F486973

General Info

Members Datasets Scaffolds Average Seq Length
965 356 965 155

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10336048|Ga0207687_103360482
Length 185
Sequence MKTAMRIKLTLFTRGGEPLTHAARRSTLSHMSAISLKVNGRTHMLDLDPATPLLYALSDDLELRGPKFGCGLGQCGSCTAIVNGTAVRSCVTPVSTVVGKDIVTLEGLGTPEKPHPIQKAFIDEQAAQCGFCLNGVILTAKAFLDKNPKASESEIQQALSGVLCRCFTHVRMQQAIQRYAKAVAK

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 5.28
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011361 3300001991 Bacteria 1603
2 JGI24750J21931_1003575 3300002070 Bacteria 1863
3 JGI24748J21848_1007802 3300002074 Bacteria 1256
4 JGI24738J21930_10007172 3300002075 Bacteria 2583
5 JGI24749J21850_1013147 3300002076 Bacteria 1162
6 JGI24744J21845_10002967 3300002077 Bacteria 3474
7 JGI24034J26672_10004889 3300002239 Bacteria 1909
8 Ga0065704_10098888 3300005289 Bacteria 2334
9 Ga0065704_10205451 3300005289 Bacteria 1129
10 Ga0065715_10005647 3300005293 Bacteria 4677
11 Ga0065715_10727806 3300005293 Bacteria 640
12 Ga0065715_10727857 3300005293 Bacteria 636
13 Ga0065707_10002482 3300005295 Bacteria 8591
14 Ga0065707_10246195 3300005295 Bacteria 1139
15 Ga0065707_10482911 3300005295 Bacteria 772
16 Ga0070676_10359797 3300005328 Bacteria 1003
17 Ga0070683_100003648 3300005329 Bacteria 12542
18 Ga0070683_100094505 3300005329 Bacteria 2810
19 Ga0070683_101256863 3300005329 Bacteria 712
20 Ga0070670_100007003 3300005331 Bacteria 9554
21 Ga0070670_100023624 3300005331 Bacteria 5291
22 Ga0070670_100048236 3300005331 Bacteria 3665
23 Ga0070670_100055058 3300005331 Bacteria 3414
24 Ga0068869_100037520 3300005334 Bacteria 3446
25 Ga0068869_100186003 3300005334 Bacteria 1631
26 Ga0068869_100601594 3300005334 Bacteria 929
27 Ga0068869_100880064 3300005334 Bacteria 774
28 Ga0068869_101077851 3300005334 Bacteria 702
29 Ga0070666_10005780 3300005335 Bacteria 7601
30 Ga0070666_10181488 3300005335 Bacteria 1476
31 Ga0070666_10233322 3300005335 Bacteria 1300
32 Ga0070682_100080773 3300005337 Bacteria 2103
33 Ga0070682_100110649 3300005337 Bacteria 1830
34 Ga0068868_100061736 3300005338 Bacteria 2969
35 Ga0068868_100089007 3300005338 Bacteria 2485
36 Ga0068868_101077290 3300005338 Bacteria 738
37 Ga0070660_100084758 3300005339 Bacteria 2491
38 Ga0070689_100006108 3300005340 Bacteria 8300
39 Ga0070689_100052234 3300005340 Bacteria 3161
40 Ga0070691_10063770 3300005341 Bacteria 1776
41 Ga0070691_10504666 3300005341 Bacteria 700
42 Ga0070687_100020271 3300005343 Bacteria 3106
43 Ga0070687_100049790 3300005343 Bacteria 2161
44 Ga0070687_100406041 3300005343 Bacteria 895
45 Ga0070661_100005776 3300005344 Bacteria 8513
46 Ga0070692_10002304 3300005345 Bacteria 7354
47 Ga0070692_10019608 3300005345 Bacteria 3266
48 Ga0070692_10035915 3300005345 Bacteria 2512
49 Ga0070692_10721997 3300005345 Bacteria 673
50 Ga0070668_100460564 3300005347 Bacteria 1095
51 Ga0070669_100000833 3300005353 Bacteria 22368
52 Ga0070669_100070078 3300005353 Bacteria 2591
53 Ga0070675_100000609 3300005354 Bacteria 24654
54 Ga0070675_100005913 3300005354 Bacteria 9371
55 Ga0070675_100104818 3300005354 Bacteria 2386
56 Ga0070675_100144567 3300005354 Bacteria 2035
57 Ga0070675_100527070 3300005354 Bacteria 1066
58 Ga0070671_100037506 3300005355 Bacteria 4019
59 Ga0070671_100074626 3300005355 Bacteria 2833
60 Ga0070671_100740254 3300005355 Bacteria 854
61 Ga0070674_100295969 3300005356 Bacteria 1288
62 Ga0070674_100902189 3300005356 Bacteria 770
63 Ga0070673_100011573 3300005364 Bacteria 6027
64 Ga0070673_100044170 3300005364 Bacteria 3449
65 Ga0070673_100472539 3300005364 Bacteria 1131
66 Ga0070673_100857731 3300005364 Bacteria 841
67 Ga0070688_100049487 3300005365 Bacteria 2615
68 Ga0070659_100170484 3300005366 Bacteria 1782
69 Ga0070667_100024923 3300005367 Bacteria 4969
70 Ga0070667_100353373 3300005367 Bacteria 1331
71 Ga0070703_10030035 3300005406 Bacteria 1635
72 Ga0070714_100221791 3300005435 Bacteria 1738
73 Ga0070714_100630850 3300005435 Bacteria 1031
74 Ga0070713_100068018 3300005436 Bacteria 3001
75 Ga0070713_100146057 3300005436 Bacteria 2100
76 Ga0070713_100393836 3300005436 Bacteria 1292
77 Ga0070713_100557764 3300005436 Bacteria 1085
78 Ga0070701_10004621 3300005438 Bacteria 5603
79 Ga0070701_10005760 3300005438 Bacteria 5153
80 Ga0070701_10028041 3300005438 Bacteria 2765
81 Ga0070701_10191699 3300005438 Bacteria 1203
82 Ga0070701_10381855 3300005438 Bacteria 888
83 Ga0070711_100025976 3300005439 Bacteria 3835
84 Ga0070705_100017489 3300005440 Bacteria 3743
85 Ga0070705_100068449 3300005440 Bacteria 2137
86 Ga0070705_100096918 3300005440 Bacteria 1852
87 Ga0070700_100034579 3300005441 Bacteria 3053
88 Ga0070700_100265026 3300005441 Bacteria 1239
89 Ga0070700_100438885 3300005441 Bacteria 990
90 Ga0070694_100010451 3300005444 Bacteria 5727
91 Ga0070694_100018066 3300005444 Bacteria 4469
92 Ga0070694_100030344 3300005444 Bacteria 3535
93 Ga0070694_100130780 3300005444 Bacteria 1813
94 Ga0070694_100133034 3300005444 Bacteria 1799
95 Ga0070694_100175000 3300005444 Bacteria 1583
96 Ga0070708_100056693 3300005445 Bacteria 3486
97 Ga0070708_100081314 3300005445 Bacteria 2933
98 Ga0070708_100329970 3300005445 Bacteria 1437
99 Ga0070708_100537228 3300005445 Bacteria 1103
100 Ga0070663_100886730 3300005455 Bacteria 770
101 Ga0070678_100403137 3300005456 Bacteria 1189
102 Ga0070678_100456831 3300005456 Unclassified 1120
103 Ga0070678_100663397 3300005456 Bacteria 937
104 Ga0070678_101185256 3300005456 Unclassified 708
105 Ga0070662_100107626 3300005457 Bacteria 2119
106 Ga0070662_100347711 3300005457 Bacteria 1214
107 Ga0070681_10009310 3300005458 Bacteria 9663
108 Ga0070681_10024462 3300005458 Bacteria 6080
109 Ga0070681_10710553 3300005458 Bacteria 921
110 Ga0070681_10768574 3300005458 Bacteria 880
111 Ga0070681_11055347 3300005458 Bacteria 733
112 Ga0068867_100000156 3300005459 Bacteria 43913
113 Ga0068867_100123668 3300005459 Bacteria 2002
114 Ga0068867_100186611 3300005459 Bacteria 1652
115 Ga0068867_100386555 3300005459 Bacteria 1177
116 Ga0070685_10121017 3300005466 Bacteria 1625
117 Ga0070706_100000006 3300005467 Bacteria 262251
118 Ga0070706_100021716 3300005467 Bacteria 5911
119 Ga0070706_100168199 3300005467 Bacteria 2047
120 Ga0070706_100315408 3300005467 Bacteria 1458
121 Ga0070706_100539001 3300005467 Unclassified 1085
122 Ga0070706_100592467 3300005467 Bacteria 1030
123 Ga0070706_100709004 3300005467 Bacteria 933
124 Ga0070707_100006432 3300005468 Bacteria 10918
125 Ga0070707_100016485 3300005468 Bacteria 6933
126 Ga0070707_100163529 3300005468 Bacteria 2169
127 Ga0070698_100005560 3300005471 Bacteria 13777
128 Ga0070698_100008137 3300005471 Bacteria 11336
129 Ga0070698_100070715 3300005471 Bacteria 3501
130 Ga0070698_100353804 3300005471 Bacteria 1400
131 Ga0070698_100653527 3300005471 Bacteria 993
132 Ga0070699_100007784 3300005518 Bacteria 9312
133 Ga0070699_100019523 3300005518 Bacteria 5838
134 Ga0070699_100037999 3300005518 Bacteria 4168
135 Ga0070699_100131116 3300005518 Bacteria 2210
136 Ga0070699_100160990 3300005518 Bacteria 1986
137 Ga0070699_100222791 3300005518 Bacteria 1681
138 Ga0070699_100255182 3300005518 Bacteria 1567
139 Ga0070699_100975958 3300005518 Unclassified 777
140 Ga0070684_100000593 3300005535 Bacteria 24951
141 Ga0070684_100205027 3300005535 Bacteria 1797
142 Ga0070684_100280532 3300005535 Bacteria 1526
143 Ga0070697_100005622 3300005536 Bacteria 9663
144 Ga0070697_100046992 3300005536 Bacteria 3500
145 Ga0070697_100076269 3300005536 Bacteria 2757
146 Ga0070697_100088380 3300005536 Bacteria 2559
147 Ga0070697_100959519 3300005536 Bacteria 759
148 Ga0068853_100065714 3300005539 Bacteria 3148
149 Ga0070672_100043045 3300005543 Bacteria 3479
150 Ga0070672_100077846 3300005543 Bacteria 2653
151 Ga0070672_100140013 3300005543 Bacteria 1995
152 Ga0070686_100243733 3300005544 Bacteria 1310
153 Ga0070686_100525837 3300005544 Bacteria 922
154 Ga0070686_100669873 3300005544 Bacteria 824
155 Ga0070695_100000076 3300005545 Bacteria 40234
156 Ga0070695_100092972 3300005545 Bacteria 2017
157 Ga0070695_100187772 3300005545 Unclassified 1469
158 Ga0070695_100268582 3300005545 Bacteria 1249
159 Ga0070695_101013655 3300005545 Bacteria 676
160 Ga0070695_101072201 3300005545 Bacteria 658
161 Ga0070696_100011537 3300005546 Bacteria 5920
162 Ga0070696_100088596 3300005546 Bacteria 2200
163 Ga0070696_101139862 3300005546 Bacteria 657
164 Ga0070696_101255631 3300005546 Bacteria 627
165 Ga0070693_100025364 3300005547 Bacteria 3190
166 Ga0070665_100253268 3300005548 Bacteria 1761
167 Ga0070665_100975798 3300005548 Bacteria 860
168 Ga0070704_100000290 3300005549 Bacteria 22046
169 Ga0070704_100033380 3300005549 Bacteria 3479
170 Ga0070704_100103430 3300005549 Bacteria 2151
171 Ga0070704_100133408 3300005549 Bacteria 1928
172 Ga0070704_100140732 3300005549 Bacteria 1884
173 Ga0070704_100617605 3300005549 Bacteria 954
174 Ga0070704_100697619 3300005549 Bacteria 900
175 Ga0068855_100001557 3300005563 Bacteria 28824
176 Ga0068855_101227947 3300005563 Bacteria 778
177 Ga0070664_100001006 3300005564 Bacteria 22147
178 Ga0070664_100057063 3300005564 Bacteria 3318
179 Ga0070664_100238657 3300005564 Bacteria 1631
180 Ga0070664_100346893 3300005564 Bacteria 1350
181 Ga0068857_100004183 3300005577 Bacteria 12148
182 Ga0068857_100020929 3300005577 Bacteria 5754
183 Ga0068856_100201340 3300005614 Bacteria 2005
184 Ga0068856_100236957 3300005614 Bacteria 1840
185 Ga0068856_100583600 3300005614 Bacteria 1139
186 Ga0068856_100842867 3300005614 Bacteria 936
187 Ga0068856_101045116 3300005614 Bacteria 835
188 Ga0070702_100007457 3300005615 Bacteria 5239
189 Ga0068852_100044420 3300005616 Bacteria 3773
190 Ga0068852_100407829 3300005616 Bacteria 1338
191 Ga0068852_100498714 3300005616 Bacteria 1212
192 Ga0068859_100002969 3300005617 Bacteria 17194
193 Ga0068859_100054432 3300005617 Bacteria 4024
194 Ga0068859_100055535 3300005617 Bacteria 3985
195 Ga0068859_100888731 3300005617 Bacteria 976
196 Ga0068864_100029088 3300005618 Bacteria 4675
197 Ga0068864_100066440 3300005618 Bacteria 3130
198 Ga0068864_100113720 3300005618 Bacteria 2413
199 Ga0068864_100406486 3300005618 Bacteria 1295
200 Ga0068864_100457602 3300005618 Bacteria 1221
201 Ga0068864_101029357 3300005618 Bacteria 817
202 Ga0068866_10019531 3300005718 Bacteria 3087
203 Ga0068861_100002891 3300005719 Bacteria 11317
204 Ga0068861_100099175 3300005719 Bacteria 2313
205 Ga0068851_10189188 3300005834 Bacteria 1144
206 Ga0068870_10023082 3300005840 Bacteria 3064
207 Ga0068870_10091009 3300005840 Bacteria 1705
208 Ga0068870_10143071 3300005840 Bacteria 1401
209 Ga0068870_10507874 3300005840 Bacteria 805
210 Ga0068863_100063192 3300005841 Bacteria 3501
211 Ga0068863_100120259 3300005841 Bacteria 2504
212 Ga0068858_100017104 3300005842 Bacteria 6806
213 Ga0068858_100027876 3300005842 Bacteria 5248
214 Ga0068858_100423333 3300005842 Bacteria 1281
215 Ga0068860_100013106 3300005843 Bacteria 8136
216 Ga0068860_100018719 3300005843 Bacteria 6731
217 Ga0068860_100121854 3300005843 Bacteria 2498
218 Ga0068860_100132207 3300005843 Bacteria 2395
219 Ga0068860_100546898 3300005843 Bacteria 1160
220 Ga0068862_100001535 3300005844 Bacteria 21114
221 Ga0068862_100038147 3300005844 Bacteria 4074
222 Ga0068862_100092126 3300005844 Bacteria 2641
223 Ga0068862_100187686 3300005844 Bacteria 1859
224 Ga0081455_10000226 3300005937 Bacteria 72690
225 Ga0081455_10057182 3300005937 Bacteria 3307
226 Ga0081455_10065788 3300005937 Bacteria 3030
227 Ga0081540_1028604 3300005983 Bacteria 3126
228 Ga0081540_1153816 3300005983 Bacteria 903
229 Ga0070717_10009977 3300006028 Bacteria 7146
230 Ga0075365_10076119 3300006038 Bacteria 2266
231 Ga0075365_10378392 3300006038 Bacteria 999
232 Ga0075368_10288463 3300006042 Bacteria 706
233 Ga0075432_10034783 3300006058 Bacteria 1751
234 Ga0070716_100440109 3300006173 Bacteria 947
235 Ga0070712_101430321 3300006175 Bacteria 604
236 Ga0075362_10095754 3300006177 Bacteria 1382
237 Ga0075362_10377078 3300006177 Bacteria 713
238 Ga0075367_10149424 3300006178 Bacteria 1449
239 Ga0097621_100003859 3300006237 Bacteria 10383
240 Ga0097621_100015822 3300006237 Bacteria 5687
241 Ga0097621_100056795 3300006237 Bacteria 3199
242 Ga0097621_100213726 3300006237 Bacteria 1678
243 Ga0097621_100408523 3300006237 Bacteria 1217
244 Ga0097621_100429022 3300006237 Bacteria 1188
245 Ga0097621_100572561 3300006237 Bacteria 1030
246 Ga0075370_10174715 3300006353 Bacteria 1263
247 Ga0068871_100043381 3300006358 Bacteria 3612
248 Ga0068871_100048016 3300006358 Bacteria 3444
249 Ga0068871_100065352 3300006358 Bacteria 2979
250 Ga0068871_100229011 3300006358 Bacteria 1613
251 Ga0068871_100379425 3300006358 Bacteria 1256
252 Ga0068871_101005510 3300006358 Bacteria 777
253 Ga0075428_100016948 3300006844 Bacteria 8046
254 Ga0075428_100102590 3300006844 Bacteria 3119
255 Ga0075428_100672416 3300006844 Bacteria 1104
256 Ga0075430_100733325 3300006846 Bacteria 815
257 Ga0075431_100107857 3300006847 Bacteria 2874
258 Ga0075431_100830049 3300006847 Bacteria 896
259 Ga0075433_10072556 3300006852 Bacteria 3027
260 Ga0075433_10359297 3300006852 Bacteria 1287
261 Ga0075433_10362326 3300006852 Bacteria 1281
262 Ga0075433_10593956 3300006852 Unclassified 972
263 Ga0075434_100003572 3300006871 Bacteria 13893
264 Ga0075434_100037514 3300006871 Bacteria 4798
265 Ga0075434_100096263 3300006871 Bacteria 2965
266 Ga0075434_100338448 3300006871 Bacteria 1525
267 Ga0075434_100654203 3300006871 Bacteria 1069
