065704_10084188 3300005289 Bacteria 3367
25 Ga0065704_10120659 3300005289 Bacteria 1779
26 Ga0065712_10113238 3300005290 Bacteria 1786
27 Ga0070658_10125382 3300005327 Bacteria 2137
28 Ga0070658_10348780 3300005327 Bacteria 1267
29 Ga0070658_10464939 3300005327 Bacteria 1091
30 Ga0070690_100060000 3300005330 Bacteria 2447
31 Ga0070690_101137090 3300005330 Bacteria 621
32 Ga0070670_100121801 3300005331 Bacteria 2250
33 Ga0070677_10739912 3300005333 Bacteria 557
34 Ga0068869_100142867 3300005334 Bacteria 1850
35 Ga0068869_101085959 3300005334 Bacteria 700
36 Ga0068868_100114481 3300005338 Bacteria 2194
37 Ga0068868_100134560 3300005338 Bacteria 2025
38 Ga0068868_101963374 3300005338 Bacteria 555
39 Ga0070660_100298819 3300005339 Bacteria 1320
40 Ga0070660_100510107 3300005339 Bacteria 1001
41 Ga0070660_100849105 3300005339 Bacteria 769
42 Ga0070689_100129868 3300005340 Bacteria 2020
43 Ga0070689_100181428 3300005340 Bacteria 1710
44 Ga0070689_100524344 3300005340 Bacteria 1018
45 Ga0070689_100785076 3300005340 Bacteria 837
46 Ga0070687_100128442 3300005343 Bacteria 1460
47 Ga0070687_100580583 3300005343 Bacteria 767
48 Ga0070661_100206043 3300005344 Bacteria 1504
49 Ga0070661_100597518 3300005344 Bacteria 892
50 Ga0070692_11133852 3300005345 Bacteria 554
51 Ga0070669_100443346 3300005353 Bacteria 1069
52 Ga0070675_100063736 3300005354 Bacteria 3047
53 Ga0070674_100688727 3300005356 Bacteria 873
54 Ga0070673_100452017 3300005364 Bacteria 1156
55 Ga0070709_10596502 3300005434 Bacteria 850
56 Ga0070713_100040111 3300005436 Bacteria 3805
57 Ga0070701_10175363 3300005438 Bacteria 1251
58 Ga0070711_100129730 3300005439 Bacteria 1876
59 Ga0070711_100664273 3300005439 Bacteria 875
60 Ga0070700_101315065 3300005441 Bacteria 608
61 Ga0070694_100570890 3300005444 Bacteria 908
62 Ga0070694_101131353 3300005444 Bacteria 654
63 Ga0070663_100239123 3300005455 Bacteria 1433
64 Ga0070678_100470936 3300005456 Bacteria 1104
65 Ga0070678_100652866 3300005456 Bacteria 944
66 Ga0070681_10088625 3300005458 Bacteria 3046
67 Ga0070681_10627559 3300005458 Bacteria 989
68 Ga0070681_10702598 3300005458 Bacteria 927
69 Ga0068867_100057812 3300005459 Bacteria 2873
70 Ga0068867_100301413 3300005459 Bacteria 1321
71 Ga0070685_10475463 3300005466 Bacteria 880
72 Ga0070707_102141001 3300005468 Bacteria 527
73 Ga0070698_101617732 3300005471 Bacteria 600
74 Ga0070679_100462873 3300005530 Bacteria 1213
75 Ga0068853_100558689 3300005539 Bacteria 1085
76 Ga0070686_100520399 3300005544 Bacteria 926
77 Ga0070695_100195237 3300005545 Bacteria 1443
78 Ga0070695_100976294 3300005545 Bacteria 688
79 Ga0070696_100887507 3300005546 Bacteria 739
80 Ga0070693_100005048 3300005547 Bacteria 6304
81 Ga0070693_100357871 3300005547 Bacteria 1001
82 Ga0070693_100699790 3300005547 Bacteria 742
83 Ga0070665_100001059 3300005548 Bacteria 34416
84 Ga0070665_100091129 3300005548 Bacteria 3054
85 Ga0070704_100018129 3300005549 Bacteria 4492
86 Ga0070704_100128921 3300005549 Bacteria 1957
87 Ga0070704_100244230 3300005549 Bacteria 1471
88 Ga0068855_100008249 3300005563 Bacteria 12592
89 Ga0070664_100808020 3300005564 Bacteria 877
90 Ga0070664_101224579 3300005564 Bacteria 708
91 Ga0068854_100132290 3300005578 Bacteria 1906
92 Ga0068854_100211793 3300005578 Bacteria 1529
93 Ga0068852_100002208 3300005616 Bacteria 13359
94 Ga0068852_101632820 3300005616 Bacteria 667
95 Ga0068859_100337700 3300005617 Bacteria 1601
96 Ga0068864_100625080 3300005618 Bacteria 1047
97 Ga0068861_100282436 3300005719 Bacteria 1430
98 Ga0068861_101868485 3300005719 Bacteria 597
99 Ga0068851_10018416 3300005834 Bacteria 3362
100 Ga0068858_100012301 3300005842 Bacteria 8071
101 Ga0068858_100159203 3300005842 Bacteria 2126
102 Ga0068858_101025234 3300005842 Bacteria 809
103 Ga0068860_101435092 3300005843 Bacteria 711
104 Ga0068862_101633005 3300005844 Bacteria 652
105 Ga0068862_102011803 3300005844 Bacteria 588
106 Ga0081539_10378110 3300005985 Bacteria 591
107 Ga0075364_10002445 3300006051 Bacteria 10404
108 Ga0075364_10004592 3300006051 Bacteria 7954
109 Ga0075364_10007007 3300006051 Bacteria 6659
110 Ga0075364_10109884 3300006051 Bacteria 1839
111 Ga0070715_10094362 3300006163 Bacteria 1383
112 Ga0070716_100009989 3300006173 Bacteria 4747
113 Ga0070716_100359235 3300006173 Bacteria 1034
114 Ga0075367_10346117 3300006178 Bacteria 938
115 Ga0075369_10147689 3300006186 Bacteria 1074
116 Ga0075366_10116574 3300006195 Bacteria 1608
117 Ga0097621_100007616 3300006237 Bacteria 7759
118 Ga0097621_100009054 3300006237 Bacteria 7213
119 Ga0097621_100086881 3300006237 Bacteria 2611
120 Ga0068871_100006498 3300006358 Bacteria 8277
121 Ga0068871_100072587 3300006358 Bacteria 2835
122 Ga0068871_100124948 3300006358 Bacteria 2177
123 Ga0068871_100335359 3300006358 Bacteria 1334
124 Ga0075428_100006503 3300006844 Bacteria 12990
125 Ga0075433_10674742 3300006852 Bacteria 906
126 Ga0075433_10948002 3300006852 Bacteria 750
127 Ga0075434_100047404 3300006871 Bacteria 4265
128 Ga0075434_100119458 3300006871 Bacteria 2650
129 Ga0075434_101562038 3300006871 Bacteria 669
130 Ga0075429_100100535 3300006880 Bacteria 2524
131 Ga0068865_100073079 3300006881 Bacteria 2438
132 Ga0068865_100681850 3300006881 Bacteria 876
133 Ga0068865_100724343 3300006881 Bacteria 852
134 Ga0068865_101795990 3300006881 Bacteria 554
135 Ga0075436_100184107 3300006914 Bacteria 1477
136 Ga0075436_100275520 3300006914 Bacteria 1202
137 Ga0097620_101474986 3300006931 Bacteria 751
138 Ga0079104_1000075 3300006946 Bacteria 148544
139 Ga0079104_1000201 3300006946 Bacteria 83853
140 Ga0079104_1000365 3300006946 Bacteria 53914
141 Ga0079104_1000393 3300006946 Bacteria 50644
142 Ga0079104_1000633 3300006946 Bacteria 34240
143 Ga0079104_1004575 3300006946 Bacteria 5844
144 Ga0079104_1014486 3300006946 Bacteria 2376
145 Ga0079104_1093474 3300006946 Bacteria 607
146 Ga0079104_1109260 3300006946 Bacteria 548
147 Ga0075435_100745732 3300007076 Bacteria 852
148 Ga0099794_10007400 3300007265 Bacteria 4509
149 Ga0099794_10048093 3300007265 Bacteria 2047
150 Ga0105251_10000059 3300009011 Bacteria 103346
151 Ga0105251_10000095 3300009011 Bacteria 85705
152 Ga0105251_10001934 3300009011 Bacteria 16959
153 Ga0105251_10002308 3300009011 Bacteria 15120
154 Ga0105251_10004319 3300009011 Bacteria 9735
155 Ga0105251_10013853 3300009011 Bacteria 4486
156 Ga0105251_10039845 3300009011 Bacteria 2293
157 Ga0105244_10000492 3300009036 Bacteria 35654
158 Ga0105244_10009735 3300009036 Bacteria 5877
159 Ga0105244_10016161 3300009036 Bacteria 4259
160 Ga0105244_10023125 3300009036 Bacteria 3413
161 Ga0105244_10179570 3300009036 Bacteria 1004
162 Ga0105250_10001437 3300009092 Bacteria 12849
163 Ga0105250_10003023 3300009092 Bacteria 8134
164 Ga0105250_10003263 3300009092 Bacteria 7723
165 Ga0105250_10014289 3300009092 Bacteria 3265
166 Ga0105250_10064963 3300009092 Bacteria 1471
167 Ga0105250_10406285 3300009092 Bacteria 605
168 Ga0105240_10603666 3300009093 Bacteria 1208
169 Ga0105240_12058803 3300009093 Bacteria 593
170 Ga0111539_10001926 3300009094 Bacteria 27651
171 Ga0105245_10063400 3300009098 Bacteria 3337
172 Ga0105245_10346774 3300009098 Bacteria 1470
173 Ga0105247_10000048 3300009101 Bacteria 150745
174 Ga0114129_12086825 3300009147 Bacteria 684
175 Ga0105243_10390554 3300009148 Bacteria 1290
176 Ga0105243_10461327 3300009148 Bacteria 1194
177 Ga0105243_10834870 3300009148 Bacteria 911
178 Ga0105241_10000011 3300009174 Bacteria 243033
179 Ga0105241_10485221 3300009174 Bacteria 1099
180 Ga0105241_10705625 3300009174 Bacteria 921
181 Ga0105241_11987294 3300009174 Bacteria 572
182 Ga0105242_10004829 3300009176 Bacteria 10435
183 Ga0105242_10058987 3300009176 Bacteria 3148
184 Ga0105242_10079008 3300009176 Bacteria 2747
185 Ga0105242_10275254 3300009176 Bacteria 1526
186 Ga0105242_10421353 3300009176 Bacteria 1251
187 Ga0105242_10717925 3300009176 Bacteria 980
188 Ga0105242_11110735 3300009176 Bacteria 805
189 Ga0105242_12175794 3300009176 Bacteria 599
190 Ga0105248_10017686 3300009177 Bacteria 7862
191 Ga0105248_10571757 3300009177 Bacteria 1275
192 Ga0105248_10834109 3300009177 Bacteria 1040
193 Ga0105238_10298441 3300009551 Bacteria 1594
194 Ga0105238_10382073 3300009551 Bacteria 1400
195 Ga0105147_105402 3300009982 Bacteria 1073
196 Ga0105239_10782256 3300010375 Bacteria 1093
197 Ga0157373_10081290 3300013100 Bacteria 2284
198 Ga0157373_10081315 3300013100 Bacteria 2284
199 Ga0157371_10145974 3300013102 Bacteria 1686
200 Ga0157371_11189844 3300013102 Bacteria 587
201 Ga0157370_10036610 3300013104 Bacteria 4760
202 Ga0157370_10860115 3300013104 Bacteria 824
203 Ga0157370_11011251 3300013104 Bacteria 752
204 Ga0157369_10117752 3300013105 Bacteria 2820
205 Ga0157369_10182804 3300013105 Bacteria 2206
206 Ga0157374_10000104 3300013296 Bacteria 78523
207 Ga0157374_10293378 3300013296 Bacteria 1608
208 Ga0157374_11071054 3300013296 Bacteria 826
209 Ga0157378_10044245 3300013297 Bacteria 3953
210 Ga0157378_10180762 3300013297 Bacteria 1984
211 Ga0157378_11332658 3300013297 Bacteria 759
212 Ga0163162_10120065 3300013306 Bacteria 2732
213 Ga0163162_10167337 3300013306 Bacteria 2322
214 Ga0163162_10790689 3300013306 Bacteria 1066
215 Ga0157372_10002107 3300013307 Bacteria 21623
216 Ga0157372_10082577 3300013307 Bacteria 3638
217 Ga0157372_10186523 3300013307 Bacteria 2402
218 Ga0157372_12952868 3300013307 Bacteria 544
219 Ga0157375_10025335 3300013308 Bacteria 5509
220 Ga0157375_11815739 3300013308 Bacteria 723
221 Ga0163163_11904632 3300014325 Bacteria 655
222 Ga0157380_11008574 3300014326 Bacteria 866
223 Ga0157380_12342514 3300014326 Bacteria 599
224 Ga0182008_10005391 3300014497 Bacteria 7295
225 Ga0182008_10039474 3300014497 Bacteria 2359
226 Ga0157379_10022492 3300014968 Bacteria 5584
227 Ga0157379_10057239 3300014968 Bacteria 3484
228 Ga0157376_10063556 3300014969 Bacteria 3110
229 Ga0157376_10098142 3300014969 Bacteria 2553
230 Ga0157376_10098918 3300014969 Bacteria 2544
231 Ga0157376_10373060 3300014969 Bacteria 1372
232 Ga0157376_10388863 3300014969 Bacteria 1346
233 Ga0157376_10486419 3300014969 Bacteria 1210
234 Ga0182006_1000024 3300015261 Bacteria 257431
235 Ga0182006_1027678 3300015261 Bacteria 2311
236 Ga0182006_1052496 3300015261 Bacteria 1566
237 Ga0182007_10003840 3300015262 Bacteria 6985
238 Ga0182005_1011700 3300015265 Bacteria 2496
239 Ga0183361_10006 3300016635 Bacteria 368532
240 Ga0163161_10000005 3300017792 Bacteria 327860
241 Ga0163161_11324204 3300017792 Bacteria 627
242 Ga0163161_12100340 3300017792 Bacteria 502
243 Ga0213872_10107994 3300021361 Bacteria 1237
244 Ga0213876_10000065 3300021384 Bacteria 128435
245 Ga0213876_10096216 3300021384 Bacteria 1569
246 Ga0209435_101932 3300025206 Bacteria 2495
247 Ga0209674_100005 3300025226 Bacteria 1708125
248 Ga0209674_100240 3300025226 Bacteria 46653
249 Ga0209672_100001 3300025228 Bacteria 2828210
250 Ga0209672_100023 3300025228 Bacteria 371758
251 Ga0209147_100001 3300025229 Bacteria 2384371
252 Ga0209147_100127 3300025229 Bacteria 123986
253 Ga0209563_102559 3300025230 Bacteria 4073
254 Ga0207427_102173 3300025231 Bacteria 5590
255 Ga0209258_100001 3300025242 Bacteria 2384269
256 Ga0209258_100134 3300025242 Bacteria 174683
257 Ga0207425_1008165 3300025245 Bacteria 2703
258 Ga0209677_112110 3300025253 Bacteria 1300
259 Ga0209148_1000003 3300025254 Bacteria 2384288
260 Ga0209759_1000152 3300025256 Bacteria 119866
261 Ga0209759_1000405 3300025256 Bacteria 53243
262 Ga0209129_1000104 3300025258 Bacteria 161264
263 Ga0209233_1000016 3300025261 Bacteria 907830
264 Ga0209455_1000001 3300025272 Bacteria 2384278
265 Ga0209455_1011566 3300025272 Bacteria 2165
266 Ga0207656_10016168 3300025321 Bacteria 2901
267 Ga0207696_1000039 3300025711 Bacteria 324954
268 Ga0207696_1000166 3300025711 Bacteria 104368
269 Ga0207696_1001162 3300025711 Bacteria 15076
270 Ga0207696_1003316 3300025711 Bacteria 7404
271 Ga0207696_1011571 3300025711 Bacteria 3168
272 Ga0207655_1000062 3300025728 Bacteria 258054
273 Ga0207655_1000078 3300025728 Bacteria 219360
274 Ga0207655_1000199 3300025728 Bacteria 105047
275 Ga0207655_1020086 3300025728 Bacteria 3456
276 Ga0207713_1000069 3300025735 Bacteria 191229
277 Ga0207713_1000086 3300025735 Bacteria 157106
278 Ga0207713_1000180 3300025735 Bacteria 91168
279 Ga0207713_1000202 3300025735 Bacteria 81787
280 Ga0207713_1004002 3300025735 Bacteria 9759
281 Ga0207713_1012628 3300025735 Bacteria 4500
282 Ga0207713_1027207 3300025735 Bacteria 2603
283 Ga0207713_1035423 3300025735 Bacteria 2154
284 Ga0207682_10077951 3300025893 Bacteria 1415
285 Ga0207642_10167385 3300025899 Bacteria 1186
286 Ga0207710_10000026 3300025900 Bacteria 307644
287 Ga0207647_10066910 3300025904 Bacteria 2178
288 Ga0207685_10019276 3300025905 Bacteria 2245
289 Ga0207699_10472355 3300025906 Bacteria 902
290 Ga0207705_10133856 3300025909 Bacteria 1846
291 Ga0207705_10430727 3300025909 Bacteria 1022
292 Ga0207654_10000012 3300025911 Bacteria 243044
293 Ga0207654_10357299 3300025911 Bacteria 1007
294 Ga0207654_10455448 3300025911 Bacteria 898
295 Ga0207707_10773859 3300025912 Bacteria 801
296 Ga0207693_10292339 3300025915 Bacteria 1277
