F486973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 965 | 356 | 965 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300025927|Ga0207687_10336048|Ga0207687_103360482 |
| Length | 185 |
| Sequence | MKTAMRIKLTLFTRGGEPLTHAARRSTLSHMSAISLKVNGRTHMLDLDPATPLLYALSDDLELRGPKFGCGLGQCGSCTAIVNGTAVRSCVTPVSTVVGKDIVTLEGLGTPEKPHPIQKAFIDEQAAQCGFCLNGVILTAKAFLDKNPKASESEIQQALSGVLCRCFTHVRMQQAIQRYAKAVAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 232 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 5.28 |
| Rhizosphere | 92.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10011361 | 3300001991 | Bacteria | 1603 |
| 2 | JGI24750J21931_1003575 | 3300002070 | Bacteria | 1863 |
| 3 | JGI24748J21848_1007802 | 3300002074 | Bacteria | 1256 |
| 4 | JGI24738J21930_10007172 | 3300002075 | Bacteria | 2583 |
| 5 | JGI24749J21850_1013147 | 3300002076 | Bacteria | 1162 |
| 6 | JGI24744J21845_10002967 | 3300002077 | Bacteria | 3474 |
| 7 | JGI24034J26672_10004889 | 3300002239 | Bacteria | 1909 |
| 8 | Ga0065704_10098888 | 3300005289 | Bacteria | 2334 |
| 9 | Ga0065704_10205451 | 3300005289 | Bacteria | 1129 |
| 10 | Ga0065715_10005647 | 3300005293 | Bacteria | 4677 |
| 11 | Ga0065715_10727806 | 3300005293 | Bacteria | 640 |
| 12 | Ga0065715_10727857 | 3300005293 | Bacteria | 636 |
| 13 | Ga0065707_10002482 | 3300005295 | Bacteria | 8591 |
| 14 | Ga0065707_10246195 | 3300005295 | Bacteria | 1139 |
| 15 | Ga0065707_10482911 | 3300005295 | Bacteria | 772 |
| 16 | Ga0070676_10359797 | 3300005328 | Bacteria | 1003 |
| 17 | Ga0070683_100003648 | 3300005329 | Bacteria | 12542 |
| 18 | Ga0070683_100094505 | 3300005329 | Bacteria | 2810 |
| 19 | Ga0070683_101256863 | 3300005329 | Bacteria | 712 |
| 20 | Ga0070670_100007003 | 3300005331 | Bacteria | 9554 |
| 21 | Ga0070670_100023624 | 3300005331 | Bacteria | 5291 |
| 22 | Ga0070670_100048236 | 3300005331 | Bacteria | 3665 |
| 23 | Ga0070670_100055058 | 3300005331 | Bacteria | 3414 |
| 24 | Ga0068869_100037520 | 3300005334 | Bacteria | 3446 |
| 25 | Ga0068869_100186003 | 3300005334 | Bacteria | 1631 |
| 26 | Ga0068869_100601594 | 3300005334 | Bacteria | 929 |
| 27 | Ga0068869_100880064 | 3300005334 | Bacteria | 774 |
| 28 | Ga0068869_101077851 | 3300005334 | Bacteria | 702 |
| 29 | Ga0070666_10005780 | 3300005335 | Bacteria | 7601 |
| 30 | Ga0070666_10181488 | 3300005335 | Bacteria | 1476 |
| 31 | Ga0070666_10233322 | 3300005335 | Bacteria | 1300 |
| 32 | Ga0070682_100080773 | 3300005337 | Bacteria | 2103 |
| 33 | Ga0070682_100110649 | 3300005337 | Bacteria | 1830 |
| 34 | Ga0068868_100061736 | 3300005338 | Bacteria | 2969 |
| 35 | Ga0068868_100089007 | 3300005338 | Bacteria | 2485 |
| 36 | Ga0068868_101077290 | 3300005338 | Bacteria | 738 |
| 37 | Ga0070660_100084758 | 3300005339 | Bacteria | 2491 |
| 38 | Ga0070689_100006108 | 3300005340 | Bacteria | 8300 |
| 39 | Ga0070689_100052234 | 3300005340 | Bacteria | 3161 |
| 40 | Ga0070691_10063770 | 3300005341 | Bacteria | 1776 |
| 41 | Ga0070691_10504666 | 3300005341 | Bacteria | 700 |
| 42 | Ga0070687_100020271 | 3300005343 | Bacteria | 3106 |
| 43 | Ga0070687_100049790 | 3300005343 | Bacteria | 2161 |
| 44 | Ga0070687_100406041 | 3300005343 | Bacteria | 895 |
| 45 | Ga0070661_100005776 | 3300005344 | Bacteria | 8513 |
| 46 | Ga0070692_10002304 | 3300005345 | Bacteria | 7354 |
| 47 | Ga0070692_10019608 | 3300005345 | Bacteria | 3266 |
| 48 | Ga0070692_10035915 | 3300005345 | Bacteria | 2512 |
| 49 | Ga0070692_10721997 | 3300005345 | Bacteria | 673 |
| 50 | Ga0070668_100460564 | 3300005347 | Bacteria | 1095 |
| 51 | Ga0070669_100000833 | 3300005353 | Bacteria | 22368 |
| 52 | Ga0070669_100070078 | 3300005353 | Bacteria | 2591 |
| 53 | Ga0070675_100000609 | 3300005354 | Bacteria | 24654 |
| 54 | Ga0070675_100005913 | 3300005354 | Bacteria | 9371 |
| 55 | Ga0070675_100104818 | 3300005354 | Bacteria | 2386 |
| 56 | Ga0070675_100144567 | 3300005354 | Bacteria | 2035 |
| 57 | Ga0070675_100527070 | 3300005354 | Bacteria | 1066 |
| 58 | Ga0070671_100037506 | 3300005355 | Bacteria | 4019 |
| 59 | Ga0070671_100074626 | 3300005355 | Bacteria | 2833 |
| 60 | Ga0070671_100740254 | 3300005355 | Bacteria | 854 |
| 61 | Ga0070674_100295969 | 3300005356 | Bacteria | 1288 |
| 62 | Ga0070674_100902189 | 3300005356 | Bacteria | 770 |
| 63 | Ga0070673_100011573 | 3300005364 | Bacteria | 6027 |
| 64 | Ga0070673_100044170 | 3300005364 | Bacteria | 3449 |
| 65 | Ga0070673_100472539 | 3300005364 | Bacteria | 1131 |
| 66 | Ga0070673_100857731 | 3300005364 | Bacteria | 841 |
| 67 | Ga0070688_100049487 | 3300005365 | Bacteria | 2615 |
| 68 | Ga0070659_100170484 | 3300005366 | Bacteria | 1782 |
| 69 | Ga0070667_100024923 | 3300005367 | Bacteria | 4969 |
| 70 | Ga0070667_100353373 | 3300005367 | Bacteria | 1331 |
| 71 | Ga0070703_10030035 | 3300005406 | Bacteria | 1635 |
| 72 | Ga0070714_100221791 | 3300005435 | Bacteria | 1738 |
| 73 | Ga0070714_100630850 | 3300005435 | Bacteria | 1031 |
| 74 | Ga0070713_100068018 | 3300005436 | Bacteria | 3001 |
| 75 | Ga0070713_100146057 | 3300005436 | Bacteria | 2100 |
| 76 | Ga0070713_100393836 | 3300005436 | Bacteria | 1292 |
| 77 | Ga0070713_100557764 | 3300005436 | Bacteria | 1085 |
| 78 | Ga0070701_10004621 | 3300005438 | Bacteria | 5603 |
| 79 | Ga0070701_10005760 | 3300005438 | Bacteria | 5153 |
| 80 | Ga0070701_10028041 | 3300005438 | Bacteria | 2765 |
| 81 | Ga0070701_10191699 | 3300005438 | Bacteria | 1203 |
| 82 | Ga0070701_10381855 | 3300005438 | Bacteria | 888 |
| 83 | Ga0070711_100025976 | 3300005439 | Bacteria | 3835 |
| 84 | Ga0070705_100017489 | 3300005440 | Bacteria | 3743 |
| 85 | Ga0070705_100068449 | 3300005440 | Bacteria | 2137 |
| 86 | Ga0070705_100096918 | 3300005440 | Bacteria | 1852 |
| 87 | Ga0070700_100034579 | 3300005441 | Bacteria | 3053 |
| 88 | Ga0070700_100265026 | 3300005441 | Bacteria | 1239 |
| 89 | Ga0070700_100438885 | 3300005441 | Bacteria | 990 |
| 90 | Ga0070694_100010451 | 3300005444 | Bacteria | 5727 |
| 91 | Ga0070694_100018066 | 3300005444 | Bacteria | 4469 |
| 92 | Ga0070694_100030344 | 3300005444 | Bacteria | 3535 |
| 93 | Ga0070694_100130780 | 3300005444 | Bacteria | 1813 |
| 94 | Ga0070694_100133034 | 3300005444 | Bacteria | 1799 |
| 95 | Ga0070694_100175000 | 3300005444 | Bacteria | 1583 |
| 96 | Ga0070708_100056693 | 3300005445 | Bacteria | 3486 |
| 97 | Ga0070708_100081314 | 3300005445 | Bacteria | 2933 |
| 98 | Ga0070708_100329970 | 3300005445 | Bacteria | 1437 |
| 99 | Ga0070708_100537228 | 3300005445 | Bacteria | 1103 |
| 100 | Ga0070663_100886730 | 3300005455 | Bacteria | 770 |
| 101 | Ga0070678_100403137 | 3300005456 | Bacteria | 1189 |
| 102 | Ga0070678_100456831 | 3300005456 | Unclassified | 1120 |
| 103 | Ga0070678_100663397 | 3300005456 | Bacteria | 937 |
| 104 | Ga0070678_101185256 | 3300005456 | Unclassified | 708 |
| 105 | Ga0070662_100107626 | 3300005457 | Bacteria | 2119 |
| 106 | Ga0070662_100347711 | 3300005457 | Bacteria | 1214 |
| 107 | Ga0070681_10009310 | 3300005458 | Bacteria | 9663 |
| 108 | Ga0070681_10024462 | 3300005458 | Bacteria | 6080 |
| 109 | Ga0070681_10710553 | 3300005458 | Bacteria | 921 |
| 110 | Ga0070681_10768574 | 3300005458 | Bacteria | 880 |
| 111 | Ga0070681_11055347 | 3300005458 | Bacteria | 733 |
| 112 | Ga0068867_100000156 | 3300005459 | Bacteria | 43913 |
| 113 | Ga0068867_100123668 | 3300005459 | Bacteria | 2002 |
| 114 | Ga0068867_100186611 | 3300005459 | Bacteria | 1652 |
| 115 | Ga0068867_100386555 | 3300005459 | Bacteria | 1177 |
| 116 | Ga0070685_10121017 | 3300005466 | Bacteria | 1625 |
| 117 | Ga0070706_100000006 | 3300005467 | Bacteria | 262251 |
| 118 | Ga0070706_100021716 | 3300005467 | Bacteria | 5911 |
| 119 | Ga0070706_100168199 | 3300005467 | Bacteria | 2047 |
| 120 | Ga0070706_100315408 | 3300005467 | Bacteria | 1458 |
| 121 | Ga0070706_100539001 | 3300005467 | Unclassified | 1085 |
| 122 | Ga0070706_100592467 | 3300005467 | Bacteria | 1030 |
| 123 | Ga0070706_100709004 | 3300005467 | Bacteria | 933 |
| 124 | Ga0070707_100006432 | 3300005468 | Bacteria | 10918 |
| 125 | Ga0070707_100016485 | 3300005468 | Bacteria | 6933 |
| 126 | Ga0070707_100163529 | 3300005468 | Bacteria | 2169 |
| 127 | Ga0070698_100005560 | 3300005471 | Bacteria | 13777 |
| 128 | Ga0070698_100008137 | 3300005471 | Bacteria | 11336 |
| 129 | Ga0070698_100070715 | 3300005471 | Bacteria | 3501 |
| 130 | Ga0070698_100353804 | 3300005471 | Bacteria | 1400 |
| 131 | Ga0070698_100653527 | 3300005471 | Bacteria | 993 |
| 132 | Ga0070699_100007784 | 3300005518 | Bacteria | 9312 |
| 133 | Ga0070699_100019523 | 3300005518 | Bacteria | 5838 |
| 134 | Ga0070699_100037999 | 3300005518 | Bacteria | 4168 |
| 135 | Ga0070699_100131116 | 3300005518 | Bacteria | 2210 |
| 136 | Ga0070699_100160990 | 3300005518 | Bacteria | 1986 |
| 137 | Ga0070699_100222791 | 3300005518 | Bacteria | 1681 |
| 138 | Ga0070699_100255182 | 3300005518 | Bacteria | 1567 |
| 139 | Ga0070699_100975958 | 3300005518 | Unclassified | 777 |
| 140 | Ga0070684_100000593 | 3300005535 | Bacteria | 24951 |
| 141 | Ga0070684_100205027 | 3300005535 | Bacteria | 1797 |
| 142 | Ga0070684_100280532 | 3300005535 | Bacteria | 1526 |
| 143 | Ga0070697_100005622 | 3300005536 | Bacteria | 9663 |
| 144 | Ga0070697_100046992 | 3300005536 | Bacteria | 3500 |
| 145 | Ga0070697_100076269 | 3300005536 | Bacteria | 2757 |
| 146 | Ga0070697_100088380 | 3300005536 | Bacteria | 2559 |
| 147 | Ga0070697_100959519 | 3300005536 | Bacteria | 759 |
| 148 | Ga0068853_100065714 | 3300005539 | Bacteria | 3148 |
| 149 | Ga0070672_100043045 | 3300005543 | Bacteria | 3479 |
| 150 | Ga0070672_100077846 | 3300005543 | Bacteria | 2653 |
| 151 | Ga0070672_100140013 | 3300005543 | Bacteria | 1995 |
| 152 | Ga0070686_100243733 | 3300005544 | Bacteria | 1310 |
| 153 | Ga0070686_100525837 | 3300005544 | Bacteria | 922 |
| 154 | Ga0070686_100669873 | 3300005544 | Bacteria | 824 |
| 155 | Ga0070695_100000076 | 3300005545 | Bacteria | 40234 |
| 156 | Ga0070695_100092972 | 3300005545 | Bacteria | 2017 |
| 157 | Ga0070695_100187772 | 3300005545 | Unclassified | 1469 |
| 158 | Ga0070695_100268582 | 3300005545 | Bacteria | 1249 |
| 159 | Ga0070695_101013655 | 3300005545 | Bacteria | 676 |
| 160 | Ga0070695_101072201 | 3300005545 | Bacteria | 658 |
| 161 | Ga0070696_100011537 | 3300005546 | Bacteria | 5920 |
| 162 | Ga0070696_100088596 | 3300005546 | Bacteria | 2200 |
| 163 | Ga0070696_101139862 | 3300005546 | Bacteria | 657 |
| 164 | Ga0070696_101255631 | 3300005546 | Bacteria | 627 |
| 165 | Ga0070693_100025364 | 3300005547 | Bacteria | 3190 |
| 166 | Ga0070665_100253268 | 3300005548 | Bacteria | 1761 |
| 167 | Ga0070665_100975798 | 3300005548 | Bacteria | 860 |
| 168 | Ga0070704_100000290 | 3300005549 | Bacteria | 22046 |
| 169 | Ga0070704_100033380 | 3300005549 | Bacteria | 3479 |
| 170 | Ga0070704_100103430 | 3300005549 | Bacteria | 2151 |
| 171 | Ga0070704_100133408 | 3300005549 | Bacteria | 1928 |
| 172 | Ga0070704_100140732 | 3300005549 | Bacteria | 1884 |
| 173 | Ga0070704_100617605 | 3300005549 | Bacteria | 954 |
| 174 | Ga0070704_100697619 | 3300005549 | Bacteria | 900 |
| 175 | Ga0068855_100001557 | 3300005563 | Bacteria | 28824 |
| 176 | Ga0068855_101227947 | 3300005563 | Bacteria | 778 |
| 177 | Ga0070664_100001006 | 3300005564 | Bacteria | 22147 |
| 178 | Ga0070664_100057063 | 3300005564 | Bacteria | 3318 |
| 179 | Ga0070664_100238657 | 3300005564 | Bacteria | 1631 |
| 180 | Ga0070664_100346893 | 3300005564 | Bacteria | 1350 |
| 181 | Ga0068857_100004183 | 3300005577 | Bacteria | 12148 |
| 182 | Ga0068857_100020929 | 3300005577 | Bacteria | 5754 |
| 183 | Ga0068856_100201340 | 3300005614 | Bacteria | 2005 |
| 184 | Ga0068856_100236957 | 3300005614 | Bacteria | 1840 |
| 185 | Ga0068856_100583600 | 3300005614 | Bacteria | 1139 |
| 186 | Ga0068856_100842867 | 3300005614 | Bacteria | 936 |
| 187 | Ga0068856_101045116 | 3300005614 | Bacteria | 835 |
| 188 | Ga0070702_100007457 | 3300005615 | Bacteria | 5239 |
| 189 | Ga0068852_100044420 | 3300005616 | Bacteria | 3773 |
| 190 | Ga0068852_100407829 | 3300005616 | Bacteria | 1338 |
| 191 | Ga0068852_100498714 | 3300005616 | Bacteria | 1212 |
| 192 | Ga0068859_100002969 | 3300005617 | Bacteria | 17194 |
| 193 | Ga0068859_100054432 | 3300005617 | Bacteria | 4024 |
| 194 | Ga0068859_100055535 | 3300005617 | Bacteria | 3985 |
| 195 | Ga0068859_100888731 | 3300005617 | Bacteria | 976 |
| 196 | Ga0068864_100029088 | 3300005618 | Bacteria | 4675 |
| 197 | Ga0068864_100066440 | 3300005618 | Bacteria | 3130 |
| 198 | Ga0068864_100113720 | 3300005618 | Bacteria | 2413 |
| 199 | Ga0068864_100406486 | 3300005618 | Bacteria | 1295 |
| 200 | Ga0068864_100457602 | 3300005618 | Bacteria | 1221 |
| 201 | Ga0068864_101029357 | 3300005618 | Bacteria | 817 |
| 202 | Ga0068866_10019531 | 3300005718 | Bacteria | 3087 |
| 203 | Ga0068861_100002891 | 3300005719 | Bacteria | 11317 |
| 204 | Ga0068861_100099175 | 3300005719 | Bacteria | 2313 |
| 205 | Ga0068851_10189188 | 3300005834 | Bacteria | 1144 |
| 206 | Ga0068870_10023082 | 3300005840 | Bacteria | 3064 |
| 207 | Ga0068870_10091009 | 3300005840 | Bacteria | 1705 |
| 208 | Ga0068870_10143071 | 3300005840 | Bacteria | 1401 |
| 209 | Ga0068870_10507874 | 3300005840 | Bacteria | 805 |
| 210 | Ga0068863_100063192 | 3300005841 | Bacteria | 3501 |
| 211 | Ga0068863_100120259 | 3300005841 | Bacteria | 2504 |
| 212 | Ga0068858_100017104 | 3300005842 | Bacteria | 6806 |
| 213 | Ga0068858_100027876 | 3300005842 | Bacteria | 5248 |
| 214 | Ga0068858_100423333 | 3300005842 | Bacteria | 1281 |
| 215 | Ga0068860_100013106 | 3300005843 | Bacteria | 8136 |
| 216 | Ga0068860_100018719 | 3300005843 | Bacteria | 6731 |
| 217 | Ga0068860_100121854 | 3300005843 | Bacteria | 2498 |
| 218 | Ga0068860_100132207 | 3300005843 | Bacteria | 2395 |
| 219 | Ga0068860_100546898 | 3300005843 | Bacteria | 1160 |
| 220 | Ga0068862_100001535 | 3300005844 | Bacteria | 21114 |
| 221 | Ga0068862_100038147 | 3300005844 | Bacteria | 4074 |
| 222 | Ga0068862_100092126 | 3300005844 | Bacteria | 2641 |
| 223 | Ga0068862_100187686 | 3300005844 | Bacteria | 1859 |
| 224 | Ga0081455_10000226 | 3300005937 | Bacteria | 72690 |
| 225 | Ga0081455_10057182 | 3300005937 | Bacteria | 3307 |
| 226 | Ga0081455_10065788 | 3300005937 | Bacteria | 3030 |
| 227 | Ga0081540_1028604 | 3300005983 | Bacteria | 3126 |
| 228 | Ga0081540_1153816 | 3300005983 | Bacteria | 903 |
| 229 | Ga0070717_10009977 | 3300006028 | Bacteria | 7146 |
| 230 | Ga0075365_10076119 | 3300006038 | Bacteria | 2266 |
| 231 | Ga0075365_10378392 | 3300006038 | Bacteria | 999 |
| 232 | Ga0075368_10288463 | 3300006042 | Bacteria | 706 |
| 233 | Ga0075432_10034783 | 3300006058 | Bacteria | 1751 |
| 234 | Ga0070716_100440109 | 3300006173 | Bacteria | 947 |
| 235 | Ga0070712_101430321 | 3300006175 | Bacteria | 604 |
| 236 | Ga0075362_10095754 | 3300006177 | Bacteria | 1382 |