268 Ga0075434_100915775 3300006871 Bacteria 891
269 Ga0075434_101129184 3300006871 Bacteria 797
270 Ga0075434_101289100 3300006871 Bacteria 741
271 Ga0075429_100043230 3300006880 Bacteria 3921
272 Ga0075429_100078330 3300006880 Bacteria 2880
273 Ga0068865_100010201 3300006881 Bacteria 5839
274 Ga0068865_100021178 3300006881 Bacteria 4226
275 Ga0068865_100068213 3300006881 Bacteria 2514
276 Ga0068865_101329647 3300006881 Bacteria 640
277 Ga0075436_100667354 3300006914 Bacteria 769
278 Ga0075436_100749045 3300006914 Bacteria 725
279 Ga0097620_100002969 3300006931 Bacteria 17194
280 Ga0097620_100054431 3300006931 Bacteria 4024
281 Ga0097620_100055537 3300006931 Bacteria 3985
282 Ga0097620_100888744 3300006931 Bacteria 976
283 Ga0075435_100185026 3300007076 Bacteria 1761
284 Ga0075435_100207126 3300007076 Bacteria 1663
285 Ga0075435_100214219 3300007076 Bacteria 1635
286 Ga0075435_100251502 3300007076 Bacteria 1504
287 Ga0075435_100453048 3300007076 Bacteria 1106
288 Ga0075435_100809078 3300007076 Bacteria 816
289 Ga0075435_101140303 3300007076 Bacteria 682
290 Ga0099794_10011923 3300007265 Bacteria 3737
291 Ga0099795_10400193 3300007788 Bacteria 624
292 Ga0105250_10073847 3300009092 Bacteria 1379
293 Ga0105240_10001330 3300009093 Bacteria 42531
294 Ga0111539_10203466 3300009094 Bacteria 2308
295 Ga0111539_10250089 3300009094 Bacteria 2064
296 Ga0111539_10295811 3300009094 Bacteria 1884
297 Ga0111539_10781978 3300009094 Bacteria 1111
298 Ga0105245_10053235 3300009098 Bacteria 3632
299 Ga0105245_10077693 3300009098 Bacteria 3027
300 Ga0105245_10171053 3300009098 Bacteria 2069
301 Ga0105245_12472774 3300009098 Bacteria 573
302 Ga0105247_10008977 3300009101 Bacteria 6092
303 Ga0114129_10011440 3300009147 Bacteria 12638
304 Ga0114129_10022153 3300009147 Bacteria 9018
305 Ga0114129_10196805 3300009147 Bacteria 2732
306 Ga0114129_10198157 3300009147 Bacteria 2722
307 Ga0114129_10238507 3300009147 Bacteria 2445
308 Ga0114129_10271801 3300009147 Bacteria 2267
309 Ga0114129_10311992 3300009147 Bacteria 2093
310 Ga0114129_10431959 3300009147 Bacteria 1730
311 Ga0114129_10528208 3300009147 Bacteria 1537
312 Ga0114129_10550738 3300009147 Unclassified 1500
313 Ga0114129_10594414 3300009147 Unclassified 1435
314 Ga0114129_10731549 3300009147 Bacteria 1268
315 Ga0114129_10740298 3300009147 Bacteria 1259
316 Ga0114129_11012391 3300009147 Bacteria 1045
317 Ga0105243_10141993 3300009148 Bacteria 2050
318 Ga0105243_10509341 3300009148 Bacteria 1142
319 Ga0105243_10516184 3300009148 Bacteria 1135
320 Ga0105243_10856486 3300009148 Bacteria 900
321 Ga0105243_11020737 3300009148 Bacteria 831
322 Ga0105241_10059818 3300009174 Bacteria 2930
323 Ga0105241_10092818 3300009174 Bacteria 2384
324 Ga0105241_10144541 3300009174 Bacteria 1940
325 Ga0105242_10009807 3300009176 Bacteria 7340
326 Ga0105242_10016619 3300009176 Bacteria 5723
327 Ga0105242_10049142 3300009176 Bacteria 3431
328 Ga0105242_10090718 3300009176 Bacteria 2571
329 Ga0105242_10104861 3300009176 Bacteria 2400
330 Ga0105242_10488988 3300009176 Bacteria 1168
331 Ga0105242_11639382 3300009176 Bacteria 678
332 Ga0105242_11934323 3300009176 Bacteria 631
333 Ga0105242_12060601 3300009176 Bacteria 614
334 Ga0105248_10024239 3300009177 Bacteria 6746
335 Ga0105248_10025818 3300009177 Bacteria 6533
336 Ga0105248_10036500 3300009177 Bacteria 5497
337 Ga0105248_10112799 3300009177 Bacteria 3066
338 Ga0105248_10253105 3300009177 Bacteria 1982
339 Ga0105248_10536500 3300009177 Bacteria 1320
340 Ga0105248_10979019 3300009177 Bacteria 955
341 Ga0105237_10069357 3300009545 Bacteria 3521
342 Ga0105237_10139161 3300009545 Bacteria 2422
343 Ga0105237_10185851 3300009545 Bacteria 2078
344 Ga0105237_11305299 3300009545 Bacteria 732
345 Ga0105238_10005828 3300009551 Bacteria 12197
346 Ga0105238_10244453 3300009551 Bacteria 1772
347 Ga0105249_10001223 3300009553 Bacteria 22627
348 Ga0105249_11148879 3300009553 Bacteria 847
349 Ga0105239_10565288 3300010375 Bacteria 1296
350 Ga0105246_10175600 3300011119 Bacteria 1645
351 Ga0105246_10420803 3300011119 Bacteria 1115
352 Ga0105246_10504749 3300011119 Bacteria 1028
353 Ga0105246_10534124 3300011119 Bacteria 1002
354 Ga0105246_10546199 3300011119 Bacteria 992
355 Ga0157315_1005180 3300012508 Bacteria 967
356 Ga0157371_10375229 3300013102 Bacteria 1038
357 Ga0157370_10009355 3300013104 Bacteria 10484
358 Ga0157370_10230292 3300013104 Bacteria 1715
359 Ga0157369_10631415 3300013105 Bacteria 1105
360 Ga0157374_10062855 3300013296 Bacteria 3481
361 Ga0157374_10073858 3300013296 Bacteria 3219
362 Ga0157374_10301332 3300013296 Bacteria 1586
363 Ga0157378_10082855 3300013297 Bacteria 2901
364 Ga0157378_11073682 3300013297 Bacteria 841
365 Ga0157378_11237611 3300013297 Bacteria 787
366 Ga0163162_10069114 3300013306 Bacteria 3584
367 Ga0163162_10117078 3300013306 Bacteria 2766
368 Ga0163162_10323767 3300013306 Bacteria 1674
369 Ga0163162_10537592 3300013306 Bacteria 1297
370 Ga0163162_11067052 3300013306 Bacteria 915
371 Ga0163162_12011155 3300013306 Bacteria 662
372 Ga0157372_10114885 3300013307 Bacteria 3086
373 Ga0157372_11912900 3300013307 Bacteria 682
374 Ga0157375_10056537 3300013308 Bacteria 3874
375 Ga0157375_10095545 3300013308 Bacteria 3043
376 Ga0157375_10335476 3300013308 Bacteria 1677
377 Ga0157375_10682835 3300013308 Bacteria 1181
378 Ga0157375_11959054 3300013308 Bacteria 696
379 Ga0163163_10027621 3300014325 Bacteria 5438
380 Ga0163163_10120750 3300014325 Bacteria 2655
381 Ga0163163_10156859 3300014325 Bacteria 2320
382 Ga0157380_10078136 3300014326 Bacteria 2699
383 Ga0157380_10551024 3300014326 Bacteria 1131
384 Ga0157377_10006418 3300014745 Bacteria 5610
385 Ga0157379_10007688 3300014968 Bacteria 9333
386 Ga0157379_10067866 3300014968 Bacteria 3188
387 Ga0157379_10983037 3300014968 Bacteria 804
388 Ga0157376_10014139 3300014969 Bacteria 5978
389 Ga0157376_10035926 3300014969 Bacteria 4011
390 Ga0157376_10115121 3300014969 Bacteria 2373
391 Ga0157376_10245593 3300014969 Bacteria 1669
392 Ga0157376_10360050 3300014969 Bacteria 1395
393 Ga0157376_10465284 3300014969 Bacteria 1236
394 Ga0157376_11378782 3300014969 Bacteria 736
395 Ga0163161_10073412 3300017792 Bacteria 2507
396 Ga0163161_10224990 3300017792 Bacteria 1454
397 Ga0224712_10003138 3300022467 Bacteria 4229
398 Ga0207697_10080600 3300025315 Bacteria 1371
399 Ga0207697_10189254 3300025315 Bacteria 903
400 Ga0207656_10183454 3300025321 Bacteria 1005
401 Ga0207653_10111444 3300025885 Bacteria 977
402 Ga0207653_10206557 3300025885 Bacteria 742
403 Ga0207653_10273894 3300025885 Bacteria 650
404 Ga0207682_10017781 3300025893 Bacteria 2775
405 Ga0207692_10808069 3300025898 Bacteria 613
406 Ga0207642_10070945 3300025899 Bacteria 1657
407 Ga0207688_10003055 3300025901 Bacteria 9124
408 Ga0207688_10124807 3300025901 Bacteria 1505
409 Ga0207680_10217513 3300025903 Bacteria 1308
410 Ga0207647_10144210 3300025904 Bacteria 1395
411 Ga0207645_10044683 3300025907 Bacteria 2834
412 Ga0207645_10123370 3300025907 Bacteria 1683
413 Ga0207643_10008496 3300025908 Bacteria 5507
414 Ga0207643_10017500 3300025908 Bacteria 3919
415 Ga0207643_10100937 3300025908 Bacteria 1692
416 Ga0207643_10270825 3300025908 Bacteria 1051
417 Ga0207684_10000004 3300025910 Bacteria 755956
418 Ga0207684_10034857 3300025910 Bacteria 4274
419 Ga0207684_10094665 3300025910 Bacteria 2548
420 Ga0207684_10299980 3300025910 Unclassified 1385
421 Ga0207684_10596054 3300025910 Bacteria 944
422 Ga0207684_11006118 3300025910 Bacteria 697
423 Ga0207684_11011298 3300025910 Bacteria 695
424 Ga0207654_10038891 3300025911 Bacteria 2672
425 Ga0207654_10172793 3300025911 Bacteria 1404
426 Ga0207707_10079898 3300025912 Bacteria 2855
427 Ga0207707_10237013 3300025912 Bacteria 1587
428 Ga0207707_10779401 3300025912 Bacteria 798
429 Ga0207695_10002411 3300025913 Bacteria 27678
430 Ga0207695_10343044 3300025913 Bacteria 1381
431 Ga0207695_10468447 3300025913 Bacteria 1142
432 Ga0207695_11032223 3300025913 Unclassified 702
433 Ga0207671_10115324 3300025914 Bacteria 2048
434 Ga0207671_10390103 3300025914 Unclassified 1107
435 Ga0207671_11032265 3300025914 Bacteria 647
436 Ga0207693_10129071 3300025915 Bacteria 1987
437 Ga0207663_10445217 3300025916 Bacteria 998
438 Ga0207663_10900665 3300025916 Bacteria 707
439 Ga0207660_10040125 3300025917 Bacteria 3276
440 Ga0207660_10136350 3300025917 Bacteria 1873
441 Ga0207660_10794446 3300025917 Bacteria 772
442 Ga0207662_10018473 3300025918 Bacteria 3957
443 Ga0207662_10036843 3300025918 Bacteria 2860
444 Ga0207662_10651175 3300025918 Bacteria 736
445 Ga0207657_10082888 3300025919 Bacteria 2691
446 Ga0207657_10538352 3300025919 Bacteria 913
447 Ga0207649_10008732 3300025920 Bacteria 5533
448 Ga0207649_10399469 3300025920 Bacteria 1028
449 Ga0207649_10407022 3300025920 Bacteria 1019
450 Ga0207649_10547796 3300025920 Bacteria 885
451 Ga0207652_10757141 3300025921 Bacteria 864
452 Ga0207646_10026114 3300025922 Bacteria 5335
453 Ga0207646_10044932 3300025922 Bacteria 3965
454 Ga0207646_10075989 3300025922 Bacteria 3001
455 Ga0207646_10571873 3300025922 Bacteria 1015
456 Ga0207681_10000292 3300025923 Bacteria 37133
457 Ga0207681_10453554 3300025923 Bacteria 1043
458 Ga0207694_10067586 3300025924 Bacteria 2789
459 Ga0207694_10585255 3300025924 Bacteria 938
460 Ga0207650_10005992 3300025925 Bacteria 8294
461 Ga0207650_10012968 3300025925 Bacteria 5762
462 Ga0207650_10669881 3300025925 Bacteria 875
463 Ga0207659_10000931 3300025926 Bacteria 17445
464 Ga0207659_10287240 3300025926 Bacteria 1347
465 Ga0207659_11126087 3300025926 Bacteria 675
466 Ga0207687_10050723 3300025927 Bacteria 2890
467 Ga0207687_10336048 3300025927 Bacteria 1227
468 Ga0207700_10392513 3300025928 Bacteria 1215
469 Ga0207700_10453801 3300025928 Bacteria 1130
470 Ga0207664_10951846 3300025929 Bacteria 770
471 Ga0207644_10028794 3300025931 Bacteria 3849
472 Ga0207644_10042692 3300025931 Bacteria 3215
473 Ga0207644_10321233 3300025931 Bacteria 1252
474 Ga0207644_10659563 3300025931 Bacteria 871
475 Ga0207690_10224951 3300025932 Bacteria 1438
476 Ga0207686_10008069 3300025934 Bacteria 5680
477 Ga0207686_10029951 3300025934 Bacteria 3217
478 Ga0207686_10064624 3300025934 Bacteria 2331
479 Ga0207686_10119533 3300025934 Bacteria 1791
480 Ga0207686_10321383 3300025934 Bacteria 1156
481 Ga0207686_10370605 3300025934 Bacteria 1083
482 Ga0207686_11458307 3300025934 Bacteria 564
483 Ga0207709_10043079 3300025935 Bacteria 2719
484 Ga0207709_10088224 3300025935 Bacteria 2019
485 Ga0207709_10353896 3300025935 Bacteria 1109
486 Ga0207670_10145706 3300025936 Bacteria 1751
487 Ga0207669_10105154 3300025937 Bacteria 1877
488 Ga0207669_10674776 3300025937 Bacteria 847
489 Ga0207704_10028908 3300025938 Bacteria 3083
490 Ga0207704_10039712 3300025938 Bacteria 2744
491 Ga0207691_10009425 3300025940 Bacteria 9377
492 Ga0207691_10048890 3300025940 Bacteria 3876
493 Ga0207691_10091716 3300025940 Bacteria 2722
494 Ga0207691_10748577 3300025940 Bacteria 823
495 Ga0207711_10432753 3300025941 Bacteria 1224
496 Ga0207711_10486297 3300025941 Bacteria 1150
497 Ga0207711_10719115 3300025941 Bacteria 931
498 Ga0207711_11049257 3300025941 Bacteria 755
499 Ga0207711_11087951 3300025941 Bacteria 740
500 Ga0207711_11133077 3300025941 Bacteria 723
501 Ga0207689_10036911 3300025942 Bacteria 4055
502 Ga0207689_10183898 3300025942 Bacteria 1723
503 Ga0207689_10251978 3300025942 Bacteria 1460
504 Ga0207689_10560433 3300025942 Bacteria 960
505 Ga0207661_10285102 3300025944 Bacteria 1477
506 Ga0207679_10040102 3300025945 Bacteria 3349
507 Ga0207679_10179748 3300025945 Bacteria 1749
508 Ga0207679_10394445 3300025945 Bacteria 1216
509 Ga0207667_10045803 3300025949 Bacteria 4631
510 Ga0207667_10231647 3300025949 Bacteria 1891
511 Ga0207651_10049127 3300025960 Bacteria 2856
512 Ga0207651_10161067 3300025960 Bacteria 1759
513 Ga0207651_10226725 3300025960 Bacteria 1514
514 Ga0207651_10265733 3300025960 Bacteria 1411
515 Ga0207712_10003713 3300025961 Bacteria 9633
516 Ga0207712_10352061 3300025961 Bacteria 1225
517 Ga0207668_10005811 3300025972 Bacteria 7270
518 Ga0207668_10113129 3300025972 Bacteria 2040
519 Ga0207668_10436201 3300025972 Bacteria 1115
520 Ga0207640_10931352 3300025981 Bacteria 761
521 Ga0207658_10081375 3300025986 Bacteria 2483
522 Ga0207658_10145076 3300025986 Bacteria 1926
523 Ga0207658_10286393 3300025986 Bacteria 1414
524 Ga0207677_10280726 3300026023 Bacteria 1367
525 Ga0207703_10035190 3300026035 Bacteria 3979
526 Ga0207703_10139824 3300026035 Bacteria 2100
527 Ga0207703_10756484 3300026035 Bacteria 926
528 Ga0207703_10946036 3300026035 Bacteria 826
529 Ga0207639_10065889 3300026041 Bacteria 2813
530 Ga0207639_10185768 3300026041 Bacteria 1772
531 Ga0207639_11158263 3300026041 Bacteria 726
532 Ga0207639_11456189 3300026041 Bacteria 643
533 Ga0207678_10047770 3300026067 Bacteria 3701
534 Ga0207678_10073288 3300026067 Bacteria 2935
535 Ga0207678_11566432 3300026067 Bacteria 581
536 Ga0207708_10035720 3300026075 Bacteria 3782
537 Ga0207708_10052282 3300026075 Bacteria 3112
538 Ga0207708_10334248 3300026075 Bacteria 1239
539 Ga0207702_10173340 3300026078 Bacteria 1980
540 Ga0207702_10378897 3300026078 Bacteria 1360
541 Ga0207702_10952531 3300026078 Bacteria 851
542 Ga0207702_11418863 3300026078 Bacteria 688
543 Ga0207641_10021744 3300026088 Bacteria 5273
544 Ga0207641_10049400 3300026088 Bacteria 3555
545 Ga0207641_10058812 3300026088 Bacteria 3272
546 Ga0207641_10171746 3300026088 Unclassified 1979
547 Ga0207641_10555416 3300026088 Unclassified 1120