297 Ga0207663_10554751 3300025916 Bacteria 899
298 Ga0207662_10091371 3300025918 Bacteria 1873
299 Ga0207662_10145402 3300025918 Bacteria 1504
300 Ga0207657_10060755 3300025919 Bacteria 3243
301 Ga0207649_10123796 3300025920 Bacteria 1747
302 Ga0207650_10321606 3300025925 Bacteria 1267
303 Ga0207659_10351592 3300025926 Bacteria 1223
304 Ga0207659_10361840 3300025926 Bacteria 1206
305 Ga0207687_10137966 3300025927 Bacteria 1847
306 Ga0207687_10184419 3300025927 Bacteria 1619
307 Ga0207700_10009038 3300025928 Bacteria 6203
308 Ga0207690_10732823 3300025932 Bacteria 814
309 Ga0207690_11004835 3300025932 Bacteria 694
310 Ga0207686_10042151 3300025934 Bacteria 2788
311 Ga0207686_10112937 3300025934 Bacteria 1836
312 Ga0207686_10328903 3300025934 Bacteria 1144
313 Ga0207686_10334785 3300025934 Bacteria 1135
314 Ga0207686_10704913 3300025934 Bacteria 803
315 Ga0207686_11291665 3300025934 Bacteria 599
316 Ga0207709_10337687 3300025935 Bacteria 1133
317 Ga0207670_10091382 3300025936 Bacteria 2153
318 Ga0207670_10279859 3300025936 Bacteria 1300
319 Ga0207669_10619505 3300025937 Bacteria 882
320 Ga0207704_10442878 3300025938 Bacteria 1035
321 Ga0207704_10670219 3300025938 Bacteria 856
322 Ga0207665_10035734 3300025939 Bacteria 3300
323 Ga0207665_10225755 3300025939 Bacteria 1374
324 Ga0207711_10064825 3300025941 Bacteria 3156
325 Ga0207689_10224307 3300025942 Bacteria 1553
326 Ga0207689_10939978 3300025942 Bacteria 729
327 Ga0207679_10787968 3300025945 Bacteria 866
328 Ga0207679_11807383 3300025945 Bacteria 558
329 Ga0207667_10137351 3300025949 Bacteria 2517
330 Ga0207651_10093143 3300025960 Bacteria 2212
331 Ga0207712_11306774 3300025961 Bacteria 648
332 Ga0207712_12133835 3300025961 Bacteria 501
333 Ga0207640_10139703 3300025981 Bacteria 1764
334 Ga0207658_10098859 3300025986 Bacteria 2281
335 Ga0207677_10019019 3300026023 Bacteria 4137
336 Ga0207677_10273496 3300026023 Bacteria 1383
337 Ga0207677_10654926 3300026023 Bacteria 927
338 Ga0207677_11577365 3300026023 Bacteria 607
339 Ga0207703_10015754 3300026035 Bacteria 5897
340 Ga0207703_10599650 3300026035 Bacteria 1042
341 Ga0207639_10879783 3300026041 Bacteria 837
342 Ga0207678_10072141 3300026067 Bacteria 2959
343 Ga0207708_10182101 3300026075 Bacteria 1668
344 Ga0207641_11644932 3300026088 Bacteria 644
345 Ga0207648_10025902 3300026089 Bacteria 5218
346 Ga0207648_11599736 3300026089 Bacteria 612
347 Ga0207648_11675424 3300026089 Bacteria 597
348 Ga0207676_10901227 3300026095 Bacteria 867
349 Ga0207675_100419074 3300026118 Bacteria 1322
350 Ga0207675_100997021 3300026118 Bacteria 856
351 Ga0207675_101339691 3300026118 Bacteria 736
352 Ga0207683_10174639 3300026121 Bacteria 1947
353 Ga0207683_10693029 3300026121 Bacteria 944
354 Ga0207698_10001058 3300026142 Bacteria 15993
355 Ga0209281_1000004 3300027111 Bacteria 1253949
356 Ga0209281_1000014 3300027111 Bacteria 643021
357 Ga0209281_1000079 3300027111 Bacteria 261444
358 Ga0209281_1000142 3300027111 Bacteria 174280
359 Ga0209281_1000171 3300027111 Bacteria 153284
360 Ga0209281_1000184 3300027111 Bacteria 144981
361 Ga0209281_1000901 3300027111 Bacteria 24924
362 Ga0209281_1001407 3300027111 Bacteria 14472
363 Ga0209371_1000015 3300027312 Bacteria 659640
364 Ga0209371_1000221 3300027312 Bacteria 75566
365 Ga0209371_1000867 3300027312 Bacteria 24388
366 Ga0209371_1001808 3300027312 Bacteria 13349
367 Ga0209371_1006483 3300027312 Bacteria 4323
368 Ga0209371_1020569 3300027312 Bacteria 1622
369 Ga0209371_1022855 3300027312 Bacteria 1486
370 Ga0209588_1001752 3300027671 Bacteria 5750
371 Ga0209966_1011073 3300027695 Bacteria 1638
372 Ga0207428_10010038 3300027907 Bacteria 8474
373 Ga0268266_10000213 3300028379 Bacteria 100912
374 Ga0268266_10052108 3300028379 Bacteria 3514
375 Ga0268266_10443332 3300028379 Bacteria 1233
376 Ga0268265_12113213 3300028380 Bacteria 570
377 Ga0268265_12350815 3300028380 Bacteria 540
378 Ga0268264_10346609 3300028381 Bacteria 1412
379 Ga0265338_10000437 3300028800 Bacteria 74941
380 Ga0268256_1000018 3300030500 Bacteria 594572
381 Ga0268256_1000296 3300030500 Bacteria 50031
382 Ga0268256_1000482 3300030500 Bacteria 34168
383 Ga0268256_1009140 3300030500 Bacteria 3326
384 Ga0268256_1025000 3300030500 Bacteria 1524
385 Ga0268256_1025802 3300030500 Bacteria 1487
386 Ga0265332_10015178 3300031238 Bacteria 3402
387 Ga0265331_10025255 3300031250 Bacteria 3001
388 Ga0265327_10034490 3300031251 Bacteria 2808
389 Ga0307408_100016005 3300031548 Bacteria 5001
390 Ga0307408_100234393 3300031548 Bacteria 1505
391 Ga0307408_101438142 3300031548 Bacteria 650
392 Ga0307408_101522855 3300031548 Bacteria 633
393 Ga0316575_10003170 3300031665 Bacteria 5628
394 Ga0316575_10073313 3300031665 Bacteria 1377
395 Ga0316575_10083176 3300031665 Bacteria 1292
396 Ga0316575_10383102 3300031665 Bacteria 602
397 Ga0316575_10424041 3300031665 Bacteria 572
398 Ga0316579_10000166 3300031691 Bacteria 19057
399 Ga0316579_10001592 3300031691 Bacteria 8297
400 Ga0316579_10008011 3300031691 Bacteria 4388
401 Ga0316579_10071113 3300031691 Bacteria 1649
402 Ga0316576_10002247 3300031727 Bacteria 10925
403 Ga0316576_10020056 3300031727 Bacteria 4591
404 Ga0316576_10047234 3300031727 Bacteria 3119
405 Ga0316576_10150233 3300031727 Bacteria 1755
406 Ga0316576_10539590 3300031727 Bacteria 855
407 Ga0316578_10007566 3300031728 Bacteria 5457
408 Ga0316578_10010365 3300031728 Bacteria 4836
409 Ga0316578_10011211 3300031728 Bacteria 4679
410 Ga0316578_10188720 3300031728 Bacteria 1242
411 Ga0316578_10203799 3300031728 Bacteria 1190
412 Ga0316578_10331464 3300031728 Bacteria 907
413 Ga0316578_10404389 3300031728 Bacteria 809
414 Ga0316578_10450724 3300031728 Bacteria 760
415 Ga0316578_10788372 3300031728 Bacteria 551
416 Ga0307405_10415799 3300031731 Bacteria 1057
417 Ga0316577_10007349 3300031733 Bacteria 5876
418 Ga0316577_10025632 3300031733 Bacteria 3279
419 Ga0316577_10085194 3300031733 Bacteria 1768
420 Ga0316577_10090512 3300031733 Bacteria 1713
421 Ga0316577_10126628 3300031733 Bacteria 1436
422 Ga0316577_10156907 3300031733 Bacteria 1283
423 Ga0316577_10189202 3300031733 Bacteria 1163
424 Ga0316577_10208269 3300031733 Bacteria 1105
425 Ga0316577_10244551 3300031733 Bacteria 1015
426 Ga0316577_10333796 3300031733 Bacteria 860
427 Ga0316577_10631675 3300031733 Bacteria 609
428 Ga0307413_10185902 3300031824 Bacteria 1487
429 Ga0307410_10839006 3300031852 Bacteria 784
430 Ga0307406_11736058 3300031901 Bacteria 554
431 Ga0307412_10000008 3300031911 Bacteria 461034
432 Ga0307412_10797864 3300031911 Bacteria 819
433 Ga0307412_10975572 3300031911 Bacteria 747
434 Ga0307409_100253454 3300031995 Bacteria 1610
435 Ga0307409_101303169 3300031995 Bacteria 751
436 Ga0307416_100068522 3300032002 Bacteria 2932
437 Ga0307416_100716091 3300032002 Bacteria 1091
438 Ga0307416_100873333 3300032002 Bacteria 998
439 Ga0316583_10002671 3300032133 Bacteria 6231
440 Ga0316583_10003546 3300032133 Bacteria 5505
441 Ga0316583_10003976 3300032133 Bacteria 5253
442 Ga0316583_10027667 3300032133 Bacteria 2024
443 Ga0316583_10069160 3300032133 Bacteria 1235
444 Ga0316583_10075684 3300032133 Bacteria 1177
445 Ga0316583_10077462 3300032133 Bacteria 1162
446 Ga0316583_10176418 3300032133 Bacteria 743
447 Ga0316585_10000025 3300032137 Bacteria 22134
448 Ga0316585_10041606 3300032137 Bacteria 1464
449 Ga0316585_10117994 3300032137 Bacteria 873
450 Ga0316580_10001116 3300032139 Bacteria 6785
451 Ga0316580_10010848 3300032139 Bacteria 2761
452 Ga0316580_10036841 3300032139 Bacteria 1513
453 Ga0316580_10082323 3300032139 Bacteria 984
454 Ga0316580_10282659 3300032139 Bacteria 515
455 Ga0316593_10000022 3300032168 Bacteria 15802
456 Ga0316593_10000063 3300032168 Bacteria 12542
457 Ga0316593_10000189 3300032168 Bacteria 9417
458 Ga0316593_10000373 3300032168 Bacteria 7941
459 Ga0316593_10000378 3300032168 Bacteria 7925
460 Ga0316593_10000410 3300032168 Bacteria 7748
461 Ga0316593_10000534 3300032168 Bacteria 7077
462 Ga0316593_10000536 3300032168 Bacteria 7070
463 Ga0316593_10000714 3300032168 Bacteria 6508
464 Ga0316593_10000847 3300032168 Bacteria 6190
465 Ga0316593_10006179 3300032168 Bacteria 3219
466 Ga0316593_10009179 3300032168 Bacteria 2785
467 Ga0316593_10010401 3300032168 Bacteria 2667
468 Ga0316593_10011638 3300032168 Bacteria 2562
469 Ga0316593_10011695 3300032168 Bacteria 2558
470 Ga0316593_10015438 3300032168 Bacteria 2298
471 Ga0316593_10031057 3300032168 Bacteria 1738
472 Ga0316593_10039047 3300032168 Bacteria 1574
473 Ga0316593_10046365 3300032168 Bacteria 1459
474 Ga0316593_10073690 3300032168 Bacteria 1183
475 Ga0316593_10173446 3300032168 Bacteria 791
476 Ga0316593_10316729 3300032168 Bacteria 592
477 Ga0316593_10322666 3300032168 Bacteria 587
478 Ga0316592_1155182 3300033524 Bacteria 541
479 Ga0316586_1033341 3300033527 Bacteria 888
480 Ga0316586_1075717 3300033527 Bacteria 624
481 Ga0316596_1000357 3300033541 Bacteria 7472
482 Ga0316596_1011271 3300033541 Bacteria 2181
483 Ga0316596_1013554 3300033541 Bacteria 2015
484 Ga0316596_1027389 3300033541 Bacteria 1471
485 Ga0316596_1029345 3300033541 Bacteria 1423
486 Ga0316596_1038833 3300033541 Bacteria 1248
487 Ga0316596_1074651 3300033541 Bacteria 909
488 Ga0316596_1133759 3300033541 Bacteria 678
489 Ga0316596_1207472 3300033541 Bacteria 546
490 Ga0373930_0094254 3300034816 Bacteria 705
491 Ga0373938_0079650 3300034957 Bacteria 796
492 Ga0373934_0026886 3300035086 Bacteria 2233
493 Ga0373934_0061966 3300035086 Bacteria 1490
494 Ga0373951_0175613 3300035091 Bacteria 613
495 Ga0373923_0041195 3300035111 Bacteria 1903
496 Ga0373932_0292692 3300035112 Bacteria 605
497 Ga0373936_0263778 3300035113 Bacteria 771
498 Ga0373936_0476353 3300035113 Bacteria 579
499 Ga0373953_0068844 3300035117 Bacteria 1457
500 Ga0373954_0196606 3300035118 Bacteria 990
501 Ga0373956_0000024 3300035119 Bacteria 47805
502 Ga0373956_0017108 3300035119 Bacteria 3053
503 Ga0373943_0366924 3300035170 Bacteria 827
504 Ga0373943_0389702 3300035170 Bacteria 803
505 Ga0373946_0080067 3300035171 Bacteria 1428
506 Ga0373946_0456464 3300035171 Bacteria 651
507 Ga0373946_0750237 3300035171 Bacteria 512
508 Ga0373955_0016875 3300035172 Bacteria 3601
509 Ga0373955_0394464 3300035172 Bacteria 840
510 Ga0373955_0675983 3300035172 Bacteria 633
511 Ga0373962_0121263 3300035242 Bacteria 834
512 Ga0316574_0000748 3300035398 Bacteria 13973
513 Ga0316574_0001967 3300035398 Bacteria 10086
514 Ga0316574_0004868 3300035398 Bacteria 7112
515 Ga0316574_0006357 3300035398 Bacteria 6381
516 Ga0316574_0019010 3300035398 Bacteria 4048
517 Ga0316574_0026509 3300035398 Bacteria 3486
518 Ga0316574_0072040 3300035398 Bacteria 2183
519 Ga0316574_0096801 3300035398 Bacteria 1886
520 Ga0316574_0112688 3300035398 Bacteria 1744
521 Ga0316574_0117769 3300035398 Bacteria 1704
522 Ga0316574_0149683 3300035398 Bacteria 1504
523 Ga0316574_0171803 3300035398 Bacteria 1395
524 Ga0316574_0223115 3300035398 Bacteria 1207
525 Ga0316574_0229180 3300035398 Bacteria 1189
526 Ga0316574_0353425 3300035398 Bacteria 929
527 Ga0316574_0354581 3300035398 Bacteria 928
528 Ga0316574_0387049 3300035398 Bacteria 882
529 Ga0316574_0651368 3300035398 Bacteria 648
530 Ga0316574_0672537 3300035398 Bacteria 636
531 Ga0373924_0011697 3300035410 Bacteria 3264
532 Ga0373931_0154429 3300035691 Bacteria 1340
533 Ga0373931_0171989 3300035691 Bacteria 1277
534 Ga0373931_0649595 3300035691 Bacteria 693
535 Ga0373935_0403092 3300035692 Bacteria 982
536 Ga0373935_0872395 3300035692 Bacteria 666
537 Ga0373935_1372708 3300035692 Bacteria 528
538 Ga0373927_0095027 3300035695 Bacteria 1937
539 Ga0373933_0001797 3300035724 Bacteria 12425
540 Ga0373933_0625137 3300035724 Bacteria 707
541 Ga0373947_0133470 3300035725 Bacteria 1587
542 Ga0373947_0555010 3300035725 Bacteria 782
543 Ga0373937_0071339 3300036401 Bacteria 3203
544 Ga0373937_0538608 3300036401 Bacteria 1109
545 Ga0373937_0549442 3300036401 Bacteria 1097
546 Ga0373937_0833286 3300036401 Bacteria 870
547 Ga0316582_0000356 3300036647 Bacteria 16270
548 Ga0316582_0001138 3300036647 Bacteria 11320
549 Ga0316582_0003304 3300036647 Bacteria 7870
550 Ga0316582_0003393 3300036647 Bacteria 7806
551 Ga0316582_0008678 3300036647 Bacteria 5470
552 Ga0316582_0037790 3300036647 Bacteria 2996
553 Ga0316582_0040423 3300036647 Bacteria 2910
554 Ga0316582_0066343 3300036647 Bacteria 2326
555 Ga0316582_0088588 3300036647 Bacteria 2033
556 Ga0316582_0092240 3300036647 Bacteria 1995
557 Ga0316582_0116838 3300036647 Bacteria 1781
558 Ga0316582_0145162 3300036647 Bacteria 1601
559 Ga0316582_0154190 3300036647 Bacteria 1554
560 Ga0316582_0211340 3300036647 Bacteria 1325
561 Ga0316582_0237126 3300036647 Bacteria 1249
562 Ga0316582_0276998 3300036647 Bacteria 1151
563 Ga0316582_0434745 3300036647 Bacteria 904
564 Ga0316582_0443962 3300036647 Bacteria 894
565 Ga0316582_0651361 3300036647 Bacteria 724
566 Ga0316582_0741101 3300036647 Bacteria 674
567 Ga0316584_0003189 3300036712 Bacteria 10613
568 Ga0316584_0003517 3300036712 Bacteria 10214
569 Ga0316584_0005698 3300036712 Bacteria 8383
570 Ga0316584_0005825 3300036712 Bacteria 8316
571 Ga0316584_0022402 3300036712 Bacteria 4607
572 Ga0316584_0076465 3300036712 Bacteria 2509