| 237 | Ga0075362_10377078 | 3300006177 | Bacteria | 713 |
| 238 | Ga0075367_10149424 | 3300006178 | Bacteria | 1449 |
| 239 | Ga0097621_100003859 | 3300006237 | Bacteria | 10383 |
| 240 | Ga0097621_100015822 | 3300006237 | Bacteria | 5687 |
| 241 | Ga0097621_100056795 | 3300006237 | Bacteria | 3199 |
| 242 | Ga0097621_100213726 | 3300006237 | Bacteria | 1678 |
| 243 | Ga0097621_100408523 | 3300006237 | Bacteria | 1217 |
| 244 | Ga0097621_100429022 | 3300006237 | Bacteria | 1188 |
| 245 | Ga0097621_100572561 | 3300006237 | Bacteria | 1030 |
| 246 | Ga0075370_10174715 | 3300006353 | Bacteria | 1263 |
| 247 | Ga0068871_100043381 | 3300006358 | Bacteria | 3612 |
| 248 | Ga0068871_100048016 | 3300006358 | Bacteria | 3444 |
| 249 | Ga0068871_100065352 | 3300006358 | Bacteria | 2979 |
| 250 | Ga0068871_100229011 | 3300006358 | Bacteria | 1613 |
| 251 | Ga0068871_100379425 | 3300006358 | Bacteria | 1256 |
| 252 | Ga0068871_101005510 | 3300006358 | Bacteria | 777 |
| 253 | Ga0075428_100016948 | 3300006844 | Bacteria | 8046 |
| 254 | Ga0075428_100102590 | 3300006844 | Bacteria | 3119 |
| 255 | Ga0075428_100672416 | 3300006844 | Bacteria | 1104 |
| 256 | Ga0075430_100733325 | 3300006846 | Bacteria | 815 |
| 257 | Ga0075431_100107857 | 3300006847 | Bacteria | 2874 |
| 258 | Ga0075431_100830049 | 3300006847 | Bacteria | 896 |
| 259 | Ga0075433_10072556 | 3300006852 | Bacteria | 3027 |
| 260 | Ga0075433_10359297 | 3300006852 | Bacteria | 1287 |
| 261 | Ga0075433_10362326 | 3300006852 | Bacteria | 1281 |
| 262 | Ga0075433_10593956 | 3300006852 | Unclassified | 972 |
| 263 | Ga0075434_100003572 | 3300006871 | Bacteria | 13893 |
| 264 | Ga0075434_100037514 | 3300006871 | Bacteria | 4798 |
| 265 | Ga0075434_100096263 | 3300006871 | Bacteria | 2965 |
| 266 | Ga0075434_100338448 | 3300006871 | Bacteria | 1525 |
| 267 | Ga0075434_100654203 | 3300006871 | Bacteria | 1069 |
| 268 | Ga0075434_100915775 | 3300006871 | Bacteria | 891 |
| 269 | Ga0075434_101129184 | 3300006871 | Bacteria | 797 |
| 270 | Ga0075434_101289100 | 3300006871 | Bacteria | 741 |
| 271 | Ga0075429_100043230 | 3300006880 | Bacteria | 3921 |
| 272 | Ga0075429_100078330 | 3300006880 | Bacteria | 2880 |
| 273 | Ga0068865_100010201 | 3300006881 | Bacteria | 5839 |
| 274 | Ga0068865_100021178 | 3300006881 | Bacteria | 4226 |
| 275 | Ga0068865_100068213 | 3300006881 | Bacteria | 2514 |
| 276 | Ga0068865_101329647 | 3300006881 | Bacteria | 640 |
| 277 | Ga0075436_100667354 | 3300006914 | Bacteria | 769 |
| 278 | Ga0075436_100749045 | 3300006914 | Bacteria | 725 |
| 279 | Ga0097620_100002969 | 3300006931 | Bacteria | 17194 |
| 280 | Ga0097620_100054431 | 3300006931 | Bacteria | 4024 |
| 281 | Ga0097620_100055537 | 3300006931 | Bacteria | 3985 |
| 282 | Ga0097620_100888744 | 3300006931 | Bacteria | 976 |
| 283 | Ga0075435_100185026 | 3300007076 | Bacteria | 1761 |
| 284 | Ga0075435_100207126 | 3300007076 | Bacteria | 1663 |
| 285 | Ga0075435_100214219 | 3300007076 | Bacteria | 1635 |
| 286 | Ga0075435_100251502 | 3300007076 | Bacteria | 1504 |
| 287 | Ga0075435_100453048 | 3300007076 | Bacteria | 1106 |
| 288 | Ga0075435_100809078 | 3300007076 | Bacteria | 816 |
| 289 | Ga0075435_101140303 | 3300007076 | Bacteria | 682 |
| 290 | Ga0099794_10011923 | 3300007265 | Bacteria | 3737 |
| 291 | Ga0099795_10400193 | 3300007788 | Bacteria | 624 |
| 292 | Ga0105250_10073847 | 3300009092 | Bacteria | 1379 |
| 293 | Ga0105240_10001330 | 3300009093 | Bacteria | 42531 |
| 294 | Ga0111539_10203466 | 3300009094 | Bacteria | 2308 |
| 295 | Ga0111539_10250089 | 3300009094 | Bacteria | 2064 |
| 296 | Ga0111539_10295811 | 3300009094 | Bacteria | 1884 |
| 297 | Ga0111539_10781978 | 3300009094 | Bacteria | 1111 |
| 298 | Ga0105245_10053235 | 3300009098 | Bacteria | 3632 |
| 299 | Ga0105245_10077693 | 3300009098 | Bacteria | 3027 |
| 300 | Ga0105245_10171053 | 3300009098 | Bacteria | 2069 |
| 301 | Ga0105245_12472774 | 3300009098 | Bacteria | 573 |
| 302 | Ga0105247_10008977 | 3300009101 | Bacteria | 6092 |
| 303 | Ga0114129_10011440 | 3300009147 | Bacteria | 12638 |
| 304 | Ga0114129_10022153 | 3300009147 | Bacteria | 9018 |
| 305 | Ga0114129_10196805 | 3300009147 | Bacteria | 2732 |
| 306 | Ga0114129_10198157 | 3300009147 | Bacteria | 2722 |
| 307 | Ga0114129_10238507 | 3300009147 | Bacteria | 2445 |
| 308 | Ga0114129_10271801 | 3300009147 | Bacteria | 2267 |
| 309 | Ga0114129_10311992 | 3300009147 | Bacteria | 2093 |
| 310 | Ga0114129_10431959 | 3300009147 | Bacteria | 1730 |
| 311 | Ga0114129_10528208 | 3300009147 | Bacteria | 1537 |
| 312 | Ga0114129_10550738 | 3300009147 | Unclassified | 1500 |
| 313 | Ga0114129_10594414 | 3300009147 | Unclassified | 1435 |
| 314 | Ga0114129_10731549 | 3300009147 | Bacteria | 1268 |
| 315 | Ga0114129_10740298 | 3300009147 | Bacteria | 1259 |
| 316 | Ga0114129_11012391 | 3300009147 | Bacteria | 1045 |
| 317 | Ga0105243_10141993 | 3300009148 | Bacteria | 2050 |
| 318 | Ga0105243_10509341 | 3300009148 | Bacteria | 1142 |
| 319 | Ga0105243_10516184 | 3300009148 | Bacteria | 1135 |
| 320 | Ga0105243_10856486 | 3300009148 | Bacteria | 900 |
| 321 | Ga0105243_11020737 | 3300009148 | Bacteria | 831 |
| 322 | Ga0105241_10059818 | 3300009174 | Bacteria | 2930 |
| 323 | Ga0105241_10092818 | 3300009174 | Bacteria | 2384 |
| 324 | Ga0105241_10144541 | 3300009174 | Bacteria | 1940 |
| 325 | Ga0105242_10009807 | 3300009176 | Bacteria | 7340 |
| 326 | Ga0105242_10016619 | 3300009176 | Bacteria | 5723 |
| 327 | Ga0105242_10049142 | 3300009176 | Bacteria | 3431 |
| 328 | Ga0105242_10090718 | 3300009176 | Bacteria | 2571 |
| 329 | Ga0105242_10104861 | 3300009176 | Bacteria | 2400 |
| 330 | Ga0105242_10488988 | 3300009176 | Bacteria | 1168 |
| 331 | Ga0105242_11639382 | 3300009176 | Bacteria | 678 |
| 332 | Ga0105242_11934323 | 3300009176 | Bacteria | 631 |
| 333 | Ga0105242_12060601 | 3300009176 | Bacteria | 614 |
| 334 | Ga0105248_10024239 | 3300009177 | Bacteria | 6746 |
| 335 | Ga0105248_10025818 | 3300009177 | Bacteria | 6533 |
| 336 | Ga0105248_10036500 | 3300009177 | Bacteria | 5497 |
| 337 | Ga0105248_10112799 | 3300009177 | Bacteria | 3066 |
| 338 | Ga0105248_10253105 | 3300009177 | Bacteria | 1982 |
| 339 | Ga0105248_10536500 | 3300009177 | Bacteria | 1320 |
| 340 | Ga0105248_10979019 | 3300009177 | Bacteria | 955 |
| 341 | Ga0105237_10069357 | 3300009545 | Bacteria | 3521 |
| 342 | Ga0105237_10139161 | 3300009545 | Bacteria | 2422 |
| 343 | Ga0105237_10185851 | 3300009545 | Bacteria | 2078 |
| 344 | Ga0105237_11305299 | 3300009545 | Bacteria | 732 |
| 345 | Ga0105238_10005828 | 3300009551 | Bacteria | 12197 |
| 346 | Ga0105238_10244453 | 3300009551 | Bacteria | 1772 |
| 347 | Ga0105249_10001223 | 3300009553 | Bacteria | 22627 |
| 348 | Ga0105249_11148879 | 3300009553 | Bacteria | 847 |
| 349 | Ga0105239_10565288 | 3300010375 | Bacteria | 1296 |
| 350 | Ga0105246_10175600 | 3300011119 | Bacteria | 1645 |
| 351 | Ga0105246_10420803 | 3300011119 | Bacteria | 1115 |
| 352 | Ga0105246_10504749 | 3300011119 | Bacteria | 1028 |
| 353 | Ga0105246_10534124 | 3300011119 | Bacteria | 1002 |
| 354 | Ga0105246_10546199 | 3300011119 | Bacteria | 992 |
| 355 | Ga0157315_1005180 | 3300012508 | Bacteria | 967 |
| 356 | Ga0157371_10375229 | 3300013102 | Bacteria | 1038 |
| 357 | Ga0157370_10009355 | 3300013104 | Bacteria | 10484 |
| 358 | Ga0157370_10230292 | 3300013104 | Bacteria | 1715 |
| 359 | Ga0157369_10631415 | 3300013105 | Bacteria | 1105 |
| 360 | Ga0157374_10062855 | 3300013296 | Bacteria | 3481 |
| 361 | Ga0157374_10073858 | 3300013296 | Bacteria | 3219 |
| 362 | Ga0157374_10301332 | 3300013296 | Bacteria | 1586 |
| 363 | Ga0157378_10082855 | 3300013297 | Bacteria | 2901 |
| 364 | Ga0157378_11073682 | 3300013297 | Bacteria | 841 |
| 365 | Ga0157378_11237611 | 3300013297 | Bacteria | 787 |
| 366 | Ga0163162_10069114 | 3300013306 | Bacteria | 3584 |
| 367 | Ga0163162_10117078 | 3300013306 | Bacteria | 2766 |
| 368 | Ga0163162_10323767 | 3300013306 | Bacteria | 1674 |
| 369 | Ga0163162_10537592 | 3300013306 | Bacteria | 1297 |
| 370 | Ga0163162_11067052 | 3300013306 | Bacteria | 915 |
| 371 | Ga0163162_12011155 | 3300013306 | Bacteria | 662 |
| 372 | Ga0157372_10114885 | 3300013307 | Bacteria | 3086 |
| 373 | Ga0157372_11912900 | 3300013307 | Bacteria | 682 |
| 374 | Ga0157375_10056537 | 3300013308 | Bacteria | 3874 |
| 375 | Ga0157375_10095545 | 3300013308 | Bacteria | 3043 |
| 376 | Ga0157375_10335476 | 3300013308 | Bacteria | 1677 |
| 377 | Ga0157375_10682835 | 3300013308 | Bacteria | 1181 |
| 378 | Ga0157375_11959054 | 3300013308 | Bacteria | 696 |
| 379 | Ga0163163_10027621 | 3300014325 | Bacteria | 5438 |
| 380 | Ga0163163_10120750 | 3300014325 | Bacteria | 2655 |
| 381 | Ga0163163_10156859 | 3300014325 | Bacteria | 2320 |
| 382 | Ga0157380_10078136 | 3300014326 | Bacteria | 2699 |
| 383 | Ga0157380_10551024 | 3300014326 | Bacteria | 1131 |
| 384 | Ga0157377_10006418 | 3300014745 | Bacteria | 5610 |
| 385 | Ga0157379_10007688 | 3300014968 | Bacteria | 9333 |
| 386 | Ga0157379_10067866 | 3300014968 | Bacteria | 3188 |
| 387 | Ga0157379_10983037 | 3300014968 | Bacteria | 804 |
| 388 | Ga0157376_10014139 | 3300014969 | Bacteria | 5978 |
| 389 | Ga0157376_10035926 | 3300014969 | Bacteria | 4011 |
| 390 | Ga0157376_10115121 | 3300014969 | Bacteria | 2373 |
| 391 | Ga0157376_10245593 | 3300014969 | Bacteria | 1669 |
| 392 | Ga0157376_10360050 | 3300014969 | Bacteria | 1395 |
| 393 | Ga0157376_10465284 | 3300014969 | Bacteria | 1236 |
| 394 | Ga0157376_11378782 | 3300014969 | Bacteria | 736 |
| 395 | Ga0163161_10073412 | 3300017792 | Bacteria | 2507 |
| 396 | Ga0163161_10224990 | 3300017792 | Bacteria | 1454 |
| 397 | Ga0224712_10003138 | 3300022467 | Bacteria | 4229 |
| 398 | Ga0207697_10080600 | 3300025315 | Bacteria | 1371 |
| 399 | Ga0207697_10189254 | 3300025315 | Bacteria | 903 |
| 400 | Ga0207656_10183454 | 3300025321 | Bacteria | 1005 |
| 401 | Ga0207653_10111444 | 3300025885 | Bacteria | 977 |
| 402 | Ga0207653_10206557 | 3300025885 | Bacteria | 742 |
| 403 | Ga0207653_10273894 | 3300025885 | Bacteria | 650 |
| 404 | Ga0207682_10017781 | 3300025893 | Bacteria | 2775 |
| 405 | Ga0207692_10808069 | 3300025898 | Bacteria | 613 |
| 406 | Ga0207642_10070945 | 3300025899 | Bacteria | 1657 |
| 407 | Ga0207688_10003055 | 3300025901 | Bacteria | 9124 |
| 408 | Ga0207688_10124807 | 3300025901 | Bacteria | 1505 |
| 409 | Ga0207680_10217513 | 3300025903 | Bacteria | 1308 |
| 410 | Ga0207647_10144210 | 3300025904 | Bacteria | 1395 |
| 411 | Ga0207645_10044683 | 3300025907 | Bacteria | 2834 |
| 412 | Ga0207645_10123370 | 3300025907 | Bacteria | 1683 |
| 413 | Ga0207643_10008496 | 3300025908 | Bacteria | 5507 |
| 414 | Ga0207643_10017500 | 3300025908 | Bacteria | 3919 |
| 415 | Ga0207643_10100937 | 3300025908 | Bacteria | 1692 |
| 416 | Ga0207643_10270825 | 3300025908 | Bacteria | 1051 |
| 417 | Ga0207684_10000004 | 3300025910 | Bacteria | 755956 |
| 418 | Ga0207684_10034857 | 3300025910 | Bacteria | 4274 |
| 419 | Ga0207684_10094665 | 3300025910 | Bacteria | 2548 |
| 420 | Ga0207684_10299980 | 3300025910 | Unclassified | 1385 |
| 421 | Ga0207684_10596054 | 3300025910 | Bacteria | 944 |
| 422 | Ga0207684_11006118 | 3300025910 | Bacteria | 697 |
| 423 | Ga0207684_11011298 | 3300025910 | Bacteria | 695 |
| 424 | Ga0207654_10038891 | 3300025911 | Bacteria | 2672 |
| 425 | Ga0207654_10172793 | 3300025911 | Bacteria | 1404 |
| 426 | Ga0207707_10079898 | 3300025912 | Bacteria | 2855 |
| 427 | Ga0207707_10237013 | 3300025912 | Bacteria | 1587 |
| 428 | Ga0207707_10779401 | 3300025912 | Bacteria | 798 |
| 429 | Ga0207695_10002411 | 3300025913 | Bacteria | 27678 |
| 430 | Ga0207695_10343044 | 3300025913 | Bacteria | 1381 |
| 431 | Ga0207695_10468447 | 3300025913 | Bacteria | 1142 |
| 432 | Ga0207695_11032223 | 3300025913 | Unclassified | 702 |
| 433 | Ga0207671_10115324 | 3300025914 | Bacteria | 2048 |
| 434 | Ga0207671_10390103 | 3300025914 | Unclassified | 1107 |
| 435 | Ga0207671_11032265 | 3300025914 | Bacteria | 647 |
| 436 | Ga0207693_10129071 | 3300025915 | Bacteria | 1987 |
| 437 | Ga0207663_10445217 | 3300025916 | Bacteria | 998 |
| 438 | Ga0207663_10900665 | 3300025916 | Bacteria | 707 |
| 439 | Ga0207660_10040125 | 3300025917 | Bacteria | 3276 |
| 440 | Ga0207660_10136350 | 3300025917 | Bacteria | 1873 |
| 441 | Ga0207660_10794446 | 3300025917 | Bacteria | 772 |
| 442 | Ga0207662_10018473 | 3300025918 | Bacteria | 3957 |
| 443 | Ga0207662_10036843 | 3300025918 | Bacteria | 2860 |
| 444 | Ga0207662_10651175 | 3300025918 | Bacteria | 736 |
| 445 | Ga0207657_10082888 | 3300025919 | Bacteria | 2691 |
| 446 | Ga0207657_10538352 | 3300025919 | Bacteria | 913 |
| 447 | Ga0207649_10008732 | 3300025920 | Bacteria | 5533 |
| 448 | Ga0207649_10399469 | 3300025920 | Bacteria | 1028 |
| 449 | Ga0207649_10407022 | 3300025920 | Bacteria | 1019 |
| 450 | Ga0207649_10547796 | 3300025920 | Bacteria | 885 |
| 451 | Ga0207652_10757141 | 3300025921 | Bacteria | 864 |
| 452 | Ga0207646_10026114 | 3300025922 | Bacteria | 5335 |
| 453 | Ga0207646_10044932 | 3300025922 | Bacteria | 3965 |
| 454 | Ga0207646_10075989 | 3300025922 | Bacteria | 3001 |
| 455 | Ga0207646_10571873 | 3300025922 | Bacteria | 1015 |
| 456 | Ga0207681_10000292 | 3300025923 | Bacteria | 37133 |
| 457 | Ga0207681_10453554 | 3300025923 | Bacteria | 1043 |
| 458 | Ga0207694_10067586 | 3300025924 | Bacteria | 2789 |
| 459 | Ga0207694_10585255 | 3300025924 | Bacteria | 938 |
| 460 | Ga0207650_10005992 | 3300025925 | Bacteria | 8294 |
| 461 | Ga0207650_10012968 | 3300025925 | Bacteria | 5762 |
| 462 | Ga0207650_10669881 | 3300025925 | Bacteria | 875 |
| 463 | Ga0207659_10000931 | 3300025926 | Bacteria | 17445 |
| 464 | Ga0207659_10287240 | 3300025926 | Bacteria | 1347 |
| 465 | Ga0207659_11126087 | 3300025926 | Bacteria | 675 |
| 466 | Ga0207687_10050723 | 3300025927 | Bacteria | 2890 |
| 467 | Ga0207687_10336048 | 3300025927 | Bacteria | 1227 |
| 468 | Ga0207700_10392513 | 3300025928 | Bacteria | 1215 |
| 469 | Ga0207700_10453801 | 3300025928 | Bacteria | 1130 |
| 470 | Ga0207664_10951846 | 3300025929 | Bacteria | 770 |
| 471 | Ga0207644_10028794 | 3300025931 | Bacteria | 3849 |
| 472 | Ga0207644_10042692 | 3300025931 | Bacteria | 3215 |
| 473 | Ga0207644_10321233 | 3300025931 | Bacteria | 1252 |
| 474 | Ga0207644_10659563 | 3300025931 | Bacteria | 871 |
| 475 | Ga0207690_10224951 | 3300025932 | Bacteria | 1438 |
| 476 | Ga0207686_10008069 | 3300025934 | Bacteria | 5680 |
| 477 | Ga0207686_10029951 | 3300025934 | Bacteria | 3217 |
| 478 | Ga0207686_10064624 | 3300025934 | Bacteria | 2331 |
| 479 | Ga0207686_10119533 | 3300025934 | Bacteria | 1791 |
| 480 | Ga0207686_10321383 | 3300025934 | Bacteria | 1156 |
| 481 | Ga0207686_10370605 | 3300025934 | Bacteria | 1083 |
| 482 | Ga0207686_11458307 | 3300025934 | Bacteria | 564 |
| 483 | Ga0207709_10043079 | 3300025935 | Bacteria | 2719 |