548 Ga0207648_10000938 3300026089 Bacteria 32907
549 Ga0207648_10054113 3300026089 Bacteria 3506
550 Ga0207676_10004720 3300026095 Bacteria 9657
551 Ga0207676_10022478 3300026095 Bacteria 4639
552 Ga0207676_10035799 3300026095 Bacteria 3771
553 Ga0207676_10234985 3300026095 Bacteria 1641
554 Ga0207676_11224240 3300026095 Bacteria 744
555 Ga0207674_10043797 3300026116 Bacteria 4613
556 Ga0207674_11153607 3300026116 Bacteria 744
557 Ga0207675_100001384 3300026118 Bacteria 24327
558 Ga0207675_100003563 3300026118 Bacteria 15160
559 Ga0207675_100334315 3300026118 Bacteria 1482
560 Ga0207675_101557717 3300026118 Bacteria 681
561 Ga0207683_10064073 3300026121 Bacteria 3239
562 Ga0207683_10409672 3300026121 Bacteria 1248
563 Ga0207683_10516020 3300026121 Bacteria 1104
564 Ga0207683_10550786 3300026121 Bacteria 1066
565 Ga0207683_11396317 3300026121 Bacteria 647
566 Ga0207698_10221559 3300026142 Bacteria 1710
567 Ga0207698_10517771 3300026142 Bacteria 1163
568 Ga0210002_1029676 3300027617 Bacteria 906
569 Ga0209588_1028656 3300027671 Bacteria 1773
570 Ga0209966_1034525 3300027695 Bacteria 1035
571 Ga0209974_10056907 3300027876 Bacteria 1320
572 Ga0207428_10000562 3300027907 Bacteria 43846
573 Ga0207428_10990430 3300027907 Bacteria 591
574 Ga0268266_10036665 3300028379 Bacteria 4176
575 Ga0268265_10000103 3300028380 Bacteria 106177
576 Ga0268265_10300765 3300028380 Bacteria 1444
577 Ga0268265_10603622 3300028380 Bacteria 1049
578 Ga0268265_10682639 3300028380 Bacteria 990
579 Ga0268264_10020042 3300028381 Bacteria 5464
580 Ga0268264_10124713 3300028381 Bacteria 2274
581 Ga0268264_10137446 3300028381 Bacteria 2175
582 Ga0268264_10276102 3300028381 Bacteria 1572
583 Ga0268264_10311470 3300028381 Bacteria 1485
584 Ga0268264_10374221 3300028381 Bacteria 1362
585 Ga0265329_10105184 3300031242 Unclassified 900
586 Ga0265339_10136875 3300031249 Unclassified 1249
587 Ga0265327_10106121 3300031251 Bacteria 1349
588 Ga0265314_10001454 3300031711 Bacteria 26457
589 Ga0373959_0054010 3300034820 Bacteria 874
590 Ga0373926_0356464 3300035083 Bacteria 575
591 Ga0373949_0037290 3300035090 Bacteria 1182
592 Ga0373952_0268072 3300035092 Bacteria 522
593 Ga0373936_0200539 3300035113 Bacteria 881
594 Ga0373939_0032575 3300035114 Bacteria 1516
595 Ga0373939_0044667 3300035114 Bacteria 1349
596 Ga0373939_0187369 3300035114 Bacteria 775
597 Ga0373941_0101373 3300035115 Bacteria 1003
598 Ga0373945_0048053 3300035116 Bacteria 1562
599 Ga0373954_0308422 3300035118 Unclassified 781
600 Ga0373954_0361884 3300035118 Bacteria 717
601 Ga0373954_0572893 3300035118 Bacteria 560
602 Ga0373956_0072790 3300035119 Bacteria 1570
603 Ga0373956_0077187 3300035119 Bacteria 1525
604 Ga0373960_0004518 3300035121 Bacteria 3193
605 Ga0373943_0073906 3300035170 Bacteria 1732
606 Ga0373943_0139140 3300035170 Bacteria 1306
607 Ga0373943_0175446 3300035170 Bacteria 1175
608 Ga0373946_0011306 3300035171 Bacteria 3327
609 Ga0373955_0002461 3300035172 Bacteria 8090
610 Ga0373955_0056957 3300035172 Unclassified 2146
611 Ga0373955_0141987 3300035172 Bacteria 1409
612 Ga0373955_0188367 3300035172 Bacteria 1226
613 Ga0373955_0712081 3300035172 Bacteria 616
614 Ga0373924_0012321 3300035410 Bacteria 3193
615 Ga0373924_0014243 3300035410 Bacteria 3003
616 Ga0373931_0021322 3300035691 Bacteria 3250
617 Ga0373935_0024708 3300035692 Unclassified 3701
618 Ga0373935_0341335 3300035692 Bacteria 1066
619 Ga0373935_0435121 3300035692 Bacteria 946
620 Ga0373935_0515391 3300035692 Bacteria 869
621 Ga0373927_0011784 3300035695 Bacteria 5822
622 Ga0373927_0013854 3300035695 Bacteria 5351
623 Ga0373927_0194675 3300035695 Bacteria 1330
624 Ga0373927_0679101 3300035695 Bacteria 680
625 Ga0373927_0757209 3300035695 Bacteria 642
626 Ga0373933_0236551 3300035724 Unclassified 1174
627 Ga0373933_0299634 3300035724 Unclassified 1041
628 Ga0373947_0065523 3300035725 Unclassified 2216
629 Ga0373947_0448756 3300035725 Bacteria 873
630 Ga0373947_0650992 3300035725 Bacteria 718
631 Ga0373947_0840724 3300035725 Bacteria 627
632 Ga0373947_1010188 3300035725 Bacteria 567
633 Ga0373937_0009278 3300036401 Bacteria 8542
634 Ga0373937_0014245 3300036401 Bacteria 7018
635 Ga0373937_0098568 3300036401 Bacteria 2711
636 Ga0373937_0333697 3300036401 Archaea 1435
637 Ga0373937_0688370 3300036401 Bacteria 969
638 Ga0373937_1710923 3300036401 Bacteria 576
639 Ga0373937_1855746 3300036401 Bacteria 549
640 Ga0373925_0026267 3300037068 Bacteria 4261
641 Ga0373925_0056176 3300037068 Bacteria 2949
642 Ga0373925_0082087 3300037068 Unclassified 2452
643 Ga0373925_0307013 3300037068 Bacteria 1282
644 Ga0373925_0452164 3300037068 Bacteria 1052
645 Ga0436361_0314528 3300039447 Bacteria 662
646 Ga0436361_0481279 3300039447 Bacteria 1943
647 Ga0451835_0112714 3300041492 Bacteria 580
648 Ga0451843_0352523 3300041509 Unclassified 754
649 Ga0451577_0788457 3300042876 Bacteria 859
650 Ga0453683_0392434 3300044673 Bacteria 894
651 Ga0451576_0021376 3300045051 Bacteria 7032
652 Ga0451576_0054255 3300045051 Bacteria 4197
653 Ga0451576_0079760 3300045051 Bacteria 3406
654 Ga0495592_0012432 3300046454 Bacteria 6466
655 Ga0495592_0145772 3300046454 Bacteria 1642
656 Ga0495592_0341041 3300046454 Bacteria 963
657 Ga0495603_0012179 3300046455 Bacteria 5208
658 Ga0495603_0033288 3300046455 Bacteria 3101
659 Ga0495603_0354626 3300046455 Bacteria 841
660 Ga0495591_031022 3300046458 Bacteria 1608
661 Ga0495629_0001619 3300046459 Bacteria 17689
662 Ga0495629_0206406 3300046459 Bacteria 1358
663 Ga0495641_0011781 3300046461 Bacteria 4946
664 Ga0495641_0059056 3300046461 Bacteria 1734
665 Ga0495641_0128963 3300046461 Bacteria 1129
666 Ga0495641_0157720 3300046461 Bacteria 1015
667 Ga0495651_0010791 3300046462 Bacteria 7023
668 Ga0495653_0007069 3300046463 Bacteria 9207
669 Ga0495653_0423410 3300046463 Bacteria 842
670 Ga0495580_0282572 3300046472 Archaea 1132
671 Ga0495580_0381500 3300046472 Bacteria 952
672 Ga0495580_0436195 3300046472 Bacteria 880
673 Ga0495580_0648168 3300046472 Unclassified 695
674 Ga0495582_0030627 3300046473 Bacteria 2955
675 Ga0495582_0622721 3300046473 Bacteria 624
676 Ga0495605_0039567 3300046474 Bacteria 2361
677 Ga0495662_0118018 3300046476 Bacteria 1302
678 Ga0495662_0333473 3300046476 Bacteria 746
679 Ga0495664_0055733 3300046477 Bacteria 2352
680 Ga0495664_0421175 3300046477 Unclassified 801
681 Ga0495584_0021570 3300046491 Bacteria 3271
682 Ga0495584_0090238 3300046491 Bacteria 1545
683 Ga0495584_0264785 3300046491 Bacteria 874
684 Ga0495585_0033701 3300046492 Bacteria 2898
685 Ga0495594_0363912 3300046499 Bacteria 823
686 Ga0495608_0019989 3300046511 Bacteria 4605
687 Ga0495608_0021909 3300046511 Bacteria 4382
688 Ga0495608_0039578 3300046511 Bacteria 3159
689 Ga0495608_0077149 3300046511 Bacteria 2169
690 Ga0495618_0074366 3300046514 Unclassified 2164
691 Ga0495618_0096622 3300046514 Bacteria 1889
692 Ga0495618_0131235 3300046514 Bacteria 1603
693 Ga0495618_0593975 3300046514 Bacteria 659
694 Ga0495628_0001354 3300046516 Bacteria 22458
695 Ga0495628_0135498 3300046516 Bacteria 1882
696 Ga0495628_0669244 3300046516 Bacteria 736
697 Ga0495628_1020346 3300046516 Bacteria 568
698 Ga0495630_0024914 3300046517 Bacteria 4423
699 Ga0495630_0121217 3300046517 Bacteria 1984
700 Ga0495630_0315905 3300046517 Bacteria 1194
701 Ga0495630_0980307 3300046517 Bacteria 643
702 Ga0495631_0308298 3300046518 Bacteria 673
703 Ga0495632_0071273 3300046519 Bacteria 1670
704 Ga0495637_0183949 3300046520 Bacteria 774
705 Ga0495644_0115441 3300046523 Bacteria 1020
706 Ga0495663_0168992 3300046525 Bacteria 753
707 Ga0495663_0189248 3300046525 Bacteria 715
708 Ga0495666_0331104 3300046526 Unclassified 687
709 Ga0495642_0006036 3300046528 Bacteria 4653
710 Ga0495642_0134962 3300046528 Bacteria 1064
711 Ga0495652_0040705 3300046529 Bacteria 4016
712 Ga0495652_0209326 3300046529 Bacteria 1474
713 Ga0495652_0292797 3300046529 Bacteria 1187
714 Ga0495652_0398382 3300046529 Bacteria 975
715 Ga0495652_0434933 3300046529 Bacteria 922
716 Ga0495652_0973534 3300046529 Bacteria 556
717 Ga0495652_1059032 3300046529 Bacteria 528
718 Ga0495665_0141141 3300046531 Bacteria 1259
719 Ga0495665_0160666 3300046531 Bacteria 1171
720 Ga0495665_0319687 3300046531 Bacteria 793
721 Ga0495640_0088887 3300046533 Bacteria 2041
722 Ga0495640_0115812 3300046533 Bacteria 1746
723 Ga0495640_0172548 3300046533 Bacteria 1381
724 Ga0495586_0631293 3300046535 Unclassified 619
725 Ga0495587_0005263 3300046536 Bacteria 8457
726 Ga0495598_0026697 3300046537 Bacteria 1585
727 Ga0495609_0023267 3300046538 Bacteria 2849
728 Ga0495621_0000998 3300046539 Bacteria 7250
729 Ga0495621_0017434 3300046539 Bacteria 2322
730 Ga0495621_0035833 3300046539 Bacteria 1719
731 Ga0495621_0203818 3300046539 Bacteria 796
732 Ga0495621_0371963 3300046539 Bacteria 602
733 Ga0495645_0052499 3300046543 Bacteria 2965
734 Ga0495645_0637842 3300046543 Bacteria 652
735 Ga0495622_0263691 3300046557 Bacteria 756
736 Ga0495633_0025927 3300046558 Bacteria 2882
737 Ga0495633_0046916 3300046558 Bacteria 2043
738 Ga0495667_0021607 3300046559 Unclassified 4342
739 Ga0495667_0025835 3300046559 Bacteria 3956
740 Ga0495667_0030689 3300046559 Bacteria 3611
741 Ga0495656_0035345 3300046615 Bacteria 2052
742 Ga0495656_0239086 3300046615 Bacteria 914
743 Ga0495668_0097931 3300046616 Bacteria 1605
744 Ga0495634_0033268 3300046642 Bacteria 3543
745 Ga0495634_0482094 3300046642 Bacteria 729
746 Ga0495634_0648927 3300046642 Bacteria 610
747 Ga0495611_0178484 3300046648 Bacteria 992
748 Ga0495611_0288816 3300046648 Bacteria 757
749 Ga0495625_0505361 3300046660 Bacteria 738
750 Ga0495635_0041719 3300046663 Unclassified 3170
751 Ga0495635_0415040 3300046663 Bacteria 893
752 Ga0495659_0004982 3300046664 Bacteria 4177
753 Ga0495659_0007522 3300046664 Bacteria 3456
754 Ga0495659_0015511 3300046664 Bacteria 2505
755 Ga0495659_0020676 3300046664 Bacteria 2213
756 Ga0495659_0236393 3300046664 Bacteria 758
757 Ga0495659_0335034 3300046664 Bacteria 644
758 Ga0495659_0395922 3300046664 Bacteria 595
759 Ga0495661_0085478 3300046665 Bacteria 1808
760 Ga0495588_0083921 3300046674 Bacteria 1664
761 Ga0495657_0001786 3300046675 Bacteria 18404
762 Ga0495657_0062405 3300046675 Bacteria 2462
763 Ga0495657_0222807 3300046675 Bacteria 1143
764 Ga0495599_0004979 3300046678 Bacteria 7901
765 Ga0495599_0216736 3300046678 Bacteria 1172
766 Ga0495599_0250736 3300046678 Bacteria 1077
767 Ga0495646_0339656 3300046680 Bacteria 788
768 Ga0495646_0400732 3300046680 Bacteria 713
769 Ga0495647_0236460 3300046681 Bacteria 810
770 Ga0495647_0281589 3300046681 Bacteria 746
771 Ga0495658_0028683 3300046683 Bacteria 3007
772 Ga0495658_0042543 3300046683 Bacteria 2537
773 Ga0495658_0045312 3300046683 Bacteria 2468
774 Ga0495658_0133088 3300046683 Bacteria 1515
775 Ga0495658_0190355 3300046683 Bacteria 1275
776 Ga0495658_0235714 3300046683 Bacteria 1148
777 Ga0495669_0041245 3300046684 Bacteria 2049
778 Ga0495669_0131570 3300046684 Bacteria 1178
779 Ga0495613_0000397 3300046689 Bacteria 37243
780 Ga0495613_0052429 3300046689 Bacteria 3005
781 Ga0495613_0086411 3300046689 Bacteria 2274
782 Ga0495613_0211325 3300046689 Bacteria 1364
783 Ga0495613_0279244 3300046689 Archaea 1160
784 Ga0495613_0382967 3300046689 Bacteria 961
785 Ga0495624_0270103 3300046690 Bacteria 1027
786 Ga0495670_0050138 3300046691 Bacteria 2089
787 Ga0495670_0805766 3300046691 Bacteria 513
788 Ga0495671_0314313 3300046692 Bacteria 752
789 Ga0495600_0005852 3300046809 Bacteria 7436
790 Ga0495600_0050520 3300046809 Bacteria 2714
791 Ga0495600_0431272 3300046809 Unclassified 817
792 Ga0495600_0728359 3300046809 Bacteria 595
793 Ga0495660_0099059 3300046810 Bacteria 1503
794 Ga0495581_0032318 3300047315 Bacteria 3031
795 Ga0495581_0065787 3300047315 Bacteria 2096
796 Ga0495581_0070552 3300047315 Bacteria 2021
797 Ga0495581_0679300 3300047315 Bacteria 594
798 Ga0495604_0003278 3300047317 Bacteria 12936
799 Ga0495604_0027344 3300047317 Bacteria 4538
800 Ga0495636_0015384 3300047318 Bacteria 3049
801 Ga0495636_0062273 3300047318 Bacteria 1579
802 Ga0495636_0071921 3300047318 Bacteria 1477
803 Ga0495636_0312481 3300047318 Bacteria 737
804 Ga0495674_0002008 3300047319 Bacteria 20015
805 Ga0495674_0054300 3300047319 Bacteria 3519
806 Ga0495674_0061291 3300047319 Bacteria 3280
807 Ga0495674_0163199 3300047319 Bacteria 1863
808 Ga0495674_0576860 3300047319 Bacteria 893
809 Ga0495674_1464621 3300047319 Unclassified 507
810 Ga0495676_0010821 3300047321 Bacteria 8254
811 Ga0495676_0237402 3300047321 Bacteria 1249
812 Ga0495680_0032767 3300047322 Bacteria 4214
813 Ga0495680_0399851 3300047322 Unclassified 949
814 Ga0495680_0937945 3300047322 Bacteria 557
815 Ga0495683_0081466 3300047323 Bacteria 1578
816 Ga0495675_0002749 3300047444 Bacteria 10537
817 Ga0495675_0199333 3300047444 Unclassified 1219
818 Ga0495675_0738754 3300047444 Unclassified 549
819 Ga0495677_0019265 3300047445 Bacteria 2475
820 Ga0495677_0025693 3300047445 Bacteria 2137
821 Ga0495677_0091357 3300047445 Bacteria 1147
822 Ga0495679_061254 3300047446 Bacteria 1103
823 Ga0495685_076757 3300047447 Bacteria 1115
824 Ga0495673_0110984 3300047469 Bacteria 1097
825 Ga0495684_0000431 3300047471 Bacteria 34259
826 Ga0495684_0049741 3300047471 Bacteria 3202
827 Ga0495684_0067277 3300047471 Unclassified 2725
828 Ga0495684_0114954 3300047471 Bacteria 2029
829 Ga0495684_0165691 3300047471 Archaea 1646
830 Ga0495684_0346958 3300047471 Bacteria 1055
831 Ga0495684_0454716 3300047471 Bacteria 889