573 Ga0316584_0094405 3300036712 Bacteria 2240
574 Ga0316584_0138016 3300036712 Bacteria 1819
575 Ga0316584_0585754 3300036712 Bacteria 775
576 Ga0316584_0965838 3300036712 Bacteria 570
577 Ga0316584_1146010 3300036712 Bacteria 515
578 Ga0316584_1200895 3300036712 Bacteria 500
579 Ga0373925_0086034 3300037068 Bacteria 2397
580 Ga0373925_0211615 3300037068 Bacteria 1544
581 Ga0395905_0000050 3300037471 Bacteria 223801
582 Ga0316581_0029303 3300037588 Bacteria 1652
583 Ga0316581_0031542 3300037588 Bacteria 1597
584 Ga0316581_0143840 3300037588 Bacteria 735
585 Ga0400484_24412 3300038725 Bacteria 11780
586 Ga0400484_38179 3300038725 Bacteria 1192
587 Ga0400490_11517 3300038726 Bacteria 2941
588 Ga0400490_13120 3300038726 Bacteria 11388
589 Ga0400490_18522 3300038726 Bacteria 2509
590 Ga0400490_22126 3300038726 Bacteria 6709
591 Ga0400490_23950 3300038726 Bacteria 14629
592 Ga0400490_30842 3300038726 Bacteria 4132
593 Ga0400490_48844 3300038726 Bacteria 4879
594 Ga0400491_01922 3300038727 Bacteria 1251
595 Ga0400491_24888 3300038727 Bacteria 2019
596 Ga0400485_14652 3300038735 Bacteria 151508
597 Ga0400485_17084 3300038735 Bacteria 1085
598 Ga0400485_19195 3300038735 Bacteria 9706
599 Ga0400488_17899 3300038741 Bacteria 4212
600 Ga0400488_18723 3300038741 Bacteria 3676
601 Ga0400488_34854 3300038741 Bacteria 17853
602 Ga0400488_45757 3300038741 Bacteria 1781
603 Ga0400488_48988 3300038741 Bacteria 2734
604 Ga0400488_62546 3300038741 Bacteria 4072
605 Ga0400486_01330 3300038742 Bacteria 81885
606 Ga0400486_08001 3300038742 Bacteria 1816
607 Ga0400486_26876 3300038742 Bacteria 1130
608 Ga0400486_31436 3300038742 Bacteria 10731
609 Ga0400483_023047 3300039062 Bacteria 3525
610 Ga0400483_023048 3300039062 Bacteria 3956
611 Ga0400483_068582 3300039062 Bacteria 10539
612 Ga0400483_068705 3300039062 Bacteria 4495
613 Ga0400483_075161 3300039062 Bacteria 103046
614 Ga0400483_076132 3300039062 Bacteria 2565
615 Ga0400483_093628 3300039062 Bacteria 14526
616 Ga0400483_105262 3300039062 Bacteria 6746
617 Ga0400483_130844 3300039062 Bacteria 10521
618 Ga0400483_152590 3300039062 Bacteria 7611
619 Ga0400483_164381 3300039062 Bacteria 3885
620 Ga0400483_171387 3300039062 Bacteria 1127
621 Ga0400483_187275 3300039062 Bacteria 48736
622 Ga0400483_218008 3300039062 Bacteria 3602
623 Ga0400483_220571 3300039062 Bacteria 6251
624 Ga0400483_239456 3300039062 Bacteria 7377
625 Ga0400483_249287 3300039062 Bacteria 4354
626 Ga0400483_289306 3300039062 Bacteria 4070
627 Ga0400483_291627 3300039062 Bacteria 1094
628 Ga0400489_46000 3300039093 Bacteria 4389
629 Ga0400487_02579 3300039110 Bacteria 6502
630 Ga0400487_23468 3300039110 Bacteria 5660
631 Ga0400487_34970 3300039110 Bacteria 222491
632 Ga0400487_64287 3300039110 Bacteria 4533
633 Ga0400487_65366 3300039110 Bacteria 123063
634 Ga0436365_1585837 3300039437 Bacteria 2279
635 Ga0436365_1613017 3300039437 Bacteria 128504
636 Ga0439438_003058 3300041405 Bacteria 6878
637 Ga0439438_019507 3300041405 Bacteria 1915
638 Ga0439439_0107193 3300041406 Bacteria 772
639 Ga0439447_159608 3300041407 Bacteria 519
640 Ga0439466_0042115 3300041411 Bacteria 1521
641 Ga0451851_0919370 3300041507 Bacteria 906
642 Ga0451853_1858486 3300041512 Bacteria 5832
643 Ga0439432_007984 3300042006 Bacteria 3732
644 Ga0439432_018173 3300042006 Bacteria 2353
645 Ga0439452_000002 3300042010 Bacteria 1377577
646 Ga0439452_000036 3300042010 Bacteria 158675
647 Ga0439452_000270 3300042010 Bacteria 34501
648 Ga0450900_006194 3300042136 Bacteria 1440
649 Ga0439464_0013001 3300042439 Bacteria 2223
650 Ga0439464_0016542 3300042439 Bacteria 1995
651 Ga0451577_0101028 3300042876 Bacteria 2577
652 Ga0451577_0246453 3300042876 Bacteria 1617
653 Ga0451577_0251020 3300042876 Bacteria 1601
654 Ga0451577_0531454 3300042876 Bacteria 1068
655 Ga0451577_0538398 3300042876 Bacteria 1060
656 Ga0453683_0145204 3300044673 Bacteria 1498
657 Ga0453684_0000005 3300044712 Bacteria 1431632
658 Ga0453684_0007382 3300044712 Bacteria 20255
659 Ga0453684_0264256 3300044712 Bacteria 1970
660 Ga0453684_0540007 3300044712 Bacteria 1286
661 Ga0453684_1033249 3300044712 Bacteria 872
662 Ga0451576_0000034 3300045051 Bacteria 390778
663 Ga0451576_0000461 3300045051 Bacteria 92083
664 Ga0451576_0066240 3300045051 Bacteria 3760
665 Ga0451576_0134068 3300045051 Bacteria 2582
666 Ga0451576_0171590 3300045051 Bacteria 2264
667 Ga0451576_0566285 3300045051 Bacteria 1194
668 Ga0451576_0864672 3300045051 Bacteria 949
669 Ga0451576_0909564 3300045051 Bacteria 923
670 Ga0495627_000433 3300046453 Bacteria 36340
671 Ga0495592_0001313 3300046454 Bacteria 17257
672 Ga0495592_0035700 3300046454 Bacteria 3745
673 Ga0495592_0076229 3300046454 Bacteria 2433
674 Ga0495592_0087719 3300046454 Bacteria 2237
675 Ga0495603_0051535 3300046455 Bacteria 2445
676 Ga0495590_0005690 3300046457 Bacteria 4901
677 Ga0495591_000066 3300046458 Bacteria 121317
678 Ga0495591_005751 3300046458 Bacteria 5651
679 Ga0495629_0008262 3300046459 Bacteria 7654
680 Ga0495629_0009715 3300046459 Bacteria 7025
681 Ga0495629_0099939 3300046459 Bacteria 2024
682 Ga0495638_0005497 3300046460 Bacteria 9420
683 Ga0495641_0019820 3300046461 Bacteria 3429
684 Ga0495641_0024414 3300046461 Bacteria 2984
685 Ga0495651_0001164 3300046462 Bacteria 20299
686 Ga0495651_0003321 3300046462 Bacteria 12354
687 Ga0495651_0221737 3300046462 Bacteria 1308
688 Ga0495651_0435522 3300046462 Bacteria 850
689 Ga0495651_0899396 3300046462 Bacteria 541
690 Ga0495653_0001712 3300046463 Bacteria 17277
691 Ga0495653_0045461 3300046463 Bacteria 3404
692 Ga0495653_0064843 3300046463 Bacteria 2751
693 Ga0495653_0069955 3300046463 Bacteria 2627
694 Ga0495650_0000326 3300046471 Bacteria 85267
695 Ga0495650_0009064 3300046471 Bacteria 5708
696 Ga0495650_0013790 3300046471 Bacteria 4251
697 Ga0495580_0001745 3300046472 Bacteria 19125
698 Ga0495580_0044244 3300046472 Bacteria 3167
699 Ga0495580_0088429 3300046472 Bacteria 2157
700 Ga0495582_0005561 3300046473 Bacteria 7017
701 Ga0495582_0144212 3300046473 Bacteria 1350
702 Ga0495605_0007456 3300046474 Bacteria 6208
703 Ga0495639_0055350 3300046475 Bacteria 1809
704 Ga0495662_0036737 3300046476 Bacteria 2364
705 Ga0495662_0044605 3300046476 Bacteria 2140
706 Ga0495662_0060251 3300046476 Bacteria 1833
707 Ga0495662_0093033 3300046476 Bacteria 1471
708 Ga0495664_0003770 3300046477 Bacteria 8269
709 Ga0495664_0070366 3300046477 Bacteria 2089
710 Ga0495664_0106516 3300046477 Bacteria 1690
711 Ga0495664_0522093 3300046477 Bacteria 708
712 Ga0495594_0085091 3300046499 Bacteria 1769
713 Ga0495594_0085339 3300046499 Bacteria 1766
714 Ga0495596_0009887 3300046500 Bacteria 4180
715 Ga0495596_0032104 3300046500 Bacteria 2095
716 Ga0495606_0002813 3300046507 Bacteria 19352
717 Ga0495606_0019929 3300046507 Bacteria 4966
718 Ga0495606_0028739 3300046507 Bacteria 3916
719 Ga0495608_0004176 3300046511 Bacteria 10359
720 Ga0495608_0026692 3300046511 Bacteria 3935
721 Ga0495608_0026754 3300046511 Bacteria 3931
722 Ga0495608_0084657 3300046511 Bacteria 2056
723 Ga0495610_0014021 3300046512 Bacteria 4733
724 Ga0495618_0020240 3300046514 Bacteria 4097
725 Ga0495618_0106945 3300046514 Bacteria 1791
726 Ga0495618_0256069 3300046514 Bacteria 1097
727 Ga0495620_0019454 3300046515 Bacteria 3338
728 Ga0495628_0011513 3300046516 Bacteria 7477
729 Ga0495628_0029916 3300046516 Bacteria 4412
730 Ga0495628_0033225 3300046516 Bacteria 4159
731 Ga0495628_0065873 3300046516 Bacteria 2832
732 Ga0495628_0124454 3300046516 Bacteria 1976
733 Ga0495628_0367357 3300046516 Bacteria 1055
734 Ga0495630_0018171 3300046517 Bacteria 5163
735 Ga0495630_0053365 3300046517 Bacteria 3026
736 Ga0495630_0053406 3300046517 Bacteria 3025
737 Ga0495630_0263267 3300046517 Bacteria 1317
738 Ga0495630_0686498 3300046517 Bacteria 783
739 Ga0495643_0107211 3300046522 Bacteria 1425
740 Ga0495643_0126123 3300046522 Bacteria 1289
741 Ga0495648_0033444 3300046524 Bacteria 3356
742 Ga0495648_0036486 3300046524 Bacteria 3170
743 Ga0495663_0317091 3300046525 Bacteria 564
744 Ga0495666_0001724 3300046526 Bacteria 10786
745 Ga0495666_0004045 3300046526 Bacteria 7413
746 Ga0495666_0014527 3300046526 Bacteria 3921
747 Ga0495666_0031606 3300046526 Bacteria 2593
748 Ga0495652_0019979 3300046529 Bacteria 5957
749 Ga0495652_0087237 3300046529 Bacteria 2559
750 Ga0495652_0092003 3300046529 Bacteria 2478
751 Ga0495652_0259508 3300046529 Bacteria 1283
752 Ga0495652_1122335 3300046529 Bacteria 510
753 Ga0495654_0000964 3300046530 Bacteria 21224
754 Ga0495654_0016345 3300046530 Bacteria 3926
755 Ga0495665_0005305 3300046531 Bacteria 6945
756 Ga0495665_0006059 3300046531 Bacteria 6522
757 Ga0495665_0009459 3300046531 Bacteria 5275
758 Ga0495665_0063494 3300046531 Bacteria 1949
759 Ga0495640_0007608 3300046533 Bacteria 8513
760 Ga0495640_0010353 3300046533 Bacteria 7209
761 Ga0495640_0394283 3300046533 Bacteria 850
762 Ga0495586_0004361 3300046535 Bacteria 7563
763 Ga0495586_0052836 3300046535 Bacteria 2200
764 Ga0495586_0151331 3300046535 Bacteria 1305
765 Ga0495587_0000845 3300046536 Bacteria 20252
766 Ga0495587_0022745 3300046536 Bacteria 3857
767 Ga0495587_0053763 3300046536 Bacteria 2373
768 Ga0495621_0021458 3300046539 Bacteria 2129
769 Ga0495597_0001266 3300046542 Bacteria 18625
770 Ga0495597_0111126 3300046542 Bacteria 1149
771 Ga0495645_0005078 3300046543 Bacteria 9021
772 Ga0495645_0060781 3300046543 Bacteria 2738
773 Ga0495645_0600156 3300046543 Bacteria 677
774 Ga0495645_0694729 3300046543 Bacteria 618
775 Ga0495622_0087462 3300046557 Bacteria 1433
776 Ga0495633_0360525 3300046558 Bacteria 658
777 Ga0495667_0047368 3300046559 Bacteria 2841
778 Ga0495667_0389617 3300046559 Bacteria 878
779 Ga0495634_0005222 3300046642 Bacteria 10032
780 Ga0495634_0010809 3300046642 Bacteria 6677
781 Ga0495634_0014642 3300046642 Bacteria 5649
782 Ga0495634_0130899 3300046642 Bacteria 1599
783 Ga0495625_0002671 3300046660 Bacteria 18973
784 Ga0495635_0020425 3300046663 Bacteria 4613
785 Ga0495635_0023389 3300046663 Bacteria 4306
786 Ga0495635_0042769 3300046663 Bacteria 3127
787 Ga0495635_0170115 3300046663 Bacteria 1482
788 Ga0495661_0017977 3300046665 Bacteria 4658
789 Ga0495661_0032063 3300046665 Bacteria 3325
790 Ga0495588_0029013 3300046674 Bacteria 2773
791 Ga0495588_0103118 3300046674 Bacteria 1500
792 Ga0495657_0011839 3300046675 Bacteria 6502
793 Ga0495657_0130660 3300046675 Bacteria 1573
794 Ga0495657_0319775 3300046675 Bacteria 922
795 Ga0495599_0018741 3300046678 Bacteria 4313
796 Ga0495599_0026148 3300046678 Bacteria 3657
797 Ga0495599_0045972 3300046678 Bacteria 2738
798 Ga0495599_0058244 3300046678 Bacteria 2417
799 Ga0495599_0546512 3300046678 Bacteria 678
800 Ga0495623_0071830 3300046679 Bacteria 2152
801 Ga0495623_0216904 3300046679 Bacteria 1092
802 Ga0495646_0004507 3300046680 Bacteria 8768
803 Ga0495646_0021509 3300046680 Bacteria 4073
804 Ga0495646_0096810 3300046680 Bacteria 1696
805 Ga0495647_0028969 3300046681 Bacteria 2044
806 Ga0495658_0176625 3300046683 Bacteria 1323
807 Ga0495669_0126951 3300046684 Bacteria 1199
808 Ga0495613_0015752 3300046689 Bacteria 5627
809 Ga0495613_0020692 3300046689 Bacteria 4905
810 Ga0495613_0516682 3300046689 Bacteria 802
811 Ga0495624_0020183 3300046690 Bacteria 4438
812 Ga0495624_0088756 3300046690 Bacteria 1908
813 Ga0495624_0118496 3300046690 Bacteria 1626
814 Ga0495624_0130548 3300046690 Bacteria 1540
815 Ga0495624_0544477 3300046690 Bacteria 693
816 Ga0495670_0353466 3300046691 Bacteria 791
817 Ga0495649_0001045 3300046694 Bacteria 21720
818 Ga0495649_0001390 3300046694 Bacteria 18291
819 Ga0495649_0006282 3300046694 Bacteria 7395
820 Ga0495649_0136022 3300046694 Bacteria 1295
821 Ga0495649_0325329 3300046694 Bacteria 780
822 Ga0495589_0000032 3300046794 Bacteria 167736
823 Ga0495589_0022934 3300046794 Bacteria 3181
824 Ga0495589_0296103 3300046794 Bacteria 750
825 Ga0495600_0015117 3300046809 Bacteria 4875
826 Ga0495600_0078879 3300046809 Bacteria 2150
827 Ga0495600_0109577 3300046809 Bacteria 1798
828 Ga0495660_0046599 3300046810 Bacteria 2377
829 Ga0495581_0001049 3300047315 Bacteria 14962
830 Ga0495581_0018271 3300047315 Bacteria 4072
831 Ga0495604_0001474 3300047317 Bacteria 19379
832 Ga0495604_0018792 3300047317 Bacteria 5534
833 Ga0495604_0028929 3300047317 Bacteria 4408
834 Ga0495604_0046393 3300047317 Bacteria 3387
835 Ga0495604_0410842 3300047317 Bacteria 890
836 Ga0495674_0032854 3300047319 Bacteria 4703
837 Ga0495674_0046785 3300047319 Bacteria 3839
838 Ga0495674_0058935 3300047319 Bacteria 3354
839 Ga0495674_0092710 3300047319 Bacteria 2578
840 Ga0495674_0338292 3300047319 Bacteria 1223
841 Ga0495674_1420440 3300047319 Bacteria 516
842 Ga0495672_0000156 3300047320 Bacteria 98712
843 Ga0495672_0139772 3300047320 Bacteria 1266
844 Ga0495676_0045713 3300047321 Bacteria 3560
845 Ga0495676_0048592 3300047321 Bacteria 3419
846 Ga0495676_0057991 3300047321 Bacteria 3050
847 Ga0495680_0006154 3300047322 Bacteria 11193
848 Ga0495680_0017184 3300047322 Bacteria 6187
849 Ga0495680_0068306 3300047322 Bacteria 2715
850 Ga0495680_0112126 3300047322 Bacteria 2020
851 Ga0495683_0006981 3300047323 Bacteria 6132