| 484 | Ga0207709_10088224 | 3300025935 | Bacteria | 2019 |
| 485 | Ga0207709_10353896 | 3300025935 | Bacteria | 1109 |
| 486 | Ga0207670_10145706 | 3300025936 | Bacteria | 1751 |
| 487 | Ga0207669_10105154 | 3300025937 | Bacteria | 1877 |
| 488 | Ga0207669_10674776 | 3300025937 | Bacteria | 847 |
| 489 | Ga0207704_10028908 | 3300025938 | Bacteria | 3083 |
| 490 | Ga0207704_10039712 | 3300025938 | Bacteria | 2744 |
| 491 | Ga0207691_10009425 | 3300025940 | Bacteria | 9377 |
| 492 | Ga0207691_10048890 | 3300025940 | Bacteria | 3876 |
| 493 | Ga0207691_10091716 | 3300025940 | Bacteria | 2722 |
| 494 | Ga0207691_10748577 | 3300025940 | Bacteria | 823 |
| 495 | Ga0207711_10432753 | 3300025941 | Bacteria | 1224 |
| 496 | Ga0207711_10486297 | 3300025941 | Bacteria | 1150 |
| 497 | Ga0207711_10719115 | 3300025941 | Bacteria | 931 |
| 498 | Ga0207711_11049257 | 3300025941 | Bacteria | 755 |
| 499 | Ga0207711_11087951 | 3300025941 | Bacteria | 740 |
| 500 | Ga0207711_11133077 | 3300025941 | Bacteria | 723 |
| 501 | Ga0207689_10036911 | 3300025942 | Bacteria | 4055 |
| 502 | Ga0207689_10183898 | 3300025942 | Bacteria | 1723 |
| 503 | Ga0207689_10251978 | 3300025942 | Bacteria | 1460 |
| 504 | Ga0207689_10560433 | 3300025942 | Bacteria | 960 |
| 505 | Ga0207661_10285102 | 3300025944 | Bacteria | 1477 |
| 506 | Ga0207679_10040102 | 3300025945 | Bacteria | 3349 |
| 507 | Ga0207679_10179748 | 3300025945 | Bacteria | 1749 |
| 508 | Ga0207679_10394445 | 3300025945 | Bacteria | 1216 |
| 509 | Ga0207667_10045803 | 3300025949 | Bacteria | 4631 |
| 510 | Ga0207667_10231647 | 3300025949 | Bacteria | 1891 |
| 511 | Ga0207651_10049127 | 3300025960 | Bacteria | 2856 |
| 512 | Ga0207651_10161067 | 3300025960 | Bacteria | 1759 |
| 513 | Ga0207651_10226725 | 3300025960 | Bacteria | 1514 |
| 514 | Ga0207651_10265733 | 3300025960 | Bacteria | 1411 |
| 515 | Ga0207712_10003713 | 3300025961 | Bacteria | 9633 |
| 516 | Ga0207712_10352061 | 3300025961 | Bacteria | 1225 |
| 517 | Ga0207668_10005811 | 3300025972 | Bacteria | 7270 |
| 518 | Ga0207668_10113129 | 3300025972 | Bacteria | 2040 |
| 519 | Ga0207668_10436201 | 3300025972 | Bacteria | 1115 |
| 520 | Ga0207640_10931352 | 3300025981 | Bacteria | 761 |
| 521 | Ga0207658_10081375 | 3300025986 | Bacteria | 2483 |
| 522 | Ga0207658_10145076 | 3300025986 | Bacteria | 1926 |
| 523 | Ga0207658_10286393 | 3300025986 | Bacteria | 1414 |
| 524 | Ga0207677_10280726 | 3300026023 | Bacteria | 1367 |
| 525 | Ga0207703_10035190 | 3300026035 | Bacteria | 3979 |
| 526 | Ga0207703_10139824 | 3300026035 | Bacteria | 2100 |
| 527 | Ga0207703_10756484 | 3300026035 | Bacteria | 926 |
| 528 | Ga0207703_10946036 | 3300026035 | Bacteria | 826 |
| 529 | Ga0207639_10065889 | 3300026041 | Bacteria | 2813 |
| 530 | Ga0207639_10185768 | 3300026041 | Bacteria | 1772 |
| 531 | Ga0207639_11158263 | 3300026041 | Bacteria | 726 |
| 532 | Ga0207639_11456189 | 3300026041 | Bacteria | 643 |
| 533 | Ga0207678_10047770 | 3300026067 | Bacteria | 3701 |
| 534 | Ga0207678_10073288 | 3300026067 | Bacteria | 2935 |
| 535 | Ga0207678_11566432 | 3300026067 | Bacteria | 581 |
| 536 | Ga0207708_10035720 | 3300026075 | Bacteria | 3782 |
| 537 | Ga0207708_10052282 | 3300026075 | Bacteria | 3112 |
| 538 | Ga0207708_10334248 | 3300026075 | Bacteria | 1239 |
| 539 | Ga0207702_10173340 | 3300026078 | Bacteria | 1980 |
| 540 | Ga0207702_10378897 | 3300026078 | Bacteria | 1360 |
| 541 | Ga0207702_10952531 | 3300026078 | Bacteria | 851 |
| 542 | Ga0207702_11418863 | 3300026078 | Bacteria | 688 |
| 543 | Ga0207641_10021744 | 3300026088 | Bacteria | 5273 |
| 544 | Ga0207641_10049400 | 3300026088 | Bacteria | 3555 |
| 545 | Ga0207641_10058812 | 3300026088 | Bacteria | 3272 |
| 546 | Ga0207641_10171746 | 3300026088 | Unclassified | 1979 |
| 547 | Ga0207641_10555416 | 3300026088 | Unclassified | 1120 |
| 548 | Ga0207648_10000938 | 3300026089 | Bacteria | 32907 |
| 549 | Ga0207648_10054113 | 3300026089 | Bacteria | 3506 |
| 550 | Ga0207676_10004720 | 3300026095 | Bacteria | 9657 |
| 551 | Ga0207676_10022478 | 3300026095 | Bacteria | 4639 |
| 552 | Ga0207676_10035799 | 3300026095 | Bacteria | 3771 |
| 553 | Ga0207676_10234985 | 3300026095 | Bacteria | 1641 |
| 554 | Ga0207676_11224240 | 3300026095 | Bacteria | 744 |
| 555 | Ga0207674_10043797 | 3300026116 | Bacteria | 4613 |
| 556 | Ga0207674_11153607 | 3300026116 | Bacteria | 744 |
| 557 | Ga0207675_100001384 | 3300026118 | Bacteria | 24327 |
| 558 | Ga0207675_100003563 | 3300026118 | Bacteria | 15160 |
| 559 | Ga0207675_100334315 | 3300026118 | Bacteria | 1482 |
| 560 | Ga0207675_101557717 | 3300026118 | Bacteria | 681 |
| 561 | Ga0207683_10064073 | 3300026121 | Bacteria | 3239 |
| 562 | Ga0207683_10409672 | 3300026121 | Bacteria | 1248 |
| 563 | Ga0207683_10516020 | 3300026121 | Bacteria | 1104 |
| 564 | Ga0207683_10550786 | 3300026121 | Bacteria | 1066 |
| 565 | Ga0207683_11396317 | 3300026121 | Bacteria | 647 |
| 566 | Ga0207698_10221559 | 3300026142 | Bacteria | 1710 |
| 567 | Ga0207698_10517771 | 3300026142 | Bacteria | 1163 |
| 568 | Ga0210002_1029676 | 3300027617 | Bacteria | 906 |
| 569 | Ga0209588_1028656 | 3300027671 | Bacteria | 1773 |
| 570 | Ga0209966_1034525 | 3300027695 | Bacteria | 1035 |
| 571 | Ga0209974_10056907 | 3300027876 | Bacteria | 1320 |
| 572 | Ga0207428_10000562 | 3300027907 | Bacteria | 43846 |
| 573 | Ga0207428_10990430 | 3300027907 | Bacteria | 591 |
| 574 | Ga0268266_10036665 | 3300028379 | Bacteria | 4176 |
| 575 | Ga0268265_10000103 | 3300028380 | Bacteria | 106177 |
| 576 | Ga0268265_10300765 | 3300028380 | Bacteria | 1444 |
| 577 | Ga0268265_10603622 | 3300028380 | Bacteria | 1049 |
| 578 | Ga0268265_10682639 | 3300028380 | Bacteria | 990 |
| 579 | Ga0268264_10020042 | 3300028381 | Bacteria | 5464 |
| 580 | Ga0268264_10124713 | 3300028381 | Bacteria | 2274 |
| 581 | Ga0268264_10137446 | 3300028381 | Bacteria | 2175 |
| 582 | Ga0268264_10276102 | 3300028381 | Bacteria | 1572 |
| 583 | Ga0268264_10311470 | 3300028381 | Bacteria | 1485 |
| 584 | Ga0268264_10374221 | 3300028381 | Bacteria | 1362 |
| 585 | Ga0265329_10105184 | 3300031242 | Unclassified | 900 |
| 586 | Ga0265339_10136875 | 3300031249 | Unclassified | 1249 |
| 587 | Ga0265327_10106121 | 3300031251 | Bacteria | 1349 |
| 588 | Ga0265314_10001454 | 3300031711 | Bacteria | 26457 |
| 589 | Ga0373959_0054010 | 3300034820 | Bacteria | 874 |
| 590 | Ga0373926_0356464 | 3300035083 | Bacteria | 575 |
| 591 | Ga0373949_0037290 | 3300035090 | Bacteria | 1182 |
| 592 | Ga0373952_0268072 | 3300035092 | Bacteria | 522 |
| 593 | Ga0373936_0200539 | 3300035113 | Bacteria | 881 |
| 594 | Ga0373939_0032575 | 3300035114 | Bacteria | 1516 |
| 595 | Ga0373939_0044667 | 3300035114 | Bacteria | 1349 |
| 596 | Ga0373939_0187369 | 3300035114 | Bacteria | 775 |
| 597 | Ga0373941_0101373 | 3300035115 | Bacteria | 1003 |
| 598 | Ga0373945_0048053 | 3300035116 | Bacteria | 1562 |
| 599 | Ga0373954_0308422 | 3300035118 | Unclassified | 781 |
| 600 | Ga0373954_0361884 | 3300035118 | Bacteria | 717 |
| 601 | Ga0373954_0572893 | 3300035118 | Bacteria | 560 |
| 602 | Ga0373956_0072790 | 3300035119 | Bacteria | 1570 |
| 603 | Ga0373956_0077187 | 3300035119 | Bacteria | 1525 |
| 604 | Ga0373960_0004518 | 3300035121 | Bacteria | 3193 |
| 605 | Ga0373943_0073906 | 3300035170 | Bacteria | 1732 |
| 606 | Ga0373943_0139140 | 3300035170 | Bacteria | 1306 |
| 607 | Ga0373943_0175446 | 3300035170 | Bacteria | 1175 |
| 608 | Ga0373946_0011306 | 3300035171 | Bacteria | 3327 |
| 609 | Ga0373955_0002461 | 3300035172 | Bacteria | 8090 |
| 610 | Ga0373955_0056957 | 3300035172 | Unclassified | 2146 |
| 611 | Ga0373955_0141987 | 3300035172 | Bacteria | 1409 |
| 612 | Ga0373955_0188367 | 3300035172 | Bacteria | 1226 |
| 613 | Ga0373955_0712081 | 3300035172 | Bacteria | 616 |
| 614 | Ga0373924_0012321 | 3300035410 | Bacteria | 3193 |
| 615 | Ga0373924_0014243 | 3300035410 | Bacteria | 3003 |
| 616 | Ga0373931_0021322 | 3300035691 | Bacteria | 3250 |
| 617 | Ga0373935_0024708 | 3300035692 | Unclassified | 3701 |
| 618 | Ga0373935_0341335 | 3300035692 | Bacteria | 1066 |
| 619 | Ga0373935_0435121 | 3300035692 | Bacteria | 946 |
| 620 | Ga0373935_0515391 | 3300035692 | Bacteria | 869 |
| 621 | Ga0373927_0011784 | 3300035695 | Bacteria | 5822 |
| 622 | Ga0373927_0013854 | 3300035695 | Bacteria | 5351 |
| 623 | Ga0373927_0194675 | 3300035695 | Bacteria | 1330 |
| 624 | Ga0373927_0679101 | 3300035695 | Bacteria | 680 |
| 625 | Ga0373927_0757209 | 3300035695 | Bacteria | 642 |
| 626 | Ga0373933_0236551 | 3300035724 | Unclassified | 1174 |
| 627 | Ga0373933_0299634 | 3300035724 | Unclassified | 1041 |
| 628 | Ga0373947_0065523 | 3300035725 | Unclassified | 2216 |
| 629 | Ga0373947_0448756 | 3300035725 | Bacteria | 873 |
| 630 | Ga0373947_0650992 | 3300035725 | Bacteria | 718 |
| 631 | Ga0373947_0840724 | 3300035725 | Bacteria | 627 |
| 632 | Ga0373947_1010188 | 3300035725 | Bacteria | 567 |
| 633 | Ga0373937_0009278 | 3300036401 | Bacteria | 8542 |
| 634 | Ga0373937_0014245 | 3300036401 | Bacteria | 7018 |
| 635 | Ga0373937_0098568 | 3300036401 | Bacteria | 2711 |
| 636 | Ga0373937_0333697 | 3300036401 | Archaea | 1435 |
| 637 | Ga0373937_0688370 | 3300036401 | Bacteria | 969 |
| 638 | Ga0373937_1710923 | 3300036401 | Bacteria | 576 |
| 639 | Ga0373937_1855746 | 3300036401 | Bacteria | 549 |
| 640 | Ga0373925_0026267 | 3300037068 | Bacteria | 4261 |
| 641 | Ga0373925_0056176 | 3300037068 | Bacteria | 2949 |
| 642 | Ga0373925_0082087 | 3300037068 | Unclassified | 2452 |
| 643 | Ga0373925_0307013 | 3300037068 | Bacteria | 1282 |
| 644 | Ga0373925_0452164 | 3300037068 | Bacteria | 1052 |
| 645 | Ga0436361_0314528 | 3300039447 | Bacteria | 662 |
| 646 | Ga0436361_0481279 | 3300039447 | Bacteria | 1943 |
| 647 | Ga0451835_0112714 | 3300041492 | Bacteria | 580 |
| 648 | Ga0451843_0352523 | 3300041509 | Unclassified | 754 |
| 649 | Ga0451577_0788457 | 3300042876 | Bacteria | 859 |
| 650 | Ga0453683_0392434 | 3300044673 | Bacteria | 894 |
| 651 | Ga0451576_0021376 | 3300045051 | Bacteria | 7032 |
| 652 | Ga0451576_0054255 | 3300045051 | Bacteria | 4197 |
| 653 | Ga0451576_0079760 | 3300045051 | Bacteria | 3406 |
| 654 | Ga0495592_0012432 | 3300046454 | Bacteria | 6466 |
| 655 | Ga0495592_0145772 | 3300046454 | Bacteria | 1642 |
| 656 | Ga0495592_0341041 | 3300046454 | Bacteria | 963 |
| 657 | Ga0495603_0012179 | 3300046455 | Bacteria | 5208 |
| 658 | Ga0495603_0033288 | 3300046455 | Bacteria | 3101 |
| 659 | Ga0495603_0354626 | 3300046455 | Bacteria | 841 |
| 660 | Ga0495591_031022 | 3300046458 | Bacteria | 1608 |
| 661 | Ga0495629_0001619 | 3300046459 | Bacteria | 17689 |
| 662 | Ga0495629_0206406 | 3300046459 | Bacteria | 1358 |
| 663 | Ga0495641_0011781 | 3300046461 | Bacteria | 4946 |
| 664 | Ga0495641_0059056 | 3300046461 | Bacteria | 1734 |
| 665 | Ga0495641_0128963 | 3300046461 | Bacteria | 1129 |
| 666 | Ga0495641_0157720 | 3300046461 | Bacteria | 1015 |
| 667 | Ga0495651_0010791 | 3300046462 | Bacteria | 7023 |
| 668 | Ga0495653_0007069 | 3300046463 | Bacteria | 9207 |
| 669 | Ga0495653_0423410 | 3300046463 | Bacteria | 842 |
| 670 | Ga0495580_0282572 | 3300046472 | Archaea | 1132 |
| 671 | Ga0495580_0381500 | 3300046472 | Bacteria | 952 |
| 672 | Ga0495580_0436195 | 3300046472 | Bacteria | 880 |
| 673 | Ga0495580_0648168 | 3300046472 | Unclassified | 695 |
| 674 | Ga0495582_0030627 | 3300046473 | Bacteria | 2955 |
| 675 | Ga0495582_0622721 | 3300046473 | Bacteria | 624 |
| 676 | Ga0495605_0039567 | 3300046474 | Bacteria | 2361 |
| 677 | Ga0495662_0118018 | 3300046476 | Bacteria | 1302 |
| 678 | Ga0495662_0333473 | 3300046476 | Bacteria | 746 |
| 679 | Ga0495664_0055733 | 3300046477 | Bacteria | 2352 |
| 680 | Ga0495664_0421175 | 3300046477 | Unclassified | 801 |
| 681 | Ga0495584_0021570 | 3300046491 | Bacteria | 3271 |
| 682 | Ga0495584_0090238 | 3300046491 | Bacteria | 1545 |
| 683 | Ga0495584_0264785 | 3300046491 | Bacteria | 874 |
| 684 | Ga0495585_0033701 | 3300046492 | Bacteria | 2898 |
| 685 | Ga0495594_0363912 | 3300046499 | Bacteria | 823 |
| 686 | Ga0495608_0019989 | 3300046511 | Bacteria | 4605 |
| 687 | Ga0495608_0021909 | 3300046511 | Bacteria | 4382 |
| 688 | Ga0495608_0039578 | 3300046511 | Bacteria | 3159 |
| 689 | Ga0495608_0077149 | 3300046511 | Bacteria | 2169 |
| 690 | Ga0495618_0074366 | 3300046514 | Unclassified | 2164 |
| 691 | Ga0495618_0096622 | 3300046514 | Bacteria | 1889 |
| 692 | Ga0495618_0131235 | 3300046514 | Bacteria | 1603 |
| 693 | Ga0495618_0593975 | 3300046514 | Bacteria | 659 |
| 694 | Ga0495628_0001354 | 3300046516 | Bacteria | 22458 |
| 695 | Ga0495628_0135498 | 3300046516 | Bacteria | 1882 |
| 696 | Ga0495628_0669244 | 3300046516 | Bacteria | 736 |
| 697 | Ga0495628_1020346 | 3300046516 | Bacteria | 568 |
| 698 | Ga0495630_0024914 | 3300046517 | Bacteria | 4423 |
| 699 | Ga0495630_0121217 | 3300046517 | Bacteria | 1984 |
| 700 | Ga0495630_0315905 | 3300046517 | Bacteria | 1194 |
| 701 | Ga0495630_0980307 | 3300046517 | Bacteria | 643 |
| 702 | Ga0495631_0308298 | 3300046518 | Bacteria | 673 |
| 703 | Ga0495632_0071273 | 3300046519 | Bacteria | 1670 |
| 704 | Ga0495637_0183949 | 3300046520 | Bacteria | 774 |
| 705 | Ga0495644_0115441 | 3300046523 | Bacteria | 1020 |
| 706 | Ga0495663_0168992 | 3300046525 | Bacteria | 753 |
| 707 | Ga0495663_0189248 | 3300046525 | Bacteria | 715 |
| 708 | Ga0495666_0331104 | 3300046526 | Unclassified | 687 |
| 709 | Ga0495642_0006036 | 3300046528 | Bacteria | 4653 |
| 710 | Ga0495642_0134962 | 3300046528 | Bacteria | 1064 |
| 711 | Ga0495652_0040705 | 3300046529 | Bacteria | 4016 |
| 712 | Ga0495652_0209326 | 3300046529 | Bacteria | 1474 |
| 713 | Ga0495652_0292797 | 3300046529 | Bacteria | 1187 |
| 714 | Ga0495652_0398382 | 3300046529 | Bacteria | 975 |
| 715 | Ga0495652_0434933 | 3300046529 | Bacteria | 922 |
| 716 | Ga0495652_0973534 | 3300046529 | Bacteria | 556 |
| 717 | Ga0495652_1059032 | 3300046529 | Bacteria | 528 |
| 718 | Ga0495665_0141141 | 3300046531 | Bacteria | 1259 |
| 719 | Ga0495665_0160666 | 3300046531 | Bacteria | 1171 |
| 720 | Ga0495665_0319687 | 3300046531 | Bacteria | 793 |
| 721 | Ga0495640_0088887 | 3300046533 | Bacteria | 2041 |
| 722 | Ga0495640_0115812 | 3300046533 | Bacteria | 1746 |
| 723 | Ga0495640_0172548 | 3300046533 | Bacteria | 1381 |
| 724 | Ga0495586_0631293 | 3300046535 | Unclassified | 619 |
| 725 | Ga0495587_0005263 | 3300046536 | Bacteria | 8457 |
| 726 | Ga0495598_0026697 | 3300046537 | Bacteria | 1585 |
| 727 | Ga0495609_0023267 | 3300046538 | Bacteria | 2849 |
| 728 | Ga0495621_0000998 | 3300046539 | Bacteria | 7250 |
| 729 | Ga0495621_0017434 | 3300046539 | Bacteria | 2322 |
| 730 | Ga0495621_0035833 | 3300046539 | Bacteria | 1719 |
| 731 | Ga0495621_0203818 | 3300046539 | Bacteria | 796 |
| 732 | Ga0495621_0371963 | 3300046539 | Bacteria | 602 |