832 Ga0495684_0744010 3300047471 Bacteria 646
833 Ga0495686_0067826 3300047472 Bacteria 2202
834 Ga0495686_0084280 3300047472 Bacteria 1937
835 Ga0495593_0028114 3300047673 Bacteria 3090
836 Ga0495593_0266968 3300047673 Bacteria 856
837 Ga0495602_0022172 3300048088 Bacteria 6224
838 Ga0495602_0142743 3300048088 Bacteria 1894
839 Ga0495602_0919688 3300048088 Bacteria 581
840 Ga0495614_0089055 3300048089 Bacteria 1342
841 Ga0495626_0233556 3300048091 Bacteria 742
842 Ga0496100_0051860 3300048903 Bacteria 2665
843 Ga0496100_0147115 3300048903 Bacteria 1676
844 Ga0496101_0014720 3300048904 Bacteria 5263
845 Ga0496101_0134728 3300048904 Bacteria 1878
846 Ga0496101_0201882 3300048904 Bacteria 1537
847 Ga0496101_0490320 3300048904 Bacteria 970
848 Ga0496102_0141525 3300048905 Bacteria 2256
849 Ga0496103_0022195 3300048906 Bacteria 3821
850 Ga0496103_0128291 3300048906 Bacteria 1618
851 Ga0496103_0678130 3300048906 Bacteria 654
852 Ga0496104_0003063 3300048907 Bacteria 14409
853 Ga0496104_0009201 3300048907 Bacteria 8782
854 Ga0496104_0045229 3300048907 Bacteria 4139
855 Ga0496104_0113510 3300048907 Bacteria 2598
856 Ga0496104_0150665 3300048907 Bacteria 2233
857 Ga0496104_1709966 3300048907 Bacteria 531
858 Ga0496105_0008859 3300048908 Bacteria 7839
859 Ga0496105_0041428 3300048908 Bacteria 3796
860 Ga0496105_0136114 3300048908 Bacteria 2024
861 Ga0496105_0144110 3300048908 Bacteria 1960
862 Ga0496105_0307586 3300048908 Bacteria 1273
863 Ga0496105_0484311 3300048908 Bacteria 973
864 Ga0496106_0028179 3300048909 Bacteria 4183
865 Ga0496106_0041843 3300048909 Bacteria 3435
866 Ga0496106_0192272 3300048909 Bacteria 1623
867 Ga0496106_0536135 3300048909 Bacteria 939
868 Ga0496107_0036722 3300048910 Bacteria 3515
869 Ga0496107_0191751 3300048910 Bacteria 1518
870 Ga0496107_0215504 3300048910 Bacteria 1428
871 Ga0496108_0029096 3300048911 Bacteria 4573
872 Ga0496108_0765552 3300048911 Bacteria 834
873 Ga0496109_0004243 3300048912 Bacteria 11968
874 Ga0496109_0030998 3300048912 Bacteria 4794
875 Ga0496109_0229630 3300048912 Bacteria 1746
876 Ga0496110_0015614 3300048913 Bacteria 6324
877 Ga0496110_0030728 3300048913 Bacteria 4631
878 Ga0496110_0182665 3300048913 Bacteria 1905
879 Ga0496110_0494998 3300048913 Bacteria 1113
880 Ga0496110_1095673 3300048913 Bacteria 704
881 Ga0496111_0040436 3300048914 Bacteria 3344
882 Ga0496112_0056354 3300048915 Bacteria 3867
883 Ga0496112_0149860 3300048915 Bacteria 2300
884 Ga0496112_0552791 3300048915 Bacteria 1085
885 Ga0496113_0203985 3300048916 Bacteria 1572
886 Ga0496114_0034306 3300048917 Bacteria 4185
887 Ga0496114_0530816 3300048917 Bacteria 1040
888 Ga0496114_0561175 3300048917 Bacteria 1008
889 Ga0496115_0063455 3300048918 Bacteria 2981
890 Ga0496115_0089709 3300048918 Bacteria 2511
891 Ga0496115_0094720 3300048918 Bacteria 2443
892 Ga0496115_0127180 3300048918 Bacteria 2099
893 Ga0495678_180658 3300049459 Bacteria 662
894 Ga0501033_0344295 3300049570 Bacteria 1045
895 Ga0501047_0362572 3300049581 Bacteria 1285
896 Ga0501069_0060766 3300049585 Bacteria 2110
897 Ga0501077_0337569 3300049593 Bacteria 961
898 Ga0501079_0381439 3300049741 Bacteria 1105
899 Ga0501035_0913295 3300049822 Bacteria 695
900 Ga0501044_0132431 3300049823 Bacteria 2487
901 Ga0501045_0426208 3300049824 Bacteria 987
902 nmdc:mga03683_67014_c1 3300050489 Bacteria 1527
903 nmdc:mga03683_72119_c1 3300050489 Bacteria 1478
904 nmdc:mga00v17_278245_c1 3300050491 Bacteria 1086
905 nmdc:mga00v17_411970_c1 3300050491 Bacteria 878
906 nmdc:mga0yw44_148899_c1 3300050492 Bacteria 1526
907 nmdc:mga0yw44_324843_c1 3300050492 Bacteria 1034
908 nmdc:mga0yw44_54592_c1 3300050492 Bacteria 2429
909 nmdc:mga04h51_105977_c1 3300050495 Bacteria 1030
910 nmdc:mga05p37_133007_c1 3300050507 Bacteria 3051
911 nmdc:mga05p37_1614817_c1 3300050507 Bacteria 638
912 nmdc:mga05p37_162177_c1 3300050507 Bacteria 2730
913 nmdc:mga05p37_166004_c1 3300050507 Bacteria 2694
914 nmdc:mga05p37_18097_c1 3300050507 Bacteria 8511
915 nmdc:mga05p37_266694_c1 3300050507 Bacteria 2047
916 nmdc:mga05p37_297280_c1 3300050507 Bacteria 831
917 nmdc:mga05p37_304676_c1 3300050507 Bacteria 1891
918 nmdc:mga05p37_690598_c1 3300050507 Unclassified 1136
919 nmdc:mga09592_21311_c1 3300050508 Bacteria 5341
920 nmdc:mga09592_483879_c1 3300050508 Unclassified 1066
921 nmdc:mga09592_90167_c1 3300050508 Bacteria 2619
922 nmdc:mga0qj67_181347_c1 3300050509 Bacteria 1710
923 nmdc:mga0qj67_551623_c1 3300050509 Bacteria 924
924 nmdc:mga06r32_427885_c1 3300050510 Bacteria 1305
925 nmdc:mga06r32_74553_c1 3300050510 Bacteria 3290
926 nmdc:mga08y16_1204_c1 3300050511 Bacteria 25555
927 nmdc:mga08y16_230785_c1 3300050511 Bacteria 1914
928 nmdc:mga08y16_293757_c1 3300050511 Bacteria 1675
929 nmdc:mga08y16_372888_c1 3300050511 Bacteria 1464
930 nmdc:mga08y16_802366_c1 3300050511 Bacteria 934
931 nmdc:mga08y16_917282_c1 3300050511 Bacteria 861
932 nmdc:mga0n895_1009795_c1 3300050512 Bacteria 813
933 nmdc:mga0n895_140796_c1 3300050512 Bacteria 2441
934 nmdc:mga0n895_14463_c1 3300050512 Bacteria 7168
935 nmdc:mga0n895_180357_c1 3300050512 Bacteria 2143
936 nmdc:mga0n895_236091_c1 3300050512 Bacteria 1856
937 nmdc:mga0n895_500844_c1 3300050512 Bacteria 1224
938 nmdc:mga0n895_732268_c1 3300050512 Bacteria 983
939 nmdc:mga0n895_75340_c1 3300050512 Bacteria 3354
940 nmdc:mga0rr50_39643_c1 3300050513 Bacteria 3418
941 nmdc:mga0rr50_855086_c1 3300050513 Bacteria 776
942 nmdc:mga08x19_375248_c1 3300050514 Bacteria 996
943 nmdc:mga08x19_47150_c1 3300050514 Bacteria 2757
944 nmdc:mga08x19_958886_c1 3300050514 Unclassified 608
945 nmdc:mga0a205_198749_c1 3300050515 Bacteria 1896
946 nmdc:mga0a205_235148_c1 3300050515 Bacteria 1714
947 nmdc:mga0a205_359156_c1 3300050515 Bacteria 1323
948 nmdc:mga0a205_463163_c1 3300050515 Bacteria 1127
949 nmdc:mga0a205_47295_c1 3300050515 Bacteria 4150
950 nmdc:mga0a205_78530_c1 3300050515 Bacteria 3189
951 nmdc:mga0a205_94729_c1 3300050515 Bacteria 2885
952 nmdc:mga0a205_959868_c1 3300050515 Bacteria 702
953 Ga0495601_0010275 3300053077 Bacteria 5567
954 Ga0495601_0025087 3300053077 Bacteria 3675
955 Ga0495601_0461116 3300053077 Bacteria 821
956 Ga0495612_0113192 3300053078 Unclassified 1163
957 Ga0495612_0544750 3300053078 Bacteria 534
958 Ga0495655_0047399 3300053083 Bacteria 1124
959 Ga0495595_0479171 3300053084 Bacteria 633
960 Ga0495619_0005559 3300053085 Bacteria 7999
961 Ga0495619_0009832 3300053085 Bacteria 6029
962 Ga0495619_0080455 3300053085 Unclassified 2193
963 Ga0495619_0081089 3300053085 Bacteria 2184
964 Ga0495619_0462316 3300053085 Bacteria 874
965 Ga0530510_0733527 3300061734 Unclassified 753

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0669244 Ga0495628_0669244_303_719 134
2 3300005456 Ga0070678_101185256 Ga0070678_1011852562 148
3 3300007788 Ga0099795_10400193 Ga0099795_104001931 148
4 3300014969 Ga0157376_10014139 Ga0157376_100141393 148
5 3300025898 Ga0207692_10808069 Ga0207692_108080691 148
6 3300026088 Ga0207641_10555416 Ga0207641_105554162 148
7 3300035695 Ga0373927_0757209 Ga0373927_0757209_45_515 148
8 3300035118 Ga0373954_0308422 Ga0373954_0308422_141_608 149
9 3300035410 Ga0373924_0012321 Ga0373924_0012321_1911_2378 149
10 3300035724 Ga0373933_0236551 Ga0373933_0236551_641_1108 149
11 3300036401 Ga0373937_0014245 Ga0373937_0014245_5587_6054 149
12 3300041509 Ga0451843_0352523 Ga0451843_0352523_74_541 149
13 3300046458 Ga0495591_031022 Ga0495591_031022_61_510 149
14 3300046511 Ga0495608_0019989 Ga0495608_0019989_2341_2808 149
15 3300046514 Ga0495618_0074366 Ga0495618_0074366_716_1183 149
16 3300046517 Ga0495630_0121217 Ga0495630_0121217_194_661 149
17 3300046559 Ga0495667_0021607 Ga0495667_0021607_546_1013 149
18 3300046675 Ga0495657_0001786 Ga0495657_0001786_16896_17363 149
19 3300046809 Ga0495600_0431272 Ga0495600_0431272_93_560 149
20 3300047444 Ga0495675_0199333 Ga0495675_0199333_108_575 149
21 3300047471 Ga0495684_0067277 Ga0495684_0067277_1176_1643 149
22 3300048088 Ga0495602_0919688 Ga0495602_0919688_18_482 149
23 3300053085 Ga0495619_0005559 Ga0495619_0005559_1836_2303 149
24 3300005439 Ga0070711_100025976 Ga0070711_1000259763 150
25 3300005614 Ga0068856_101045116 Ga0068856_1010451162 150
26 3300007265 Ga0099794_10011923 Ga0099794_100119233 150
27 3300025916 Ga0207663_10445217 Ga0207663_104452172 150
28 3300026078 Ga0207702_10378897 Ga0207702_103788972 150
29 3300036401 Ga0373937_0688370 Ga0373937_0688370_114_566 150
30 3300046529 Ga0495652_1059032 Ga0495652_1059032_24_476 150
31 3300047471 Ga0495684_0744010 Ga0495684_0744010_22_474 150
32 3300005289 Ga0065704_10205451 Ga0065704_102054512 151
33 3300005295 Ga0065707_10246195 Ga0065707_102461952 151
34 3300005334 Ga0068869_101077851 Ga0068869_1010778512 151
35 3300005335 Ga0070666_10233322 Ga0070666_102333222 151
36 3300005338 Ga0068868_100061736 Ga0068868_1000617362 151
37 3300005355 Ga0070671_100740254 Ga0070671_1007402542 151
38 3300005356 Ga0070674_100902189 Ga0070674_1009021892 151
39 3300005364 Ga0070673_100472539 Ga0070673_1004725392 151
40 3300005445 Ga0070708_100056693 Ga0070708_1000566931 151
41 3300005456 Ga0070678_100456831 Ga0070678_1004568312 151
42 3300005459 Ga0068867_100386555 Ga0068867_1003865551 151
43 3300005467 Ga0070706_100021716 Ga0070706_1000217166 151
44 3300005468 Ga0070707_100016485 Ga0070707_1000164852 151
45 3300005518 Ga0070699_100222791 Ga0070699_1002227911 151
46 3300005544 Ga0070686_100243733 Ga0070686_1002437332 151
47 3300005548 Ga0070665_100253268 Ga0070665_1002532682 151
48 3300005843 Ga0068860_100546898 Ga0068860_1005468982 151
49 3300006237 Ga0097621_100003859 Ga0097621_1000038592 151
50 3300006237 Ga0097621_100408523 Ga0097621_1004085232 151
51 3300006358 Ga0068871_100043381 Ga0068871_1000433813 151
52 3300006358 Ga0068871_100065352 Ga0068871_1000653521 151
53 3300006871 Ga0075434_100915775 Ga0075434_1009157752 151
54 3300006881 Ga0068865_100010201 Ga0068865_1000102015 151
55 3300009098 Ga0105245_10053235 Ga0105245_100532353 151
56 3300009098 Ga0105245_12472774 Ga0105245_124727741 151
57 3300009147 Ga0114129_10528208 Ga0114129_105282082 151
58 3300009148 Ga0105243_10509341 Ga0105243_105093412 151
59 3300009176 Ga0105242_10104861 Ga0105242_101048613 151
60 3300009176 Ga0105242_11934323 Ga0105242_119343232 151
61 3300009177 Ga0105248_10025818 Ga0105248_100258183 151
62 3300009177 Ga0105248_10036500 Ga0105248_100365006 151
63 3300009551 Ga0105238_10244453 Ga0105238_102444532 151
64 3300013297 Ga0157378_11073682 Ga0157378_110736821 151
65 3300013306 Ga0163162_10323767 Ga0163162_103237672 151
66 3300013308 Ga0157375_10335476 Ga0157375_103354762 151
67 3300014969 Ga0157376_10035926 Ga0157376_100359264 151
68 3300014969 Ga0157376_11378782 Ga0157376_113787822 151
69 3300025910 Ga0207684_10094665 Ga0207684_100946651 151
70 3300025922 Ga0207646_10026114 Ga0207646_100261142 151
71 3300025931 Ga0207644_10321233 Ga0207644_103212332 151
72 3300025934 Ga0207686_11458307 Ga0207686_114583071 151
73 3300025937 Ga0207669_10674776 Ga0207669_106747762 151
74 3300025941 Ga0207711_11049257 Ga0207711_110492571 151
75 3300025941 Ga0207711_11087951 Ga0207711_110879512 151
76 3300025960 Ga0207651_10265733 Ga0207651_102657332 151
77 3300026035 Ga0207703_10756484 Ga0207703_107564841 151
78 3300026067 Ga0207678_11566432 Ga0207678_115664321 151
79 3300026121 Ga0207683_10409672 Ga0207683_104096722 151
80 3300035118 Ga0373954_0572893 Ga0373954_0572893_21_479 151
81 3300035119 Ga0373956_0072790 Ga0373956_0072790_51_509 151
82 3300035172 Ga0373955_0141987 Ga0373955_0141987_745_1203 151
83 3300035692 Ga0373935_0515391 Ga0373935_0515391_370_828 151
84 3300035724 Ga0373933_0299634 Ga0373933_0299634_199_657 151
85 3300036401 Ga0373937_1710923 Ga0373937_1710923_66_524 151
86 3300039447 Ga0436361_0481279 Ga0436361_0481279_339_794 151
87 3300046459 Ga0495629_0206406 Ga0495629_0206406_518_976 151
88 3300046461 Ga0495641_0157720 Ga0495641_0157720_104_562 151
89 3300046476 Ga0495662_0333473 Ga0495662_0333473_21_479 151
90 3300046543 Ga0495645_0637842 Ga0495645_0637842_64_519 151
91 3300046642 Ga0495634_0482094 Ga0495634_0482094_123_581 151
92 3300048903 Ga0496100_0051860 Ga0496100_0051860_552_1010 151
93 3300048904 Ga0496101_0014720 Ga0496101_0014720_2905_3363 151
94 3300048905 Ga0496102_0141525 Ga0496102_0141525_67_525 151
95 3300048907 Ga0496104_1709966 Ga0496104_1709966_37_495 151
96 3300048908 Ga0496105_0307586 Ga0496105_0307586_539_997 151
97 3300048908 Ga0496105_0484311 Ga0496105_0484311_246_704 151
98 3300048910 Ga0496107_0036722 Ga0496107_0036722_3032_3490 151
99 3300048918 Ga0496115_0089709 Ga0496115_0089709_1256_1714 151
100 3300049824 Ga0501045_0426208 Ga0501045_0426208_443_913 151
101 3300050512 nmdc:mga0n895_180357_c1 nmdc:mga0n895_180357_c1_593_1048 151
102 3300050514 nmdc:mga08x19_47150_c1 nmdc:mga08x19_47150_c1_1626_2081 151
103 3300053085 Ga0495619_0462316 Ga0495619_0462316_79_537 151
104 3300005331 Ga0070670_100048236 Ga0070670_1000482364 152
105 3300005438 Ga0070701_10381855 Ga0070701_103818551 152
106 3300005458 Ga0070681_10768574 Ga0070681_107685742 152
107 3300005518 Ga0070699_100975958 Ga0070699_1009759582 152
108 3300005549 Ga0070704_100033380 Ga0070704_1000333804 152
109 3300009147 Ga0114129_10196805 Ga0114129_101968051 152
110 3300009147 Ga0114129_10731549 Ga0114129_107315492 152
111 3300035114 Ga0373939_0187369 Ga0373939_0187369_190_657 152
112 3300048904 Ga0496101_0201882 Ga0496101_0201882_319_786 152
113 3300048907 Ga0496104_0003063 Ga0496104_0003063_13837_14304 152