852 Ga0495687_019977 3300047443 Bacteria 3274
853 Ga0495675_0010643 3300047444 Bacteria 5751
854 Ga0495675_0020929 3300047444 Bacteria 4163
855 Ga0495675_0036406 3300047444 Bacteria 3139
856 Ga0495679_000195 3300047446 Bacteria 53965
857 Ga0495679_001999 3300047446 Bacteria 10815
858 Ga0495679_002765 3300047446 Bacteria 8729
859 Ga0495679_006165 3300047446 Bacteria 5214
860 Ga0495681_0131001 3300047470 Bacteria 1067
861 Ga0495681_0209986 3300047470 Bacteria 785
862 Ga0495684_0156547 3300047471 Bacteria 1701
863 Ga0495684_0458328 3300047471 Bacteria 884
864 Ga0495686_0000002 3300047472 Bacteria 1050777
865 Ga0495686_0433351 3300047472 Bacteria 701
866 Ga0495593_0008398 3300047673 Bacteria 6005
867 Ga0495593_0012038 3300047673 Bacteria 4958
868 Ga0495602_0011608 3300048088 Bacteria 9101
869 Ga0495602_0044036 3300048088 Bacteria 4051
870 Ga0495602_0070335 3300048088 Bacteria 2995
871 Ga0495602_0083251 3300048088 Bacteria 2681
872 Ga0495614_0000826 3300048089 Bacteria 13085
873 Ga0495614_0003464 3300048089 Bacteria 7057
874 Ga0495614_0262032 3300048089 Bacteria 793
875 Ga0495626_0087058 3300048091 Bacteria 1379
876 Ga0496100_0494036 3300048903 Bacteria 942
877 Ga0496101_1025543 3300048904 Bacteria 649
878 Ga0496102_0069517 3300048905 Bacteria 3232
879 Ga0496102_1572291 3300048905 Bacteria 576
880 Ga0496103_0021032 3300048906 Bacteria 3924
881 Ga0496103_0133620 3300048906 Bacteria 1585
882 Ga0496104_0764620 3300048907 Bacteria 873
883 Ga0496105_0799561 3300048908 Bacteria 717
884 Ga0496106_0000023 3300048909 Bacteria 165457
885 Ga0496110_0177508 3300048913 Bacteria 1934
886 Ga0496111_0167246 3300048914 Bacteria 1633
887 Ga0496112_0501198 3300048915 Bacteria 1150
888 Ga0496113_0531412 3300048916 Bacteria 944
889 Ga0496115_0457801 3300048918 Bacteria 1030
890 Ga0496116_0000007 3300048919 Bacteria 795464
891 Ga0496116_0003553 3300048919 Bacteria 15330
892 Ga0496116_0012961 3300048919 Bacteria 6763
893 Ga0496117_0003271 3300048920 Bacteria 19041
894 Ga0496117_0003856 3300048920 Bacteria 17063
895 Ga0496117_0019314 3300048920 Bacteria 5603
896 Ga0496117_0040958 3300048920 Bacteria 3400
897 Ga0496117_0075288 3300048920 Bacteria 2243
898 Ga0496117_0111359 3300048920 Bacteria 1704
899 Ga0496117_0164340 3300048920 Bacteria 1296
900 Ga0496118_0001700 3300048921 Bacteria 32185
901 Ga0496118_0001781 3300048921 Bacteria 31089
902 Ga0496118_0010415 3300048921 Bacteria 9214
903 Ga0496118_0021027 3300048921 Bacteria 5761
904 Ga0496118_0030452 3300048921 Bacteria 4502
905 Ga0496118_0053651 3300048921 Bacteria 3061
906 Ga0496119_0000013 3300048922 Bacteria 323820
907 Ga0496119_0001881 3300048922 Bacteria 24207
908 Ga0496119_0090294 3300048922 Bacteria 1742
909 Ga0496120_0003642 3300048923 Bacteria 13815
910 Ga0496120_0007320 3300048923 Bacteria 8236
911 Ga0496120_0020001 3300048923 Bacteria 4267
912 Ga0496121_0004540 3300048924 Bacteria 18565
913 Ga0496121_0005179 3300048924 Bacteria 16904
914 Ga0496121_0012769 3300048924 Bacteria 9097
915 Ga0496121_0066801 3300048924 Bacteria 2917
916 Ga0496122_0000619 3300048925 Bacteria 72800
917 Ga0496122_0000849 3300048925 Bacteria 57536
918 Ga0496122_0001669 3300048925 Bacteria 34423
919 Ga0496122_0123695 3300048925 Bacteria 1661
920 Ga0496123_0000012 3300048926 Bacteria 458760
921 Ga0496123_0001359 3300048926 Bacteria 34451
922 Ga0496123_0001875 3300048926 Bacteria 27530
923 Ga0496123_0112664 3300048926 Bacteria 1551
924 Ga0496123_0254332 3300048926 Bacteria 864
925 Ga0496124_0000049 3300048927 Bacteria 269753
926 Ga0496124_0001722 3300048927 Bacteria 30829
927 Ga0496124_0028242 3300048927 Bacteria 5021
928 Ga0496124_0088620 3300048927 Bacteria 2529
929 Ga0496124_0467276 3300048927 Bacteria 855
930 Ga0496124_0567361 3300048927 Bacteria 745
931 Ga0496124_0839208 3300048927 Bacteria 564
932 Ga0496125_0000405 3300048928 Bacteria 80765
933 Ga0496125_0046818 3300048928 Bacteria 3624
934 Ga0496125_0084257 3300048928 Bacteria 2414
935 Ga0496126_0000031 3300048929 Bacteria 373371
936 Ga0496126_0034302 3300048929 Bacteria 4766
937 Ga0496126_0078886 3300048929 Bacteria 2916
938 Ga0496126_0372232 3300048929 Bacteria 1164
939 Ga0496126_1304420 3300048929 Bacteria 528
940 Ga0501261_041006 3300049690 Bacteria 731
941 Ga0501280_004384 3300049776 Bacteria 2077
942 nmdc:mga00v17_14683_c1 3300050491 Bacteria 4380
943 nmdc:mga00v17_2036_c1 3300050491 Bacteria 10407
944 nmdc:mga00v17_316684_c1 3300050491 Bacteria 1014
945 nmdc:mga00v17_689621_c1 3300050491 Bacteria 655
946 nmdc:mga00v17_920272_c1 3300050491 Bacteria 553
947 nmdc:mga0k408_834066_c1 3300050493 Bacteria 536
948 nmdc:mga0k408_9476_c1 3300050493 Bacteria 3352
949 nmdc:mga05p37_1685756_c1 3300050507 Bacteria 619
950 nmdc:mga09592_887527_c1 3300050508 Bacteria 750
951 nmdc:mga0qj67_440290_c1 3300050509 Bacteria 1050
952 nmdc:mga08y16_101458_c1 3300050511 Bacteria 2996
953 nmdc:mga08y16_1567005_c1 3300050511 Bacteria 617
954 nmdc:mga0n895_431777_c1 3300050512 Bacteria 1331
955 nmdc:mga0n895_668864_c1 3300050512 Bacteria 1036
956 nmdc:mga0n895_771058_c1 3300050512 Bacteria 954
957 nmdc:mga0a205_543073_c1 3300050515 Bacteria 1018
958 nmdc:mga0sz30_116226_c1 3300050516 Bacteria 1174
959 Ga0495601_0007759 3300053077 Bacteria 6309
960 Ga0495601_0053564 3300053077 Bacteria 2550
961 Ga0495601_0146949 3300053077 Bacteria 1539
962 Ga0495612_0049590 3300053078 Bacteria 1723
963 Ga0495595_0021725 3300053084 Bacteria 2807
964 Ga0495595_0073949 3300053084 Bacteria 1614
965 Ga0495619_0262169 3300053085 Bacteria 1197
966 Ga0466962_0428647 3300061719 Bacteria 664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049776 Ga0501280_004384 Ga0501280_004384_948_1280 108
2 3300005343 Ga0070687_100128442 Ga0070687_1001284422 110
3 3300005547 Ga0070693_100699790 Ga0070693_1006997902 110
4 3300025918 Ga0207662_10091371 Ga0207662_100913712 110
5 3300026118 Ga0207675_100997021 Ga0207675_1009970211 110
6 3300031251 Ga0265327_10034490 Ga0265327_100344902 110
7 3300031548 Ga0307408_101522855 Ga0307408_1015228552 110
8 3300031731 Ga0307405_10415799 Ga0307405_104157992 110
9 3300032133 Ga0316583_10002671 Ga0316583_100026717 110
10 3300044673 Ga0453683_0145204 Ga0453683_0145204_580_912 110
11 3300045051 Ga0451576_0000034 Ga0451576_0000034_286101_286433 110
12 3300049690 Ga0501261_041006 Ga0501261_041006_80_418 110
13 3300050512 nmdc:mga0n895_431777_c1 nmdc:mga0n895_431777_c1_730_1071 110
14 2010549000 RicEn_C1984 RicEn_36500 111
15 2162886007 SwRhRL2b_contig_2515474 SwRhRL2b_0386.00004770 111
16 2162886007 SwRhRL2b_contig_3243000 SwRhRL2b_0084.00004960 111
17 3300001989 JGI24739J22299_10003976 JGI24739J22299_100039766 111
18 3300002067 JGI24735J21928_10036514 JGI24735J21928_100365142 111
19 3300002075 JGI24738J21930_10008726 JGI24738J21930_100087262 111
20 3300002705 JGI25156J39149_1001614 JGI25156J39149_10016144 111
21 3300003214 JGI25165J46597_1002430 JGI25165J46597_10024306 111
22 3300003323 rootH1_10308890 rootH1_103088902 111
23 3300003756 Ga0055533_1000300 Ga0055533_100030012 111
24 3300003756 Ga0055533_1006544 Ga0055533_10065443 111
25 3300003758 Ga0055532_1000001 Ga0055532_1000001356 111
26 3300003760 Ga0055527_1000002 Ga0055527_1000002402 111
27 3300003760 Ga0055527_1001325 Ga0055527_10013255 111
28 3300003761 Ga0055535_1000001 Ga0055535_1000001648 111
29 3300003761 Ga0055535_1002900 Ga0055535_10029005 111
30 3300003762 Ga0055542_1000001 Ga0055542_1000001355 111
31 3300003763 Ga0055529_1000001 Ga0055529_1000001648 111
32 3300003763 Ga0055529_1005550 Ga0055529_10055502 111
33 3300003856 Ga0058692_1006038 Ga0058692_10060382 111
34 3300003856 Ga0058692_1061626 Ga0058692_10616261 111
35 3300005289 Ga0065704_10000456 Ga0065704_100004562 111
36 3300005289 Ga0065704_10073661 Ga0065704_100736614 111
37 3300005289 Ga0065704_10084188 Ga0065704_100841882 111
38 3300005289 Ga0065704_10120659 Ga0065704_101206591 111
39 3300005290 Ga0065712_10113238 Ga0065712_101132381 111
40 3300005327 Ga0070658_10125382 Ga0070658_101253823 111
41 3300005327 Ga0070658_10348780 Ga0070658_103487802 111
42 3300005327 Ga0070658_10464939 Ga0070658_104649391 111
43 3300005330 Ga0070690_100060000 Ga0070690_1000600004 111
44 3300005330 Ga0070690_101137090 Ga0070690_1011370902 111
45 3300005331 Ga0070670_100121801 Ga0070670_1001218012 111
46 3300005333 Ga0070677_10739912 Ga0070677_107399122 111
47 3300005334 Ga0068869_100142867 Ga0068869_1001428672 111
48 3300005334 Ga0068869_101085959 Ga0068869_1010859592 111
49 3300005338 Ga0068868_100114481 Ga0068868_1001144812 111
50 3300005338 Ga0068868_100134560 Ga0068868_1001345602 111
51 3300005338 Ga0068868_101963374 Ga0068868_1019633742 111
52 3300005339 Ga0070660_100298819 Ga0070660_1002988192 111
53 3300005339 Ga0070660_100510107 Ga0070660_1005101073 111
54 3300005339 Ga0070660_100849105 Ga0070660_1008491052 111
55 3300005340 Ga0070689_100129868 Ga0070689_1001298684 111
56 3300005340 Ga0070689_100181428 Ga0070689_1001814282 111
57 3300005340 Ga0070689_100524344 Ga0070689_1005243442 111
58 3300005340 Ga0070689_100785076 Ga0070689_1007850762 111
59 3300005343 Ga0070687_100580583 Ga0070687_1005805832 111
60 3300005344 Ga0070661_100206043 Ga0070661_1002060432 111
61 3300005344 Ga0070661_100597518 Ga0070661_1005975182 111
62 3300005345 Ga0070692_11133852 Ga0070692_111338521 111
63 3300005353 Ga0070669_100443346 Ga0070669_1004433463 111
64 3300005354 Ga0070675_100063736 Ga0070675_1000637362 111
65 3300005356 Ga0070674_100688727 Ga0070674_1006887271 111
66 3300005364 Ga0070673_100452017 Ga0070673_1004520173 111
67 3300005434 Ga0070709_10596502 Ga0070709_105965023 111
68 3300005436 Ga0070713_100040111 Ga0070713_1000401115 111
69 3300005438 Ga0070701_10175363 Ga0070701_101753633 111
70 3300005439 Ga0070711_100129730 Ga0070711_1001297302 111
71 3300005439 Ga0070711_100664273 Ga0070711_1006642732 111
72 3300005441 Ga0070700_101315065 Ga0070700_1013150651 111
73 3300005444 Ga0070694_100570890 Ga0070694_1005708902 111
74 3300005444 Ga0070694_101131353 Ga0070694_1011313531 111
75 3300005455 Ga0070663_100239123 Ga0070663_1002391232 111
76 3300005456 Ga0070678_100470936 Ga0070678_1004709362 111
77 3300005456 Ga0070678_100652866 Ga0070678_1006528662 111
78 3300005458 Ga0070681_10088625 Ga0070681_100886252 111
79 3300005458 Ga0070681_10627559 Ga0070681_106275592 111
80 3300005458 Ga0070681_10702598 Ga0070681_107025982 111
81 3300005459 Ga0068867_100057812 Ga0068867_1000578123 111
82 3300005459 Ga0068867_100301413 Ga0068867_1003014132 111
83 3300005466 Ga0070685_10475463 Ga0070685_104754632 111
84 3300005468 Ga0070707_102141001 Ga0070707_1021410011 111
85 3300005471 Ga0070698_101617732 Ga0070698_1016177322 111
86 3300005530 Ga0070679_100462873 Ga0070679_1004628732 111
87 3300005539 Ga0068853_100558689 Ga0068853_1005586891 111
88 3300005544 Ga0070686_100520399 Ga0070686_1005203991 111
89 3300005545 Ga0070695_100195237 Ga0070695_1001952372 111
90 3300005545 Ga0070695_100976294 Ga0070695_1009762941 111
91 3300005546 Ga0070696_100887507 Ga0070696_1008875072 111
92 3300005547 Ga0070693_100005048 Ga0070693_1000050482 111
93 3300005547 Ga0070693_100357871 Ga0070693_1003578712 111
94 3300005548 Ga0070665_100001059 Ga0070665_10000105915 111
95 3300005548 Ga0070665_100091129 Ga0070665_1000911292 111
96 3300005549 Ga0070704_100018129 Ga0070704_1000181292 111
97 3300005549 Ga0070704_100128921 Ga0070704_1001289214 111
98 3300005549 Ga0070704_100244230 Ga0070704_1002442302 111
99 3300005563 Ga0068855_100008249 Ga0068855_1000082495 111
100 3300005564 Ga0070664_100808020 Ga0070664_1008080202 111
101 3300005564 Ga0070664_101224579 Ga0070664_1012245791 111
102 3300005578 Ga0068854_100132290 Ga0068854_1001322902 111
103 3300005578 Ga0068854_100211793 Ga0068854_1002117933 111
104 3300005616 Ga0068852_100002208 Ga0068852_1000022084 111
105 3300005616 Ga0068852_101632820 Ga0068852_1016328201 111
106 3300005617 Ga0068859_100337700 Ga0068859_1003377001 111
107 3300005618 Ga0068864_100625080 Ga0068864_1006250802 111
108 3300005719 Ga0068861_100282436 Ga0068861_1002824364 111
109 3300005719 Ga0068861_101868485 Ga0068861_1018684851 111
110 3300005834 Ga0068851_10018416 Ga0068851_100184162 111
111 3300005842 Ga0068858_100012301 Ga0068858_1000123019 111
112 3300005842 Ga0068858_100159203 Ga0068858_1001592034 111
113 3300005842 Ga0068858_101025234 Ga0068858_1010252342 111
114 3300005843 Ga0068860_101435092 Ga0068860_1014350922 111
115 3300005844 Ga0068862_101633005 Ga0068862_1016330052 111
116 3300005844 Ga0068862_102011803 Ga0068862_1020118032 111
117 3300005985 Ga0081539_10378110 Ga0081539_103781102 111
118 3300006051 Ga0075364_10002445 Ga0075364_100024452 111
119 3300006051 Ga0075364_10004592 Ga0075364_100045926 111
120 3300006051 Ga0075364_10007007 Ga0075364_100070077 111
121 3300006051 Ga0075364_10109884 Ga0075364_101098843 111
122 3300006163 Ga0070715_10094362 Ga0070715_100943622 111
123 3300006173 Ga0070716_100009989 Ga0070716_1000099892 111
124 3300006173 Ga0070716_100359235 Ga0070716_1003592352 111
125 3300006178 Ga0075367_10346117 Ga0075367_103461172 111
126 3300006186 Ga0075369_10147689 Ga0075369_101476892 111
127 3300006195 Ga0075366_10116574 Ga0075366_101165742 111
128 3300006237 Ga0097621_100007616 Ga0097621_1000076165 111