| 733 | Ga0495645_0052499 | 3300046543 | Bacteria | 2965 |
| 734 | Ga0495645_0637842 | 3300046543 | Bacteria | 652 |
| 735 | Ga0495622_0263691 | 3300046557 | Bacteria | 756 |
| 736 | Ga0495633_0025927 | 3300046558 | Bacteria | 2882 |
| 737 | Ga0495633_0046916 | 3300046558 | Bacteria | 2043 |
| 738 | Ga0495667_0021607 | 3300046559 | Unclassified | 4342 |
| 739 | Ga0495667_0025835 | 3300046559 | Bacteria | 3956 |
| 740 | Ga0495667_0030689 | 3300046559 | Bacteria | 3611 |
| 741 | Ga0495656_0035345 | 3300046615 | Bacteria | 2052 |
| 742 | Ga0495656_0239086 | 3300046615 | Bacteria | 914 |
| 743 | Ga0495668_0097931 | 3300046616 | Bacteria | 1605 |
| 744 | Ga0495634_0033268 | 3300046642 | Bacteria | 3543 |
| 745 | Ga0495634_0482094 | 3300046642 | Bacteria | 729 |
| 746 | Ga0495634_0648927 | 3300046642 | Bacteria | 610 |
| 747 | Ga0495611_0178484 | 3300046648 | Bacteria | 992 |
| 748 | Ga0495611_0288816 | 3300046648 | Bacteria | 757 |
| 749 | Ga0495625_0505361 | 3300046660 | Bacteria | 738 |
| 750 | Ga0495635_0041719 | 3300046663 | Unclassified | 3170 |
| 751 | Ga0495635_0415040 | 3300046663 | Bacteria | 893 |
| 752 | Ga0495659_0004982 | 3300046664 | Bacteria | 4177 |
| 753 | Ga0495659_0007522 | 3300046664 | Bacteria | 3456 |
| 754 | Ga0495659_0015511 | 3300046664 | Bacteria | 2505 |
| 755 | Ga0495659_0020676 | 3300046664 | Bacteria | 2213 |
| 756 | Ga0495659_0236393 | 3300046664 | Bacteria | 758 |
| 757 | Ga0495659_0335034 | 3300046664 | Bacteria | 644 |
| 758 | Ga0495659_0395922 | 3300046664 | Bacteria | 595 |
| 759 | Ga0495661_0085478 | 3300046665 | Bacteria | 1808 |
| 760 | Ga0495588_0083921 | 3300046674 | Bacteria | 1664 |
| 761 | Ga0495657_0001786 | 3300046675 | Bacteria | 18404 |
| 762 | Ga0495657_0062405 | 3300046675 | Bacteria | 2462 |
| 763 | Ga0495657_0222807 | 3300046675 | Bacteria | 1143 |
| 764 | Ga0495599_0004979 | 3300046678 | Bacteria | 7901 |
| 765 | Ga0495599_0216736 | 3300046678 | Bacteria | 1172 |
| 766 | Ga0495599_0250736 | 3300046678 | Bacteria | 1077 |
| 767 | Ga0495646_0339656 | 3300046680 | Bacteria | 788 |
| 768 | Ga0495646_0400732 | 3300046680 | Bacteria | 713 |
| 769 | Ga0495647_0236460 | 3300046681 | Bacteria | 810 |
| 770 | Ga0495647_0281589 | 3300046681 | Bacteria | 746 |
| 771 | Ga0495658_0028683 | 3300046683 | Bacteria | 3007 |
| 772 | Ga0495658_0042543 | 3300046683 | Bacteria | 2537 |
| 773 | Ga0495658_0045312 | 3300046683 | Bacteria | 2468 |
| 774 | Ga0495658_0133088 | 3300046683 | Bacteria | 1515 |
| 775 | Ga0495658_0190355 | 3300046683 | Bacteria | 1275 |
| 776 | Ga0495658_0235714 | 3300046683 | Bacteria | 1148 |
| 777 | Ga0495669_0041245 | 3300046684 | Bacteria | 2049 |
| 778 | Ga0495669_0131570 | 3300046684 | Bacteria | 1178 |
| 779 | Ga0495613_0000397 | 3300046689 | Bacteria | 37243 |
| 780 | Ga0495613_0052429 | 3300046689 | Bacteria | 3005 |
| 781 | Ga0495613_0086411 | 3300046689 | Bacteria | 2274 |
| 782 | Ga0495613_0211325 | 3300046689 | Bacteria | 1364 |
| 783 | Ga0495613_0279244 | 3300046689 | Archaea | 1160 |
| 784 | Ga0495613_0382967 | 3300046689 | Bacteria | 961 |
| 785 | Ga0495624_0270103 | 3300046690 | Bacteria | 1027 |
| 786 | Ga0495670_0050138 | 3300046691 | Bacteria | 2089 |
| 787 | Ga0495670_0805766 | 3300046691 | Bacteria | 513 |
| 788 | Ga0495671_0314313 | 3300046692 | Bacteria | 752 |
| 789 | Ga0495600_0005852 | 3300046809 | Bacteria | 7436 |
| 790 | Ga0495600_0050520 | 3300046809 | Bacteria | 2714 |
| 791 | Ga0495600_0431272 | 3300046809 | Unclassified | 817 |
| 792 | Ga0495600_0728359 | 3300046809 | Bacteria | 595 |
| 793 | Ga0495660_0099059 | 3300046810 | Bacteria | 1503 |
| 794 | Ga0495581_0032318 | 3300047315 | Bacteria | 3031 |
| 795 | Ga0495581_0065787 | 3300047315 | Bacteria | 2096 |
| 796 | Ga0495581_0070552 | 3300047315 | Bacteria | 2021 |
| 797 | Ga0495581_0679300 | 3300047315 | Bacteria | 594 |
| 798 | Ga0495604_0003278 | 3300047317 | Bacteria | 12936 |
| 799 | Ga0495604_0027344 | 3300047317 | Bacteria | 4538 |
| 800 | Ga0495636_0015384 | 3300047318 | Bacteria | 3049 |
| 801 | Ga0495636_0062273 | 3300047318 | Bacteria | 1579 |
| 802 | Ga0495636_0071921 | 3300047318 | Bacteria | 1477 |
| 803 | Ga0495636_0312481 | 3300047318 | Bacteria | 737 |
| 804 | Ga0495674_0002008 | 3300047319 | Bacteria | 20015 |
| 805 | Ga0495674_0054300 | 3300047319 | Bacteria | 3519 |
| 806 | Ga0495674_0061291 | 3300047319 | Bacteria | 3280 |
| 807 | Ga0495674_0163199 | 3300047319 | Bacteria | 1863 |
| 808 | Ga0495674_0576860 | 3300047319 | Bacteria | 893 |
| 809 | Ga0495674_1464621 | 3300047319 | Unclassified | 507 |
| 810 | Ga0495676_0010821 | 3300047321 | Bacteria | 8254 |
| 811 | Ga0495676_0237402 | 3300047321 | Bacteria | 1249 |
| 812 | Ga0495680_0032767 | 3300047322 | Bacteria | 4214 |
| 813 | Ga0495680_0399851 | 3300047322 | Unclassified | 949 |
| 814 | Ga0495680_0937945 | 3300047322 | Bacteria | 557 |
| 815 | Ga0495683_0081466 | 3300047323 | Bacteria | 1578 |
| 816 | Ga0495675_0002749 | 3300047444 | Bacteria | 10537 |
| 817 | Ga0495675_0199333 | 3300047444 | Unclassified | 1219 |
| 818 | Ga0495675_0738754 | 3300047444 | Unclassified | 549 |
| 819 | Ga0495677_0019265 | 3300047445 | Bacteria | 2475 |
| 820 | Ga0495677_0025693 | 3300047445 | Bacteria | 2137 |
| 821 | Ga0495677_0091357 | 3300047445 | Bacteria | 1147 |
| 822 | Ga0495679_061254 | 3300047446 | Bacteria | 1103 |
| 823 | Ga0495685_076757 | 3300047447 | Bacteria | 1115 |
| 824 | Ga0495673_0110984 | 3300047469 | Bacteria | 1097 |
| 825 | Ga0495684_0000431 | 3300047471 | Bacteria | 34259 |
| 826 | Ga0495684_0049741 | 3300047471 | Bacteria | 3202 |
| 827 | Ga0495684_0067277 | 3300047471 | Unclassified | 2725 |
| 828 | Ga0495684_0114954 | 3300047471 | Bacteria | 2029 |
| 829 | Ga0495684_0165691 | 3300047471 | Archaea | 1646 |
| 830 | Ga0495684_0346958 | 3300047471 | Bacteria | 1055 |
| 831 | Ga0495684_0454716 | 3300047471 | Bacteria | 889 |
| 832 | Ga0495684_0744010 | 3300047471 | Bacteria | 646 |
| 833 | Ga0495686_0067826 | 3300047472 | Bacteria | 2202 |
| 834 | Ga0495686_0084280 | 3300047472 | Bacteria | 1937 |
| 835 | Ga0495593_0028114 | 3300047673 | Bacteria | 3090 |
| 836 | Ga0495593_0266968 | 3300047673 | Bacteria | 856 |
| 837 | Ga0495602_0022172 | 3300048088 | Bacteria | 6224 |
| 838 | Ga0495602_0142743 | 3300048088 | Bacteria | 1894 |
| 839 | Ga0495602_0919688 | 3300048088 | Bacteria | 581 |
| 840 | Ga0495614_0089055 | 3300048089 | Bacteria | 1342 |
| 841 | Ga0495626_0233556 | 3300048091 | Bacteria | 742 |
| 842 | Ga0496100_0051860 | 3300048903 | Bacteria | 2665 |
| 843 | Ga0496100_0147115 | 3300048903 | Bacteria | 1676 |
| 844 | Ga0496101_0014720 | 3300048904 | Bacteria | 5263 |
| 845 | Ga0496101_0134728 | 3300048904 | Bacteria | 1878 |
| 846 | Ga0496101_0201882 | 3300048904 | Bacteria | 1537 |
| 847 | Ga0496101_0490320 | 3300048904 | Bacteria | 970 |
| 848 | Ga0496102_0141525 | 3300048905 | Bacteria | 2256 |
| 849 | Ga0496103_0022195 | 3300048906 | Bacteria | 3821 |
| 850 | Ga0496103_0128291 | 3300048906 | Bacteria | 1618 |
| 851 | Ga0496103_0678130 | 3300048906 | Bacteria | 654 |
| 852 | Ga0496104_0003063 | 3300048907 | Bacteria | 14409 |
| 853 | Ga0496104_0009201 | 3300048907 | Bacteria | 8782 |
| 854 | Ga0496104_0045229 | 3300048907 | Bacteria | 4139 |
| 855 | Ga0496104_0113510 | 3300048907 | Bacteria | 2598 |
| 856 | Ga0496104_0150665 | 3300048907 | Bacteria | 2233 |
| 857 | Ga0496104_1709966 | 3300048907 | Bacteria | 531 |
| 858 | Ga0496105_0008859 | 3300048908 | Bacteria | 7839 |
| 859 | Ga0496105_0041428 | 3300048908 | Bacteria | 3796 |
| 860 | Ga0496105_0136114 | 3300048908 | Bacteria | 2024 |
| 861 | Ga0496105_0144110 | 3300048908 | Bacteria | 1960 |
| 862 | Ga0496105_0307586 | 3300048908 | Bacteria | 1273 |
| 863 | Ga0496105_0484311 | 3300048908 | Bacteria | 973 |
| 864 | Ga0496106_0028179 | 3300048909 | Bacteria | 4183 |
| 865 | Ga0496106_0041843 | 3300048909 | Bacteria | 3435 |
| 866 | Ga0496106_0192272 | 3300048909 | Bacteria | 1623 |
| 867 | Ga0496106_0536135 | 3300048909 | Bacteria | 939 |
| 868 | Ga0496107_0036722 | 3300048910 | Bacteria | 3515 |
| 869 | Ga0496107_0191751 | 3300048910 | Bacteria | 1518 |
| 870 | Ga0496107_0215504 | 3300048910 | Bacteria | 1428 |
| 871 | Ga0496108_0029096 | 3300048911 | Bacteria | 4573 |
| 872 | Ga0496108_0765552 | 3300048911 | Bacteria | 834 |
| 873 | Ga0496109_0004243 | 3300048912 | Bacteria | 11968 |
| 874 | Ga0496109_0030998 | 3300048912 | Bacteria | 4794 |
| 875 | Ga0496109_0229630 | 3300048912 | Bacteria | 1746 |
| 876 | Ga0496110_0015614 | 3300048913 | Bacteria | 6324 |
| 877 | Ga0496110_0030728 | 3300048913 | Bacteria | 4631 |
| 878 | Ga0496110_0182665 | 3300048913 | Bacteria | 1905 |
| 879 | Ga0496110_0494998 | 3300048913 | Bacteria | 1113 |
| 880 | Ga0496110_1095673 | 3300048913 | Bacteria | 704 |
| 881 | Ga0496111_0040436 | 3300048914 | Bacteria | 3344 |
| 882 | Ga0496112_0056354 | 3300048915 | Bacteria | 3867 |
| 883 | Ga0496112_0149860 | 3300048915 | Bacteria | 2300 |
| 884 | Ga0496112_0552791 | 3300048915 | Bacteria | 1085 |
| 885 | Ga0496113_0203985 | 3300048916 | Bacteria | 1572 |
| 886 | Ga0496114_0034306 | 3300048917 | Bacteria | 4185 |
| 887 | Ga0496114_0530816 | 3300048917 | Bacteria | 1040 |
| 888 | Ga0496114_0561175 | 3300048917 | Bacteria | 1008 |
| 889 | Ga0496115_0063455 | 3300048918 | Bacteria | 2981 |
| 890 | Ga0496115_0089709 | 3300048918 | Bacteria | 2511 |
| 891 | Ga0496115_0094720 | 3300048918 | Bacteria | 2443 |
| 892 | Ga0496115_0127180 | 3300048918 | Bacteria | 2099 |
| 893 | Ga0495678_180658 | 3300049459 | Bacteria | 662 |
| 894 | Ga0501033_0344295 | 3300049570 | Bacteria | 1045 |
| 895 | Ga0501047_0362572 | 3300049581 | Bacteria | 1285 |
| 896 | Ga0501069_0060766 | 3300049585 | Bacteria | 2110 |
| 897 | Ga0501077_0337569 | 3300049593 | Bacteria | 961 |
| 898 | Ga0501079_0381439 | 3300049741 | Bacteria | 1105 |
| 899 | Ga0501035_0913295 | 3300049822 | Bacteria | 695 |
| 900 | Ga0501044_0132431 | 3300049823 | Bacteria | 2487 |
| 901 | Ga0501045_0426208 | 3300049824 | Bacteria | 987 |
| 902 | nmdc:mga03683_67014_c1 | 3300050489 | Bacteria | 1527 |
| 903 | nmdc:mga03683_72119_c1 | 3300050489 | Bacteria | 1478 |
| 904 | nmdc:mga00v17_278245_c1 | 3300050491 | Bacteria | 1086 |
| 905 | nmdc:mga00v17_411970_c1 | 3300050491 | Bacteria | 878 |
| 906 | nmdc:mga0yw44_148899_c1 | 3300050492 | Bacteria | 1526 |
| 907 | nmdc:mga0yw44_324843_c1 | 3300050492 | Bacteria | 1034 |
| 908 | nmdc:mga0yw44_54592_c1 | 3300050492 | Bacteria | 2429 |
| 909 | nmdc:mga04h51_105977_c1 | 3300050495 | Bacteria | 1030 |
| 910 | nmdc:mga05p37_133007_c1 | 3300050507 | Bacteria | 3051 |
| 911 | nmdc:mga05p37_1614817_c1 | 3300050507 | Bacteria | 638 |
| 912 | nmdc:mga05p37_162177_c1 | 3300050507 | Bacteria | 2730 |
| 913 | nmdc:mga05p37_166004_c1 | 3300050507 | Bacteria | 2694 |
| 914 | nmdc:mga05p37_18097_c1 | 3300050507 | Bacteria | 8511 |
| 915 | nmdc:mga05p37_266694_c1 | 3300050507 | Bacteria | 2047 |
| 916 | nmdc:mga05p37_297280_c1 | 3300050507 | Bacteria | 831 |
| 917 | nmdc:mga05p37_304676_c1 | 3300050507 | Bacteria | 1891 |
| 918 | nmdc:mga05p37_690598_c1 | 3300050507 | Unclassified | 1136 |
| 919 | nmdc:mga09592_21311_c1 | 3300050508 | Bacteria | 5341 |
| 920 | nmdc:mga09592_483879_c1 | 3300050508 | Unclassified | 1066 |
| 921 | nmdc:mga09592_90167_c1 | 3300050508 | Bacteria | 2619 |
| 922 | nmdc:mga0qj67_181347_c1 | 3300050509 | Bacteria | 1710 |
| 923 | nmdc:mga0qj67_551623_c1 | 3300050509 | Bacteria | 924 |
| 924 | nmdc:mga06r32_427885_c1 | 3300050510 | Bacteria | 1305 |
| 925 | nmdc:mga06r32_74553_c1 | 3300050510 | Bacteria | 3290 |
| 926 | nmdc:mga08y16_1204_c1 | 3300050511 | Bacteria | 25555 |
| 927 | nmdc:mga08y16_230785_c1 | 3300050511 | Bacteria | 1914 |
| 928 | nmdc:mga08y16_293757_c1 | 3300050511 | Bacteria | 1675 |
| 929 | nmdc:mga08y16_372888_c1 | 3300050511 | Bacteria | 1464 |
| 930 | nmdc:mga08y16_802366_c1 | 3300050511 | Bacteria | 934 |
| 931 | nmdc:mga08y16_917282_c1 | 3300050511 | Bacteria | 861 |
| 932 | nmdc:mga0n895_1009795_c1 | 3300050512 | Bacteria | 813 |
| 933 | nmdc:mga0n895_140796_c1 | 3300050512 | Bacteria | 2441 |
| 934 | nmdc:mga0n895_14463_c1 | 3300050512 | Bacteria | 7168 |
| 935 | nmdc:mga0n895_180357_c1 | 3300050512 | Bacteria | 2143 |
| 936 | nmdc:mga0n895_236091_c1 | 3300050512 | Bacteria | 1856 |
| 937 | nmdc:mga0n895_500844_c1 | 3300050512 | Bacteria | 1224 |
| 938 | nmdc:mga0n895_732268_c1 | 3300050512 | Bacteria | 983 |
| 939 | nmdc:mga0n895_75340_c1 | 3300050512 | Bacteria | 3354 |
| 940 | nmdc:mga0rr50_39643_c1 | 3300050513 | Bacteria | 3418 |
| 941 | nmdc:mga0rr50_855086_c1 | 3300050513 | Bacteria | 776 |
| 942 | nmdc:mga08x19_375248_c1 | 3300050514 | Bacteria | 996 |
| 943 | nmdc:mga08x19_47150_c1 | 3300050514 | Bacteria | 2757 |
| 944 | nmdc:mga08x19_958886_c1 | 3300050514 | Unclassified | 608 |
| 945 | nmdc:mga0a205_198749_c1 | 3300050515 | Bacteria | 1896 |
| 946 | nmdc:mga0a205_235148_c1 | 3300050515 | Bacteria | 1714 |
| 947 | nmdc:mga0a205_359156_c1 | 3300050515 | Bacteria | 1323 |
| 948 | nmdc:mga0a205_463163_c1 | 3300050515 | Bacteria | 1127 |
| 949 | nmdc:mga0a205_47295_c1 | 3300050515 | Bacteria | 4150 |
| 950 | nmdc:mga0a205_78530_c1 | 3300050515 | Bacteria | 3189 |
| 951 | nmdc:mga0a205_94729_c1 | 3300050515 | Bacteria | 2885 |
| 952 | nmdc:mga0a205_959868_c1 | 3300050515 | Bacteria | 702 |
| 953 | Ga0495601_0010275 | 3300053077 | Bacteria | 5567 |
| 954 | Ga0495601_0025087 | 3300053077 | Bacteria | 3675 |
| 955 | Ga0495601_0461116 | 3300053077 | Bacteria | 821 |
| 956 | Ga0495612_0113192 | 3300053078 | Unclassified | 1163 |
| 957 | Ga0495612_0544750 | 3300053078 | Bacteria | 534 |
| 958 | Ga0495655_0047399 | 3300053083 | Bacteria | 1124 |
| 959 | Ga0495595_0479171 | 3300053084 | Bacteria | 633 |
| 960 | Ga0495619_0005559 | 3300053085 | Bacteria | 7999 |
| 961 | Ga0495619_0009832 | 3300053085 | Bacteria | 6029 |
| 962 | Ga0495619_0080455 | 3300053085 | Unclassified | 2193 |
| 963 | Ga0495619_0081089 | 3300053085 | Bacteria | 2184 |
| 964 | Ga0495619_0462316 | 3300053085 | Bacteria | 874 |
| 965 | Ga0530510_0733527 | 3300061734 | Unclassified | 753 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0669244 | Ga0495628_0669244_303_719 | 134 |
| 2 | 3300005456 | Ga0070678_101185256 | Ga0070678_1011852562 | 148 |
| 3 | 3300007788 | Ga0099795_10400193 | Ga0099795_104001931 | 148 |
| 4 | 3300014969 | Ga0157376_10014139 | Ga0157376_100141393 | 148 |
| 5 | 3300025898 | Ga0207692_10808069 | Ga0207692_108080691 | 148 |
| 6 | 3300026088 | Ga0207641_10555416 | Ga0207641_105554162 | 148 |
| 7 | 3300035695 | Ga0373927_0757209 | Ga0373927_0757209_45_515 | 148 |
| 8 | 3300035118 | Ga0373954_0308422 | Ga0373954_0308422_141_608 | 149 |
| 9 | 3300035410 | Ga0373924_0012321 | Ga0373924_0012321_1911_2378 | 149 |
| 10 | 3300035724 | Ga0373933_0236551 | Ga0373933_0236551_641_1108 | 149 |
| 11 | 3300036401 | Ga0373937_0014245 | Ga0373937_0014245_5587_6054 | 149 |