114 3300048907 Ga0496104_0009201 Ga0496104_0009201_2096_2563 152
115 3300048908 Ga0496105_0041428 Ga0496105_0041428_1511_1978 152
116 3300048909 Ga0496106_0192272 Ga0496106_0192272_1142_1609 152
117 3300048910 Ga0496107_0215504 Ga0496107_0215504_789_1256 152
118 3300048911 Ga0496108_0029096 Ga0496108_0029096_2015_2482 152
119 3300048912 Ga0496109_0229630 Ga0496109_0229630_1260_1727 152
120 3300048913 Ga0496110_0494998 Ga0496110_0494998_388_855 152
121 3300048915 Ga0496112_0552791 Ga0496112_0552791_120_587 152
122 3300048918 Ga0496115_0094720 Ga0496115_0094720_36_503 152
123 3300050507 nmdc:mga05p37_304676_c1 nmdc:mga05p37_304676_c1_1405_1881 152
124 3300005347 Ga0070668_100460564 Ga0070668_1004605641 153
125 3300005354 Ga0070675_100104818 Ga0070675_1001048183 153
126 3300005436 Ga0070713_100068018 Ga0070713_1000680181 153
127 3300005457 Ga0070662_100347711 Ga0070662_1003477112 153
128 3300005458 Ga0070681_11055347 Ga0070681_110553471 153
129 3300005840 Ga0068870_10143071 Ga0068870_101430712 153
130 3300005937 Ga0081455_10065788 Ga0081455_100657882 153
131 3300005983 Ga0081540_1153816 Ga0081540_11538162 153
132 3300006028 Ga0070717_10009977 Ga0070717_100099776 153
133 3300006042 Ga0075368_10288463 Ga0075368_102884632 153
134 3300006237 Ga0097621_100056795 Ga0097621_1000567952 153
135 3300006871 Ga0075434_100654203 Ga0075434_1006542032 153
136 3300007076 Ga0075435_100251502 Ga0075435_1002515022 153
137 3300007076 Ga0075435_100809078 Ga0075435_1008090781 153
138 3300009147 Ga0114129_10271801 Ga0114129_102718012 153
139 3300009148 Ga0105243_11020737 Ga0105243_110207372 153
140 3300009177 Ga0105248_10536500 Ga0105248_105365002 153
141 3300014969 Ga0157376_10360050 Ga0157376_103600502 153
142 3300022467 Ga0224712_10003138 Ga0224712_100031382 153
143 3300025315 Ga0207697_10189254 Ga0207697_101892542 153
144 3300025893 Ga0207682_10017781 Ga0207682_100177812 153
145 3300025912 Ga0207707_10779401 Ga0207707_107794011 153
146 3300025925 Ga0207650_10669881 Ga0207650_106698812 153
147 3300025937 Ga0207669_10105154 Ga0207669_101051542 153
148 3300025972 Ga0207668_10436201 Ga0207668_104362011 153
149 3300025981 Ga0207640_10931352 Ga0207640_109313522 153
150 3300026121 Ga0207683_10064073 Ga0207683_100640732 153
151 3300026121 Ga0207683_11396317 Ga0207683_113963171 153
152 3300027617 Ga0210002_1029676 Ga0210002_10296762 153
153 3300027671 Ga0209588_1028656 Ga0209588_10286562 153
154 3300035114 Ga0373939_0032575 Ga0373939_0032575_421_885 153
155 3300035170 Ga0373943_0175446 Ga0373943_0175446_302_769 153
156 3300035695 Ga0373927_0013854 Ga0373927_0013854_177_641 153
157 3300035725 Ga0373947_0650992 Ga0373947_0650992_82_546 153
158 3300036401 Ga0373937_1855746 Ga0373937_1855746_40_507 153
159 3300037068 Ga0373925_0026267 Ga0373925_0026267_994_1458 153
160 3300037068 Ga0373925_0307013 Ga0373925_0307013_142_609 153
161 3300046472 Ga0495580_0436195 Ga0495580_0436195_238_705 153
162 3300046531 Ga0495665_0160666 Ga0495665_0160666_341_805 153
163 3300046531 Ga0495665_0319687 Ga0495665_0319687_81_566 153
164 3300046557 Ga0495622_0263691 Ga0495622_0263691_109_573 153
165 3300046683 Ga0495658_0133088 Ga0495658_0133088_990_1454 153
166 3300046683 Ga0495658_0190355 Ga0495658_0190355_591_1058 153
167 3300046689 Ga0495613_0052429 Ga0495613_0052429_948_1412 153
168 3300047315 Ga0495581_0032318 Ga0495581_0032318_819_1283 153
169 3300048906 Ga0496103_0678130 Ga0496103_0678130_100_564 153
170 3300048907 Ga0496104_0150665 Ga0496104_0150665_1709_2173 153
171 3300048908 Ga0496105_0136114 Ga0496105_0136114_820_1284 153
172 3300048909 Ga0496106_0041843 Ga0496106_0041843_1657_2121 153
173 3300050512 nmdc:mga0n895_732268_c1 nmdc:mga0n895_732268_c1_213_674 153
174 3300001991 JGI24743J22301_10011361 JGI24743J22301_100113612 154
175 3300002070 JGI24750J21931_1003575 JGI24750J21931_10035752 154
176 3300002074 JGI24748J21848_1007802 JGI24748J21848_10078022 154
177 3300002075 JGI24738J21930_10007172 JGI24738J21930_100071721 154
178 3300002076 JGI24749J21850_1013147 JGI24749J21850_10131471 154
179 3300002077 JGI24744J21845_10002967 JGI24744J21845_100029672 154
180 3300002239 JGI24034J26672_10004889 JGI24034J26672_100048893 154
181 3300005289 Ga0065704_10098888 Ga0065704_100988882 154
182 3300005293 Ga0065715_10005647 Ga0065715_100056472 154
183 3300005293 Ga0065715_10727806 Ga0065715_107278062 154
184 3300005293 Ga0065715_10727857 Ga0065715_107278571 154
185 3300005295 Ga0065707_10002482 Ga0065707_100024823 154
186 3300005295 Ga0065707_10482911 Ga0065707_104829111 154
187 3300005328 Ga0070676_10359797 Ga0070676_103597971 154
188 3300005329 Ga0070683_100003648 Ga0070683_1000036485 154
189 3300005329 Ga0070683_100094505 Ga0070683_1000945052 154
190 3300005329 Ga0070683_101256863 Ga0070683_1012568632 154
191 3300005331 Ga0070670_100007003 Ga0070670_1000070037 154
192 3300005331 Ga0070670_100023624 Ga0070670_1000236243 154
193 3300005331 Ga0070670_100055058 Ga0070670_1000550584 154
194 3300005334 Ga0068869_100037520 Ga0068869_1000375202 154
195 3300005334 Ga0068869_100186003 Ga0068869_1001860032 154
196 3300005334 Ga0068869_100601594 Ga0068869_1006015942 154
197 3300005334 Ga0068869_100880064 Ga0068869_1008800641 154
198 3300005335 Ga0070666_10005780 Ga0070666_100057803 154
199 3300005335 Ga0070666_10181488 Ga0070666_101814882 154
200 3300005337 Ga0070682_100080773 Ga0070682_1000807734 154
201 3300005337 Ga0070682_100110649 Ga0070682_1001106492 154
202 3300005338 Ga0068868_100089007 Ga0068868_1000890072 154
203 3300005338 Ga0068868_101077290 Ga0068868_1010772902 154
204 3300005339 Ga0070660_100084758 Ga0070660_1000847582 154
205 3300005340 Ga0070689_100006108 Ga0070689_10000610810 154
206 3300005340 Ga0070689_100052234 Ga0070689_1000522341 154
207 3300005341 Ga0070691_10063770 Ga0070691_100637702 154
208 3300005341 Ga0070691_10504666 Ga0070691_105046661 154
209 3300005343 Ga0070687_100020271 Ga0070687_1000202712 154
210 3300005343 Ga0070687_100049790 Ga0070687_1000497902 154
211 3300005343 Ga0070687_100406041 Ga0070687_1004060412 154
212 3300005344 Ga0070661_100005776 Ga0070661_1000057766 154
213 3300005345 Ga0070692_10002304 Ga0070692_100023046 154
214 3300005345 Ga0070692_10019608 Ga0070692_100196082 154
215 3300005345 Ga0070692_10035915 Ga0070692_100359152 154
216 3300005345 Ga0070692_10721997 Ga0070692_107219971 154
217 3300005353 Ga0070669_100000833 Ga0070669_1000008339 154
218 3300005353 Ga0070669_100070078 Ga0070669_1000700782 154
219 3300005354 Ga0070675_100000609 Ga0070675_1000006097 154
220 3300005354 Ga0070675_100005913 Ga0070675_1000059138 154
221 3300005354 Ga0070675_100144567 Ga0070675_1001445672 154
222 3300005354 Ga0070675_100527070 Ga0070675_1005270701 154
223 3300005355 Ga0070671_100037506 Ga0070671_1000375061 154
224 3300005355 Ga0070671_100074626 Ga0070671_1000746261 154
225 3300005356 Ga0070674_100295969 Ga0070674_1002959693 154
226 3300005364 Ga0070673_100011573 Ga0070673_1000115733 154
227 3300005364 Ga0070673_100044170 Ga0070673_1000441702 154
228 3300005364 Ga0070673_100857731 Ga0070673_1008577312 154
229 3300005365 Ga0070688_100049487 Ga0070688_1000494872 154
230 3300005366 Ga0070659_100170484 Ga0070659_1001704843 154
231 3300005367 Ga0070667_100024923 Ga0070667_1000249234 154
232 3300005367 Ga0070667_100353373 Ga0070667_1003533732 154
233 3300005406 Ga0070703_10030035 Ga0070703_100300352 154
234 3300005435 Ga0070714_100221791 Ga0070714_1002217911 154
235 3300005435 Ga0070714_100630850 Ga0070714_1006308502 154
236 3300005436 Ga0070713_100146057 Ga0070713_1001460572 154
237 3300005436 Ga0070713_100393836 Ga0070713_1003938362 154
238 3300005436 Ga0070713_100557764 Ga0070713_1005577641 154
239 3300005438 Ga0070701_10004621 Ga0070701_100046213 154
240 3300005438 Ga0070701_10005760 Ga0070701_100057602 154
241 3300005438 Ga0070701_10028041 Ga0070701_100280413 154
242 3300005438 Ga0070701_10191699 Ga0070701_101916992 154
243 3300005440 Ga0070705_100017489 Ga0070705_1000174893 154
244 3300005440 Ga0070705_100068449 Ga0070705_1000684492 154
245 3300005440 Ga0070705_100096918 Ga0070705_1000969183 154
246 3300005441 Ga0070700_100034579 Ga0070700_1000345792 154
247 3300005441 Ga0070700_100265026 Ga0070700_1002650262 154
248 3300005441 Ga0070700_100438885 Ga0070700_1004388851 154
249 3300005444 Ga0070694_100010451 Ga0070694_1000104513 154
250 3300005444 Ga0070694_100018066 Ga0070694_1000180662 154
251 3300005444 Ga0070694_100030344 Ga0070694_1000303443 154
252 3300005444 Ga0070694_100130780 Ga0070694_1001307802 154
253 3300005444 Ga0070694_100133034 Ga0070694_1001330342 154
254 3300005444 Ga0070694_100175000 Ga0070694_1001750003 154
255 3300005445 Ga0070708_100081314 Ga0070708_1000813142 154
256 3300005445 Ga0070708_100329970 Ga0070708_1003299701 154
257 3300005445 Ga0070708_100537228 Ga0070708_1005372282 154
258 3300005455 Ga0070663_100886730 Ga0070663_1008867302 154
259 3300005456 Ga0070678_100403137 Ga0070678_1004031372 154
260 3300005456 Ga0070678_100663397 Ga0070678_1006633971 154
261 3300005457 Ga0070662_100107626 Ga0070662_1001076262 154
262 3300005458 Ga0070681_10009310 Ga0070681_100093103 154
263 3300005458 Ga0070681_10024462 Ga0070681_100244627 154
264 3300005458 Ga0070681_10710553 Ga0070681_107105531 154
265 3300005459 Ga0068867_100000156 Ga0068867_10000015644 154
266 3300005459 Ga0068867_100123668 Ga0068867_1001236682 154
267 3300005459 Ga0068867_100186611 Ga0068867_1001866113 154
268 3300005466 Ga0070685_10121017 Ga0070685_101210173 154
269 3300005467 Ga0070706_100000006 Ga0070706_10000000672 154
270 3300005467 Ga0070706_100168199 Ga0070706_1001681993 154
271 3300005467 Ga0070706_100315408 Ga0070706_1003154082 154
272 3300005467 Ga0070706_100539001 Ga0070706_1005390012 154
273 3300005467 Ga0070706_100592467 Ga0070706_1005924671 154
274 3300005467 Ga0070706_100709004 Ga0070706_1007090042 154
275 3300005468 Ga0070707_100006432 Ga0070707_1000064322 154
276 3300005468 Ga0070707_100163529 Ga0070707_1001635292 154
277 3300005471 Ga0070698_100005560 Ga0070698_10000556011 154
278 3300005471 Ga0070698_100008137 Ga0070698_10000813710 154
279 3300005471 Ga0070698_100070715 Ga0070698_1000707152 154
280 3300005471 Ga0070698_100353804 Ga0070698_1003538041 154
281 3300005471 Ga0070698_100653527 Ga0070698_1006535272 154
282 3300005518 Ga0070699_100007784 Ga0070699_1000077849 154
283 3300005518 Ga0070699_100019523 Ga0070699_1000195235 154
284 3300005518 Ga0070699_100037999 Ga0070699_1000379993 154
285 3300005518 Ga0070699_100131116 Ga0070699_1001311162 154
286 3300005518 Ga0070699_100160990 Ga0070699_1001609902 154
287 3300005518 Ga0070699_100255182 Ga0070699_1002551822 154
288 3300005535 Ga0070684_100000593 Ga0070684_1000005933 154
289 3300005535 Ga0070684_100205027 Ga0070684_1002050272 154
290 3300005535 Ga0070684_100280532 Ga0070684_1002805322 154
291 3300005536 Ga0070697_100005622 Ga0070697_1000056229 154
292 3300005536 Ga0070697_100046992 Ga0070697_1000469926 154
293 3300005536 Ga0070697_100076269 Ga0070697_1000762692 154
294 3300005536 Ga0070697_100088380 Ga0070697_1000883802 154
295 3300005536 Ga0070697_100959519 Ga0070697_1009595191 154
296 3300005539 Ga0068853_100065714 Ga0068853_1000657142 154
297 3300005543 Ga0070672_100043045 Ga0070672_1000430452 154
298 3300005543 Ga0070672_100077846 Ga0070672_1000778462 154
299 3300005543 Ga0070672_100140013 Ga0070672_1001400131 154
300 3300005544 Ga0070686_100525837 Ga0070686_1005258372 154
301 3300005544 Ga0070686_100669873 Ga0070686_1006698731 154
302 3300005545 Ga0070695_100000076 Ga0070695_1000000764 154
303 3300005545 Ga0070695_100092972 Ga0070695_1000929722 154
304 3300005545 Ga0070695_100187772 Ga0070695_1001877722 154
305 3300005545 Ga0070695_100268582 Ga0070695_1002685822 154
306 3300005545 Ga0070695_101013655 Ga0070695_1010136551 154
307 3300005545 Ga0070695_101072201 Ga0070695_1010722011 154
308 3300005546 Ga0070696_100011537 Ga0070696_1000115373 154
309 3300005546 Ga0070696_100088596 Ga0070696_1000885962 154
310 3300005546 Ga0070696_101139862 Ga0070696_1011398621 154
311 3300005546 Ga0070696_101255631 Ga0070696_1012556311 154
312 3300005547 Ga0070693_100025364 Ga0070693_1000253642 154
313 3300005548 Ga0070665_100975798 Ga0070665_1009757981 154
314 3300005549 Ga0070704_100000290 Ga0070704_10000029016 154
315 3300005549 Ga0070704_100103430 Ga0070704_1001034303 154
316 3300005549 Ga0070704_100133408 Ga0070704_1001334082 154
317 3300005549 Ga0070704_100140732 Ga0070704_1001407323 154
318 3300005549 Ga0070704_100617605 Ga0070704_1006176052 154
319 3300005549 Ga0070704_100697619 Ga0070704_1006976192 154
320 3300005563 Ga0068855_100001557 Ga0068855_10000155714 154
321 3300005563 Ga0068855_101227947 Ga0068855_1012279471 154
322 3300005564 Ga0070664_100001006 Ga0070664_1000010063 154
323 3300005564 Ga0070664_100057063 Ga0070664_1000570632 154
324 3300005564 Ga0070664_100238657 Ga0070664_1002386572 154
325 3300005564 Ga0070664_100346893 Ga0070664_1003468932 154
326 3300005577 Ga0068857_100004183 Ga0068857_10000418310 154
327 3300005577 Ga0068857_100020929 Ga0068857_1000209296 154
328 3300005614 Ga0068856_100201340 Ga0068856_1002013403 154
329 3300005614 Ga0068856_100236957 Ga0068856_1002369572 154
330 3300005614 Ga0068856_100583600 Ga0068856_1005836002 154
331 3300005614 Ga0068856_100842867 Ga0068856_1008428671 154
332 3300005615 Ga0070702_100007457 Ga0070702_1000074573 154
333 3300005616 Ga0068852_100044420 Ga0068852_1000444203 154
334 3300005616 Ga0068852_100407829 Ga0068852_1004078292 154
335 3300005616 Ga0068852_100498714 Ga0068852_1004987141 154