129 3300006237 Ga0097621_100009054 Ga0097621_1000090546 111
130 3300006237 Ga0097621_100086881 Ga0097621_1000868813 111
131 3300006358 Ga0068871_100006498 Ga0068871_1000064981 111
132 3300006358 Ga0068871_100072587 Ga0068871_1000725872 111
133 3300006358 Ga0068871_100124948 Ga0068871_1001249482 111
134 3300006358 Ga0068871_100335359 Ga0068871_1003353592 111
135 3300006844 Ga0075428_100006503 Ga0075428_1000065032 111
136 3300006852 Ga0075433_10674742 Ga0075433_106747423 111
137 3300006852 Ga0075433_10948002 Ga0075433_109480022 111
138 3300006871 Ga0075434_100047404 Ga0075434_1000474042 111
139 3300006871 Ga0075434_100119458 Ga0075434_1001194582 111
140 3300006871 Ga0075434_101562038 Ga0075434_1015620382 111
141 3300006880 Ga0075429_100100535 Ga0075429_1001005354 111
142 3300006881 Ga0068865_100073079 Ga0068865_1000730792 111
143 3300006881 Ga0068865_100681850 Ga0068865_1006818502 111
144 3300006881 Ga0068865_100724343 Ga0068865_1007243432 111
145 3300006881 Ga0068865_101795990 Ga0068865_1017959902 111
146 3300006914 Ga0075436_100184107 Ga0075436_1001841072 111
147 3300006914 Ga0075436_100275520 Ga0075436_1002755202 111
148 3300006931 Ga0097620_101474986 Ga0097620_1014749862 111
149 3300006946 Ga0079104_1000075 Ga0079104_100007562 111
150 3300006946 Ga0079104_1000201 Ga0079104_100020117 111
151 3300006946 Ga0079104_1000365 Ga0079104_100036520 111
152 3300006946 Ga0079104_1000393 Ga0079104_100039336 111
153 3300006946 Ga0079104_1000633 Ga0079104_100063317 111
154 3300006946 Ga0079104_1004575 Ga0079104_10045756 111
155 3300006946 Ga0079104_1014486 Ga0079104_10144862 111
156 3300006946 Ga0079104_1093474 Ga0079104_10934742 111
157 3300006946 Ga0079104_1109260 Ga0079104_11092601 111
158 3300007076 Ga0075435_100745732 Ga0075435_1007457322 111
159 3300007265 Ga0099794_10007400 Ga0099794_100074002 111
160 3300007265 Ga0099794_10048093 Ga0099794_100480934 111
161 3300009011 Ga0105251_10000059 Ga0105251_1000005924 111
162 3300009011 Ga0105251_10000095 Ga0105251_1000009525 111
163 3300009011 Ga0105251_10001934 Ga0105251_100019348 111
164 3300009011 Ga0105251_10002308 Ga0105251_1000230810 111
165 3300009011 Ga0105251_10004319 Ga0105251_100043199 111
166 3300009011 Ga0105251_10013853 Ga0105251_100138536 111
167 3300009011 Ga0105251_10039845 Ga0105251_100398452 111
168 3300009036 Ga0105244_10000492 Ga0105244_100004927 111
169 3300009036 Ga0105244_10009735 Ga0105244_100097352 111
170 3300009036 Ga0105244_10016161 Ga0105244_100161612 111
171 3300009036 Ga0105244_10023125 Ga0105244_100231252 111
172 3300009036 Ga0105244_10179570 Ga0105244_101795702 111
173 3300009092 Ga0105250_10001437 Ga0105250_100014376 111
174 3300009092 Ga0105250_10003023 Ga0105250_100030236 111
175 3300009092 Ga0105250_10003263 Ga0105250_100032637 111
176 3300009092 Ga0105250_10014289 Ga0105250_100142892 111
177 3300009092 Ga0105250_10064963 Ga0105250_100649632 111
178 3300009092 Ga0105250_10406285 Ga0105250_104062852 111
179 3300009093 Ga0105240_10603666 Ga0105240_106036663 111
180 3300009093 Ga0105240_12058803 Ga0105240_120588031 111
181 3300009094 Ga0111539_10001926 Ga0111539_1000192612 111
182 3300009098 Ga0105245_10063400 Ga0105245_100634004 111
183 3300009098 Ga0105245_10346774 Ga0105245_103467742 111
184 3300009101 Ga0105247_10000048 Ga0105247_1000004825 111
185 3300009147 Ga0114129_12086825 Ga0114129_120868253 111
186 3300009148 Ga0105243_10390554 Ga0105243_103905542 111
187 3300009148 Ga0105243_10461327 Ga0105243_104613272 111
188 3300009148 Ga0105243_10834870 Ga0105243_108348702 111
189 3300009174 Ga0105241_10000011 Ga0105241_10000011139 111
190 3300009174 Ga0105241_10485221 Ga0105241_104852212 111
191 3300009174 Ga0105241_10705625 Ga0105241_107056253 111
192 3300009174 Ga0105241_11987294 Ga0105241_119872942 111
193 3300009176 Ga0105242_10004829 Ga0105242_1000482912 111
194 3300009176 Ga0105242_10058987 Ga0105242_100589872 111
195 3300009176 Ga0105242_10079008 Ga0105242_100790083 111
196 3300009176 Ga0105242_10275254 Ga0105242_102752542 111
197 3300009176 Ga0105242_10421353 Ga0105242_104213533 111
198 3300009176 Ga0105242_10717925 Ga0105242_107179252 111
199 3300009176 Ga0105242_11110735 Ga0105242_111107352 111
200 3300009176 Ga0105242_12175794 Ga0105242_121757942 111
201 3300009177 Ga0105248_10017686 Ga0105248_100176867 111
202 3300009177 Ga0105248_10571757 Ga0105248_105717572 111
203 3300009177 Ga0105248_10834109 Ga0105248_108341092 111
204 3300009551 Ga0105238_10298441 Ga0105238_102984412 111
205 3300009551 Ga0105238_10382073 Ga0105238_103820732 111
206 3300009982 Ga0105147_105402 Ga0105147_1054022 111
207 3300010375 Ga0105239_10782256 Ga0105239_107822563 111
208 3300013100 Ga0157373_10081290 Ga0157373_100812903 111
209 3300013100 Ga0157373_10081315 Ga0157373_100813152 111
210 3300013102 Ga0157371_10145974 Ga0157371_101459743 111
211 3300013102 Ga0157371_11189844 Ga0157371_111898442 111
212 3300013104 Ga0157370_10036610 Ga0157370_100366104 111
213 3300013104 Ga0157370_10860115 Ga0157370_108601151 111
214 3300013104 Ga0157370_11011251 Ga0157370_110112512 111
215 3300013105 Ga0157369_10117752 Ga0157369_101177523 111
216 3300013105 Ga0157369_10182804 Ga0157369_101828043 111
217 3300013296 Ga0157374_10000104 Ga0157374_1000010445 111
218 3300013296 Ga0157374_10293378 Ga0157374_102933782 111
219 3300013296 Ga0157374_11071054 Ga0157374_110710542 111
220 3300013297 Ga0157378_10044245 Ga0157378_100442454 111
221 3300013297 Ga0157378_10180762 Ga0157378_101807622 111
222 3300013297 Ga0157378_11332658 Ga0157378_113326582 111
223 3300013306 Ga0163162_10120065 Ga0163162_101200653 111
224 3300013306 Ga0163162_10167337 Ga0163162_101673372 111
225 3300013306 Ga0163162_10790689 Ga0163162_107906893 111
226 3300013307 Ga0157372_10002107 Ga0157372_100021078 111
227 3300013307 Ga0157372_10082577 Ga0157372_100825773 111
228 3300013307 Ga0157372_10186523 Ga0157372_101865232 111
229 3300013307 Ga0157372_12952868 Ga0157372_129528681 111
230 3300013308 Ga0157375_10025335 Ga0157375_100253356 111
231 3300013308 Ga0157375_11815739 Ga0157375_118157392 111
232 3300014325 Ga0163163_11904632 Ga0163163_119046321 111
233 3300014326 Ga0157380_11008574 Ga0157380_110085742 111
234 3300014326 Ga0157380_12342514 Ga0157380_123425142 111
235 3300014497 Ga0182008_10005391 Ga0182008_100053912 111
236 3300014497 Ga0182008_10039474 Ga0182008_100394742 111
237 3300014968 Ga0157379_10022492 Ga0157379_100224926 111
238 3300014968 Ga0157379_10057239 Ga0157379_100572394 111
239 3300014969 Ga0157376_10063556 Ga0157376_100635563 111
240 3300014969 Ga0157376_10098142 Ga0157376_100981424 111
241 3300014969 Ga0157376_10098918 Ga0157376_100989183 111
242 3300014969 Ga0157376_10373060 Ga0157376_103730602 111
243 3300014969 Ga0157376_10388863 Ga0157376_103888633 111
244 3300014969 Ga0157376_10486419 Ga0157376_104864193 111
245 3300015261 Ga0182006_1000024 Ga0182006_1000024172 111
246 3300015261 Ga0182006_1027678 Ga0182006_10276783 111
247 3300015261 Ga0182006_1052496 Ga0182006_10524963 111
248 3300015262 Ga0182007_10003840 Ga0182007_100038404 111
249 3300015265 Ga0182005_1011700 Ga0182005_10117002 111
250 3300016635 Ga0183361_10006 Ga0183361_10006291 111
251 3300017792 Ga0163161_10000005 Ga0163161_10000005159 111
252 3300017792 Ga0163161_11324204 Ga0163161_113242042 111
253 3300017792 Ga0163161_12100340 Ga0163161_121003401 111
254 3300021361 Ga0213872_10107994 Ga0213872_101079942 111
255 3300021384 Ga0213876_10000065 Ga0213876_1000006570 111
256 3300021384 Ga0213876_10096216 Ga0213876_100962162 111
257 3300025206 Ga0209435_101932 Ga0209435_1019322 111
258 3300025226 Ga0209674_100005 Ga0209674_100005722 111
259 3300025226 Ga0209674_100240 Ga0209674_10024023 111
260 3300025228 Ga0209672_100001 Ga0209672_1000011185 111
261 3300025228 Ga0209672_100023 Ga0209672_10002385 111
262 3300025229 Ga0209147_100001 Ga0209147_1000011185 111
263 3300025229 Ga0209147_100127 Ga0209147_100127103 111
264 3300025230 Ga0209563_102559 Ga0209563_1025592 111
265 3300025231 Ga0207427_102173 Ga0207427_1021736 111
266 3300025242 Ga0209258_100001 Ga0209258_1000011185 111
267 3300025242 Ga0209258_100134 Ga0209258_10013469 111
268 3300025245 Ga0207425_1008165 Ga0207425_10081652 111
269 3300025253 Ga0209677_112110 Ga0209677_1121102 111
270 3300025254 Ga0209148_1000003 Ga0209148_10000031185 111
271 3300025256 Ga0209759_1000152 Ga0209759_100015291 111
272 3300025256 Ga0209759_1000405 Ga0209759_100040513 111
273 3300025258 Ga0209129_1000104 Ga0209129_100010450 111
274 3300025261 Ga0209233_1000016 Ga0209233_1000016143 111
275 3300025272 Ga0209455_1000001 Ga0209455_10000011185 111
276 3300025272 Ga0209455_1011566 Ga0209455_10115663 111
277 3300025321 Ga0207656_10016168 Ga0207656_100161682 111
278 3300025711 Ga0207696_1000039 Ga0207696_1000039135 111
279 3300025711 Ga0207696_1000166 Ga0207696_100016684 111
280 3300025711 Ga0207696_1001162 Ga0207696_10011623 111
281 3300025711 Ga0207696_1003316 Ga0207696_10033166 111
282 3300025711 Ga0207696_1011571 Ga0207696_10115714 111
283 3300025728 Ga0207655_1000062 Ga0207655_1000062191 111
284 3300025728 Ga0207655_1000078 Ga0207655_100007875 111
285 3300025728 Ga0207655_1000199 Ga0207655_100019965 111
286 3300025728 Ga0207655_1020086 Ga0207655_10200863 111
287 3300025735 Ga0207713_1000069 Ga0207713_1000069122 111
288 3300025735 Ga0207713_1000086 Ga0207713_1000086119 111
289 3300025735 Ga0207713_1000180 Ga0207713_100018027 111
290 3300025735 Ga0207713_1000202 Ga0207713_100020261 111
291 3300025735 Ga0207713_1004002 Ga0207713_10040029 111
292 3300025735 Ga0207713_1012628 Ga0207713_10126283 111
293 3300025735 Ga0207713_1027207 Ga0207713_10272072 111
294 3300025735 Ga0207713_1035423 Ga0207713_10354232 111
295 3300025893 Ga0207682_10077951 Ga0207682_100779512 111
296 3300025899 Ga0207642_10167385 Ga0207642_101673853 111
297 3300025900 Ga0207710_10000026 Ga0207710_10000026119 111
298 3300025904 Ga0207647_10066910 Ga0207647_100669102 111
299 3300025905 Ga0207685_10019276 Ga0207685_100192764 111
300 3300025906 Ga0207699_10472355 Ga0207699_104723551 111
301 3300025909 Ga0207705_10133856 Ga0207705_101338562 111
302 3300025909 Ga0207705_10430727 Ga0207705_104307273 111
303 3300025911 Ga0207654_10000012 Ga0207654_10000012139 111
304 3300025911 Ga0207654_10357299 Ga0207654_103572992 111
305 3300025911 Ga0207654_10455448 Ga0207654_104554482 111
306 3300025912 Ga0207707_10773859 Ga0207707_107738592 111
307 3300025915 Ga0207693_10292339 Ga0207693_102923392 111
308 3300025916 Ga0207663_10554751 Ga0207663_105547512 111
309 3300025918 Ga0207662_10145402 Ga0207662_101454023 111
310 3300025919 Ga0207657_10060755 Ga0207657_100607552 111
311 3300025920 Ga0207649_10123796 Ga0207649_101237962 111
312 3300025925 Ga0207650_10321606 Ga0207650_103216062 111
313 3300025926 Ga0207659_10351592 Ga0207659_103515923 111
314 3300025926 Ga0207659_10361840 Ga0207659_103618403 111
315 3300025927 Ga0207687_10137966 Ga0207687_101379662 111
316 3300025927 Ga0207687_10184419 Ga0207687_101844193 111
317 3300025928 Ga0207700_10009038 Ga0207700_100090388 111
318 3300025932 Ga0207690_10732823 Ga0207690_107328232 111
319 3300025932 Ga0207690_11004835 Ga0207690_110048352 111
320 3300025934 Ga0207686_10042151 Ga0207686_100421512 111
321 3300025934 Ga0207686_10112937 Ga0207686_101129372 111
322 3300025934 Ga0207686_10328903 Ga0207686_103289032 111
323 3300025934 Ga0207686_10334785 Ga0207686_103347852 111
324 3300025934 Ga0207686_10704913 Ga0207686_107049133 111
325 3300025934 Ga0207686_11291665 Ga0207686_112916651 111
326 3300025935 Ga0207709_10337687 Ga0207709_103376872 111
327 3300025936 Ga0207670_10091382 Ga0207670_100913824 111
328 3300025936 Ga0207670_10279859 Ga0207670_102798593 111
329 3300025937 Ga0207669_10619505 Ga0207669_106195052 111
330 3300025938 Ga0207704_10442878 Ga0207704_104428782 111
331 3300025938 Ga0207704_10670219 Ga0207704_106702192 111
332 3300025939 Ga0207665_10035734 Ga0207665_100357346 111
333 3300025939 Ga0207665_10225755 Ga0207665_102257553 111
334 3300025941 Ga0207711_10064825 Ga0207711_100648254 111
335 3300025942 Ga0207689_10224307 Ga0207689_102243071 111
336 3300025942 Ga0207689_10939978 Ga0207689_109399782 111
337 3300025945 Ga0207679_10787968 Ga0207679_107879682 111
338 3300025945 Ga0207679_11807383 Ga0207679_118073832 111
339 3300025949 Ga0207667_10137351 Ga0207667_101373513 111
340 3300025960 Ga0207651_10093143 Ga0207651_100931433 111
341 3300025961 Ga0207712_11306774 Ga0207712_113067742 111
342 3300025961 Ga0207712_12133835 Ga0207712_121338352 111
343 3300025981 Ga0207640_10139703 Ga0207640_101397032 111
344 3300025986 Ga0207658_10098859 Ga0207658_100988592 111
345 3300026023 Ga0207677_10019019 Ga0207677_100190195 111
346 3300026023 Ga0207677_10273496 Ga0207677_102734963 111
347 3300026023 Ga0207677_10654926 Ga0207677_106549263 111
348 3300026023 Ga0207677_11577365 Ga0207677_115773652 111
349 3300026035 Ga0207703_10015754 Ga0207703_100157542 111
350 3300026035 Ga0207703_10599650 Ga0207703_105996503 111
351 3300026041 Ga0207639_10879783 Ga0207639_108797833 111
352 3300026067 Ga0207678_10072141 Ga0207678_100721414 111
353 3300026075 Ga0207708_10182101 Ga0207708_101821012 111
354 3300026088 Ga0207641_11644932 Ga0207641_116449322 111