| 12 | 3300041509 | Ga0451843_0352523 | Ga0451843_0352523_74_541 | 149 |
| 13 | 3300046458 | Ga0495591_031022 | Ga0495591_031022_61_510 | 149 |
| 14 | 3300046511 | Ga0495608_0019989 | Ga0495608_0019989_2341_2808 | 149 |
| 15 | 3300046514 | Ga0495618_0074366 | Ga0495618_0074366_716_1183 | 149 |
| 16 | 3300046517 | Ga0495630_0121217 | Ga0495630_0121217_194_661 | 149 |
| 17 | 3300046559 | Ga0495667_0021607 | Ga0495667_0021607_546_1013 | 149 |
| 18 | 3300046675 | Ga0495657_0001786 | Ga0495657_0001786_16896_17363 | 149 |
| 19 | 3300046809 | Ga0495600_0431272 | Ga0495600_0431272_93_560 | 149 |
| 20 | 3300047444 | Ga0495675_0199333 | Ga0495675_0199333_108_575 | 149 |
| 21 | 3300047471 | Ga0495684_0067277 | Ga0495684_0067277_1176_1643 | 149 |
| 22 | 3300048088 | Ga0495602_0919688 | Ga0495602_0919688_18_482 | 149 |
| 23 | 3300053085 | Ga0495619_0005559 | Ga0495619_0005559_1836_2303 | 149 |
| 24 | 3300005439 | Ga0070711_100025976 | Ga0070711_1000259763 | 150 |
| 25 | 3300005614 | Ga0068856_101045116 | Ga0068856_1010451162 | 150 |
| 26 | 3300007265 | Ga0099794_10011923 | Ga0099794_100119233 | 150 |
| 27 | 3300025916 | Ga0207663_10445217 | Ga0207663_104452172 | 150 |
| 28 | 3300026078 | Ga0207702_10378897 | Ga0207702_103788972 | 150 |
| 29 | 3300036401 | Ga0373937_0688370 | Ga0373937_0688370_114_566 | 150 |
| 30 | 3300046529 | Ga0495652_1059032 | Ga0495652_1059032_24_476 | 150 |
| 31 | 3300047471 | Ga0495684_0744010 | Ga0495684_0744010_22_474 | 150 |
| 32 | 3300005289 | Ga0065704_10205451 | Ga0065704_102054512 | 151 |
| 33 | 3300005295 | Ga0065707_10246195 | Ga0065707_102461952 | 151 |
| 34 | 3300005334 | Ga0068869_101077851 | Ga0068869_1010778512 | 151 |
| 35 | 3300005335 | Ga0070666_10233322 | Ga0070666_102333222 | 151 |
| 36 | 3300005338 | Ga0068868_100061736 | Ga0068868_1000617362 | 151 |
| 37 | 3300005355 | Ga0070671_100740254 | Ga0070671_1007402542 | 151 |
| 38 | 3300005356 | Ga0070674_100902189 | Ga0070674_1009021892 | 151 |
| 39 | 3300005364 | Ga0070673_100472539 | Ga0070673_1004725392 | 151 |
| 40 | 3300005445 | Ga0070708_100056693 | Ga0070708_1000566931 | 151 |
| 41 | 3300005456 | Ga0070678_100456831 | Ga0070678_1004568312 | 151 |
| 42 | 3300005459 | Ga0068867_100386555 | Ga0068867_1003865551 | 151 |
| 43 | 3300005467 | Ga0070706_100021716 | Ga0070706_1000217166 | 151 |
| 44 | 3300005468 | Ga0070707_100016485 | Ga0070707_1000164852 | 151 |
| 45 | 3300005518 | Ga0070699_100222791 | Ga0070699_1002227911 | 151 |
| 46 | 3300005544 | Ga0070686_100243733 | Ga0070686_1002437332 | 151 |
| 47 | 3300005548 | Ga0070665_100253268 | Ga0070665_1002532682 | 151 |
| 48 | 3300005843 | Ga0068860_100546898 | Ga0068860_1005468982 | 151 |
| 49 | 3300006237 | Ga0097621_100003859 | Ga0097621_1000038592 | 151 |
| 50 | 3300006237 | Ga0097621_100408523 | Ga0097621_1004085232 | 151 |
| 51 | 3300006358 | Ga0068871_100043381 | Ga0068871_1000433813 | 151 |
| 52 | 3300006358 | Ga0068871_100065352 | Ga0068871_1000653521 | 151 |
| 53 | 3300006871 | Ga0075434_100915775 | Ga0075434_1009157752 | 151 |
| 54 | 3300006881 | Ga0068865_100010201 | Ga0068865_1000102015 | 151 |
| 55 | 3300009098 | Ga0105245_10053235 | Ga0105245_100532353 | 151 |
| 56 | 3300009098 | Ga0105245_12472774 | Ga0105245_124727741 | 151 |
| 57 | 3300009147 | Ga0114129_10528208 | Ga0114129_105282082 | 151 |
| 58 | 3300009148 | Ga0105243_10509341 | Ga0105243_105093412 | 151 |
| 59 | 3300009176 | Ga0105242_10104861 | Ga0105242_101048613 | 151 |
| 60 | 3300009176 | Ga0105242_11934323 | Ga0105242_119343232 | 151 |
| 61 | 3300009177 | Ga0105248_10025818 | Ga0105248_100258183 | 151 |
| 62 | 3300009177 | Ga0105248_10036500 | Ga0105248_100365006 | 151 |
| 63 | 3300009551 | Ga0105238_10244453 | Ga0105238_102444532 | 151 |
| 64 | 3300013297 | Ga0157378_11073682 | Ga0157378_110736821 | 151 |
| 65 | 3300013306 | Ga0163162_10323767 | Ga0163162_103237672 | 151 |
| 66 | 3300013308 | Ga0157375_10335476 | Ga0157375_103354762 | 151 |
| 67 | 3300014969 | Ga0157376_10035926 | Ga0157376_100359264 | 151 |
| 68 | 3300014969 | Ga0157376_11378782 | Ga0157376_113787822 | 151 |
| 69 | 3300025910 | Ga0207684_10094665 | Ga0207684_100946651 | 151 |
| 70 | 3300025922 | Ga0207646_10026114 | Ga0207646_100261142 | 151 |
| 71 | 3300025931 | Ga0207644_10321233 | Ga0207644_103212332 | 151 |
| 72 | 3300025934 | Ga0207686_11458307 | Ga0207686_114583071 | 151 |
| 73 | 3300025937 | Ga0207669_10674776 | Ga0207669_106747762 | 151 |
| 74 | 3300025941 | Ga0207711_11049257 | Ga0207711_110492571 | 151 |
| 75 | 3300025941 | Ga0207711_11087951 | Ga0207711_110879512 | 151 |
| 76 | 3300025960 | Ga0207651_10265733 | Ga0207651_102657332 | 151 |
| 77 | 3300026035 | Ga0207703_10756484 | Ga0207703_107564841 | 151 |
| 78 | 3300026067 | Ga0207678_11566432 | Ga0207678_115664321 | 151 |
| 79 | 3300026121 | Ga0207683_10409672 | Ga0207683_104096722 | 151 |
| 80 | 3300035118 | Ga0373954_0572893 | Ga0373954_0572893_21_479 | 151 |
| 81 | 3300035119 | Ga0373956_0072790 | Ga0373956_0072790_51_509 | 151 |
| 82 | 3300035172 | Ga0373955_0141987 | Ga0373955_0141987_745_1203 | 151 |
| 83 | 3300035692 | Ga0373935_0515391 | Ga0373935_0515391_370_828 | 151 |
| 84 | 3300035724 | Ga0373933_0299634 | Ga0373933_0299634_199_657 | 151 |
| 85 | 3300036401 | Ga0373937_1710923 | Ga0373937_1710923_66_524 | 151 |
| 86 | 3300039447 | Ga0436361_0481279 | Ga0436361_0481279_339_794 | 151 |
| 87 | 3300046459 | Ga0495629_0206406 | Ga0495629_0206406_518_976 | 151 |
| 88 | 3300046461 | Ga0495641_0157720 | Ga0495641_0157720_104_562 | 151 |
| 89 | 3300046476 | Ga0495662_0333473 | Ga0495662_0333473_21_479 | 151 |
| 90 | 3300046543 | Ga0495645_0637842 | Ga0495645_0637842_64_519 | 151 |
| 91 | 3300046642 | Ga0495634_0482094 | Ga0495634_0482094_123_581 | 151 |
| 92 | 3300048903 | Ga0496100_0051860 | Ga0496100_0051860_552_1010 | 151 |
| 93 | 3300048904 | Ga0496101_0014720 | Ga0496101_0014720_2905_3363 | 151 |
| 94 | 3300048905 | Ga0496102_0141525 | Ga0496102_0141525_67_525 | 151 |
| 95 | 3300048907 | Ga0496104_1709966 | Ga0496104_1709966_37_495 | 151 |
| 96 | 3300048908 | Ga0496105_0307586 | Ga0496105_0307586_539_997 | 151 |
| 97 | 3300048908 | Ga0496105_0484311 | Ga0496105_0484311_246_704 | 151 |
| 98 | 3300048910 | Ga0496107_0036722 | Ga0496107_0036722_3032_3490 | 151 |
| 99 | 3300048918 | Ga0496115_0089709 | Ga0496115_0089709_1256_1714 | 151 |
| 100 | 3300049824 | Ga0501045_0426208 | Ga0501045_0426208_443_913 | 151 |
| 101 | 3300050512 | nmdc:mga0n895_180357_c1 | nmdc:mga0n895_180357_c1_593_1048 | 151 |
| 102 | 3300050514 | nmdc:mga08x19_47150_c1 | nmdc:mga08x19_47150_c1_1626_2081 | 151 |
| 103 | 3300053085 | Ga0495619_0462316 | Ga0495619_0462316_79_537 | 151 |
| 104 | 3300005331 | Ga0070670_100048236 | Ga0070670_1000482364 | 152 |
| 105 | 3300005438 | Ga0070701_10381855 | Ga0070701_103818551 | 152 |
| 106 | 3300005458 | Ga0070681_10768574 | Ga0070681_107685742 | 152 |
| 107 | 3300005518 | Ga0070699_100975958 | Ga0070699_1009759582 | 152 |
| 108 | 3300005549 | Ga0070704_100033380 | Ga0070704_1000333804 | 152 |
| 109 | 3300009147 | Ga0114129_10196805 | Ga0114129_101968051 | 152 |
| 110 | 3300009147 | Ga0114129_10731549 | Ga0114129_107315492 | 152 |
| 111 | 3300035114 | Ga0373939_0187369 | Ga0373939_0187369_190_657 | 152 |
| 112 | 3300048904 | Ga0496101_0201882 | Ga0496101_0201882_319_786 | 152 |
| 113 | 3300048907 | Ga0496104_0003063 | Ga0496104_0003063_13837_14304 | 152 |
| 114 | 3300048907 | Ga0496104_0009201 | Ga0496104_0009201_2096_2563 | 152 |
| 115 | 3300048908 | Ga0496105_0041428 | Ga0496105_0041428_1511_1978 | 152 |
| 116 | 3300048909 | Ga0496106_0192272 | Ga0496106_0192272_1142_1609 | 152 |
| 117 | 3300048910 | Ga0496107_0215504 | Ga0496107_0215504_789_1256 | 152 |
| 118 | 3300048911 | Ga0496108_0029096 | Ga0496108_0029096_2015_2482 | 152 |
| 119 | 3300048912 | Ga0496109_0229630 | Ga0496109_0229630_1260_1727 | 152 |
| 120 | 3300048913 | Ga0496110_0494998 | Ga0496110_0494998_388_855 | 152 |
| 121 | 3300048915 | Ga0496112_0552791 | Ga0496112_0552791_120_587 | 152 |
| 122 | 3300048918 | Ga0496115_0094720 | Ga0496115_0094720_36_503 | 152 |
| 123 | 3300050507 | nmdc:mga05p37_304676_c1 | nmdc:mga05p37_304676_c1_1405_1881 | 152 |
| 124 | 3300005347 | Ga0070668_100460564 | Ga0070668_1004605641 | 153 |
| 125 | 3300005354 | Ga0070675_100104818 | Ga0070675_1001048183 | 153 |
| 126 | 3300005436 | Ga0070713_100068018 | Ga0070713_1000680181 | 153 |
| 127 | 3300005457 | Ga0070662_100347711 | Ga0070662_1003477112 | 153 |
| 128 | 3300005458 | Ga0070681_11055347 | Ga0070681_110553471 | 153 |
| 129 | 3300005840 | Ga0068870_10143071 | Ga0068870_101430712 | 153 |
| 130 | 3300005937 | Ga0081455_10065788 | Ga0081455_100657882 | 153 |
| 131 | 3300005983 | Ga0081540_1153816 | Ga0081540_11538162 | 153 |
| 132 | 3300006028 | Ga0070717_10009977 | Ga0070717_100099776 | 153 |
| 133 | 3300006042 | Ga0075368_10288463 | Ga0075368_102884632 | 153 |
| 134 | 3300006237 | Ga0097621_100056795 | Ga0097621_1000567952 | 153 |
| 135 | 3300006871 | Ga0075434_100654203 | Ga0075434_1006542032 | 153 |
| 136 | 3300007076 | Ga0075435_100251502 | Ga0075435_1002515022 | 153 |
| 137 | 3300007076 | Ga0075435_100809078 | Ga0075435_1008090781 | 153 |
| 138 | 3300009147 | Ga0114129_10271801 | Ga0114129_102718012 | 153 |
| 139 | 3300009148 | Ga0105243_11020737 | Ga0105243_110207372 | 153 |
| 140 | 3300009177 | Ga0105248_10536500 | Ga0105248_105365002 | 153 |
| 141 | 3300014969 | Ga0157376_10360050 | Ga0157376_103600502 | 153 |
| 142 | 3300022467 | Ga0224712_10003138 | Ga0224712_100031382 | 153 |
| 143 | 3300025315 | Ga0207697_10189254 | Ga0207697_101892542 | 153 |
| 144 | 3300025893 | Ga0207682_10017781 | Ga0207682_100177812 | 153 |
| 145 | 3300025912 | Ga0207707_10779401 | Ga0207707_107794011 | 153 |
| 146 | 3300025925 | Ga0207650_10669881 | Ga0207650_106698812 | 153 |
| 147 | 3300025937 | Ga0207669_10105154 | Ga0207669_101051542 | 153 |
| 148 | 3300025972 | Ga0207668_10436201 | Ga0207668_104362011 | 153 |
| 149 | 3300025981 | Ga0207640_10931352 | Ga0207640_109313522 | 153 |
| 150 | 3300026121 | Ga0207683_10064073 | Ga0207683_100640732 | 153 |
| 151 | 3300026121 | Ga0207683_11396317 | Ga0207683_113963171 | 153 |
| 152 | 3300027617 | Ga0210002_1029676 | Ga0210002_10296762 | 153 |
| 153 | 3300027671 | Ga0209588_1028656 | Ga0209588_10286562 | 153 |
| 154 | 3300035114 | Ga0373939_0032575 | Ga0373939_0032575_421_885 | 153 |
| 155 | 3300035170 | Ga0373943_0175446 | Ga0373943_0175446_302_769 | 153 |
| 156 | 3300035695 | Ga0373927_0013854 | Ga0373927_0013854_177_641 | 153 |
| 157 | 3300035725 | Ga0373947_0650992 | Ga0373947_0650992_82_546 | 153 |
| 158 | 3300036401 | Ga0373937_1855746 | Ga0373937_1855746_40_507 | 153 |
| 159 | 3300037068 | Ga0373925_0026267 | Ga0373925_0026267_994_1458 | 153 |
| 160 | 3300037068 | Ga0373925_0307013 | Ga0373925_0307013_142_609 | 153 |
| 161 | 3300046472 | Ga0495580_0436195 | Ga0495580_0436195_238_705 | 153 |
| 162 | 3300046531 | Ga0495665_0160666 | Ga0495665_0160666_341_805 | 153 |
| 163 | 3300046531 | Ga0495665_0319687 | Ga0495665_0319687_81_566 | 153 |
| 164 | 3300046557 | Ga0495622_0263691 | Ga0495622_0263691_109_573 | 153 |
| 165 | 3300046683 | Ga0495658_0133088 | Ga0495658_0133088_990_1454 | 153 |
| 166 | 3300046683 | Ga0495658_0190355 | Ga0495658_0190355_591_1058 | 153 |
| 167 | 3300046689 | Ga0495613_0052429 | Ga0495613_0052429_948_1412 | 153 |
| 168 | 3300047315 | Ga0495581_0032318 | Ga0495581_0032318_819_1283 | 153 |
| 169 | 3300048906 | Ga0496103_0678130 | Ga0496103_0678130_100_564 | 153 |
| 170 | 3300048907 | Ga0496104_0150665 | Ga0496104_0150665_1709_2173 | 153 |
| 171 | 3300048908 | Ga0496105_0136114 | Ga0496105_0136114_820_1284 | 153 |
| 172 | 3300048909 | Ga0496106_0041843 | Ga0496106_0041843_1657_2121 | 153 |
| 173 | 3300050512 | nmdc:mga0n895_732268_c1 | nmdc:mga0n895_732268_c1_213_674 | 153 |
| 174 | 3300001991 | JGI24743J22301_10011361 | JGI24743J22301_100113612 | 154 |
| 175 | 3300002070 | JGI24750J21931_1003575 | JGI24750J21931_10035752 | 154 |
| 176 | 3300002074 | JGI24748J21848_1007802 | JGI24748J21848_10078022 | 154 |
| 177 | 3300002075 | JGI24738J21930_10007172 | JGI24738J21930_100071721 | 154 |
| 178 | 3300002076 | JGI24749J21850_1013147 | JGI24749J21850_10131471 | 154 |
| 179 | 3300002077 | JGI24744J21845_10002967 | JGI24744J21845_100029672 | 154 |
| 180 | 3300002239 | JGI24034J26672_10004889 | JGI24034J26672_100048893 | 154 |
| 181 | 3300005289 | Ga0065704_10098888 | Ga0065704_100988882 | 154 |
| 182 | 3300005293 | Ga0065715_10005647 | Ga0065715_100056472 | 154 |
| 183 | 3300005293 | Ga0065715_10727806 | Ga0065715_107278062 | 154 |
| 184 | 3300005293 | Ga0065715_10727857 | Ga0065715_107278571 | 154 |
| 185 | 3300005295 | Ga0065707_10002482 | Ga0065707_100024823 | 154 |
| 186 | 3300005295 | Ga0065707_10482911 | Ga0065707_104829111 | 154 |
| 187 | 3300005328 | Ga0070676_10359797 | Ga0070676_103597971 | 154 |
| 188 | 3300005329 | Ga0070683_100003648 | Ga0070683_1000036485 | 154 |
| 189 | 3300005329 | Ga0070683_100094505 | Ga0070683_1000945052 | 154 |
| 190 | 3300005329 | Ga0070683_101256863 | Ga0070683_1012568632 | 154 |
| 191 | 3300005331 | Ga0070670_100007003 | Ga0070670_1000070037 | 154 |
| 192 | 3300005331 | Ga0070670_100023624 | Ga0070670_1000236243 | 154 |
| 193 | 3300005331 | Ga0070670_100055058 | Ga0070670_1000550584 | 154 |
| 194 | 3300005334 | Ga0068869_100037520 | Ga0068869_1000375202 | 154 |
| 195 | 3300005334 | Ga0068869_100186003 | Ga0068869_1001860032 | 154 |
| 196 | 3300005334 | Ga0068869_100601594 | Ga0068869_1006015942 | 154 |
| 197 | 3300005334 | Ga0068869_100880064 | Ga0068869_1008800641 | 154 |
| 198 | 3300005335 | Ga0070666_10005780 | Ga0070666_100057803 | 154 |
| 199 | 3300005335 | Ga0070666_10181488 | Ga0070666_101814882 | 154 |
| 200 | 3300005337 | Ga0070682_100080773 | Ga0070682_1000807734 | 154 |
| 201 | 3300005337 | Ga0070682_100110649 | Ga0070682_1001106492 | 154 |
| 202 | 3300005338 | Ga0068868_100089007 | Ga0068868_1000890072 | 154 |
| 203 | 3300005338 | Ga0068868_101077290 | Ga0068868_1010772902 | 154 |
| 204 | 3300005339 | Ga0070660_100084758 | Ga0070660_1000847582 | 154 |
| 205 | 3300005340 | Ga0070689_100006108 | Ga0070689_10000610810 | 154 |
| 206 | 3300005340 | Ga0070689_100052234 | Ga0070689_1000522341 | 154 |
| 207 | 3300005341 | Ga0070691_10063770 | Ga0070691_100637702 | 154 |
| 208 | 3300005341 | Ga0070691_10504666 | Ga0070691_105046661 | 154 |
| 209 | 3300005343 | Ga0070687_100020271 | Ga0070687_1000202712 | 154 |
| 210 | 3300005343 | Ga0070687_100049790 | Ga0070687_1000497902 | 154 |
| 211 | 3300005343 | Ga0070687_100406041 | Ga0070687_1004060412 | 154 |
| 212 | 3300005344 | Ga0070661_100005776 | Ga0070661_1000057766 | 154 |
| 213 | 3300005345 | Ga0070692_10002304 | Ga0070692_100023046 | 154 |
| 214 | 3300005345 | Ga0070692_10019608 | Ga0070692_100196082 | 154 |
| 215 | 3300005345 | Ga0070692_10035915 | Ga0070692_100359152 | 154 |
| 216 | 3300005345 | Ga0070692_10721997 | Ga0070692_107219971 | 154 |