336 3300005617 Ga0068859_100002969 Ga0068859_10000296913 154
337 3300005617 Ga0068859_100054432 Ga0068859_1000544323 154
338 3300005617 Ga0068859_100055535 Ga0068859_1000555352 154
339 3300005617 Ga0068859_100888731 Ga0068859_1008887312 154
340 3300005618 Ga0068864_100029088 Ga0068864_1000290882 154
341 3300005618 Ga0068864_100066440 Ga0068864_1000664402 154
342 3300005618 Ga0068864_100113720 Ga0068864_1001137202 154
343 3300005618 Ga0068864_100406486 Ga0068864_1004064861 154
344 3300005618 Ga0068864_100457602 Ga0068864_1004576022 154
345 3300005618 Ga0068864_101029357 Ga0068864_1010293572 154
346 3300005718 Ga0068866_10019531 Ga0068866_100195312 154
347 3300005719 Ga0068861_100002891 Ga0068861_1000028912 154
348 3300005719 Ga0068861_100099175 Ga0068861_1000991752 154
349 3300005834 Ga0068851_10189188 Ga0068851_101891881 154
350 3300005840 Ga0068870_10023082 Ga0068870_100230822 154
351 3300005840 Ga0068870_10091009 Ga0068870_100910092 154
352 3300005840 Ga0068870_10507874 Ga0068870_105078742 154
353 3300005841 Ga0068863_100063192 Ga0068863_1000631922 154
354 3300005841 Ga0068863_100120259 Ga0068863_1001202592 154
355 3300005842 Ga0068858_100017104 Ga0068858_1000171042 154
356 3300005842 Ga0068858_100027876 Ga0068858_1000278763 154
357 3300005842 Ga0068858_100423333 Ga0068858_1004233332 154
358 3300005843 Ga0068860_100013106 Ga0068860_1000131069 154
359 3300005843 Ga0068860_100018719 Ga0068860_1000187195 154
360 3300005843 Ga0068860_100121854 Ga0068860_1001218542 154
361 3300005843 Ga0068860_100132207 Ga0068860_1001322072 154
362 3300005844 Ga0068862_100001535 Ga0068862_10000153516 154
363 3300005844 Ga0068862_100038147 Ga0068862_1000381472 154
364 3300005844 Ga0068862_100092126 Ga0068862_1000921263 154
365 3300005844 Ga0068862_100187686 Ga0068862_1001876862 154
366 3300005937 Ga0081455_10000226 Ga0081455_1000022665 154
367 3300005937 Ga0081455_10057182 Ga0081455_100571823 154
368 3300005983 Ga0081540_1028604 Ga0081540_10286041 154
369 3300006038 Ga0075365_10076119 Ga0075365_100761192 154
370 3300006038 Ga0075365_10378392 Ga0075365_103783921 154
371 3300006058 Ga0075432_10034783 Ga0075432_100347833 154
372 3300006173 Ga0070716_100440109 Ga0070716_1004401091 154
373 3300006175 Ga0070712_101430321 Ga0070712_1014303211 154
374 3300006177 Ga0075362_10095754 Ga0075362_100957542 154
375 3300006177 Ga0075362_10377078 Ga0075362_103770781 154
376 3300006178 Ga0075367_10149424 Ga0075367_101494241 154
377 3300006237 Ga0097621_100015822 Ga0097621_1000158223 154
378 3300006237 Ga0097621_100213726 Ga0097621_1002137262 154
379 3300006237 Ga0097621_100429022 Ga0097621_1004290222 154
380 3300006237 Ga0097621_100572561 Ga0097621_1005725612 154
381 3300006353 Ga0075370_10174715 Ga0075370_101747153 154
382 3300006358 Ga0068871_100048016 Ga0068871_1000480161 154
383 3300006358 Ga0068871_100229011 Ga0068871_1002290112 154
384 3300006358 Ga0068871_100379425 Ga0068871_1003794252 154
385 3300006358 Ga0068871_101005510 Ga0068871_1010055102 154
386 3300006844 Ga0075428_100016948 Ga0075428_1000169483 154
387 3300006844 Ga0075428_100102590 Ga0075428_1001025902 154
388 3300006844 Ga0075428_100672416 Ga0075428_1006724162 154
389 3300006846 Ga0075430_100733325 Ga0075430_1007333251 154
390 3300006847 Ga0075431_100107857 Ga0075431_1001078572 154
391 3300006847 Ga0075431_100830049 Ga0075431_1008300492 154
392 3300006852 Ga0075433_10072556 Ga0075433_100725562 154
393 3300006852 Ga0075433_10359297 Ga0075433_103592972 154
394 3300006852 Ga0075433_10362326 Ga0075433_103623262 154
395 3300006852 Ga0075433_10593956 Ga0075433_105939562 154
396 3300006871 Ga0075434_100003572 Ga0075434_1000035728 154
397 3300006871 Ga0075434_100037514 Ga0075434_1000375144 154
398 3300006871 Ga0075434_100096263 Ga0075434_1000962632 154
399 3300006871 Ga0075434_100338448 Ga0075434_1003384482 154
400 3300006871 Ga0075434_101129184 Ga0075434_1011291842 154
401 3300006871 Ga0075434_101289100 Ga0075434_1012891001 154
402 3300006880 Ga0075429_100043230 Ga0075429_1000432302 154
403 3300006880 Ga0075429_100078330 Ga0075429_1000783302 154
404 3300006881 Ga0068865_100021178 Ga0068865_1000211783 154
405 3300006881 Ga0068865_100068213 Ga0068865_1000682132 154
406 3300006881 Ga0068865_101329647 Ga0068865_1013296472 154
407 3300006914 Ga0075436_100667354 Ga0075436_1006673542 154
408 3300006914 Ga0075436_100749045 Ga0075436_1007490452 154
409 3300006931 Ga0097620_100002969 Ga0097620_10000296913 154
410 3300006931 Ga0097620_100054431 Ga0097620_1000544313 154
411 3300006931 Ga0097620_100055537 Ga0097620_1000555372 154
412 3300006931 Ga0097620_100888744 Ga0097620_1008887442 154
413 3300007076 Ga0075435_100185026 Ga0075435_1001850262 154
414 3300007076 Ga0075435_100207126 Ga0075435_1002071262 154
415 3300007076 Ga0075435_100214219 Ga0075435_1002142191 154
416 3300007076 Ga0075435_100453048 Ga0075435_1004530482 154
417 3300007076 Ga0075435_101140303 Ga0075435_1011403032 154
418 3300009092 Ga0105250_10073847 Ga0105250_100738472 154
419 3300009093 Ga0105240_10001330 Ga0105240_100013302 154
420 3300009094 Ga0111539_10203466 Ga0111539_102034662 154
421 3300009094 Ga0111539_10250089 Ga0111539_102500893 154
422 3300009094 Ga0111539_10295811 Ga0111539_102958112 154
423 3300009094 Ga0111539_10781978 Ga0111539_107819782 154
424 3300009098 Ga0105245_10077693 Ga0105245_100776932 154
425 3300009098 Ga0105245_10171053 Ga0105245_101710532 154
426 3300009101 Ga0105247_10008977 Ga0105247_100089773 154
427 3300009147 Ga0114129_10011440 Ga0114129_1001144012 154
428 3300009147 Ga0114129_10022153 Ga0114129_100221533 154
429 3300009147 Ga0114129_10198157 Ga0114129_101981572 154
430 3300009147 Ga0114129_10238507 Ga0114129_102385072 154
431 3300009147 Ga0114129_10311992 Ga0114129_103119922 154
432 3300009147 Ga0114129_10431959 Ga0114129_104319592 154
433 3300009147 Ga0114129_10550738 Ga0114129_105507382 154
434 3300009147 Ga0114129_10594414 Ga0114129_105944142 154
435 3300009147 Ga0114129_10740298 Ga0114129_107402981 154
436 3300009147 Ga0114129_11012391 Ga0114129_110123912 154
437 3300009148 Ga0105243_10141993 Ga0105243_101419931 154
438 3300009148 Ga0105243_10516184 Ga0105243_105161842 154
439 3300009148 Ga0105243_10856486 Ga0105243_108564861 154
440 3300009174 Ga0105241_10059818 Ga0105241_100598182 154
441 3300009174 Ga0105241_10092818 Ga0105241_100928182 154
442 3300009174 Ga0105241_10144541 Ga0105241_101445413 154
443 3300009176 Ga0105242_10009807 Ga0105242_100098072 154
444 3300009176 Ga0105242_10016619 Ga0105242_100166192 154
445 3300009176 Ga0105242_10049142 Ga0105242_100491423 154
446 3300009176 Ga0105242_10090718 Ga0105242_100907182 154
447 3300009176 Ga0105242_10488988 Ga0105242_104889882 154
448 3300009176 Ga0105242_11639382 Ga0105242_116393821 154
449 3300009176 Ga0105242_12060601 Ga0105242_120606011 154
450 3300009177 Ga0105248_10024239 Ga0105248_100242394 154
451 3300009177 Ga0105248_10112799 Ga0105248_101127992 154
452 3300009177 Ga0105248_10253105 Ga0105248_102531052 154
453 3300009177 Ga0105248_10979019 Ga0105248_109790192 154
454 3300009545 Ga0105237_10069357 Ga0105237_100693572 154
455 3300009545 Ga0105237_10139161 Ga0105237_101391612 154
456 3300009545 Ga0105237_10185851 Ga0105237_101858512 154
457 3300009545 Ga0105237_11305299 Ga0105237_113052992 154
458 3300009551 Ga0105238_10005828 Ga0105238_100058288 154
459 3300009553 Ga0105249_10001223 Ga0105249_100012232 154
460 3300009553 Ga0105249_11148879 Ga0105249_111488792 154
461 3300010375 Ga0105239_10565288 Ga0105239_105652882 154
462 3300011119 Ga0105246_10175600 Ga0105246_101756002 154
463 3300011119 Ga0105246_10420803 Ga0105246_104208031 154
464 3300011119 Ga0105246_10504749 Ga0105246_105047491 154
465 3300011119 Ga0105246_10534124 Ga0105246_105341242 154
466 3300011119 Ga0105246_10546199 Ga0105246_105461991 154
467 3300012508 Ga0157315_1005180 Ga0157315_10051801 154
468 3300013102 Ga0157371_10375229 Ga0157371_103752291 154
469 3300013104 Ga0157370_10009355 Ga0157370_100093552 154
470 3300013104 Ga0157370_10230292 Ga0157370_102302922 154
471 3300013105 Ga0157369_10631415 Ga0157369_106314151 154
472 3300013296 Ga0157374_10062855 Ga0157374_100628552 154
473 3300013296 Ga0157374_10073858 Ga0157374_100738583 154
474 3300013296 Ga0157374_10301332 Ga0157374_103013322 154
475 3300013297 Ga0157378_10082855 Ga0157378_100828552 154
476 3300013297 Ga0157378_11237611 Ga0157378_112376112 154
477 3300013306 Ga0163162_10069114 Ga0163162_100691142 154
478 3300013306 Ga0163162_10117078 Ga0163162_101170782 154
479 3300013306 Ga0163162_10537592 Ga0163162_105375922 154
480 3300013306 Ga0163162_11067052 Ga0163162_110670522 154
481 3300013306 Ga0163162_12011155 Ga0163162_120111552 154
482 3300013307 Ga0157372_10114885 Ga0157372_101148852 154
483 3300013307 Ga0157372_11912900 Ga0157372_119129002 154
484 3300013308 Ga0157375_10056537 Ga0157375_100565372 154
485 3300013308 Ga0157375_10095545 Ga0157375_100955452 154
486 3300013308 Ga0157375_10682835 Ga0157375_106828352 154
487 3300013308 Ga0157375_11959054 Ga0157375_119590542 154
488 3300014325 Ga0163163_10027621 Ga0163163_100276211 154
489 3300014325 Ga0163163_10120750 Ga0163163_101207502 154
490 3300014325 Ga0163163_10156859 Ga0163163_101568593 154
491 3300014326 Ga0157380_10078136 Ga0157380_100781362 154
492 3300014326 Ga0157380_10551024 Ga0157380_105510241 154
493 3300014745 Ga0157377_10006418 Ga0157377_100064181 154
494 3300014968 Ga0157379_10007688 Ga0157379_100076886 154
495 3300014968 Ga0157379_10067866 Ga0157379_100678662 154
496 3300014968 Ga0157379_10983037 Ga0157379_109830371 154
497 3300014969 Ga0157376_10115121 Ga0157376_101151211 154
498 3300014969 Ga0157376_10245593 Ga0157376_102455932 154
499 3300014969 Ga0157376_10465284 Ga0157376_104652842 154
500 3300017792 Ga0163161_10073412 Ga0163161_100734122 154
501 3300017792 Ga0163161_10224990 Ga0163161_102249902 154
502 3300025315 Ga0207697_10080600 Ga0207697_100806002 154
503 3300025321 Ga0207656_10183454 Ga0207656_101834542 154
504 3300025885 Ga0207653_10111444 Ga0207653_101114441 154
505 3300025885 Ga0207653_10206557 Ga0207653_102065572 154
506 3300025885 Ga0207653_10273894 Ga0207653_102738942 154
507 3300025899 Ga0207642_10070945 Ga0207642_100709452 154
508 3300025901 Ga0207688_10003055 Ga0207688_100030559 154
509 3300025901 Ga0207688_10124807 Ga0207688_101248072 154
510 3300025903 Ga0207680_10217513 Ga0207680_102175131 154
511 3300025904 Ga0207647_10144210 Ga0207647_101442102 154
512 3300025907 Ga0207645_10044683 Ga0207645_100446831 154
513 3300025907 Ga0207645_10123370 Ga0207645_101233702 154
514 3300025908 Ga0207643_10008496 Ga0207643_100084963 154
515 3300025908 Ga0207643_10017500 Ga0207643_100175002 154
516 3300025908 Ga0207643_10100937 Ga0207643_101009372 154
517 3300025908 Ga0207643_10270825 Ga0207643_102708251 154
518 3300025910 Ga0207684_10000004 Ga0207684_10000004397 154
519 3300025910 Ga0207684_10034857 Ga0207684_100348572 154
520 3300025910 Ga0207684_10299980 Ga0207684_102999802 154
521 3300025910 Ga0207684_10596054 Ga0207684_105960541 154
522 3300025910 Ga0207684_11006118 Ga0207684_110061181 154
523 3300025910 Ga0207684_11011298 Ga0207684_110112982 154
524 3300025911 Ga0207654_10038891 Ga0207654_100388913 154
525 3300025911 Ga0207654_10172793 Ga0207654_101727931 154
526 3300025912 Ga0207707_10079898 Ga0207707_100798982 154
527 3300025912 Ga0207707_10237013 Ga0207707_102370132 154
528 3300025913 Ga0207695_10002411 Ga0207695_1000241111 154
529 3300025913 Ga0207695_10343044 Ga0207695_103430442 154
530 3300025913 Ga0207695_10468447 Ga0207695_104684472 154
531 3300025913 Ga0207695_11032223 Ga0207695_110322232 154
532 3300025914 Ga0207671_10115324 Ga0207671_101153242 154
533 3300025914 Ga0207671_10390103 Ga0207671_103901032 154
534 3300025914 Ga0207671_11032265 Ga0207671_110322652 154
535 3300025915 Ga0207693_10129071 Ga0207693_101290712 154
536 3300025916 Ga0207663_10900665 Ga0207663_109006652 154
537 3300025917 Ga0207660_10040125 Ga0207660_100401252 154
538 3300025917 Ga0207660_10136350 Ga0207660_101363501 154
539 3300025917 Ga0207660_10794446 Ga0207660_107944462 154
540 3300025918 Ga0207662_10018473 Ga0207662_100184732 154
541 3300025918 Ga0207662_10036843 Ga0207662_100368432 154
542 3300025918 Ga0207662_10651175 Ga0207662_106511751 154
543 3300025919 Ga0207657_10082888 Ga0207657_100828882 154
544 3300025919 Ga0207657_10538352 Ga0207657_105383522 154
545 3300025920 Ga0207649_10008732 Ga0207649_100087325 154
546 3300025920 Ga0207649_10399469 Ga0207649_103994692 154
547 3300025920 Ga0207649_10407022 Ga0207649_104070222 154
548 3300025920 Ga0207649_10547796 Ga0207649_105477962 154
549 3300025921 Ga0207652_10757141 Ga0207652_107571412 154
550 3300025922 Ga0207646_10044932 Ga0207646_100449322 154
551 3300025922 Ga0207646_10075989 Ga0207646_100759894 154
552 3300025922 Ga0207646_10571873 Ga0207646_105718732 154
553 3300025923 Ga0207681_10000292 Ga0207681_1000029212 154
554 3300025923 Ga0207681_10453554 Ga0207681_104535541 154
555 3300025924 Ga0207694_10067586 Ga0207694_100675863 154
556 3300025924 Ga0207694_10585255 Ga0207694_105852552 154
557 3300025925 Ga0207650_10005992 Ga0207650_100059927 154
558 3300025925 Ga0207650_10012968 Ga0207650_100129683 154
559 3300025926 Ga0207659_10000931 Ga0207659_1000093114 154
560 3300025926 Ga0207659_10287240 Ga0207659_102872402 154
561 3300025926 Ga0207659_11126087 Ga0207659_111260871 154
562 3300025927 Ga0207687_10050723 Ga0207687_100507232 154
563 3300025927 Ga0207687_10336048 Ga0207687_103360482 154
564 3300025928 Ga0207700_10392513 Ga0207700_103925131 154