355 3300026089 Ga0207648_10025902 Ga0207648_100259025 111
356 3300026089 Ga0207648_11599736 Ga0207648_115997362 111
357 3300026089 Ga0207648_11675424 Ga0207648_116754242 111
358 3300026095 Ga0207676_10901227 Ga0207676_109012272 111
359 3300026118 Ga0207675_100419074 Ga0207675_1004190744 111
360 3300026118 Ga0207675_101339691 Ga0207675_1013396912 111
361 3300026121 Ga0207683_10174639 Ga0207683_101746393 111
362 3300026121 Ga0207683_10693029 Ga0207683_106930291 111
363 3300026142 Ga0207698_10001058 Ga0207698_1000105815 111
364 3300027111 Ga0209281_1000004 Ga0209281_100000453 111
365 3300027111 Ga0209281_1000014 Ga0209281_100001463 111
366 3300027111 Ga0209281_1000079 Ga0209281_1000079159 111
367 3300027111 Ga0209281_1000142 Ga0209281_100014260 111
368 3300027111 Ga0209281_1000171 Ga0209281_100017163 111
369 3300027111 Ga0209281_1000184 Ga0209281_1000184122 111
370 3300027111 Ga0209281_1000901 Ga0209281_10009019 111
371 3300027111 Ga0209281_1001407 Ga0209281_10014079 111
372 3300027312 Ga0209371_1000015 Ga0209371_1000015571 111
373 3300027312 Ga0209371_1000221 Ga0209371_100022159 111
374 3300027312 Ga0209371_1000867 Ga0209371_10008677 111
375 3300027312 Ga0209371_1001808 Ga0209371_10018082 111
376 3300027312 Ga0209371_1006483 Ga0209371_10064833 111
377 3300027312 Ga0209371_1020569 Ga0209371_10205693 111
378 3300027312 Ga0209371_1022855 Ga0209371_10228552 111
379 3300027671 Ga0209588_1001752 Ga0209588_10017522 111
380 3300027695 Ga0209966_1011073 Ga0209966_10110732 111
381 3300027907 Ga0207428_10010038 Ga0207428_100100384 111
382 3300028379 Ga0268266_10000213 Ga0268266_1000021350 111
383 3300028379 Ga0268266_10052108 Ga0268266_100521082 111
384 3300028379 Ga0268266_10443332 Ga0268266_104433322 111
385 3300028380 Ga0268265_12113213 Ga0268265_121132131 111
386 3300028380 Ga0268265_12350815 Ga0268265_123508152 111
387 3300028381 Ga0268264_10346609 Ga0268264_103466092 111
388 3300028800 Ga0265338_10000437 Ga0265338_1000043724 111
389 3300030500 Ga0268256_1000018 Ga0268256_100001852 111
390 3300030500 Ga0268256_1000296 Ga0268256_100029640 111
391 3300030500 Ga0268256_1000482 Ga0268256_10004827 111
392 3300030500 Ga0268256_1009140 Ga0268256_10091404 111
393 3300030500 Ga0268256_1025000 Ga0268256_10250002 111
394 3300030500 Ga0268256_1025802 Ga0268256_10258023 111
395 3300031238 Ga0265332_10015178 Ga0265332_100151782 111
396 3300031250 Ga0265331_10025255 Ga0265331_100252553 111
397 3300031548 Ga0307408_100016005 Ga0307408_1000160054 111
398 3300031548 Ga0307408_100234393 Ga0307408_1002343932 111
399 3300031548 Ga0307408_101438142 Ga0307408_1014381422 111
400 3300031665 Ga0316575_10003170 Ga0316575_100031704 111
401 3300031665 Ga0316575_10073313 Ga0316575_100733132 111
402 3300031665 Ga0316575_10083176 Ga0316575_100831762 111
403 3300031665 Ga0316575_10383102 Ga0316575_103831021 111
404 3300031665 Ga0316575_10424041 Ga0316575_104240412 111
405 3300031691 Ga0316579_10000166 Ga0316579_1000016612 111
406 3300031691 Ga0316579_10001592 Ga0316579_100015926 111
407 3300031691 Ga0316579_10008011 Ga0316579_100080115 111
408 3300031691 Ga0316579_10071113 Ga0316579_100711132 111
409 3300031727 Ga0316576_10002247 Ga0316576_100022479 111
410 3300031727 Ga0316576_10020056 Ga0316576_100200563 111
411 3300031727 Ga0316576_10047234 Ga0316576_100472341 111
412 3300031727 Ga0316576_10150233 Ga0316576_101502334 111
413 3300031727 Ga0316576_10539590 Ga0316576_105395901 111
414 3300031728 Ga0316578_10007566 Ga0316578_100075662 111
415 3300031728 Ga0316578_10010365 Ga0316578_100103652 111
416 3300031728 Ga0316578_10011211 Ga0316578_100112116 111
417 3300031728 Ga0316578_10188720 Ga0316578_101887201 111
418 3300031728 Ga0316578_10203799 Ga0316578_102037991 111
419 3300031728 Ga0316578_10331464 Ga0316578_103314643 111
420 3300031728 Ga0316578_10404389 Ga0316578_104043892 111
421 3300031728 Ga0316578_10450724 Ga0316578_104507241 111
422 3300031728 Ga0316578_10788372 Ga0316578_107883721 111
423 3300031733 Ga0316577_10007349 Ga0316577_100073492 111
424 3300031733 Ga0316577_10025632 Ga0316577_100256323 111
425 3300031733 Ga0316577_10085194 Ga0316577_100851942 111
426 3300031733 Ga0316577_10090512 Ga0316577_100905122 111
427 3300031733 Ga0316577_10126628 Ga0316577_101266283 111
428 3300031733 Ga0316577_10156907 Ga0316577_101569072 111
429 3300031733 Ga0316577_10189202 Ga0316577_101892022 111
430 3300031733 Ga0316577_10208269 Ga0316577_102082692 111
431 3300031733 Ga0316577_10244551 Ga0316577_102445511 111
432 3300031733 Ga0316577_10333796 Ga0316577_103337962 111
433 3300031733 Ga0316577_10631675 Ga0316577_106316752 111
434 3300031824 Ga0307413_10185902 Ga0307413_101859022 111
435 3300031852 Ga0307410_10839006 Ga0307410_108390062 111
436 3300031901 Ga0307406_11736058 Ga0307406_117360582 111
437 3300031911 Ga0307412_10000008 Ga0307412_1000000856 111
438 3300031911 Ga0307412_10797864 Ga0307412_107978642 111
439 3300031911 Ga0307412_10975572 Ga0307412_109755722 111
440 3300031995 Ga0307409_100253454 Ga0307409_1002534542 111
441 3300031995 Ga0307409_101303169 Ga0307409_1013031691 111
442 3300032002 Ga0307416_100068522 Ga0307416_1000685224 111
443 3300032002 Ga0307416_100716091 Ga0307416_1007160912 111
444 3300032002 Ga0307416_100873333 Ga0307416_1008733332 111
445 3300032133 Ga0316583_10003546 Ga0316583_100035462 111
446 3300032133 Ga0316583_10003976 Ga0316583_100039765 111
447 3300032133 Ga0316583_10027667 Ga0316583_100276675 111
448 3300032133 Ga0316583_10069160 Ga0316583_100691602 111
449 3300032133 Ga0316583_10075684 Ga0316583_100756842 111
450 3300032133 Ga0316583_10077462 Ga0316583_100774623 111
451 3300032133 Ga0316583_10176418 Ga0316583_101764182 111
452 3300032137 Ga0316585_10000025 Ga0316585_1000002511 111
453 3300032137 Ga0316585_10041606 Ga0316585_100416062 111
454 3300032137 Ga0316585_10117994 Ga0316585_101179942 111
455 3300032139 Ga0316580_10001116 Ga0316580_1000111610 111
456 3300032139 Ga0316580_10010848 Ga0316580_100108482 111
457 3300032139 Ga0316580_10036841 Ga0316580_100368412 111
458 3300032139 Ga0316580_10082323 Ga0316580_100823231 111
459 3300032139 Ga0316580_10282659 Ga0316580_102826591 111
460 3300032168 Ga0316593_10000022 Ga0316593_100000229 111
461 3300032168 Ga0316593_10000063 Ga0316593_1000006310 111
462 3300032168 Ga0316593_10000189 Ga0316593_100001897 111
463 3300032168 Ga0316593_10000373 Ga0316593_100003739 111
464 3300032168 Ga0316593_10000378 Ga0316593_100003785 111
465 3300032168 Ga0316593_10000410 Ga0316593_100004104 111
466 3300032168 Ga0316593_10000534 Ga0316593_100005344 111
467 3300032168 Ga0316593_10000536 Ga0316593_100005367 111
468 3300032168 Ga0316593_10000714 Ga0316593_100007145 111
469 3300032168 Ga0316593_10000847 Ga0316593_100008477 111
470 3300032168 Ga0316593_10006179 Ga0316593_100061794 111
471 3300032168 Ga0316593_10009179 Ga0316593_100091792 111
472 3300032168 Ga0316593_10010401 Ga0316593_100104012 111
473 3300032168 Ga0316593_10011638 Ga0316593_100116382 111
474 3300032168 Ga0316593_10011695 Ga0316593_100116952 111
475 3300032168 Ga0316593_10015438 Ga0316593_100154382 111
476 3300032168 Ga0316593_10031057 Ga0316593_100310572 111
477 3300032168 Ga0316593_10039047 Ga0316593_100390473 111
478 3300032168 Ga0316593_10046365 Ga0316593_100463652 111
479 3300032168 Ga0316593_10073690 Ga0316593_100736902 111
480 3300032168 Ga0316593_10173446 Ga0316593_101734462 111
481 3300032168 Ga0316593_10316729 Ga0316593_103167292 111
482 3300032168 Ga0316593_10322666 Ga0316593_103226662 111
483 3300033524 Ga0316592_1155182 Ga0316592_11551821 111
484 3300033527 Ga0316586_1033341 Ga0316586_10333412 111
485 3300033527 Ga0316586_1075717 Ga0316586_10757172 111
486 3300033541 Ga0316596_1000357 Ga0316596_10003572 111
487 3300033541 Ga0316596_1011271 Ga0316596_10112712 111
488 3300033541 Ga0316596_1013554 Ga0316596_10135542 111
489 3300033541 Ga0316596_1027389 Ga0316596_10273893 111
490 3300033541 Ga0316596_1029345 Ga0316596_10293452 111
491 3300033541 Ga0316596_1038833 Ga0316596_10388332 111
492 3300033541 Ga0316596_1074651 Ga0316596_10746511 111
493 3300033541 Ga0316596_1133759 Ga0316596_11337591 111
494 3300033541 Ga0316596_1207472 Ga0316596_12074721 111
495 3300034816 Ga0373930_0094254 Ga0373930_0094254_319_660 111
496 3300034957 Ga0373938_0079650 Ga0373938_0079650_51_389 111
497 3300035086 Ga0373934_0026886 Ga0373934_0026886_422_760 111
498 3300035086 Ga0373934_0061966 Ga0373934_0061966_728_1069 111
499 3300035091 Ga0373951_0175613 Ga0373951_0175613_41_379 111
500 3300035111 Ga0373923_0041195 Ga0373923_0041195_776_1114 111
501 3300035112 Ga0373932_0292692 Ga0373932_0292692_166_507 111
502 3300035113 Ga0373936_0263778 Ga0373936_0263778_198_536 111
503 3300035113 Ga0373936_0476353 Ga0373936_0476353_201_542 111
504 3300035117 Ga0373953_0068844 Ga0373953_0068844_409_750 111
505 3300035118 Ga0373954_0196606 Ga0373954_0196606_402_740 111
506 3300035119 Ga0373956_0000024 Ga0373956_0000024_24451_24792 111
507 3300035119 Ga0373956_0017108 Ga0373956_0017108_2483_2821 111
508 3300035170 Ga0373943_0366924 Ga0373943_0366924_194_532 111
509 3300035170 Ga0373943_0389702 Ga0373943_0389702_230_571 111
510 3300035171 Ga0373946_0080067 Ga0373946_0080067_971_1309 111
511 3300035171 Ga0373946_0456464 Ga0373946_0456464_202_543 111
512 3300035171 Ga0373946_0750237 Ga0373946_0750237_32_373 111
513 3300035172 Ga0373955_0016875 Ga0373955_0016875_2113_2454 111
514 3300035172 Ga0373955_0394464 Ga0373955_0394464_171_509 111
515 3300035172 Ga0373955_0675983 Ga0373955_0675983_123_464 111
516 3300035242 Ga0373962_0121263 Ga0373962_0121263_107_445 111
517 3300035398 Ga0316574_0000748 Ga0316574_0000748_13233_13571 111
518 3300035398 Ga0316574_0001967 Ga0316574_0001967_6683_7021 111
519 3300035398 Ga0316574_0004868 Ga0316574_0004868_5279_5617 111
520 3300035398 Ga0316574_0006357 Ga0316574_0006357_216_554 111
521 3300035398 Ga0316574_0019010 Ga0316574_0019010_3654_3992 111
522 3300035398 Ga0316574_0026509 Ga0316574_0026509_57_395 111
523 3300035398 Ga0316574_0072040 Ga0316574_0072040_450_788 111
524 3300035398 Ga0316574_0096801 Ga0316574_0096801_779_1117 111
525 3300035398 Ga0316574_0112688 Ga0316574_0112688_993_1385 111
526 3300035398 Ga0316574_0117769 Ga0316574_0117769_567_905 111
527 3300035398 Ga0316574_0149683 Ga0316574_0149683_882_1220 111
528 3300035398 Ga0316574_0171803 Ga0316574_0171803_961_1299 111
529 3300035398 Ga0316574_0223115 Ga0316574_0223115_822_1160 111
530 3300035398 Ga0316574_0229180 Ga0316574_0229180_469_807 111
531 3300035398 Ga0316574_0353425 Ga0316574_0353425_395_733 111
532 3300035398 Ga0316574_0354581 Ga0316574_0354581_482_820 111
533 3300035398 Ga0316574_0387049 Ga0316574_0387049_477_815 111
534 3300035398 Ga0316574_0651368 Ga0316574_0651368_11_349 111
535 3300035398 Ga0316574_0672537 Ga0316574_0672537_88_426 111
536 3300035410 Ga0373924_0011697 Ga0373924_0011697_2766_3107 111
537 3300035691 Ga0373931_0154429 Ga0373931_0154429_452_793 111
538 3300035691 Ga0373931_0171989 Ga0373931_0171989_730_1071 111
539 3300035691 Ga0373931_0649595 Ga0373931_0649595_176_517 111
540 3300035692 Ga0373935_0403092 Ga0373935_0403092_199_537 111
541 3300035692 Ga0373935_0872395 Ga0373935_0872395_17_355 111
542 3300035692 Ga0373935_1372708 Ga0373935_1372708_176_517 111
543 3300035695 Ga0373927_0095027 Ga0373927_0095027_768_1106 111
544 3300035724 Ga0373933_0001797 Ga0373933_0001797_3092_3433 111
545 3300035724 Ga0373933_0625137 Ga0373933_0625137_199_537 111
546 3300035725 Ga0373947_0133470 Ga0373947_0133470_315_653 111
547 3300035725 Ga0373947_0555010 Ga0373947_0555010_309_650 111
548 3300036401 Ga0373937_0071339 Ga0373937_0071339_1847_2188 111
549 3300036401 Ga0373937_0538608 Ga0373937_0538608_189_530 111
550 3300036401 Ga0373937_0549442 Ga0373937_0549442_452_790 111
551 3300036401 Ga0373937_0833286 Ga0373937_0833286_409_747 111
552 3300036647 Ga0316582_0000356 Ga0316582_0000356_9011_9349 111
553 3300036647 Ga0316582_0001138 Ga0316582_0001138_6205_6543 111
554 3300036647 Ga0316582_0003304 Ga0316582_0003304_2049_2387 111
555 3300036647 Ga0316582_0003393 Ga0316582_0003393_3576_3914 111
556 3300036647 Ga0316582_0008678 Ga0316582_0008678_3757_4095 111
557 3300036647 Ga0316582_0037790 Ga0316582_0037790_691_1029 111
558 3300036647 Ga0316582_0040423 Ga0316582_0040423_2030_2368 111
559 3300036647 Ga0316582_0066343 Ga0316582_0066343_1174_1512 111
560 3300036647 Ga0316582_0088588 Ga0316582_0088588_1437_1775 111
561 3300036647 Ga0316582_0092240 Ga0316582_0092240_355_693 111
562 3300036647 Ga0316582_0116838 Ga0316582_0116838_30_368 111
563 3300036647 Ga0316582_0145162 Ga0316582_0145162_261_599 111
564 3300036647 Ga0316582_0154190 Ga0316582_0154190_502_840 111
565 3300036647 Ga0316582_0211340 Ga0316582_0211340_139_477 111
566 3300036647 Ga0316582_0237126 Ga0316582_0237126_156_494 111
567 3300036647 Ga0316582_0276998 Ga0316582_0276998_240_578 111
568 3300036647 Ga0316582_0434745 Ga0316582_0434745_380_718 111
569 3300036647 Ga0316582_0443962 Ga0316582_0443962_367_705 111
570 3300036647 Ga0316582_0651361 Ga0316582_0651361_375_713 111
571 3300036647 Ga0316582_0741101 Ga0316582_0741101_155_493 111
572 3300036712 Ga0316584_0003189 Ga0316584_0003189_6205_6543 111
573 3300036712 Ga0316584_0003517 Ga0316584_0003517_8572_8910 111