| 217 | 3300005353 | Ga0070669_100000833 | Ga0070669_1000008339 | 154 |
| 218 | 3300005353 | Ga0070669_100070078 | Ga0070669_1000700782 | 154 |
| 219 | 3300005354 | Ga0070675_100000609 | Ga0070675_1000006097 | 154 |
| 220 | 3300005354 | Ga0070675_100005913 | Ga0070675_1000059138 | 154 |
| 221 | 3300005354 | Ga0070675_100144567 | Ga0070675_1001445672 | 154 |
| 222 | 3300005354 | Ga0070675_100527070 | Ga0070675_1005270701 | 154 |
| 223 | 3300005355 | Ga0070671_100037506 | Ga0070671_1000375061 | 154 |
| 224 | 3300005355 | Ga0070671_100074626 | Ga0070671_1000746261 | 154 |
| 225 | 3300005356 | Ga0070674_100295969 | Ga0070674_1002959693 | 154 |
| 226 | 3300005364 | Ga0070673_100011573 | Ga0070673_1000115733 | 154 |
| 227 | 3300005364 | Ga0070673_100044170 | Ga0070673_1000441702 | 154 |
| 228 | 3300005364 | Ga0070673_100857731 | Ga0070673_1008577312 | 154 |
| 229 | 3300005365 | Ga0070688_100049487 | Ga0070688_1000494872 | 154 |
| 230 | 3300005366 | Ga0070659_100170484 | Ga0070659_1001704843 | 154 |
| 231 | 3300005367 | Ga0070667_100024923 | Ga0070667_1000249234 | 154 |
| 232 | 3300005367 | Ga0070667_100353373 | Ga0070667_1003533732 | 154 |
| 233 | 3300005406 | Ga0070703_10030035 | Ga0070703_100300352 | 154 |
| 234 | 3300005435 | Ga0070714_100221791 | Ga0070714_1002217911 | 154 |
| 235 | 3300005435 | Ga0070714_100630850 | Ga0070714_1006308502 | 154 |
| 236 | 3300005436 | Ga0070713_100146057 | Ga0070713_1001460572 | 154 |
| 237 | 3300005436 | Ga0070713_100393836 | Ga0070713_1003938362 | 154 |
| 238 | 3300005436 | Ga0070713_100557764 | Ga0070713_1005577641 | 154 |
| 239 | 3300005438 | Ga0070701_10004621 | Ga0070701_100046213 | 154 |
| 240 | 3300005438 | Ga0070701_10005760 | Ga0070701_100057602 | 154 |
| 241 | 3300005438 | Ga0070701_10028041 | Ga0070701_100280413 | 154 |
| 242 | 3300005438 | Ga0070701_10191699 | Ga0070701_101916992 | 154 |
| 243 | 3300005440 | Ga0070705_100017489 | Ga0070705_1000174893 | 154 |
| 244 | 3300005440 | Ga0070705_100068449 | Ga0070705_1000684492 | 154 |
| 245 | 3300005440 | Ga0070705_100096918 | Ga0070705_1000969183 | 154 |
| 246 | 3300005441 | Ga0070700_100034579 | Ga0070700_1000345792 | 154 |
| 247 | 3300005441 | Ga0070700_100265026 | Ga0070700_1002650262 | 154 |
| 248 | 3300005441 | Ga0070700_100438885 | Ga0070700_1004388851 | 154 |
| 249 | 3300005444 | Ga0070694_100010451 | Ga0070694_1000104513 | 154 |
| 250 | 3300005444 | Ga0070694_100018066 | Ga0070694_1000180662 | 154 |
| 251 | 3300005444 | Ga0070694_100030344 | Ga0070694_1000303443 | 154 |
| 252 | 3300005444 | Ga0070694_100130780 | Ga0070694_1001307802 | 154 |
| 253 | 3300005444 | Ga0070694_100133034 | Ga0070694_1001330342 | 154 |
| 254 | 3300005444 | Ga0070694_100175000 | Ga0070694_1001750003 | 154 |
| 255 | 3300005445 | Ga0070708_100081314 | Ga0070708_1000813142 | 154 |
| 256 | 3300005445 | Ga0070708_100329970 | Ga0070708_1003299701 | 154 |
| 257 | 3300005445 | Ga0070708_100537228 | Ga0070708_1005372282 | 154 |
| 258 | 3300005455 | Ga0070663_100886730 | Ga0070663_1008867302 | 154 |
| 259 | 3300005456 | Ga0070678_100403137 | Ga0070678_1004031372 | 154 |
| 260 | 3300005456 | Ga0070678_100663397 | Ga0070678_1006633971 | 154 |
| 261 | 3300005457 | Ga0070662_100107626 | Ga0070662_1001076262 | 154 |
| 262 | 3300005458 | Ga0070681_10009310 | Ga0070681_100093103 | 154 |
| 263 | 3300005458 | Ga0070681_10024462 | Ga0070681_100244627 | 154 |
| 264 | 3300005458 | Ga0070681_10710553 | Ga0070681_107105531 | 154 |
| 265 | 3300005459 | Ga0068867_100000156 | Ga0068867_10000015644 | 154 |
| 266 | 3300005459 | Ga0068867_100123668 | Ga0068867_1001236682 | 154 |
| 267 | 3300005459 | Ga0068867_100186611 | Ga0068867_1001866113 | 154 |
| 268 | 3300005466 | Ga0070685_10121017 | Ga0070685_101210173 | 154 |
| 269 | 3300005467 | Ga0070706_100000006 | Ga0070706_10000000672 | 154 |
| 270 | 3300005467 | Ga0070706_100168199 | Ga0070706_1001681993 | 154 |
| 271 | 3300005467 | Ga0070706_100315408 | Ga0070706_1003154082 | 154 |
| 272 | 3300005467 | Ga0070706_100539001 | Ga0070706_1005390012 | 154 |
| 273 | 3300005467 | Ga0070706_100592467 | Ga0070706_1005924671 | 154 |
| 274 | 3300005467 | Ga0070706_100709004 | Ga0070706_1007090042 | 154 |
| 275 | 3300005468 | Ga0070707_100006432 | Ga0070707_1000064322 | 154 |
| 276 | 3300005468 | Ga0070707_100163529 | Ga0070707_1001635292 | 154 |
| 277 | 3300005471 | Ga0070698_100005560 | Ga0070698_10000556011 | 154 |
| 278 | 3300005471 | Ga0070698_100008137 | Ga0070698_10000813710 | 154 |
| 279 | 3300005471 | Ga0070698_100070715 | Ga0070698_1000707152 | 154 |
| 280 | 3300005471 | Ga0070698_100353804 | Ga0070698_1003538041 | 154 |
| 281 | 3300005471 | Ga0070698_100653527 | Ga0070698_1006535272 | 154 |
| 282 | 3300005518 | Ga0070699_100007784 | Ga0070699_1000077849 | 154 |
| 283 | 3300005518 | Ga0070699_100019523 | Ga0070699_1000195235 | 154 |
| 284 | 3300005518 | Ga0070699_100037999 | Ga0070699_1000379993 | 154 |
| 285 | 3300005518 | Ga0070699_100131116 | Ga0070699_1001311162 | 154 |
| 286 | 3300005518 | Ga0070699_100160990 | Ga0070699_1001609902 | 154 |
| 287 | 3300005518 | Ga0070699_100255182 | Ga0070699_1002551822 | 154 |
| 288 | 3300005535 | Ga0070684_100000593 | Ga0070684_1000005933 | 154 |
| 289 | 3300005535 | Ga0070684_100205027 | Ga0070684_1002050272 | 154 |
| 290 | 3300005535 | Ga0070684_100280532 | Ga0070684_1002805322 | 154 |
| 291 | 3300005536 | Ga0070697_100005622 | Ga0070697_1000056229 | 154 |
| 292 | 3300005536 | Ga0070697_100046992 | Ga0070697_1000469926 | 154 |
| 293 | 3300005536 | Ga0070697_100076269 | Ga0070697_1000762692 | 154 |
| 294 | 3300005536 | Ga0070697_100088380 | Ga0070697_1000883802 | 154 |
| 295 | 3300005536 | Ga0070697_100959519 | Ga0070697_1009595191 | 154 |
| 296 | 3300005539 | Ga0068853_100065714 | Ga0068853_1000657142 | 154 |
| 297 | 3300005543 | Ga0070672_100043045 | Ga0070672_1000430452 | 154 |
| 298 | 3300005543 | Ga0070672_100077846 | Ga0070672_1000778462 | 154 |
| 299 | 3300005543 | Ga0070672_100140013 | Ga0070672_1001400131 | 154 |
| 300 | 3300005544 | Ga0070686_100525837 | Ga0070686_1005258372 | 154 |
| 301 | 3300005544 | Ga0070686_100669873 | Ga0070686_1006698731 | 154 |
| 302 | 3300005545 | Ga0070695_100000076 | Ga0070695_1000000764 | 154 |
| 303 | 3300005545 | Ga0070695_100092972 | Ga0070695_1000929722 | 154 |
| 304 | 3300005545 | Ga0070695_100187772 | Ga0070695_1001877722 | 154 |
| 305 | 3300005545 | Ga0070695_100268582 | Ga0070695_1002685822 | 154 |
| 306 | 3300005545 | Ga0070695_101013655 | Ga0070695_1010136551 | 154 |
| 307 | 3300005545 | Ga0070695_101072201 | Ga0070695_1010722011 | 154 |
| 308 | 3300005546 | Ga0070696_100011537 | Ga0070696_1000115373 | 154 |
| 309 | 3300005546 | Ga0070696_100088596 | Ga0070696_1000885962 | 154 |
| 310 | 3300005546 | Ga0070696_101139862 | Ga0070696_1011398621 | 154 |
| 311 | 3300005546 | Ga0070696_101255631 | Ga0070696_1012556311 | 154 |
| 312 | 3300005547 | Ga0070693_100025364 | Ga0070693_1000253642 | 154 |
| 313 | 3300005548 | Ga0070665_100975798 | Ga0070665_1009757981 | 154 |
| 314 | 3300005549 | Ga0070704_100000290 | Ga0070704_10000029016 | 154 |
| 315 | 3300005549 | Ga0070704_100103430 | Ga0070704_1001034303 | 154 |
| 316 | 3300005549 | Ga0070704_100133408 | Ga0070704_1001334082 | 154 |
| 317 | 3300005549 | Ga0070704_100140732 | Ga0070704_1001407323 | 154 |
| 318 | 3300005549 | Ga0070704_100617605 | Ga0070704_1006176052 | 154 |
| 319 | 3300005549 | Ga0070704_100697619 | Ga0070704_1006976192 | 154 |
| 320 | 3300005563 | Ga0068855_100001557 | Ga0068855_10000155714 | 154 |
| 321 | 3300005563 | Ga0068855_101227947 | Ga0068855_1012279471 | 154 |
| 322 | 3300005564 | Ga0070664_100001006 | Ga0070664_1000010063 | 154 |
| 323 | 3300005564 | Ga0070664_100057063 | Ga0070664_1000570632 | 154 |
| 324 | 3300005564 | Ga0070664_100238657 | Ga0070664_1002386572 | 154 |
| 325 | 3300005564 | Ga0070664_100346893 | Ga0070664_1003468932 | 154 |
| 326 | 3300005577 | Ga0068857_100004183 | Ga0068857_10000418310 | 154 |
| 327 | 3300005577 | Ga0068857_100020929 | Ga0068857_1000209296 | 154 |
| 328 | 3300005614 | Ga0068856_100201340 | Ga0068856_1002013403 | 154 |
| 329 | 3300005614 | Ga0068856_100236957 | Ga0068856_1002369572 | 154 |
| 330 | 3300005614 | Ga0068856_100583600 | Ga0068856_1005836002 | 154 |
| 331 | 3300005614 | Ga0068856_100842867 | Ga0068856_1008428671 | 154 |
| 332 | 3300005615 | Ga0070702_100007457 | Ga0070702_1000074573 | 154 |
| 333 | 3300005616 | Ga0068852_100044420 | Ga0068852_1000444203 | 154 |
| 334 | 3300005616 | Ga0068852_100407829 | Ga0068852_1004078292 | 154 |
| 335 | 3300005616 | Ga0068852_100498714 | Ga0068852_1004987141 | 154 |
| 336 | 3300005617 | Ga0068859_100002969 | Ga0068859_10000296913 | 154 |
| 337 | 3300005617 | Ga0068859_100054432 | Ga0068859_1000544323 | 154 |
| 338 | 3300005617 | Ga0068859_100055535 | Ga0068859_1000555352 | 154 |
| 339 | 3300005617 | Ga0068859_100888731 | Ga0068859_1008887312 | 154 |
| 340 | 3300005618 | Ga0068864_100029088 | Ga0068864_1000290882 | 154 |
| 341 | 3300005618 | Ga0068864_100066440 | Ga0068864_1000664402 | 154 |
| 342 | 3300005618 | Ga0068864_100113720 | Ga0068864_1001137202 | 154 |
| 343 | 3300005618 | Ga0068864_100406486 | Ga0068864_1004064861 | 154 |
| 344 | 3300005618 | Ga0068864_100457602 | Ga0068864_1004576022 | 154 |
| 345 | 3300005618 | Ga0068864_101029357 | Ga0068864_1010293572 | 154 |
| 346 | 3300005718 | Ga0068866_10019531 | Ga0068866_100195312 | 154 |
| 347 | 3300005719 | Ga0068861_100002891 | Ga0068861_1000028912 | 154 |
| 348 | 3300005719 | Ga0068861_100099175 | Ga0068861_1000991752 | 154 |
| 349 | 3300005834 | Ga0068851_10189188 | Ga0068851_101891881 | 154 |
| 350 | 3300005840 | Ga0068870_10023082 | Ga0068870_100230822 | 154 |
| 351 | 3300005840 | Ga0068870_10091009 | Ga0068870_100910092 | 154 |
| 352 | 3300005840 | Ga0068870_10507874 | Ga0068870_105078742 | 154 |
| 353 | 3300005841 | Ga0068863_100063192 | Ga0068863_1000631922 | 154 |
| 354 | 3300005841 | Ga0068863_100120259 | Ga0068863_1001202592 | 154 |
| 355 | 3300005842 | Ga0068858_100017104 | Ga0068858_1000171042 | 154 |
| 356 | 3300005842 | Ga0068858_100027876 | Ga0068858_1000278763 | 154 |
| 357 | 3300005842 | Ga0068858_100423333 | Ga0068858_1004233332 | 154 |
| 358 | 3300005843 | Ga0068860_100013106 | Ga0068860_1000131069 | 154 |
| 359 | 3300005843 | Ga0068860_100018719 | Ga0068860_1000187195 | 154 |
| 360 | 3300005843 | Ga0068860_100121854 | Ga0068860_1001218542 | 154 |
| 361 | 3300005843 | Ga0068860_100132207 | Ga0068860_1001322072 | 154 |
| 362 | 3300005844 | Ga0068862_100001535 | Ga0068862_10000153516 | 154 |
| 363 | 3300005844 | Ga0068862_100038147 | Ga0068862_1000381472 | 154 |
| 364 | 3300005844 | Ga0068862_100092126 | Ga0068862_1000921263 | 154 |
| 365 | 3300005844 | Ga0068862_100187686 | Ga0068862_1001876862 | 154 |
| 366 | 3300005937 | Ga0081455_10000226 | Ga0081455_1000022665 | 154 |
| 367 | 3300005937 | Ga0081455_10057182 | Ga0081455_100571823 | 154 |
| 368 | 3300005983 | Ga0081540_1028604 | Ga0081540_10286041 | 154 |
| 369 | 3300006038 | Ga0075365_10076119 | Ga0075365_100761192 | 154 |
| 370 | 3300006038 | Ga0075365_10378392 | Ga0075365_103783921 | 154 |
| 371 | 3300006058 | Ga0075432_10034783 | Ga0075432_100347833 | 154 |
| 372 | 3300006173 | Ga0070716_100440109 | Ga0070716_1004401091 | 154 |
| 373 | 3300006175 | Ga0070712_101430321 | Ga0070712_1014303211 | 154 |
| 374 | 3300006177 | Ga0075362_10095754 | Ga0075362_100957542 | 154 |
| 375 | 3300006177 | Ga0075362_10377078 | Ga0075362_103770781 | 154 |
| 376 | 3300006178 | Ga0075367_10149424 | Ga0075367_101494241 | 154 |
| 377 | 3300006237 | Ga0097621_100015822 | Ga0097621_1000158223 | 154 |
| 378 | 3300006237 | Ga0097621_100213726 | Ga0097621_1002137262 | 154 |
| 379 | 3300006237 | Ga0097621_100429022 | Ga0097621_1004290222 | 154 |
| 380 | 3300006237 | Ga0097621_100572561 | Ga0097621_1005725612 | 154 |
| 381 | 3300006353 | Ga0075370_10174715 | Ga0075370_101747153 | 154 |
| 382 | 3300006358 | Ga0068871_100048016 | Ga0068871_1000480161 | 154 |
| 383 | 3300006358 | Ga0068871_100229011 | Ga0068871_1002290112 | 154 |
| 384 | 3300006358 | Ga0068871_100379425 | Ga0068871_1003794252 | 154 |
| 385 | 3300006358 | Ga0068871_101005510 | Ga0068871_1010055102 | 154 |
| 386 | 3300006844 | Ga0075428_100016948 | Ga0075428_1000169483 | 154 |
| 387 | 3300006844 | Ga0075428_100102590 | Ga0075428_1001025902 | 154 |
| 388 | 3300006844 | Ga0075428_100672416 | Ga0075428_1006724162 | 154 |
| 389 | 3300006846 | Ga0075430_100733325 | Ga0075430_1007333251 | 154 |
| 390 | 3300006847 | Ga0075431_100107857 | Ga0075431_1001078572 | 154 |
| 391 | 3300006847 | Ga0075431_100830049 | Ga0075431_1008300492 | 154 |
| 392 | 3300006852 | Ga0075433_10072556 | Ga0075433_100725562 | 154 |
| 393 | 3300006852 | Ga0075433_10359297 | Ga0075433_103592972 | 154 |
| 394 | 3300006852 | Ga0075433_10362326 | Ga0075433_103623262 | 154 |
| 395 | 3300006852 | Ga0075433_10593956 | Ga0075433_105939562 | 154 |
| 396 | 3300006871 | Ga0075434_100003572 | Ga0075434_1000035728 | 154 |
| 397 | 3300006871 | Ga0075434_100037514 | Ga0075434_1000375144 | 154 |
| 398 | 3300006871 | Ga0075434_100096263 | Ga0075434_1000962632 | 154 |
| 399 | 3300006871 | Ga0075434_100338448 | Ga0075434_1003384482 | 154 |
| 400 | 3300006871 | Ga0075434_101129184 | Ga0075434_1011291842 | 154 |
| 401 | 3300006871 | Ga0075434_101289100 | Ga0075434_1012891001 | 154 |
| 402 | 3300006880 | Ga0075429_100043230 | Ga0075429_1000432302 | 154 |
| 403 | 3300006880 | Ga0075429_100078330 | Ga0075429_1000783302 | 154 |
| 404 | 3300006881 | Ga0068865_100021178 | Ga0068865_1000211783 | 154 |
| 405 | 3300006881 | Ga0068865_100068213 | Ga0068865_1000682132 | 154 |
| 406 | 3300006881 | Ga0068865_101329647 | Ga0068865_1013296472 | 154 |
| 407 | 3300006914 | Ga0075436_100667354 | Ga0075436_1006673542 | 154 |
| 408 | 3300006914 | Ga0075436_100749045 | Ga0075436_1007490452 | 154 |
| 409 | 3300006931 | Ga0097620_100002969 | Ga0097620_10000296913 | 154 |
| 410 | 3300006931 | Ga0097620_100054431 | Ga0097620_1000544313 | 154 |
| 411 | 3300006931 | Ga0097620_100055537 | Ga0097620_1000555372 | 154 |
| 412 | 3300006931 | Ga0097620_100888744 | Ga0097620_1008887442 | 154 |
| 413 | 3300007076 | Ga0075435_100185026 | Ga0075435_1001850262 | 154 |
| 414 | 3300007076 | Ga0075435_100207126 | Ga0075435_1002071262 | 154 |
| 415 | 3300007076 | Ga0075435_100214219 | Ga0075435_1002142191 | 154 |
| 416 | 3300007076 | Ga0075435_100453048 | Ga0075435_1004530482 | 154 |
| 417 | 3300007076 | Ga0075435_101140303 | Ga0075435_1011403032 | 154 |
| 418 | 3300009092 | Ga0105250_10073847 | Ga0105250_100738472 | 154 |
| 419 | 3300009093 | Ga0105240_10001330 | Ga0105240_100013302 | 154 |
| 420 | 3300009094 | Ga0111539_10203466 | Ga0111539_102034662 | 154 |
| 421 | 3300009094 | Ga0111539_10250089 | Ga0111539_102500893 | 154 |
| 422 | 3300009094 | Ga0111539_10295811 | Ga0111539_102958112 | 154 |