565 3300025928 Ga0207700_10453801 Ga0207700_104538012 154
566 3300025929 Ga0207664_10951846 Ga0207664_109518462 154
567 3300025931 Ga0207644_10028794 Ga0207644_100287943 154
568 3300025931 Ga0207644_10042692 Ga0207644_100426922 154
569 3300025931 Ga0207644_10659563 Ga0207644_106595632 154
570 3300025932 Ga0207690_10224951 Ga0207690_102249512 154
571 3300025934 Ga0207686_10008069 Ga0207686_100080692 154
572 3300025934 Ga0207686_10029951 Ga0207686_100299511 154
573 3300025934 Ga0207686_10064624 Ga0207686_100646243 154
574 3300025934 Ga0207686_10119533 Ga0207686_101195332 154
575 3300025934 Ga0207686_10321383 Ga0207686_103213831 154
576 3300025934 Ga0207686_10370605 Ga0207686_103706052 154
577 3300025935 Ga0207709_10043079 Ga0207709_100430792 154
578 3300025935 Ga0207709_10088224 Ga0207709_100882242 154
579 3300025935 Ga0207709_10353896 Ga0207709_103538962 154
580 3300025936 Ga0207670_10145706 Ga0207670_101457061 154
581 3300025938 Ga0207704_10028908 Ga0207704_100289082 154
582 3300025938 Ga0207704_10039712 Ga0207704_100397122 154
583 3300025940 Ga0207691_10009425 Ga0207691_100094252 154
584 3300025940 Ga0207691_10048890 Ga0207691_100488901 154
585 3300025940 Ga0207691_10091716 Ga0207691_100917162 154
586 3300025940 Ga0207691_10748577 Ga0207691_107485772 154
587 3300025941 Ga0207711_10432753 Ga0207711_104327532 154
588 3300025941 Ga0207711_10486297 Ga0207711_104862972 154
589 3300025941 Ga0207711_10719115 Ga0207711_107191152 154
590 3300025941 Ga0207711_11133077 Ga0207711_111330772 154
591 3300025942 Ga0207689_10036911 Ga0207689_100369113 154
592 3300025942 Ga0207689_10183898 Ga0207689_101838982 154
593 3300025942 Ga0207689_10251978 Ga0207689_102519781 154
594 3300025942 Ga0207689_10560433 Ga0207689_105604331 154
595 3300025944 Ga0207661_10285102 Ga0207661_102851022 154
596 3300025945 Ga0207679_10040102 Ga0207679_100401022 154
597 3300025945 Ga0207679_10179748 Ga0207679_101797482 154
598 3300025945 Ga0207679_10394445 Ga0207679_103944452 154
599 3300025949 Ga0207667_10045803 Ga0207667_100458034 154
600 3300025949 Ga0207667_10231647 Ga0207667_102316472 154
601 3300025960 Ga0207651_10049127 Ga0207651_100491272 154
602 3300025960 Ga0207651_10161067 Ga0207651_101610672 154
603 3300025960 Ga0207651_10226725 Ga0207651_102267252 154
604 3300025961 Ga0207712_10003713 Ga0207712_100037133 154
605 3300025961 Ga0207712_10352061 Ga0207712_103520612 154
606 3300025972 Ga0207668_10005811 Ga0207668_100058112 154
607 3300025972 Ga0207668_10113129 Ga0207668_101131292 154
608 3300025986 Ga0207658_10081375 Ga0207658_100813752 154
609 3300025986 Ga0207658_10145076 Ga0207658_101450761 154
610 3300025986 Ga0207658_10286393 Ga0207658_102863932 154
611 3300026023 Ga0207677_10280726 Ga0207677_102807262 154
612 3300026035 Ga0207703_10035190 Ga0207703_100351903 154
613 3300026035 Ga0207703_10139824 Ga0207703_101398242 154
614 3300026035 Ga0207703_10946036 Ga0207703_109460362 154
615 3300026041 Ga0207639_10065889 Ga0207639_100658892 154
616 3300026041 Ga0207639_10185768 Ga0207639_101857681 154
617 3300026041 Ga0207639_11158263 Ga0207639_111582631 154
618 3300026041 Ga0207639_11456189 Ga0207639_114561891 154
619 3300026067 Ga0207678_10047770 Ga0207678_100477702 154
620 3300026067 Ga0207678_10073288 Ga0207678_100732882 154
621 3300026075 Ga0207708_10035720 Ga0207708_100357201 154
622 3300026075 Ga0207708_10052282 Ga0207708_100522822 154
623 3300026075 Ga0207708_10334248 Ga0207708_103342482 154
624 3300026078 Ga0207702_10173340 Ga0207702_101733402 154
625 3300026078 Ga0207702_10952531 Ga0207702_109525311 154
626 3300026078 Ga0207702_11418863 Ga0207702_114188631 154
627 3300026088 Ga0207641_10021744 Ga0207641_100217442 154
628 3300026088 Ga0207641_10049400 Ga0207641_100494003 154
629 3300026088 Ga0207641_10058812 Ga0207641_100588121 154
630 3300026088 Ga0207641_10171746 Ga0207641_101717462 154
631 3300026089 Ga0207648_10000938 Ga0207648_100009382 154
632 3300026089 Ga0207648_10054113 Ga0207648_100541132 154
633 3300026095 Ga0207676_10004720 Ga0207676_100047207 154
634 3300026095 Ga0207676_10022478 Ga0207676_100224783 154
635 3300026095 Ga0207676_10035799 Ga0207676_100357991 154
636 3300026095 Ga0207676_10234985 Ga0207676_102349852 154
637 3300026095 Ga0207676_11224240 Ga0207676_112242401 154
638 3300026116 Ga0207674_10043797 Ga0207674_100437974 154
639 3300026116 Ga0207674_11153607 Ga0207674_111536072 154
640 3300026118 Ga0207675_100001384 Ga0207675_10000138421 154
641 3300026118 Ga0207675_100003563 Ga0207675_10000356312 154
642 3300026118 Ga0207675_100334315 Ga0207675_1003343152 154
643 3300026118 Ga0207675_101557717 Ga0207675_1015577171 154
644 3300026121 Ga0207683_10516020 Ga0207683_105160202 154
645 3300026121 Ga0207683_10550786 Ga0207683_105507861 154
646 3300026142 Ga0207698_10221559 Ga0207698_102215592 154
647 3300026142 Ga0207698_10517771 Ga0207698_105177712 154
648 3300027695 Ga0209966_1034525 Ga0209966_10345252 154
649 3300027876 Ga0209974_10056907 Ga0209974_100569071 154
650 3300027907 Ga0207428_10000562 Ga0207428_100005627 154
651 3300027907 Ga0207428_10990430 Ga0207428_109904301 154
652 3300028379 Ga0268266_10036665 Ga0268266_100366654 154
653 3300028380 Ga0268265_10000103 Ga0268265_1000010381 154
654 3300028380 Ga0268265_10300765 Ga0268265_103007651 154
655 3300028380 Ga0268265_10603622 Ga0268265_106036221 154
656 3300028380 Ga0268265_10682639 Ga0268265_106826392 154
657 3300028381 Ga0268264_10020042 Ga0268264_100200422 154
658 3300028381 Ga0268264_10124713 Ga0268264_101247131 154
659 3300028381 Ga0268264_10137446 Ga0268264_101374462 154
660 3300028381 Ga0268264_10276102 Ga0268264_102761022 154
661 3300028381 Ga0268264_10311470 Ga0268264_103114702 154
662 3300028381 Ga0268264_10374221 Ga0268264_103742212 154
663 3300031242 Ga0265329_10105184 Ga0265329_101051841 154
664 3300031249 Ga0265339_10136875 Ga0265339_101368752 154
665 3300031251 Ga0265327_10106121 Ga0265327_101061212 154
666 3300031711 Ga0265314_10001454 Ga0265314_100014542 154
667 3300034820 Ga0373959_0054010 Ga0373959_0054010_298_762 154
668 3300035083 Ga0373926_0356464 Ga0373926_0356464_17_481 154
669 3300035090 Ga0373949_0037290 Ga0373949_0037290_218_682 154
670 3300035092 Ga0373952_0268072 Ga0373952_0268072_38_505 154
671 3300035113 Ga0373936_0200539 Ga0373936_0200539_211_675 154
672 3300035114 Ga0373939_0044667 Ga0373939_0044667_794_1258 154
673 3300035115 Ga0373941_0101373 Ga0373941_0101373_154_618 154
674 3300035116 Ga0373945_0048053 Ga0373945_0048053_632_1096 154
675 3300035118 Ga0373954_0361884 Ga0373954_0361884_44_517 154
676 3300035119 Ga0373956_0077187 Ga0373956_0077187_882_1355 154
677 3300035121 Ga0373960_0004518 Ga0373960_0004518_947_1411 154
678 3300035170 Ga0373943_0073906 Ga0373943_0073906_456_920 154
679 3300035170 Ga0373943_0139140 Ga0373943_0139140_591_1055 154
680 3300035171 Ga0373946_0011306 Ga0373946_0011306_273_737 154
681 3300035172 Ga0373955_0002461 Ga0373955_0002461_19_492 154
682 3300035172 Ga0373955_0056957 Ga0373955_0056957_85_552 154
683 3300035172 Ga0373955_0188367 Ga0373955_0188367_650_1114 154
684 3300035172 Ga0373955_0712081 Ga0373955_0712081_74_541 154
685 3300035410 Ga0373924_0014243 Ga0373924_0014243_2405_2878 154
686 3300035691 Ga0373931_0021322 Ga0373931_0021322_1952_2416 154
687 3300035692 Ga0373935_0024708 Ga0373935_0024708_1801_2268 154
688 3300035692 Ga0373935_0341335 Ga0373935_0341335_519_992 154
689 3300035692 Ga0373935_0435121 Ga0373935_0435121_149_613 154
690 3300035695 Ga0373927_0011784 Ga0373927_0011784_462_926 154
691 3300035695 Ga0373927_0194675 Ga0373927_0194675_434_907 154
692 3300035695 Ga0373927_0679101 Ga0373927_0679101_186_650 154
693 3300035725 Ga0373947_0065523 Ga0373947_0065523_309_776 154
694 3300035725 Ga0373947_0448756 Ga0373947_0448756_198_671 154
695 3300035725 Ga0373947_0840724 Ga0373947_0840724_89_553 154
696 3300035725 Ga0373947_1010188 Ga0373947_1010188_52_516 154
697 3300036401 Ga0373937_0009278 Ga0373937_0009278_522_989 154
698 3300036401 Ga0373937_0098568 Ga0373937_0098568_1776_2240 154
699 3300036401 Ga0373937_0333697 Ga0373937_0333697_201_668 154
700 3300037068 Ga0373925_0056176 Ga0373925_0056176_94_567 154
701 3300037068 Ga0373925_0082087 Ga0373925_0082087_576_1043 154
702 3300037068 Ga0373925_0452164 Ga0373925_0452164_565_1029 154
703 3300039447 Ga0436361_0314528 Ga0436361_0314528_93_557 154
704 3300041492 Ga0451835_0112714 Ga0451835_0112714_96_560 154
705 3300042876 Ga0451577_0788457 Ga0451577_0788457_208_675 154
706 3300044673 Ga0453683_0392434 Ga0453683_0392434_64_543 154
707 3300045051 Ga0451576_0021376 Ga0451576_0021376_5932_6396 154
708 3300045051 Ga0451576_0054255 Ga0451576_0054255_41_505 154
709 3300045051 Ga0451576_0079760 Ga0451576_0079760_2271_2735 154
710 3300046454 Ga0495592_0012432 Ga0495592_0012432_2871_3338 154
711 3300046454 Ga0495592_0145772 Ga0495592_0145772_319_837 154
712 3300046454 Ga0495592_0341041 Ga0495592_0341041_417_890 154
713 3300046455 Ga0495603_0012179 Ga0495603_0012179_4427_4891 154
714 3300046455 Ga0495603_0033288 Ga0495603_0033288_165_629 154
715 3300046455 Ga0495603_0354626 Ga0495603_0354626_39_503 154
716 3300046459 Ga0495629_0001619 Ga0495629_0001619_11176_11640 154
717 3300046461 Ga0495641_0011781 Ga0495641_0011781_1048_1512 154
718 3300046461 Ga0495641_0059056 Ga0495641_0059056_32_496 154
719 3300046461 Ga0495641_0128963 Ga0495641_0128963_284_748 154
720 3300046462 Ga0495651_0010791 Ga0495651_0010791_1005_1472 154
721 3300046463 Ga0495653_0007069 Ga0495653_0007069_5271_5738 154
722 3300046463 Ga0495653_0423410 Ga0495653_0423410_317_793 154
723 3300046472 Ga0495580_0282572 Ga0495580_0282572_561_1028 154
724 3300046472 Ga0495580_0381500 Ga0495580_0381500_434_907 154
725 3300046472 Ga0495580_0648168 Ga0495580_0648168_185_652 154
726 3300046473 Ga0495582_0030627 Ga0495582_0030627_1681_2145 154
727 3300046473 Ga0495582_0622721 Ga0495582_0622721_123_587 154
728 3300046474 Ga0495605_0039567 Ga0495605_0039567_183_647 154
729 3300046476 Ga0495662_0118018 Ga0495662_0118018_351_815 154
730 3300046477 Ga0495664_0055733 Ga0495664_0055733_628_1095 154
731 3300046477 Ga0495664_0421175 Ga0495664_0421175_142_609 154
732 3300046491 Ga0495584_0021570 Ga0495584_0021570_2133_2597 154
733 3300046491 Ga0495584_0090238 Ga0495584_0090238_655_1119 154
734 3300046491 Ga0495584_0264785 Ga0495584_0264785_11_475 154
735 3300046492 Ga0495585_0033701 Ga0495585_0033701_180_644 154
736 3300046499 Ga0495594_0363912 Ga0495594_0363912_220_684 154
737 3300046511 Ga0495608_0021909 Ga0495608_0021909_35_502 154
738 3300046511 Ga0495608_0039578 Ga0495608_0039578_685_1158 154
739 3300046511 Ga0495608_0077149 Ga0495608_0077149_628_1092 154
740 3300046514 Ga0495618_0096622 Ga0495618_0096622_175_642 154
741 3300046514 Ga0495618_0131235 Ga0495618_0131235_125_643 154
742 3300046514 Ga0495618_0593975 Ga0495618_0593975_139_603 154
743 3300046516 Ga0495628_0001354 Ga0495628_0001354_20940_21407 154
744 3300046516 Ga0495628_0135498 Ga0495628_0135498_842_1315 154
745 3300046516 Ga0495628_1020346 Ga0495628_1020346_86_550 154
746 3300046517 Ga0495630_0024914 Ga0495630_0024914_746_1219 154
747 3300046517 Ga0495630_0315905 Ga0495630_0315905_171_638 154
748 3300046517 Ga0495630_0980307 Ga0495630_0980307_12_479 154
749 3300046518 Ga0495631_0308298 Ga0495631_0308298_13_477 154
750 3300046519 Ga0495632_0071273 Ga0495632_0071273_539_1003 154
751 3300046520 Ga0495637_0183949 Ga0495637_0183949_216_680 154
752 3300046523 Ga0495644_0115441 Ga0495644_0115441_481_945 154
753 3300046525 Ga0495663_0168992 Ga0495663_0168992_261_725 154
754 3300046525 Ga0495663_0189248 Ga0495663_0189248_224_688 154
755 3300046526 Ga0495666_0331104 Ga0495666_0331104_77_544 154
756 3300046528 Ga0495642_0006036 Ga0495642_0006036_1569_2033 154
757 3300046528 Ga0495642_0134962 Ga0495642_0134962_462_926 154
758 3300046529 Ga0495652_0040705 Ga0495652_0040705_1542_2009 154
759 3300046529 Ga0495652_0209326 Ga0495652_0209326_248_712 154
760 3300046529 Ga0495652_0292797 Ga0495652_0292797_115_588 154
761 3300046529 Ga0495652_0398382 Ga0495652_0398382_474_956 154
762 3300046529 Ga0495652_0434933 Ga0495652_0434933_216_683 154
763 3300046529 Ga0495652_0973534 Ga0495652_0973534_53_520 154
764 3300046531 Ga0495665_0141141 Ga0495665_0141141_326_790 154
765 3300046533 Ga0495640_0088887 Ga0495640_0088887_467_934 154
766 3300046533 Ga0495640_0115812 Ga0495640_0115812_1248_1712 154
767 3300046533 Ga0495640_0172548 Ga0495640_0172548_35_553 154
768 3300046535 Ga0495586_0631293 Ga0495586_0631293_62_529 154
769 3300046536 Ga0495587_0005263 Ga0495587_0005263_3862_4329 154
770 3300046537 Ga0495598_0026697 Ga0495598_0026697_169_633 154
771 3300046538 Ga0495609_0023267 Ga0495609_0023267_93_557 154
772 3300046539 Ga0495621_0000998 Ga0495621_0000998_2222_2686 154
773 3300046539 Ga0495621_0017434 Ga0495621_0017434_76_540 154
774 3300046539 Ga0495621_0035833 Ga0495621_0035833_74_538 154
775 3300046539 Ga0495621_0203818 Ga0495621_0203818_178_642 154
776 3300046539 Ga0495621_0371963 Ga0495621_0371963_24_488 154
777 3300046543 Ga0495645_0052499 Ga0495645_0052499_1896_2369 154
778 3300046558 Ga0495633_0025927 Ga0495633_0025927_2322_2786 154
779 3300046558 Ga0495633_0046916 Ga0495633_0046916_137_601 154
780 3300046559 Ga0495667_0025835 Ga0495667_0025835_2809_3276 154
781 3300046559 Ga0495667_0030689 Ga0495667_0030689_836_1309 154
782 3300046615 Ga0495656_0035345 Ga0495656_0035345_382_846 154
783 3300046615 Ga0495656_0239086 Ga0495656_0239086_398_862 154
784 3300046616 Ga0495668_0097931 Ga0495668_0097931_726_1190 154