574 3300036712 Ga0316584_0005698 Ga0316584_0005698_954_1292 111
575 3300036712 Ga0316584_0005825 Ga0316584_0005825_3015_3353 111
576 3300036712 Ga0316584_0022402 Ga0316584_0022402_3024_3362 111
577 3300036712 Ga0316584_0076465 Ga0316584_0076465_1441_1779 111
578 3300036712 Ga0316584_0094405 Ga0316584_0094405_543_881 111
579 3300036712 Ga0316584_0138016 Ga0316584_0138016_70_408 111
580 3300036712 Ga0316584_0585754 Ga0316584_0585754_20_358 111
581 3300036712 Ga0316584_0965838 Ga0316584_0965838_188_526 111
582 3300036712 Ga0316584_1146010 Ga0316584_1146010_58_396 111
583 3300036712 Ga0316584_1200895 Ga0316584_1200895_13_351 111
584 3300037068 Ga0373925_0086034 Ga0373925_0086034_217_558 111
585 3300037068 Ga0373925_0211615 Ga0373925_0211615_647_985 111
586 3300037471 Ga0395905_0000050 Ga0395905_0000050_75089_75430 111
587 3300037588 Ga0316581_0029303 Ga0316581_0029303_436_774 111
588 3300037588 Ga0316581_0031542 Ga0316581_0031542_233_571 111
589 3300037588 Ga0316581_0143840 Ga0316581_0143840_381_719 111
590 3300038725 Ga0400484_24412 Ga0400484_24412_454_792 111
591 3300038725 Ga0400484_38179 Ga0400484_38179_616_954 111
592 3300038726 Ga0400490_11517 Ga0400490_11517_29_367 111
593 3300038726 Ga0400490_13120 Ga0400490_13120_29_367 111
594 3300038726 Ga0400490_18522 Ga0400490_18522_1474_1812 111
595 3300038726 Ga0400490_22126 Ga0400490_22126_2442_2780 111
596 3300038726 Ga0400490_23950 Ga0400490_23950_12469_12807 111
597 3300038726 Ga0400490_30842 Ga0400490_30842_3483_3821 111
598 3300038726 Ga0400490_48844 Ga0400490_48844_2411_2749 111
599 3300038727 Ga0400491_01922 Ga0400491_01922_471_809 111
600 3300038727 Ga0400491_24888 Ga0400491_24888_13_351 111
601 3300038735 Ga0400485_14652 Ga0400485_14652_105502_105840 111
602 3300038735 Ga0400485_17084 Ga0400485_17084_182_520 111
603 3300038735 Ga0400485_19195 Ga0400485_19195_2344_2682 111
604 3300038741 Ga0400488_17899 Ga0400488_17899_2180_2518 111
605 3300038741 Ga0400488_18723 Ga0400488_18723_294_632 111
606 3300038741 Ga0400488_34854 Ga0400488_34854_605_943 111
607 3300038741 Ga0400488_45757 Ga0400488_45757_547_885 111
608 3300038741 Ga0400488_48988 Ga0400488_48988_969_1307 111
609 3300038741 Ga0400488_62546 Ga0400488_62546_2669_3007 111
610 3300038742 Ga0400486_01330 Ga0400486_01330_18258_18596 111
611 3300038742 Ga0400486_08001 Ga0400486_08001_1033_1371 111
612 3300038742 Ga0400486_26876 Ga0400486_26876_714_1052 111
613 3300038742 Ga0400486_31436 Ga0400486_31436_3345_3683 111
614 3300039062 Ga0400483_023047 Ga0400483_023047_1690_2028 111
615 3300039062 Ga0400483_023048 Ga0400483_023048_1929_2267 111
616 3300039062 Ga0400483_068582 Ga0400483_068582_7620_7958 111
617 3300039062 Ga0400483_068705 Ga0400483_068705_3427_3765 111
618 3300039062 Ga0400483_075161 Ga0400483_075161_57243_57581 111
619 3300039062 Ga0400483_076132 Ga0400483_076132_211_549 111
620 3300039062 Ga0400483_093628 Ga0400483_093628_6934_7272 111
621 3300039062 Ga0400483_105262 Ga0400483_105262_6266_6604 111
622 3300039062 Ga0400483_130844 Ga0400483_130844_6505_6843 111
623 3300039062 Ga0400483_152590 Ga0400483_152590_4370_4708 111
624 3300039062 Ga0400483_164381 Ga0400483_164381_1462_1800 111
625 3300039062 Ga0400483_171387 Ga0400483_171387_369_707 111
626 3300039062 Ga0400483_187275 Ga0400483_187275_2291_2629 111
627 3300039062 Ga0400483_218008 Ga0400483_218008_2465_2803 111
628 3300039062 Ga0400483_220571 Ga0400483_220571_447_785 111
629 3300039062 Ga0400483_239456 Ga0400483_239456_5450_5788 111
630 3300039062 Ga0400483_249287 Ga0400483_249287_982_1320 111
631 3300039062 Ga0400483_289306 Ga0400483_289306_3533_3871 111
632 3300039062 Ga0400483_291627 Ga0400483_291627_349_687 111
633 3300039093 Ga0400489_46000 Ga0400489_46000_2380_2718 111
634 3300039110 Ga0400487_02579 Ga0400487_02579_2115_2453 111
635 3300039110 Ga0400487_23468 Ga0400487_23468_5259_5597 111
636 3300039110 Ga0400487_34970 Ga0400487_34970_121022_121360 111
637 3300039110 Ga0400487_64287 Ga0400487_64287_1444_1782 111
638 3300039110 Ga0400487_65366 Ga0400487_65366_45646_45984 111
639 3300039437 Ga0436365_1585837 Ga0436365_1585837_635_976 111
640 3300039437 Ga0436365_1613017 Ga0436365_1613017_52773_53108 111
641 3300041405 Ga0439438_003058 Ga0439438_003058_3720_4055 111
642 3300041405 Ga0439438_019507 Ga0439438_019507_1292_1627 111
643 3300041406 Ga0439439_0107193 Ga0439439_0107193_400_744 111
644 3300041407 Ga0439447_159608 Ga0439447_159608_44_388 111
645 3300041411 Ga0439466_0042115 Ga0439466_0042115_379_714 111
646 3300041507 Ga0451851_0919370 Ga0451851_0919370_81_416 111
647 3300041512 Ga0451853_1858486 Ga0451853_1858486_5253_5588 111
648 3300042006 Ga0439432_007984 Ga0439432_007984_77_412 111
649 3300042006 Ga0439432_018173 Ga0439432_018173_1621_1956 111
650 3300042010 Ga0439452_000002 Ga0439452_000002_60073_60408 111
651 3300042010 Ga0439452_000036 Ga0439452_000036_52997_53332 111
652 3300042010 Ga0439452_000270 Ga0439452_000270_1954_2289 111
653 3300042136 Ga0450900_006194 Ga0450900_006194_409_744 111
654 3300042439 Ga0439464_0013001 Ga0439464_0013001_847_1182 111
655 3300042439 Ga0439464_0016542 Ga0439464_0016542_896_1231 111
656 3300042876 Ga0451577_0101028 Ga0451577_0101028_1648_1989 111
657 3300042876 Ga0451577_0246453 Ga0451577_0246453_58_396 111
658 3300042876 Ga0451577_0251020 Ga0451577_0251020_649_987 111
659 3300042876 Ga0451577_0531454 Ga0451577_0531454_298_639 111
660 3300042876 Ga0451577_0538398 Ga0451577_0538398_574_915 111
661 3300044712 Ga0453684_0000005 Ga0453684_0000005_314879_315229 111
662 3300044712 Ga0453684_0007382 Ga0453684_0007382_19900_20241 111
663 3300044712 Ga0453684_0264256 Ga0453684_0264256_1191_1532 111
664 3300044712 Ga0453684_0540007 Ga0453684_0540007_503_853 111
665 3300044712 Ga0453684_1033249 Ga0453684_1033249_415_762 111
666 3300045051 Ga0451576_0000461 Ga0451576_0000461_7258_7599 111
667 3300045051 Ga0451576_0066240 Ga0451576_0066240_2122_2475 111
668 3300045051 Ga0451576_0134068 Ga0451576_0134068_1367_1720 111
669 3300045051 Ga0451576_0171590 Ga0451576_0171590_1580_1918 111
670 3300045051 Ga0451576_0566285 Ga0451576_0566285_465_806 111
671 3300045051 Ga0451576_0864672 Ga0451576_0864672_34_381 111
672 3300045051 Ga0451576_0909564 Ga0451576_0909564_441_791 111
673 3300046453 Ga0495627_000433 Ga0495627_000433_32366_32701 111
674 3300046454 Ga0495592_0001313 Ga0495592_0001313_7714_8055 111
675 3300046454 Ga0495592_0035700 Ga0495592_0035700_835_1173 111
676 3300046454 Ga0495592_0076229 Ga0495592_0076229_695_1033 111
677 3300046454 Ga0495592_0087719 Ga0495592_0087719_1630_1971 111
678 3300046455 Ga0495603_0051535 Ga0495603_0051535_1783_2124 111
679 3300046457 Ga0495590_0005690 Ga0495590_0005690_569_910 111
680 3300046458 Ga0495591_000066 Ga0495591_000066_89380_89715 111
681 3300046458 Ga0495591_005751 Ga0495591_005751_1800_2141 111
682 3300046459 Ga0495629_0008262 Ga0495629_0008262_2988_3329 111
683 3300046459 Ga0495629_0009715 Ga0495629_0009715_5438_5779 111
684 3300046459 Ga0495629_0099939 Ga0495629_0099939_1362_1703 111
685 3300046460 Ga0495638_0005497 Ga0495638_0005497_5917_6252 111
686 3300046461 Ga0495641_0019820 Ga0495641_0019820_1828_2169 111
687 3300046461 Ga0495641_0024414 Ga0495641_0024414_1325_1666 111
688 3300046462 Ga0495651_0001164 Ga0495651_0001164_16184_16525 111
689 3300046462 Ga0495651_0003321 Ga0495651_0003321_5865_6206 111
690 3300046462 Ga0495651_0221737 Ga0495651_0221737_480_821 111
691 3300046462 Ga0495651_0435522 Ga0495651_0435522_50_391 111
692 3300046462 Ga0495651_0899396 Ga0495651_0899396_117_458 111
693 3300046463 Ga0495653_0001712 Ga0495653_0001712_1981_2322 111
694 3300046463 Ga0495653_0045461 Ga0495653_0045461_2870_3211 111
695 3300046463 Ga0495653_0064843 Ga0495653_0064843_1416_1754 111
696 3300046463 Ga0495653_0069955 Ga0495653_0069955_1323_1664 111
697 3300046471 Ga0495650_0000326 Ga0495650_0000326_31854_32189 111
698 3300046471 Ga0495650_0009064 Ga0495650_0009064_3212_3553 111
699 3300046471 Ga0495650_0013790 Ga0495650_0013790_788_1129 111
700 3300046472 Ga0495580_0001745 Ga0495580_0001745_16102_16443 111
701 3300046472 Ga0495580_0044244 Ga0495580_0044244_70_411 111
702 3300046472 Ga0495580_0088429 Ga0495580_0088429_536_874 111
703 3300046473 Ga0495582_0005561 Ga0495582_0005561_3699_4040 111
704 3300046473 Ga0495582_0144212 Ga0495582_0144212_925_1263 111
705 3300046474 Ga0495605_0007456 Ga0495605_0007456_1396_1737 111
706 3300046475 Ga0495639_0055350 Ga0495639_0055350_1071_1409 111
707 3300046476 Ga0495662_0036737 Ga0495662_0036737_790_1131 111
708 3300046476 Ga0495662_0044605 Ga0495662_0044605_115_456 111
709 3300046476 Ga0495662_0060251 Ga0495662_0060251_1460_1801 111
710 3300046476 Ga0495662_0093033 Ga0495662_0093033_946_1284 111
711 3300046477 Ga0495664_0003770 Ga0495664_0003770_3265_3606 111
712 3300046477 Ga0495664_0070366 Ga0495664_0070366_1165_1503 111
713 3300046477 Ga0495664_0106516 Ga0495664_0106516_236_577 111
714 3300046477 Ga0495664_0522093 Ga0495664_0522093_177_518 111
715 3300046499 Ga0495594_0085091 Ga0495594_0085091_1404_1745 111
716 3300046499 Ga0495594_0085339 Ga0495594_0085339_1022_1360 111
717 3300046500 Ga0495596_0009887 Ga0495596_0009887_2044_2385 111
718 3300046500 Ga0495596_0032104 Ga0495596_0032104_1196_1537 111
719 3300046507 Ga0495606_0002813 Ga0495606_0002813_3578_3919 111
720 3300046507 Ga0495606_0019929 Ga0495606_0019929_1406_1747 111
721 3300046507 Ga0495606_0028739 Ga0495606_0028739_1552_1893 111
722 3300046511 Ga0495608_0004176 Ga0495608_0004176_8927_9268 111
723 3300046511 Ga0495608_0026692 Ga0495608_0026692_2538_2879 111
724 3300046511 Ga0495608_0026754 Ga0495608_0026754_698_1039 111
725 3300046511 Ga0495608_0084657 Ga0495608_0084657_1233_1571 111
726 3300046512 Ga0495610_0014021 Ga0495610_0014021_2442_2783 111
727 3300046514 Ga0495618_0020240 Ga0495618_0020240_1016_1357 111
728 3300046514 Ga0495618_0106945 Ga0495618_0106945_1345_1683 111
729 3300046514 Ga0495618_0256069 Ga0495618_0256069_496_837 111
730 3300046515 Ga0495620_0019454 Ga0495620_0019454_2863_3198 111
731 3300046516 Ga0495628_0011513 Ga0495628_0011513_1982_2323 111
732 3300046516 Ga0495628_0029916 Ga0495628_0029916_2907_3248 111
733 3300046516 Ga0495628_0033225 Ga0495628_0033225_175_513 111
734 3300046516 Ga0495628_0065873 Ga0495628_0065873_1686_2027 111
735 3300046516 Ga0495628_0124454 Ga0495628_0124454_466_807 111
736 3300046516 Ga0495628_0367357 Ga0495628_0367357_562_900 111
737 3300046517 Ga0495630_0018171 Ga0495630_0018171_2530_2871 111
738 3300046517 Ga0495630_0053365 Ga0495630_0053365_1089_1430 111
739 3300046517 Ga0495630_0053406 Ga0495630_0053406_1125_1466 111
740 3300046517 Ga0495630_0263267 Ga0495630_0263267_867_1208 111
741 3300046517 Ga0495630_0686498 Ga0495630_0686498_109_447 111
742 3300046522 Ga0495643_0107211 Ga0495643_0107211_318_653 111
743 3300046522 Ga0495643_0126123 Ga0495643_0126123_446_787 111
744 3300046524 Ga0495648_0033444 Ga0495648_0033444_2052_2393 111
745 3300046524 Ga0495648_0036486 Ga0495648_0036486_2370_2711 111
746 3300046525 Ga0495663_0317091 Ga0495663_0317091_130_468 111
747 3300046526 Ga0495666_0001724 Ga0495666_0001724_2739_3080 111
748 3300046526 Ga0495666_0004045 Ga0495666_0004045_2909_3250 111
749 3300046526 Ga0495666_0014527 Ga0495666_0014527_2736_3077 111
750 3300046526 Ga0495666_0031606 Ga0495666_0031606_1647_1985 111
751 3300046529 Ga0495652_0019979 Ga0495652_0019979_2450_2791 111
752 3300046529 Ga0495652_0087237 Ga0495652_0087237_1042_1383 111
753 3300046529 Ga0495652_0092003 Ga0495652_0092003_1726_2067 111
754 3300046529 Ga0495652_0259508 Ga0495652_0259508_399_737 111
755 3300046529 Ga0495652_1122335 Ga0495652_1122335_105_446 111
756 3300046530 Ga0495654_0000964 Ga0495654_0000964_14535_14870 111
757 3300046530 Ga0495654_0016345 Ga0495654_0016345_2860_3195 111
758 3300046531 Ga0495665_0005305 Ga0495665_0005305_5829_6170 111
759 3300046531 Ga0495665_0006059 Ga0495665_0006059_5034_5375 111
760 3300046531 Ga0495665_0009459 Ga0495665_0009459_3675_4016 111
761 3300046531 Ga0495665_0063494 Ga0495665_0063494_598_936 111
762 3300046533 Ga0495640_0007608 Ga0495640_0007608_6419_6760 111
763 3300046533 Ga0495640_0010353 Ga0495640_0010353_4602_4943 111
764 3300046533 Ga0495640_0394283 Ga0495640_0394283_404_742 111
765 3300046535 Ga0495586_0004361 Ga0495586_0004361_5572_5913 111
766 3300046535 Ga0495586_0052836 Ga0495586_0052836_100_438 111
767 3300046535 Ga0495586_0151331 Ga0495586_0151331_731_1069 111
768 3300046536 Ga0495587_0000845 Ga0495587_0000845_11212_11553 111
769 3300046536 Ga0495587_0022745 Ga0495587_0022745_237_578 111
770 3300046536 Ga0495587_0053763 Ga0495587_0053763_1478_1816 111
771 3300046539 Ga0495621_0021458 Ga0495621_0021458_1169_1510 111
772 3300046542 Ga0495597_0001266 Ga0495597_0001266_17759_18094 111
773 3300046542 Ga0495597_0111126 Ga0495597_0111126_787_1128 111
774 3300046543 Ga0495645_0005078 Ga0495645_0005078_5681_6022 111
775 3300046543 Ga0495645_0060781 Ga0495645_0060781_938_1279 111
776 3300046543 Ga0495645_0600156 Ga0495645_0600156_283_621 111
777 3300046543 Ga0495645_0694729 Ga0495645_0694729_211_552 111
778 3300046557 Ga0495622_0087462 Ga0495622_0087462_548_886 111