| 423 | 3300009094 | Ga0111539_10781978 | Ga0111539_107819782 | 154 |
| 424 | 3300009098 | Ga0105245_10077693 | Ga0105245_100776932 | 154 |
| 425 | 3300009098 | Ga0105245_10171053 | Ga0105245_101710532 | 154 |
| 426 | 3300009101 | Ga0105247_10008977 | Ga0105247_100089773 | 154 |
| 427 | 3300009147 | Ga0114129_10011440 | Ga0114129_1001144012 | 154 |
| 428 | 3300009147 | Ga0114129_10022153 | Ga0114129_100221533 | 154 |
| 429 | 3300009147 | Ga0114129_10198157 | Ga0114129_101981572 | 154 |
| 430 | 3300009147 | Ga0114129_10238507 | Ga0114129_102385072 | 154 |
| 431 | 3300009147 | Ga0114129_10311992 | Ga0114129_103119922 | 154 |
| 432 | 3300009147 | Ga0114129_10431959 | Ga0114129_104319592 | 154 |
| 433 | 3300009147 | Ga0114129_10550738 | Ga0114129_105507382 | 154 |
| 434 | 3300009147 | Ga0114129_10594414 | Ga0114129_105944142 | 154 |
| 435 | 3300009147 | Ga0114129_10740298 | Ga0114129_107402981 | 154 |
| 436 | 3300009147 | Ga0114129_11012391 | Ga0114129_110123912 | 154 |
| 437 | 3300009148 | Ga0105243_10141993 | Ga0105243_101419931 | 154 |
| 438 | 3300009148 | Ga0105243_10516184 | Ga0105243_105161842 | 154 |
| 439 | 3300009148 | Ga0105243_10856486 | Ga0105243_108564861 | 154 |
| 440 | 3300009174 | Ga0105241_10059818 | Ga0105241_100598182 | 154 |
| 441 | 3300009174 | Ga0105241_10092818 | Ga0105241_100928182 | 154 |
| 442 | 3300009174 | Ga0105241_10144541 | Ga0105241_101445413 | 154 |
| 443 | 3300009176 | Ga0105242_10009807 | Ga0105242_100098072 | 154 |
| 444 | 3300009176 | Ga0105242_10016619 | Ga0105242_100166192 | 154 |
| 445 | 3300009176 | Ga0105242_10049142 | Ga0105242_100491423 | 154 |
| 446 | 3300009176 | Ga0105242_10090718 | Ga0105242_100907182 | 154 |
| 447 | 3300009176 | Ga0105242_10488988 | Ga0105242_104889882 | 154 |
| 448 | 3300009176 | Ga0105242_11639382 | Ga0105242_116393821 | 154 |
| 449 | 3300009176 | Ga0105242_12060601 | Ga0105242_120606011 | 154 |
| 450 | 3300009177 | Ga0105248_10024239 | Ga0105248_100242394 | 154 |
| 451 | 3300009177 | Ga0105248_10112799 | Ga0105248_101127992 | 154 |
| 452 | 3300009177 | Ga0105248_10253105 | Ga0105248_102531052 | 154 |
| 453 | 3300009177 | Ga0105248_10979019 | Ga0105248_109790192 | 154 |
| 454 | 3300009545 | Ga0105237_10069357 | Ga0105237_100693572 | 154 |
| 455 | 3300009545 | Ga0105237_10139161 | Ga0105237_101391612 | 154 |
| 456 | 3300009545 | Ga0105237_10185851 | Ga0105237_101858512 | 154 |
| 457 | 3300009545 | Ga0105237_11305299 | Ga0105237_113052992 | 154 |
| 458 | 3300009551 | Ga0105238_10005828 | Ga0105238_100058288 | 154 |
| 459 | 3300009553 | Ga0105249_10001223 | Ga0105249_100012232 | 154 |
| 460 | 3300009553 | Ga0105249_11148879 | Ga0105249_111488792 | 154 |
| 461 | 3300010375 | Ga0105239_10565288 | Ga0105239_105652882 | 154 |
| 462 | 3300011119 | Ga0105246_10175600 | Ga0105246_101756002 | 154 |
| 463 | 3300011119 | Ga0105246_10420803 | Ga0105246_104208031 | 154 |
| 464 | 3300011119 | Ga0105246_10504749 | Ga0105246_105047491 | 154 |
| 465 | 3300011119 | Ga0105246_10534124 | Ga0105246_105341242 | 154 |
| 466 | 3300011119 | Ga0105246_10546199 | Ga0105246_105461991 | 154 |
| 467 | 3300012508 | Ga0157315_1005180 | Ga0157315_10051801 | 154 |
| 468 | 3300013102 | Ga0157371_10375229 | Ga0157371_103752291 | 154 |
| 469 | 3300013104 | Ga0157370_10009355 | Ga0157370_100093552 | 154 |
| 470 | 3300013104 | Ga0157370_10230292 | Ga0157370_102302922 | 154 |
| 471 | 3300013105 | Ga0157369_10631415 | Ga0157369_106314151 | 154 |
| 472 | 3300013296 | Ga0157374_10062855 | Ga0157374_100628552 | 154 |
| 473 | 3300013296 | Ga0157374_10073858 | Ga0157374_100738583 | 154 |
| 474 | 3300013296 | Ga0157374_10301332 | Ga0157374_103013322 | 154 |
| 475 | 3300013297 | Ga0157378_10082855 | Ga0157378_100828552 | 154 |
| 476 | 3300013297 | Ga0157378_11237611 | Ga0157378_112376112 | 154 |
| 477 | 3300013306 | Ga0163162_10069114 | Ga0163162_100691142 | 154 |
| 478 | 3300013306 | Ga0163162_10117078 | Ga0163162_101170782 | 154 |
| 479 | 3300013306 | Ga0163162_10537592 | Ga0163162_105375922 | 154 |
| 480 | 3300013306 | Ga0163162_11067052 | Ga0163162_110670522 | 154 |
| 481 | 3300013306 | Ga0163162_12011155 | Ga0163162_120111552 | 154 |
| 482 | 3300013307 | Ga0157372_10114885 | Ga0157372_101148852 | 154 |
| 483 | 3300013307 | Ga0157372_11912900 | Ga0157372_119129002 | 154 |
| 484 | 3300013308 | Ga0157375_10056537 | Ga0157375_100565372 | 154 |
| 485 | 3300013308 | Ga0157375_10095545 | Ga0157375_100955452 | 154 |
| 486 | 3300013308 | Ga0157375_10682835 | Ga0157375_106828352 | 154 |
| 487 | 3300013308 | Ga0157375_11959054 | Ga0157375_119590542 | 154 |
| 488 | 3300014325 | Ga0163163_10027621 | Ga0163163_100276211 | 154 |
| 489 | 3300014325 | Ga0163163_10120750 | Ga0163163_101207502 | 154 |
| 490 | 3300014325 | Ga0163163_10156859 | Ga0163163_101568593 | 154 |
| 491 | 3300014326 | Ga0157380_10078136 | Ga0157380_100781362 | 154 |
| 492 | 3300014326 | Ga0157380_10551024 | Ga0157380_105510241 | 154 |
| 493 | 3300014745 | Ga0157377_10006418 | Ga0157377_100064181 | 154 |
| 494 | 3300014968 | Ga0157379_10007688 | Ga0157379_100076886 | 154 |
| 495 | 3300014968 | Ga0157379_10067866 | Ga0157379_100678662 | 154 |
| 496 | 3300014968 | Ga0157379_10983037 | Ga0157379_109830371 | 154 |
| 497 | 3300014969 | Ga0157376_10115121 | Ga0157376_101151211 | 154 |
| 498 | 3300014969 | Ga0157376_10245593 | Ga0157376_102455932 | 154 |
| 499 | 3300014969 | Ga0157376_10465284 | Ga0157376_104652842 | 154 |
| 500 | 3300017792 | Ga0163161_10073412 | Ga0163161_100734122 | 154 |
| 501 | 3300017792 | Ga0163161_10224990 | Ga0163161_102249902 | 154 |
| 502 | 3300025315 | Ga0207697_10080600 | Ga0207697_100806002 | 154 |
| 503 | 3300025321 | Ga0207656_10183454 | Ga0207656_101834542 | 154 |
| 504 | 3300025885 | Ga0207653_10111444 | Ga0207653_101114441 | 154 |
| 505 | 3300025885 | Ga0207653_10206557 | Ga0207653_102065572 | 154 |
| 506 | 3300025885 | Ga0207653_10273894 | Ga0207653_102738942 | 154 |
| 507 | 3300025899 | Ga0207642_10070945 | Ga0207642_100709452 | 154 |
| 508 | 3300025901 | Ga0207688_10003055 | Ga0207688_100030559 | 154 |
| 509 | 3300025901 | Ga0207688_10124807 | Ga0207688_101248072 | 154 |
| 510 | 3300025903 | Ga0207680_10217513 | Ga0207680_102175131 | 154 |
| 511 | 3300025904 | Ga0207647_10144210 | Ga0207647_101442102 | 154 |
| 512 | 3300025907 | Ga0207645_10044683 | Ga0207645_100446831 | 154 |
| 513 | 3300025907 | Ga0207645_10123370 | Ga0207645_101233702 | 154 |
| 514 | 3300025908 | Ga0207643_10008496 | Ga0207643_100084963 | 154 |
| 515 | 3300025908 | Ga0207643_10017500 | Ga0207643_100175002 | 154 |
| 516 | 3300025908 | Ga0207643_10100937 | Ga0207643_101009372 | 154 |
| 517 | 3300025908 | Ga0207643_10270825 | Ga0207643_102708251 | 154 |
| 518 | 3300025910 | Ga0207684_10000004 | Ga0207684_10000004397 | 154 |
| 519 | 3300025910 | Ga0207684_10034857 | Ga0207684_100348572 | 154 |
| 520 | 3300025910 | Ga0207684_10299980 | Ga0207684_102999802 | 154 |
| 521 | 3300025910 | Ga0207684_10596054 | Ga0207684_105960541 | 154 |
| 522 | 3300025910 | Ga0207684_11006118 | Ga0207684_110061181 | 154 |
| 523 | 3300025910 | Ga0207684_11011298 | Ga0207684_110112982 | 154 |
| 524 | 3300025911 | Ga0207654_10038891 | Ga0207654_100388913 | 154 |
| 525 | 3300025911 | Ga0207654_10172793 | Ga0207654_101727931 | 154 |
| 526 | 3300025912 | Ga0207707_10079898 | Ga0207707_100798982 | 154 |
| 527 | 3300025912 | Ga0207707_10237013 | Ga0207707_102370132 | 154 |
| 528 | 3300025913 | Ga0207695_10002411 | Ga0207695_1000241111 | 154 |
| 529 | 3300025913 | Ga0207695_10343044 | Ga0207695_103430442 | 154 |
| 530 | 3300025913 | Ga0207695_10468447 | Ga0207695_104684472 | 154 |
| 531 | 3300025913 | Ga0207695_11032223 | Ga0207695_110322232 | 154 |
| 532 | 3300025914 | Ga0207671_10115324 | Ga0207671_101153242 | 154 |
| 533 | 3300025914 | Ga0207671_10390103 | Ga0207671_103901032 | 154 |
| 534 | 3300025914 | Ga0207671_11032265 | Ga0207671_110322652 | 154 |
| 535 | 3300025915 | Ga0207693_10129071 | Ga0207693_101290712 | 154 |
| 536 | 3300025916 | Ga0207663_10900665 | Ga0207663_109006652 | 154 |
| 537 | 3300025917 | Ga0207660_10040125 | Ga0207660_100401252 | 154 |
| 538 | 3300025917 | Ga0207660_10136350 | Ga0207660_101363501 | 154 |
| 539 | 3300025917 | Ga0207660_10794446 | Ga0207660_107944462 | 154 |
| 540 | 3300025918 | Ga0207662_10018473 | Ga0207662_100184732 | 154 |
| 541 | 3300025918 | Ga0207662_10036843 | Ga0207662_100368432 | 154 |
| 542 | 3300025918 | Ga0207662_10651175 | Ga0207662_106511751 | 154 |
| 543 | 3300025919 | Ga0207657_10082888 | Ga0207657_100828882 | 154 |
| 544 | 3300025919 | Ga0207657_10538352 | Ga0207657_105383522 | 154 |
| 545 | 3300025920 | Ga0207649_10008732 | Ga0207649_100087325 | 154 |
| 546 | 3300025920 | Ga0207649_10399469 | Ga0207649_103994692 | 154 |
| 547 | 3300025920 | Ga0207649_10407022 | Ga0207649_104070222 | 154 |
| 548 | 3300025920 | Ga0207649_10547796 | Ga0207649_105477962 | 154 |
| 549 | 3300025921 | Ga0207652_10757141 | Ga0207652_107571412 | 154 |
| 550 | 3300025922 | Ga0207646_10044932 | Ga0207646_100449322 | 154 |
| 551 | 3300025922 | Ga0207646_10075989 | Ga0207646_100759894 | 154 |
| 552 | 3300025922 | Ga0207646_10571873 | Ga0207646_105718732 | 154 |
| 553 | 3300025923 | Ga0207681_10000292 | Ga0207681_1000029212 | 154 |
| 554 | 3300025923 | Ga0207681_10453554 | Ga0207681_104535541 | 154 |
| 555 | 3300025924 | Ga0207694_10067586 | Ga0207694_100675863 | 154 |
| 556 | 3300025924 | Ga0207694_10585255 | Ga0207694_105852552 | 154 |
| 557 | 3300025925 | Ga0207650_10005992 | Ga0207650_100059927 | 154 |
| 558 | 3300025925 | Ga0207650_10012968 | Ga0207650_100129683 | 154 |
| 559 | 3300025926 | Ga0207659_10000931 | Ga0207659_1000093114 | 154 |
| 560 | 3300025926 | Ga0207659_10287240 | Ga0207659_102872402 | 154 |
| 561 | 3300025926 | Ga0207659_11126087 | Ga0207659_111260871 | 154 |
| 562 | 3300025927 | Ga0207687_10050723 | Ga0207687_100507232 | 154 |
| 563 | 3300025927 | Ga0207687_10336048 | Ga0207687_103360482 | 154 |
| 564 | 3300025928 | Ga0207700_10392513 | Ga0207700_103925131 | 154 |
| 565 | 3300025928 | Ga0207700_10453801 | Ga0207700_104538012 | 154 |
| 566 | 3300025929 | Ga0207664_10951846 | Ga0207664_109518462 | 154 |
| 567 | 3300025931 | Ga0207644_10028794 | Ga0207644_100287943 | 154 |
| 568 | 3300025931 | Ga0207644_10042692 | Ga0207644_100426922 | 154 |
| 569 | 3300025931 | Ga0207644_10659563 | Ga0207644_106595632 | 154 |
| 570 | 3300025932 | Ga0207690_10224951 | Ga0207690_102249512 | 154 |
| 571 | 3300025934 | Ga0207686_10008069 | Ga0207686_100080692 | 154 |
| 572 | 3300025934 | Ga0207686_10029951 | Ga0207686_100299511 | 154 |
| 573 | 3300025934 | Ga0207686_10064624 | Ga0207686_100646243 | 154 |
| 574 | 3300025934 | Ga0207686_10119533 | Ga0207686_101195332 | 154 |
| 575 | 3300025934 | Ga0207686_10321383 | Ga0207686_103213831 | 154 |
| 576 | 3300025934 | Ga0207686_10370605 | Ga0207686_103706052 | 154 |
| 577 | 3300025935 | Ga0207709_10043079 | Ga0207709_100430792 | 154 |
| 578 | 3300025935 | Ga0207709_10088224 | Ga0207709_100882242 | 154 |
| 579 | 3300025935 | Ga0207709_10353896 | Ga0207709_103538962 | 154 |
| 580 | 3300025936 | Ga0207670_10145706 | Ga0207670_101457061 | 154 |
| 581 | 3300025938 | Ga0207704_10028908 | Ga0207704_100289082 | 154 |
| 582 | 3300025938 | Ga0207704_10039712 | Ga0207704_100397122 | 154 |
| 583 | 3300025940 | Ga0207691_10009425 | Ga0207691_100094252 | 154 |
| 584 | 3300025940 | Ga0207691_10048890 | Ga0207691_100488901 | 154 |
| 585 | 3300025940 | Ga0207691_10091716 | Ga0207691_100917162 | 154 |
| 586 | 3300025940 | Ga0207691_10748577 | Ga0207691_107485772 | 154 |
| 587 | 3300025941 | Ga0207711_10432753 | Ga0207711_104327532 | 154 |
| 588 | 3300025941 | Ga0207711_10486297 | Ga0207711_104862972 | 154 |
| 589 | 3300025941 | Ga0207711_10719115 | Ga0207711_107191152 | 154 |
| 590 | 3300025941 | Ga0207711_11133077 | Ga0207711_111330772 | 154 |
| 591 | 3300025942 | Ga0207689_10036911 | Ga0207689_100369113 | 154 |
| 592 | 3300025942 | Ga0207689_10183898 | Ga0207689_101838982 | 154 |
| 593 | 3300025942 | Ga0207689_10251978 | Ga0207689_102519781 | 154 |
| 594 | 3300025942 | Ga0207689_10560433 | Ga0207689_105604331 | 154 |
| 595 | 3300025944 | Ga0207661_10285102 | Ga0207661_102851022 | 154 |
| 596 | 3300025945 | Ga0207679_10040102 | Ga0207679_100401022 | 154 |
| 597 | 3300025945 | Ga0207679_10179748 | Ga0207679_101797482 | 154 |
| 598 | 3300025945 | Ga0207679_10394445 | Ga0207679_103944452 | 154 |
| 599 | 3300025949 | Ga0207667_10045803 | Ga0207667_100458034 | 154 |
| 600 | 3300025949 | Ga0207667_10231647 | Ga0207667_102316472 | 154 |
| 601 | 3300025960 | Ga0207651_10049127 | Ga0207651_100491272 | 154 |
| 602 | 3300025960 | Ga0207651_10161067 | Ga0207651_101610672 | 154 |
| 603 | 3300025960 | Ga0207651_10226725 | Ga0207651_102267252 | 154 |
| 604 | 3300025961 | Ga0207712_10003713 | Ga0207712_100037133 | 154 |
| 605 | 3300025961 | Ga0207712_10352061 | Ga0207712_103520612 | 154 |
| 606 | 3300025972 | Ga0207668_10005811 | Ga0207668_100058112 | 154 |
| 607 | 3300025972 | Ga0207668_10113129 | Ga0207668_101131292 | 154 |
| 608 | 3300025986 | Ga0207658_10081375 | Ga0207658_100813752 | 154 |
| 609 | 3300025986 | Ga0207658_10145076 | Ga0207658_101450761 | 154 |
| 610 | 3300025986 | Ga0207658_10286393 | Ga0207658_102863932 | 154 |
| 611 | 3300026023 | Ga0207677_10280726 | Ga0207677_102807262 | 154 |
| 612 | 3300026035 | Ga0207703_10035190 | Ga0207703_100351903 | 154 |
| 613 | 3300026035 | Ga0207703_10139824 | Ga0207703_101398242 | 154 |
| 614 | 3300026035 | Ga0207703_10946036 | Ga0207703_109460362 | 154 |
| 615 | 3300026041 | Ga0207639_10065889 | Ga0207639_100658892 | 154 |
| 616 | 3300026041 | Ga0207639_10185768 | Ga0207639_101857681 | 154 |
| 617 | 3300026041 | Ga0207639_11158263 | Ga0207639_111582631 | 154 |
| 618 | 3300026041 | Ga0207639_11456189 | Ga0207639_114561891 | 154 |
| 619 | 3300026067 | Ga0207678_10047770 | Ga0207678_100477702 | 154 |
| 620 | 3300026067 | Ga0207678_10073288 | Ga0207678_100732882 | 154 |
| 621 | 3300026075 | Ga0207708_10035720 | Ga0207708_100357201 | 154 |
| 622 | 3300026075 | Ga0207708_10052282 | Ga0207708_100522822 | 154 |
| 623 | 3300026075 | Ga0207708_10334248 | Ga0207708_103342482 | 154 |
| 624 | 3300026078 | Ga0207702_10173340 | Ga0207702_101733402 | 154 |
| 625 | 3300026078 | Ga0207702_10952531 | Ga0207702_109525311 | 154 |
| 626 | 3300026078 | Ga0207702_11418863 | Ga0207702_114188631 | 154 |
| 627 | 3300026088 | Ga0207641_10021744 | Ga0207641_100217442 | 154 |
| 628 | 3300026088 | Ga0207641_10049400 | Ga0207641_100494003 | 154 |
| 629 | 3300026088 | Ga0207641_10058812 | Ga0207641_100588121 | 154 |
| 630 | 3300026088 | Ga0207641_10171746 | Ga0207641_101717462 | 154 |
| 631 | 3300026089 | Ga0207648_10000938 | Ga0207648_100009382 | 154 |
| 632 | 3300026089 | Ga0207648_10054113 | Ga0207648_100541132 | 154 |
| 633 | 3300026095 | Ga0207676_10004720 | Ga0207676_100047207 | 154 |
| 634 | 3300026095 | Ga0207676_10022478 | Ga0207676_100224783 | 154 |