785 3300046642 Ga0495634_0033268 Ga0495634_0033268_1841_2308 154
786 3300046642 Ga0495634_0648927 Ga0495634_0648927_93_566 154
787 3300046648 Ga0495611_0178484 Ga0495611_0178484_327_791 154
788 3300046648 Ga0495611_0288816 Ga0495611_0288816_259_723 154
789 3300046660 Ga0495625_0505361 Ga0495625_0505361_64_528 154
790 3300046663 Ga0495635_0041719 Ga0495635_0041719_1771_2238 154
791 3300046663 Ga0495635_0415040 Ga0495635_0415040_206_679 154
792 3300046664 Ga0495659_0004982 Ga0495659_0004982_579_1043 154
793 3300046664 Ga0495659_0007522 Ga0495659_0007522_451_915 154
794 3300046664 Ga0495659_0015511 Ga0495659_0015511_1949_2413 154
795 3300046664 Ga0495659_0020676 Ga0495659_0020676_630_1094 154
796 3300046664 Ga0495659_0236393 Ga0495659_0236393_68_532 154
797 3300046664 Ga0495659_0335034 Ga0495659_0335034_44_511 154
798 3300046664 Ga0495659_0395922 Ga0495659_0395922_58_522 154
799 3300046665 Ga0495661_0085478 Ga0495661_0085478_114_578 154
800 3300046674 Ga0495588_0083921 Ga0495588_0083921_654_1118 154
801 3300046675 Ga0495657_0062405 Ga0495657_0062405_420_887 154
802 3300046675 Ga0495657_0222807 Ga0495657_0222807_555_1028 154
803 3300046678 Ga0495599_0004979 Ga0495599_0004979_4506_4973 154
804 3300046678 Ga0495599_0216736 Ga0495599_0216736_533_997 154
805 3300046678 Ga0495599_0250736 Ga0495599_0250736_99_572 154
806 3300046680 Ga0495646_0339656 Ga0495646_0339656_253_717 154
807 3300046680 Ga0495646_0400732 Ga0495646_0400732_34_501 154
808 3300046681 Ga0495647_0236460 Ga0495647_0236460_157_621 154
809 3300046681 Ga0495647_0281589 Ga0495647_0281589_93_557 154
810 3300046683 Ga0495658_0028683 Ga0495658_0028683_641_1114 154
811 3300046683 Ga0495658_0042543 Ga0495658_0042543_1369_1836 154
812 3300046683 Ga0495658_0045312 Ga0495658_0045312_776_1240 154
813 3300046683 Ga0495658_0235714 Ga0495658_0235714_53_517 154
814 3300046684 Ga0495669_0041245 Ga0495669_0041245_53_517 154
815 3300046684 Ga0495669_0131570 Ga0495669_0131570_589_1053 154
816 3300046689 Ga0495613_0000397 Ga0495613_0000397_11319_11792 154
817 3300046689 Ga0495613_0086411 Ga0495613_0086411_546_1013 154
818 3300046689 Ga0495613_0211325 Ga0495613_0211325_353_820 154
819 3300046689 Ga0495613_0279244 Ga0495613_0279244_54_521 154
820 3300046689 Ga0495613_0382967 Ga0495613_0382967_448_912 154
821 3300046690 Ga0495624_0270103 Ga0495624_0270103_89_553 154
822 3300046691 Ga0495670_0050138 Ga0495670_0050138_980_1444 154
823 3300046691 Ga0495670_0805766 Ga0495670_0805766_17_481 154
824 3300046692 Ga0495671_0314313 Ga0495671_0314313_176_640 154
825 3300046809 Ga0495600_0005852 Ga0495600_0005852_4935_5402 154
826 3300046809 Ga0495600_0050520 Ga0495600_0050520_332_805 154
827 3300046809 Ga0495600_0728359 Ga0495600_0728359_90_554 154
828 3300046810 Ga0495660_0099059 Ga0495660_0099059_437_901 154
829 3300047315 Ga0495581_0065787 Ga0495581_0065787_1253_1717 154
830 3300047315 Ga0495581_0070552 Ga0495581_0070552_130_594 154
831 3300047315 Ga0495581_0679300 Ga0495581_0679300_17_490 154
832 3300047317 Ga0495604_0003278 Ga0495604_0003278_7601_8068 154
833 3300047317 Ga0495604_0027344 Ga0495604_0027344_3276_3749 154
834 3300047318 Ga0495636_0015384 Ga0495636_0015384_1620_2084 154
835 3300047318 Ga0495636_0062273 Ga0495636_0062273_1059_1523 154
836 3300047318 Ga0495636_0071921 Ga0495636_0071921_792_1256 154
837 3300047318 Ga0495636_0312481 Ga0495636_0312481_144_608 154
838 3300047319 Ga0495674_0002008 Ga0495674_0002008_12624_13091 154
839 3300047319 Ga0495674_0054300 Ga0495674_0054300_2303_2821 154
840 3300047319 Ga0495674_0061291 Ga0495674_0061291_155_622 154
841 3300047319 Ga0495674_0163199 Ga0495674_0163199_1213_1680 154
842 3300047319 Ga0495674_0576860 Ga0495674_0576860_303_767 154
843 3300047319 Ga0495674_1464621 Ga0495674_1464621_19_486 154
844 3300047321 Ga0495676_0010821 Ga0495676_0010821_5305_5769 154
845 3300047321 Ga0495676_0237402 Ga0495676_0237402_354_818 154
846 3300047322 Ga0495680_0032767 Ga0495680_0032767_2360_2827 154
847 3300047322 Ga0495680_0399851 Ga0495680_0399851_380_850 154
848 3300047322 Ga0495680_0937945 Ga0495680_0937945_78_542 154
849 3300047323 Ga0495683_0081466 Ga0495683_0081466_159_623 154
850 3300047444 Ga0495675_0002749 Ga0495675_0002749_8105_8572 154
851 3300047444 Ga0495675_0738754 Ga0495675_0738754_58_525 154
852 3300047445 Ga0495677_0019265 Ga0495677_0019265_1220_1684 154
853 3300047445 Ga0495677_0025693 Ga0495677_0025693_319_783 154
854 3300047445 Ga0495677_0091357 Ga0495677_0091357_485_949 154
855 3300047446 Ga0495679_061254 Ga0495679_061254_64_528 154
856 3300047447 Ga0495685_076757 Ga0495685_076757_344_808 154
857 3300047469 Ga0495673_0110984 Ga0495673_0110984_258_722 154
858 3300047471 Ga0495684_0000431 Ga0495684_0000431_16713_17186 154
859 3300047471 Ga0495684_0049741 Ga0495684_0049741_1457_1924 154
860 3300047471 Ga0495684_0114954 Ga0495684_0114954_1341_1805 154
861 3300047471 Ga0495684_0165691 Ga0495684_0165691_218_685 154
862 3300047471 Ga0495684_0346958 Ga0495684_0346958_378_851 154
863 3300047471 Ga0495684_0454716 Ga0495684_0454716_392_859 154
864 3300047472 Ga0495686_0067826 Ga0495686_0067826_1088_1552 154
865 3300047472 Ga0495686_0084280 Ga0495686_0084280_77_592 154
866 3300047673 Ga0495593_0028114 Ga0495593_0028114_2459_2923 154
867 3300047673 Ga0495593_0266968 Ga0495593_0266968_15_479 154
868 3300048088 Ga0495602_0022172 Ga0495602_0022172_4593_5060 154
869 3300048088 Ga0495602_0142743 Ga0495602_0142743_34_504 154
870 3300048089 Ga0495614_0089055 Ga0495614_0089055_242_706 154
871 3300048091 Ga0495626_0233556 Ga0495626_0233556_76_540 154
872 3300048903 Ga0496100_0147115 Ga0496100_0147115_543_1007 154
873 3300048904 Ga0496101_0134728 Ga0496101_0134728_710_1174 154
874 3300048904 Ga0496101_0490320 Ga0496101_0490320_295_759 154
875 3300048906 Ga0496103_0022195 Ga0496103_0022195_850_1314 154
876 3300048906 Ga0496103_0128291 Ga0496103_0128291_812_1276 154
877 3300048907 Ga0496104_0045229 Ga0496104_0045229_709_1173 154
878 3300048907 Ga0496104_0113510 Ga0496104_0113510_2100_2567 154
879 3300048908 Ga0496105_0008859 Ga0496105_0008859_670_1134 154
880 3300048908 Ga0496105_0144110 Ga0496105_0144110_493_960 154
881 3300048909 Ga0496106_0028179 Ga0496106_0028179_3010_3474 154
882 3300048909 Ga0496106_0536135 Ga0496106_0536135_372_836 154
883 3300048910 Ga0496107_0191751 Ga0496107_0191751_454_918 154
884 3300048911 Ga0496108_0765552 Ga0496108_0765552_68_532 154
885 3300048912 Ga0496109_0004243 Ga0496109_0004243_6058_6525 154
886 3300048912 Ga0496109_0030998 Ga0496109_0030998_614_1078 154
887 3300048913 Ga0496110_0015614 Ga0496110_0015614_5813_6280 154
888 3300048913 Ga0496110_0030728 Ga0496110_0030728_2680_3144 154
889 3300048913 Ga0496110_0182665 Ga0496110_0182665_260_727 154
890 3300048913 Ga0496110_1095673 Ga0496110_1095673_229_693 154
891 3300048914 Ga0496111_0040436 Ga0496111_0040436_2306_2770 154
892 3300048915 Ga0496112_0056354 Ga0496112_0056354_418_882 154
893 3300048915 Ga0496112_0149860 Ga0496112_0149860_527_994 154
894 3300048916 Ga0496113_0203985 Ga0496113_0203985_987_1454 154
895 3300048917 Ga0496114_0034306 Ga0496114_0034306_3145_3609 154
896 3300048917 Ga0496114_0530816 Ga0496114_0530816_475_939 154
897 3300048917 Ga0496114_0561175 Ga0496114_0561175_140_607 154
898 3300048918 Ga0496115_0063455 Ga0496115_0063455_1437_1904 154
899 3300048918 Ga0496115_0127180 Ga0496115_0127180_1066_1530 154
900 3300049459 Ga0495678_180658 Ga0495678_180658_89_553 154
901 3300049570 Ga0501033_0344295 Ga0501033_0344295_59_526 154
902 3300049581 Ga0501047_0362572 Ga0501047_0362572_560_1027 154
903 3300049585 Ga0501069_0060766 Ga0501069_0060766_29_493 154
904 3300049593 Ga0501077_0337569 Ga0501077_0337569_178_678 154
905 3300049741 Ga0501079_0381439 Ga0501079_0381439_291_791 154
906 3300049822 Ga0501035_0913295 Ga0501035_0913295_181_681 154
907 3300049823 Ga0501044_0132431 Ga0501044_0132431_1274_1741 154
908 3300050489 nmdc:mga03683_67014_c1 nmdc:mga03683_67014_c1_426_965 154
909 3300050489 nmdc:mga03683_72119_c1 nmdc:mga03683_72119_c1_825_1289 154
910 3300050491 nmdc:mga00v17_278245_c1 nmdc:mga00v17_278245_c1_443_907 154
911 3300050491 nmdc:mga00v17_411970_c1 nmdc:mga00v17_411970_c1_397_861 154
912 3300050492 nmdc:mga0yw44_148899_c1 nmdc:mga0yw44_148899_c1_741_1205 154
913 3300050492 nmdc:mga0yw44_324843_c1 nmdc:mga0yw44_324843_c1_147_611 154
914 3300050492 nmdc:mga0yw44_54592_c1 nmdc:mga0yw44_54592_c1_483_947 154
915 3300050495 nmdc:mga04h51_105977_c1 nmdc:mga04h51_105977_c1_449_913 154
916 3300050507 nmdc:mga05p37_133007_c1 nmdc:mga05p37_133007_c1_1251_1715 154
917 3300050507 nmdc:mga05p37_1614817_c1 nmdc:mga05p37_1614817_c1_36_503 154
918 3300050507 nmdc:mga05p37_162177_c1 nmdc:mga05p37_162177_c1_90_554 154
919 3300050507 nmdc:mga05p37_166004_c1 nmdc:mga05p37_166004_c1_1030_1575 154
920 3300050507 nmdc:mga05p37_18097_c1 nmdc:mga05p37_18097_c1_7051_7515 154
921 3300050507 nmdc:mga05p37_266694_c1 nmdc:mga05p37_266694_c1_1529_1993 154
922 3300050507 nmdc:mga05p37_297280_c1 nmdc:mga05p37_297280_c1_254_718 154
923 3300050507 nmdc:mga05p37_690598_c1 nmdc:mga05p37_690598_c1_192_659 154
924 3300050508 nmdc:mga09592_21311_c1 nmdc:mga09592_21311_c1_4354_4818 154
925 3300050508 nmdc:mga09592_483879_c1 nmdc:mga09592_483879_c1_377_844 154
926 3300050508 nmdc:mga09592_90167_c1 nmdc:mga09592_90167_c1_290_754 154
927 3300050509 nmdc:mga0qj67_181347_c1 nmdc:mga0qj67_181347_c1_17_481 154
928 3300050509 nmdc:mga0qj67_551623_c1 nmdc:mga0qj67_551623_c1_433_900 154
929 3300050510 nmdc:mga06r32_427885_c1 nmdc:mga06r32_427885_c1_28_495 154
930 3300050510 nmdc:mga06r32_74553_c1 nmdc:mga06r32_74553_c1_1508_1972 154
931 3300050511 nmdc:mga08y16_1204_c1 nmdc:mga08y16_1204_c1_24434_24898 154
932 3300050511 nmdc:mga08y16_230785_c1 nmdc:mga08y16_230785_c1_101_568 154
933 3300050511 nmdc:mga08y16_293757_c1 nmdc:mga08y16_293757_c1_243_707 154
934 3300050511 nmdc:mga08y16_372888_c1 nmdc:mga08y16_372888_c1_678_1142 154
935 3300050511 nmdc:mga08y16_802366_c1 nmdc:mga08y16_802366_c1_157_624 154
936 3300050511 nmdc:mga08y16_917282_c1 nmdc:mga08y16_917282_c1_173_664 154
937 3300050512 nmdc:mga0n895_1009795_c1 nmdc:mga0n895_1009795_c1_225_689 154
938 3300050512 nmdc:mga0n895_140796_c1 nmdc:mga0n895_140796_c1_1439_1906 154
939 3300050512 nmdc:mga0n895_14463_c1 nmdc:mga0n895_14463_c1_5974_6438 154
940 3300050512 nmdc:mga0n895_236091_c1 nmdc:mga0n895_236091_c1_153_617 154
941 3300050512 nmdc:mga0n895_500844_c1 nmdc:mga0n895_500844_c1_389_853 154
942 3300050512 nmdc:mga0n895_75340_c1 nmdc:mga0n895_75340_c1_2620_3084 154
943 3300050513 nmdc:mga0rr50_39643_c1 nmdc:mga0rr50_39643_c1_1718_2182 154
944 3300050513 nmdc:mga0rr50_855086_c1 nmdc:mga0rr50_855086_c1_231_695 154
945 3300050514 nmdc:mga08x19_375248_c1 nmdc:mga08x19_375248_c1_78_542 154
946 3300050514 nmdc:mga08x19_958886_c1 nmdc:mga08x19_958886_c1_51_518 154
947 3300050515 nmdc:mga0a205_198749_c1 nmdc:mga0a205_198749_c1_646_1110 154
948 3300050515 nmdc:mga0a205_235148_c1 nmdc:mga0a205_235148_c1_1156_1623 154
949 3300050515 nmdc:mga0a205_359156_c1 nmdc:mga0a205_359156_c1_745_1209 154
950 3300050515 nmdc:mga0a205_463163_c1 nmdc:mga0a205_463163_c1_442_909 154
951 3300050515 nmdc:mga0a205_47295_c1 nmdc:mga0a205_47295_c1_116_583 154
952 3300050515 nmdc:mga0a205_78530_c1 nmdc:mga0a205_78530_c1_1710_2174 154
953 3300050515 nmdc:mga0a205_94729_c1 nmdc:mga0a205_94729_c1_1093_1557 154
954 3300050515 nmdc:mga0a205_959868_c1 nmdc:mga0a205_959868_c1_145_609 154
955 3300053077 Ga0495601_0010275 Ga0495601_0010275_3208_3726 154
956 3300053077 Ga0495601_0025087 Ga0495601_0025087_525_998 154
957 3300053077 Ga0495601_0461116 Ga0495601_0461116_34_498 154
958 3300053078 Ga0495612_0113192 Ga0495612_0113192_433_900 154
959 3300053078 Ga0495612_0544750 Ga0495612_0544750_41_505 154
960 3300053083 Ga0495655_0047399 Ga0495655_0047399_154_618 154
961 3300053084 Ga0495595_0479171 Ga0495595_0479171_52_525 154
962 3300053085 Ga0495619_0009832 Ga0495619_0009832_2782_3255 154
963 3300053085 Ga0495619_0080455 Ga0495619_0080455_1529_1996 154
964 3300053085 Ga0495619_0081089 Ga0495619_0081089_624_1088 154
965 3300061734 Ga0530510_0733527 Ga0530510_0733527_96_563 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

104

177

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

36

102

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9292 2 153
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9277 1 153
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9195 2 153
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9189 1 153
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9163 1 153
ID Description Score Start End Superfamily
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9342 74 153 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.923 78 154 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9207 78 154 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.91 79 152 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9096 78 154 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A386E6B5-F1-model_v4 deleted 0.9471 2 153
AF-A0A7W8XAD6-F1-model_v4 Nicotinate dehydrogenase subunit A (EC 1.17.2.1) 0.9453 2 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A537UGU9-F1-model_v4 (2Fe-2S)-binding protein 0.9449 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A807CKA1-F1-model_v4 deleted 0.9447 6 153
AF-A0A537JTT9-F1-model_v4 (2Fe-2S)-binding protein 0.9445 1 154 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
91.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map