779 3300046558 Ga0495633_0360525 Ga0495633_0360525_276_617 111
780 3300046559 Ga0495667_0047368 Ga0495667_0047368_1303_1644 111
781 3300046559 Ga0495667_0389617 Ga0495667_0389617_109_450 111
782 3300046642 Ga0495634_0005222 Ga0495634_0005222_3135_3476 111
783 3300046642 Ga0495634_0010809 Ga0495634_0010809_2748_3089 111
784 3300046642 Ga0495634_0014642 Ga0495634_0014642_1879_2220 111
785 3300046642 Ga0495634_0130899 Ga0495634_0130899_402_740 111
786 3300046660 Ga0495625_0002671 Ga0495625_0002671_17510_17845 111
787 3300046663 Ga0495635_0020425 Ga0495635_0020425_2887_3228 111
788 3300046663 Ga0495635_0023389 Ga0495635_0023389_1331_1672 111
789 3300046663 Ga0495635_0042769 Ga0495635_0042769_904_1245 111
790 3300046663 Ga0495635_0170115 Ga0495635_0170115_238_576 111
791 3300046665 Ga0495661_0017977 Ga0495661_0017977_3384_3725 111
792 3300046665 Ga0495661_0032063 Ga0495661_0032063_1494_1835 111
793 3300046674 Ga0495588_0029013 Ga0495588_0029013_1333_1668 111
794 3300046674 Ga0495588_0103118 Ga0495588_0103118_422_763 111
795 3300046675 Ga0495657_0011839 Ga0495657_0011839_3033_3374 111
796 3300046675 Ga0495657_0130660 Ga0495657_0130660_773_1114 111
797 3300046675 Ga0495657_0319775 Ga0495657_0319775_259_597 111
798 3300046678 Ga0495599_0018741 Ga0495599_0018741_1345_1686 111
799 3300046678 Ga0495599_0026148 Ga0495599_0026148_2563_2901 111
800 3300046678 Ga0495599_0045972 Ga0495599_0045972_546_884 111
801 3300046678 Ga0495599_0058244 Ga0495599_0058244_421_762 111
802 3300046678 Ga0495599_0546512 Ga0495599_0546512_70_411 111
803 3300046679 Ga0495623_0071830 Ga0495623_0071830_1673_2014 111
804 3300046679 Ga0495623_0216904 Ga0495623_0216904_232_573 111
805 3300046680 Ga0495646_0004507 Ga0495646_0004507_3220_3561 111
806 3300046680 Ga0495646_0021509 Ga0495646_0021509_1345_1686 111
807 3300046680 Ga0495646_0096810 Ga0495646_0096810_1217_1558 111
808 3300046681 Ga0495647_0028969 Ga0495647_0028969_1502_1840 111
809 3300046683 Ga0495658_0176625 Ga0495658_0176625_404_742 111
810 3300046684 Ga0495669_0126951 Ga0495669_0126951_628_969 111
811 3300046689 Ga0495613_0015752 Ga0495613_0015752_3423_3764 111
812 3300046689 Ga0495613_0020692 Ga0495613_0020692_2433_2774 111
813 3300046689 Ga0495613_0516682 Ga0495613_0516682_401_739 111
814 3300046690 Ga0495624_0020183 Ga0495624_0020183_3134_3475 111
815 3300046690 Ga0495624_0088756 Ga0495624_0088756_284_625 111
816 3300046690 Ga0495624_0118496 Ga0495624_0118496_964_1305 111
817 3300046690 Ga0495624_0130548 Ga0495624_0130548_854_1192 111
818 3300046690 Ga0495624_0544477 Ga0495624_0544477_156_494 111
819 3300046691 Ga0495670_0353466 Ga0495670_0353466_262_603 111
820 3300046694 Ga0495649_0001045 Ga0495649_0001045_2878_3213 111
821 3300046694 Ga0495649_0001390 Ga0495649_0001390_2817_3152 111
822 3300046694 Ga0495649_0006282 Ga0495649_0006282_3072_3413 111
823 3300046694 Ga0495649_0136022 Ga0495649_0136022_224_565 111
824 3300046694 Ga0495649_0325329 Ga0495649_0325329_67_405 111
825 3300046794 Ga0495589_0000032 Ga0495589_0000032_163622_163957 111
826 3300046794 Ga0495589_0022934 Ga0495589_0022934_1749_2090 111
827 3300046794 Ga0495589_0296103 Ga0495589_0296103_377_718 111
828 3300046809 Ga0495600_0015117 Ga0495600_0015117_4260_4601 111
829 3300046809 Ga0495600_0078879 Ga0495600_0078879_74_415 111
830 3300046809 Ga0495600_0109577 Ga0495600_0109577_166_507 111
831 3300046810 Ga0495660_0046599 Ga0495660_0046599_1308_1649 111
832 3300047315 Ga0495581_0001049 Ga0495581_0001049_12271_12612 111
833 3300047315 Ga0495581_0018271 Ga0495581_0018271_869_1210 111
834 3300047317 Ga0495604_0001474 Ga0495604_0001474_8999_9340 111
835 3300047317 Ga0495604_0018792 Ga0495604_0018792_4072_4413 111
836 3300047317 Ga0495604_0028929 Ga0495604_0028929_1161_1502 111
837 3300047317 Ga0495604_0046393 Ga0495604_0046393_1492_1830 111
838 3300047317 Ga0495604_0410842 Ga0495604_0410842_38_379 111
839 3300047319 Ga0495674_0032854 Ga0495674_0032854_1864_2205 111
840 3300047319 Ga0495674_0046785 Ga0495674_0046785_775_1116 111
841 3300047319 Ga0495674_0058935 Ga0495674_0058935_962_1303 111
842 3300047319 Ga0495674_0092710 Ga0495674_0092710_1670_2011 111
843 3300047319 Ga0495674_0338292 Ga0495674_0338292_610_948 111
844 3300047319 Ga0495674_1420440 Ga0495674_1420440_125_466 111
845 3300047320 Ga0495672_0000156 Ga0495672_0000156_32249_32584 111
846 3300047320 Ga0495672_0139772 Ga0495672_0139772_152_493 111
847 3300047321 Ga0495676_0045713 Ga0495676_0045713_845_1186 111
848 3300047321 Ga0495676_0048592 Ga0495676_0048592_34_375 111
849 3300047321 Ga0495676_0057991 Ga0495676_0057991_97_438 111
850 3300047322 Ga0495680_0006154 Ga0495680_0006154_8999_9340 111
851 3300047322 Ga0495680_0017184 Ga0495680_0017184_2202_2543 111
852 3300047322 Ga0495680_0068306 Ga0495680_0068306_1419_1760 111
853 3300047322 Ga0495680_0112126 Ga0495680_0112126_802_1140 111
854 3300047323 Ga0495683_0006981 Ga0495683_0006981_1494_1835 111
855 3300047443 Ga0495687_019977 Ga0495687_019977_440_781 111
856 3300047444 Ga0495675_0010643 Ga0495675_0010643_3151_3492 111
857 3300047444 Ga0495675_0020929 Ga0495675_0020929_1284_1625 111
858 3300047444 Ga0495675_0036406 Ga0495675_0036406_1319_1660 111
859 3300047446 Ga0495679_000195 Ga0495679_000195_1456_1791 111
860 3300047446 Ga0495679_001999 Ga0495679_001999_9102_9437 111
861 3300047446 Ga0495679_002765 Ga0495679_002765_6831_7172 111
862 3300047446 Ga0495679_006165 Ga0495679_006165_73_414 111
863 3300047470 Ga0495681_0131001 Ga0495681_0131001_481_816 111
864 3300047470 Ga0495681_0209986 Ga0495681_0209986_394_735 111
865 3300047471 Ga0495684_0156547 Ga0495684_0156547_275_616 111
866 3300047471 Ga0495684_0458328 Ga0495684_0458328_423_761 111
867 3300047472 Ga0495686_0000002 Ga0495686_0000002_537738_538079 111
868 3300047472 Ga0495686_0433351 Ga0495686_0433351_42_377 111
869 3300047673 Ga0495593_0008398 Ga0495593_0008398_4320_4661 111
870 3300047673 Ga0495593_0012038 Ga0495593_0012038_845_1186 111
871 3300048088 Ga0495602_0011608 Ga0495602_0011608_7797_8138 111
872 3300048088 Ga0495602_0044036 Ga0495602_0044036_1323_1664 111
873 3300048088 Ga0495602_0070335 Ga0495602_0070335_1810_2151 111
874 3300048088 Ga0495602_0083251 Ga0495602_0083251_71_412 111
875 3300048089 Ga0495614_0000826 Ga0495614_0000826_4094_4435 111
876 3300048089 Ga0495614_0003464 Ga0495614_0003464_1635_1976 111
877 3300048089 Ga0495614_0262032 Ga0495614_0262032_183_521 111
878 3300048091 Ga0495626_0087058 Ga0495626_0087058_23_364 111
879 3300048903 Ga0496100_0494036 Ga0496100_0494036_328_669 111
880 3300048904 Ga0496101_1025543 Ga0496101_1025543_146_487 111
881 3300048905 Ga0496102_0069517 Ga0496102_0069517_906_1247 111
882 3300048905 Ga0496102_1572291 Ga0496102_1572291_162_497 111
883 3300048906 Ga0496103_0021032 Ga0496103_0021032_151_492 111
884 3300048906 Ga0496103_0133620 Ga0496103_0133620_911_1246 111
885 3300048907 Ga0496104_0764620 Ga0496104_0764620_219_554 111
886 3300048908 Ga0496105_0799561 Ga0496105_0799561_221_565 111
887 3300048909 Ga0496106_0000023 Ga0496106_0000023_155158_155499 111
888 3300048913 Ga0496110_0177508 Ga0496110_0177508_1258_1602 111
889 3300048914 Ga0496111_0167246 Ga0496111_0167246_1187_1531 111
890 3300048915 Ga0496112_0501198 Ga0496112_0501198_92_433 111
891 3300048916 Ga0496113_0531412 Ga0496113_0531412_14_355 111
892 3300048918 Ga0496115_0457801 Ga0496115_0457801_104_445 111
893 3300048919 Ga0496116_0000007 Ga0496116_0000007_673502_673837 111
894 3300048919 Ga0496116_0003553 Ga0496116_0003553_1935_2270 111
895 3300048919 Ga0496116_0012961 Ga0496116_0012961_2556_2891 111
896 3300048920 Ga0496117_0003271 Ga0496117_0003271_16948_17283 111
897 3300048920 Ga0496117_0003856 Ga0496117_0003856_11944_12279 111
898 3300048920 Ga0496117_0019314 Ga0496117_0019314_2424_2759 111
899 3300048920 Ga0496117_0040958 Ga0496117_0040958_1859_2194 111
900 3300048920 Ga0496117_0075288 Ga0496117_0075288_528_869 111
901 3300048920 Ga0496117_0111359 Ga0496117_0111359_32_373 111
902 3300048920 Ga0496117_0164340 Ga0496117_0164340_162_497 111
903 3300048921 Ga0496118_0001700 Ga0496118_0001700_81_416 111
904 3300048921 Ga0496118_0001781 Ga0496118_0001781_11576_11917 111
905 3300048921 Ga0496118_0010415 Ga0496118_0010415_8790_9131 111
906 3300048921 Ga0496118_0021027 Ga0496118_0021027_1207_1542 111
907 3300048921 Ga0496118_0030452 Ga0496118_0030452_1744_2079 111
908 3300048921 Ga0496118_0053651 Ga0496118_0053651_2198_2533 111
909 3300048922 Ga0496119_0000013 Ga0496119_0000013_270713_271048 111
910 3300048922 Ga0496119_0001881 Ga0496119_0001881_4261_4596 111
911 3300048922 Ga0496119_0090294 Ga0496119_0090294_1129_1464 111
912 3300048923 Ga0496120_0003642 Ga0496120_0003642_1295_1630 111
913 3300048923 Ga0496120_0007320 Ga0496120_0007320_2041_2376 111
914 3300048923 Ga0496120_0020001 Ga0496120_0020001_3881_4216 111
915 3300048924 Ga0496121_0004540 Ga0496121_0004540_15244_15579 111
916 3300048924 Ga0496121_0005179 Ga0496121_0005179_1939_2280 111
917 3300048924 Ga0496121_0012769 Ga0496121_0012769_4396_4731 111
918 3300048924 Ga0496121_0066801 Ga0496121_0066801_605_940 111
919 3300048925 Ga0496122_0000619 Ga0496122_0000619_25956_26291 111
920 3300048925 Ga0496122_0000849 Ga0496122_0000849_19174_19509 111
921 3300048925 Ga0496122_0001669 Ga0496122_0001669_30460_30795 111
922 3300048925 Ga0496122_0123695 Ga0496122_0123695_269_604 111
923 3300048926 Ga0496123_0000012 Ga0496123_0000012_421959_422294 111
924 3300048926 Ga0496123_0001359 Ga0496123_0001359_30517_30852 111
925 3300048926 Ga0496123_0001875 Ga0496123_0001875_25954_26289 111
926 3300048926 Ga0496123_0112664 Ga0496123_0112664_1141_1482 111
927 3300048926 Ga0496123_0254332 Ga0496123_0254332_269_604 111
928 3300048927 Ga0496124_0000049 Ga0496124_0000049_132583_132918 111
929 3300048927 Ga0496124_0001722 Ga0496124_0001722_27074_27409 111
930 3300048927 Ga0496124_0028242 Ga0496124_0028242_1759_2094 111
931 3300048927 Ga0496124_0088620 Ga0496124_0088620_165_506 111
932 3300048927 Ga0496124_0467276 Ga0496124_0467276_80_415 111
933 3300048927 Ga0496124_0567361 Ga0496124_0567361_50_385 111
934 3300048927 Ga0496124_0839208 Ga0496124_0839208_35_370 111
935 3300048928 Ga0496125_0000405 Ga0496125_0000405_22567_22902 111
936 3300048928 Ga0496125_0046818 Ga0496125_0046818_1904_2239 111
937 3300048928 Ga0496125_0084257 Ga0496125_0084257_2033_2368 111
938 3300048929 Ga0496126_0000031 Ga0496126_0000031_220753_221094 111
939 3300048929 Ga0496126_0034302 Ga0496126_0034302_1663_1998 111
940 3300048929 Ga0496126_0078886 Ga0496126_0078886_817_1152 111
941 3300048929 Ga0496126_0372232 Ga0496126_0372232_361_696 111
942 3300048929 Ga0496126_1304420 Ga0496126_1304420_113_448 111
943 3300050491 nmdc:mga00v17_14683_c1 nmdc:mga00v17_14683_c1_2882_3217 111
944 3300050491 nmdc:mga00v17_2036_c1 nmdc:mga00v17_2036_c1_2704_3039 111
945 3300050491 nmdc:mga00v17_316684_c1 nmdc:mga00v17_316684_c1_286_627 111
946 3300050491 nmdc:mga00v17_689621_c1 nmdc:mga00v17_689621_c1_301_642 111
947 3300050491 nmdc:mga00v17_920272_c1 nmdc:mga00v17_920272_c1_155_490 111
948 3300050493 nmdc:mga0k408_834066_c1 nmdc:mga0k408_834066_c1_64_405 111
949 3300050493 nmdc:mga0k408_9476_c1 nmdc:mga0k408_9476_c1_2892_3233 111
950 3300050507 nmdc:mga05p37_1685756_c1 nmdc:mga05p37_1685756_c1_204_545 111
951 3300050508 nmdc:mga09592_887527_c1 nmdc:mga09592_887527_c1_161_502 111
952 3300050509 nmdc:mga0qj67_440290_c1 nmdc:mga0qj67_440290_c1_88_429 111
953 3300050511 nmdc:mga08y16_101458_c1 nmdc:mga08y16_101458_c1_1649_1990 111
954 3300050511 nmdc:mga08y16_1567005_c1 nmdc:mga08y16_1567005_c1_37_378 111
955 3300050512 nmdc:mga0n895_668864_c1 nmdc:mga0n895_668864_c1_118_459 111
956 3300050512 nmdc:mga0n895_771058_c1 nmdc:mga0n895_771058_c1_529_873 111
957 3300050515 nmdc:mga0a205_543073_c1 nmdc:mga0a205_543073_c1_468_809 111
958 3300050516 nmdc:mga0sz30_116226_c1 nmdc:mga0sz30_116226_c1_413_754 111
959 3300053077 Ga0495601_0007759 Ga0495601_0007759_2962_3303 111
960 3300053077 Ga0495601_0053564 Ga0495601_0053564_1427_1765 111
961 3300053077 Ga0495601_0146949 Ga0495601_0146949_775_1116 111
962 3300053078 Ga0495612_0049590 Ga0495612_0049590_800_1138 111
963 3300053084 Ga0495595_0021725 Ga0495595_0021725_2127_2468 111
964 3300053084 Ga0495595_0073949 Ga0495595_0073949_665_1003 111
965 3300053085 Ga0495619_0262169 Ga0495619_0262169_542_880 111
966 3300061719 Ga0466962_0428647 Ga0466962_0428647_74_415 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

35

117

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.9786 2 109
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.9697 2 109
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.9623 1 107
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.9368 1 107
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.8802 2 104
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.979 2 109 3.10.20.30
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9614 2 109 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8794 2 104 3.10.20.30
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8693 2 104 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8634 2 104 3.10.20.30

Feature Viewer

pLDDT pTM Quality
92.36 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map