| 635 | 3300026095 | Ga0207676_10035799 | Ga0207676_100357991 | 154 |
| 636 | 3300026095 | Ga0207676_10234985 | Ga0207676_102349852 | 154 |
| 637 | 3300026095 | Ga0207676_11224240 | Ga0207676_112242401 | 154 |
| 638 | 3300026116 | Ga0207674_10043797 | Ga0207674_100437974 | 154 |
| 639 | 3300026116 | Ga0207674_11153607 | Ga0207674_111536072 | 154 |
| 640 | 3300026118 | Ga0207675_100001384 | Ga0207675_10000138421 | 154 |
| 641 | 3300026118 | Ga0207675_100003563 | Ga0207675_10000356312 | 154 |
| 642 | 3300026118 | Ga0207675_100334315 | Ga0207675_1003343152 | 154 |
| 643 | 3300026118 | Ga0207675_101557717 | Ga0207675_1015577171 | 154 |
| 644 | 3300026121 | Ga0207683_10516020 | Ga0207683_105160202 | 154 |
| 645 | 3300026121 | Ga0207683_10550786 | Ga0207683_105507861 | 154 |
| 646 | 3300026142 | Ga0207698_10221559 | Ga0207698_102215592 | 154 |
| 647 | 3300026142 | Ga0207698_10517771 | Ga0207698_105177712 | 154 |
| 648 | 3300027695 | Ga0209966_1034525 | Ga0209966_10345252 | 154 |
| 649 | 3300027876 | Ga0209974_10056907 | Ga0209974_100569071 | 154 |
| 650 | 3300027907 | Ga0207428_10000562 | Ga0207428_100005627 | 154 |
| 651 | 3300027907 | Ga0207428_10990430 | Ga0207428_109904301 | 154 |
| 652 | 3300028379 | Ga0268266_10036665 | Ga0268266_100366654 | 154 |
| 653 | 3300028380 | Ga0268265_10000103 | Ga0268265_1000010381 | 154 |
| 654 | 3300028380 | Ga0268265_10300765 | Ga0268265_103007651 | 154 |
| 655 | 3300028380 | Ga0268265_10603622 | Ga0268265_106036221 | 154 |
| 656 | 3300028380 | Ga0268265_10682639 | Ga0268265_106826392 | 154 |
| 657 | 3300028381 | Ga0268264_10020042 | Ga0268264_100200422 | 154 |
| 658 | 3300028381 | Ga0268264_10124713 | Ga0268264_101247131 | 154 |
| 659 | 3300028381 | Ga0268264_10137446 | Ga0268264_101374462 | 154 |
| 660 | 3300028381 | Ga0268264_10276102 | Ga0268264_102761022 | 154 |
| 661 | 3300028381 | Ga0268264_10311470 | Ga0268264_103114702 | 154 |
| 662 | 3300028381 | Ga0268264_10374221 | Ga0268264_103742212 | 154 |
| 663 | 3300031242 | Ga0265329_10105184 | Ga0265329_101051841 | 154 |
| 664 | 3300031249 | Ga0265339_10136875 | Ga0265339_101368752 | 154 |
| 665 | 3300031251 | Ga0265327_10106121 | Ga0265327_101061212 | 154 |
| 666 | 3300031711 | Ga0265314_10001454 | Ga0265314_100014542 | 154 |
| 667 | 3300034820 | Ga0373959_0054010 | Ga0373959_0054010_298_762 | 154 |
| 668 | 3300035083 | Ga0373926_0356464 | Ga0373926_0356464_17_481 | 154 |
| 669 | 3300035090 | Ga0373949_0037290 | Ga0373949_0037290_218_682 | 154 |
| 670 | 3300035092 | Ga0373952_0268072 | Ga0373952_0268072_38_505 | 154 |
| 671 | 3300035113 | Ga0373936_0200539 | Ga0373936_0200539_211_675 | 154 |
| 672 | 3300035114 | Ga0373939_0044667 | Ga0373939_0044667_794_1258 | 154 |
| 673 | 3300035115 | Ga0373941_0101373 | Ga0373941_0101373_154_618 | 154 |
| 674 | 3300035116 | Ga0373945_0048053 | Ga0373945_0048053_632_1096 | 154 |
| 675 | 3300035118 | Ga0373954_0361884 | Ga0373954_0361884_44_517 | 154 |
| 676 | 3300035119 | Ga0373956_0077187 | Ga0373956_0077187_882_1355 | 154 |
| 677 | 3300035121 | Ga0373960_0004518 | Ga0373960_0004518_947_1411 | 154 |
| 678 | 3300035170 | Ga0373943_0073906 | Ga0373943_0073906_456_920 | 154 |
| 679 | 3300035170 | Ga0373943_0139140 | Ga0373943_0139140_591_1055 | 154 |
| 680 | 3300035171 | Ga0373946_0011306 | Ga0373946_0011306_273_737 | 154 |
| 681 | 3300035172 | Ga0373955_0002461 | Ga0373955_0002461_19_492 | 154 |
| 682 | 3300035172 | Ga0373955_0056957 | Ga0373955_0056957_85_552 | 154 |
| 683 | 3300035172 | Ga0373955_0188367 | Ga0373955_0188367_650_1114 | 154 |
| 684 | 3300035172 | Ga0373955_0712081 | Ga0373955_0712081_74_541 | 154 |
| 685 | 3300035410 | Ga0373924_0014243 | Ga0373924_0014243_2405_2878 | 154 |
| 686 | 3300035691 | Ga0373931_0021322 | Ga0373931_0021322_1952_2416 | 154 |
| 687 | 3300035692 | Ga0373935_0024708 | Ga0373935_0024708_1801_2268 | 154 |
| 688 | 3300035692 | Ga0373935_0341335 | Ga0373935_0341335_519_992 | 154 |
| 689 | 3300035692 | Ga0373935_0435121 | Ga0373935_0435121_149_613 | 154 |
| 690 | 3300035695 | Ga0373927_0011784 | Ga0373927_0011784_462_926 | 154 |
| 691 | 3300035695 | Ga0373927_0194675 | Ga0373927_0194675_434_907 | 154 |
| 692 | 3300035695 | Ga0373927_0679101 | Ga0373927_0679101_186_650 | 154 |
| 693 | 3300035725 | Ga0373947_0065523 | Ga0373947_0065523_309_776 | 154 |
| 694 | 3300035725 | Ga0373947_0448756 | Ga0373947_0448756_198_671 | 154 |
| 695 | 3300035725 | Ga0373947_0840724 | Ga0373947_0840724_89_553 | 154 |
| 696 | 3300035725 | Ga0373947_1010188 | Ga0373947_1010188_52_516 | 154 |
| 697 | 3300036401 | Ga0373937_0009278 | Ga0373937_0009278_522_989 | 154 |
| 698 | 3300036401 | Ga0373937_0098568 | Ga0373937_0098568_1776_2240 | 154 |
| 699 | 3300036401 | Ga0373937_0333697 | Ga0373937_0333697_201_668 | 154 |
| 700 | 3300037068 | Ga0373925_0056176 | Ga0373925_0056176_94_567 | 154 |
| 701 | 3300037068 | Ga0373925_0082087 | Ga0373925_0082087_576_1043 | 154 |
| 702 | 3300037068 | Ga0373925_0452164 | Ga0373925_0452164_565_1029 | 154 |
| 703 | 3300039447 | Ga0436361_0314528 | Ga0436361_0314528_93_557 | 154 |
| 704 | 3300041492 | Ga0451835_0112714 | Ga0451835_0112714_96_560 | 154 |
| 705 | 3300042876 | Ga0451577_0788457 | Ga0451577_0788457_208_675 | 154 |
| 706 | 3300044673 | Ga0453683_0392434 | Ga0453683_0392434_64_543 | 154 |
| 707 | 3300045051 | Ga0451576_0021376 | Ga0451576_0021376_5932_6396 | 154 |
| 708 | 3300045051 | Ga0451576_0054255 | Ga0451576_0054255_41_505 | 154 |
| 709 | 3300045051 | Ga0451576_0079760 | Ga0451576_0079760_2271_2735 | 154 |
| 710 | 3300046454 | Ga0495592_0012432 | Ga0495592_0012432_2871_3338 | 154 |
| 711 | 3300046454 | Ga0495592_0145772 | Ga0495592_0145772_319_837 | 154 |
| 712 | 3300046454 | Ga0495592_0341041 | Ga0495592_0341041_417_890 | 154 |
| 713 | 3300046455 | Ga0495603_0012179 | Ga0495603_0012179_4427_4891 | 154 |
| 714 | 3300046455 | Ga0495603_0033288 | Ga0495603_0033288_165_629 | 154 |
| 715 | 3300046455 | Ga0495603_0354626 | Ga0495603_0354626_39_503 | 154 |
| 716 | 3300046459 | Ga0495629_0001619 | Ga0495629_0001619_11176_11640 | 154 |
| 717 | 3300046461 | Ga0495641_0011781 | Ga0495641_0011781_1048_1512 | 154 |
| 718 | 3300046461 | Ga0495641_0059056 | Ga0495641_0059056_32_496 | 154 |
| 719 | 3300046461 | Ga0495641_0128963 | Ga0495641_0128963_284_748 | 154 |
| 720 | 3300046462 | Ga0495651_0010791 | Ga0495651_0010791_1005_1472 | 154 |
| 721 | 3300046463 | Ga0495653_0007069 | Ga0495653_0007069_5271_5738 | 154 |
| 722 | 3300046463 | Ga0495653_0423410 | Ga0495653_0423410_317_793 | 154 |
| 723 | 3300046472 | Ga0495580_0282572 | Ga0495580_0282572_561_1028 | 154 |
| 724 | 3300046472 | Ga0495580_0381500 | Ga0495580_0381500_434_907 | 154 |
| 725 | 3300046472 | Ga0495580_0648168 | Ga0495580_0648168_185_652 | 154 |
| 726 | 3300046473 | Ga0495582_0030627 | Ga0495582_0030627_1681_2145 | 154 |
| 727 | 3300046473 | Ga0495582_0622721 | Ga0495582_0622721_123_587 | 154 |
| 728 | 3300046474 | Ga0495605_0039567 | Ga0495605_0039567_183_647 | 154 |
| 729 | 3300046476 | Ga0495662_0118018 | Ga0495662_0118018_351_815 | 154 |
| 730 | 3300046477 | Ga0495664_0055733 | Ga0495664_0055733_628_1095 | 154 |
| 731 | 3300046477 | Ga0495664_0421175 | Ga0495664_0421175_142_609 | 154 |
| 732 | 3300046491 | Ga0495584_0021570 | Ga0495584_0021570_2133_2597 | 154 |
| 733 | 3300046491 | Ga0495584_0090238 | Ga0495584_0090238_655_1119 | 154 |
| 734 | 3300046491 | Ga0495584_0264785 | Ga0495584_0264785_11_475 | 154 |
| 735 | 3300046492 | Ga0495585_0033701 | Ga0495585_0033701_180_644 | 154 |
| 736 | 3300046499 | Ga0495594_0363912 | Ga0495594_0363912_220_684 | 154 |
| 737 | 3300046511 | Ga0495608_0021909 | Ga0495608_0021909_35_502 | 154 |
| 738 | 3300046511 | Ga0495608_0039578 | Ga0495608_0039578_685_1158 | 154 |
| 739 | 3300046511 | Ga0495608_0077149 | Ga0495608_0077149_628_1092 | 154 |
| 740 | 3300046514 | Ga0495618_0096622 | Ga0495618_0096622_175_642 | 154 |
| 741 | 3300046514 | Ga0495618_0131235 | Ga0495618_0131235_125_643 | 154 |
| 742 | 3300046514 | Ga0495618_0593975 | Ga0495618_0593975_139_603 | 154 |
| 743 | 3300046516 | Ga0495628_0001354 | Ga0495628_0001354_20940_21407 | 154 |
| 744 | 3300046516 | Ga0495628_0135498 | Ga0495628_0135498_842_1315 | 154 |
| 745 | 3300046516 | Ga0495628_1020346 | Ga0495628_1020346_86_550 | 154 |
| 746 | 3300046517 | Ga0495630_0024914 | Ga0495630_0024914_746_1219 | 154 |
| 747 | 3300046517 | Ga0495630_0315905 | Ga0495630_0315905_171_638 | 154 |
| 748 | 3300046517 | Ga0495630_0980307 | Ga0495630_0980307_12_479 | 154 |
| 749 | 3300046518 | Ga0495631_0308298 | Ga0495631_0308298_13_477 | 154 |
| 750 | 3300046519 | Ga0495632_0071273 | Ga0495632_0071273_539_1003 | 154 |
| 751 | 3300046520 | Ga0495637_0183949 | Ga0495637_0183949_216_680 | 154 |
| 752 | 3300046523 | Ga0495644_0115441 | Ga0495644_0115441_481_945 | 154 |
| 753 | 3300046525 | Ga0495663_0168992 | Ga0495663_0168992_261_725 | 154 |
| 754 | 3300046525 | Ga0495663_0189248 | Ga0495663_0189248_224_688 | 154 |
| 755 | 3300046526 | Ga0495666_0331104 | Ga0495666_0331104_77_544 | 154 |
| 756 | 3300046528 | Ga0495642_0006036 | Ga0495642_0006036_1569_2033 | 154 |
| 757 | 3300046528 | Ga0495642_0134962 | Ga0495642_0134962_462_926 | 154 |
| 758 | 3300046529 | Ga0495652_0040705 | Ga0495652_0040705_1542_2009 | 154 |
| 759 | 3300046529 | Ga0495652_0209326 | Ga0495652_0209326_248_712 | 154 |
| 760 | 3300046529 | Ga0495652_0292797 | Ga0495652_0292797_115_588 | 154 |
| 761 | 3300046529 | Ga0495652_0398382 | Ga0495652_0398382_474_956 | 154 |
| 762 | 3300046529 | Ga0495652_0434933 | Ga0495652_0434933_216_683 | 154 |
| 763 | 3300046529 | Ga0495652_0973534 | Ga0495652_0973534_53_520 | 154 |
| 764 | 3300046531 | Ga0495665_0141141 | Ga0495665_0141141_326_790 | 154 |
| 765 | 3300046533 | Ga0495640_0088887 | Ga0495640_0088887_467_934 | 154 |
| 766 | 3300046533 | Ga0495640_0115812 | Ga0495640_0115812_1248_1712 | 154 |
| 767 | 3300046533 | Ga0495640_0172548 | Ga0495640_0172548_35_553 | 154 |
| 768 | 3300046535 | Ga0495586_0631293 | Ga0495586_0631293_62_529 | 154 |
| 769 | 3300046536 | Ga0495587_0005263 | Ga0495587_0005263_3862_4329 | 154 |
| 770 | 3300046537 | Ga0495598_0026697 | Ga0495598_0026697_169_633 | 154 |
| 771 | 3300046538 | Ga0495609_0023267 | Ga0495609_0023267_93_557 | 154 |
| 772 | 3300046539 | Ga0495621_0000998 | Ga0495621_0000998_2222_2686 | 154 |
| 773 | 3300046539 | Ga0495621_0017434 | Ga0495621_0017434_76_540 | 154 |
| 774 | 3300046539 | Ga0495621_0035833 | Ga0495621_0035833_74_538 | 154 |
| 775 | 3300046539 | Ga0495621_0203818 | Ga0495621_0203818_178_642 | 154 |
| 776 | 3300046539 | Ga0495621_0371963 | Ga0495621_0371963_24_488 | 154 |
| 777 | 3300046543 | Ga0495645_0052499 | Ga0495645_0052499_1896_2369 | 154 |
| 778 | 3300046558 | Ga0495633_0025927 | Ga0495633_0025927_2322_2786 | 154 |
| 779 | 3300046558 | Ga0495633_0046916 | Ga0495633_0046916_137_601 | 154 |
| 780 | 3300046559 | Ga0495667_0025835 | Ga0495667_0025835_2809_3276 | 154 |
| 781 | 3300046559 | Ga0495667_0030689 | Ga0495667_0030689_836_1309 | 154 |
| 782 | 3300046615 | Ga0495656_0035345 | Ga0495656_0035345_382_846 | 154 |
| 783 | 3300046615 | Ga0495656_0239086 | Ga0495656_0239086_398_862 | 154 |
| 784 | 3300046616 | Ga0495668_0097931 | Ga0495668_0097931_726_1190 | 154 |
| 785 | 3300046642 | Ga0495634_0033268 | Ga0495634_0033268_1841_2308 | 154 |
| 786 | 3300046642 | Ga0495634_0648927 | Ga0495634_0648927_93_566 | 154 |
| 787 | 3300046648 | Ga0495611_0178484 | Ga0495611_0178484_327_791 | 154 |
| 788 | 3300046648 | Ga0495611_0288816 | Ga0495611_0288816_259_723 | 154 |
| 789 | 3300046660 | Ga0495625_0505361 | Ga0495625_0505361_64_528 | 154 |
| 790 | 3300046663 | Ga0495635_0041719 | Ga0495635_0041719_1771_2238 | 154 |
| 791 | 3300046663 | Ga0495635_0415040 | Ga0495635_0415040_206_679 | 154 |
| 792 | 3300046664 | Ga0495659_0004982 | Ga0495659_0004982_579_1043 | 154 |
| 793 | 3300046664 | Ga0495659_0007522 | Ga0495659_0007522_451_915 | 154 |
| 794 | 3300046664 | Ga0495659_0015511 | Ga0495659_0015511_1949_2413 | 154 |
| 795 | 3300046664 | Ga0495659_0020676 | Ga0495659_0020676_630_1094 | 154 |
| 796 | 3300046664 | Ga0495659_0236393 | Ga0495659_0236393_68_532 | 154 |
| 797 | 3300046664 | Ga0495659_0335034 | Ga0495659_0335034_44_511 | 154 |
| 798 | 3300046664 | Ga0495659_0395922 | Ga0495659_0395922_58_522 | 154 |
| 799 | 3300046665 | Ga0495661_0085478 | Ga0495661_0085478_114_578 | 154 |
| 800 | 3300046674 | Ga0495588_0083921 | Ga0495588_0083921_654_1118 | 154 |
| 801 | 3300046675 | Ga0495657_0062405 | Ga0495657_0062405_420_887 | 154 |
| 802 | 3300046675 | Ga0495657_0222807 | Ga0495657_0222807_555_1028 | 154 |
| 803 | 3300046678 | Ga0495599_0004979 | Ga0495599_0004979_4506_4973 | 154 |
| 804 | 3300046678 | Ga0495599_0216736 | Ga0495599_0216736_533_997 | 154 |
| 805 | 3300046678 | Ga0495599_0250736 | Ga0495599_0250736_99_572 | 154 |
| 806 | 3300046680 | Ga0495646_0339656 | Ga0495646_0339656_253_717 | 154 |
| 807 | 3300046680 | Ga0495646_0400732 | Ga0495646_0400732_34_501 | 154 |
| 808 | 3300046681 | Ga0495647_0236460 | Ga0495647_0236460_157_621 | 154 |
| 809 | 3300046681 | Ga0495647_0281589 | Ga0495647_0281589_93_557 | 154 |
| 810 | 3300046683 | Ga0495658_0028683 | Ga0495658_0028683_641_1114 | 154 |
| 811 | 3300046683 | Ga0495658_0042543 | Ga0495658_0042543_1369_1836 | 154 |
| 812 | 3300046683 | Ga0495658_0045312 | Ga0495658_0045312_776_1240 | 154 |
| 813 | 3300046683 | Ga0495658_0235714 | Ga0495658_0235714_53_517 | 154 |
| 814 | 3300046684 | Ga0495669_0041245 | Ga0495669_0041245_53_517 | 154 |
| 815 | 3300046684 | Ga0495669_0131570 | Ga0495669_0131570_589_1053 | 154 |
| 816 | 3300046689 | Ga0495613_0000397 | Ga0495613_0000397_11319_11792 | 154 |
| 817 | 3300046689 | Ga0495613_0086411 | Ga0495613_0086411_546_1013 | 154 |
| 818 | 3300046689 | Ga0495613_0211325 | Ga0495613_0211325_353_820 | 154 |
| 819 | 3300046689 | Ga0495613_0279244 | Ga0495613_0279244_54_521 | 154 |
| 820 | 3300046689 | Ga0495613_0382967 | Ga0495613_0382967_448_912 | 154 |
| 821 | 3300046690 | Ga0495624_0270103 | Ga0495624_0270103_89_553 | 154 |
| 822 | 3300046691 | Ga0495670_0050138 | Ga0495670_0050138_980_1444 | 154 |
| 823 | 3300046691 | Ga0495670_0805766 | Ga0495670_0805766_17_481 | 154 |
| 824 | 3300046692 | Ga0495671_0314313 | Ga0495671_0314313_176_640 | 154 |
| 825 | 3300046809 | Ga0495600_0005852 | Ga0495600_0005852_4935_5402 | 154 |
| 826 | 3300046809 | Ga0495600_0050520 | Ga0495600_0050520_332_805 | 154 |
| 827 | 3300046809 | Ga0495600_0728359 | Ga0495600_0728359_90_554 | 154 |
| 828 | 3300046810 | Ga0495660_0099059 | Ga0495660_0099059_437_901 | 154 |
| 829 | 3300047315 | Ga0495581_0065787 | Ga0495581_0065787_1253_1717 | 154 |
| 830 | 3300047315 | Ga0495581_0070552 | Ga0495581_0070552_130_594 | 154 |
| 831 | 3300047315 | Ga0495581_0679300 | Ga0495581_0679300_17_490 | 154 |
| 832 | 3300047317 | Ga0495604_0003278 | Ga0495604_0003278_7601_8068 | 154 |
| 833 | 3300047317 | Ga0495604_0027344 | Ga0495604_0027344_3276_3749 | 154 |
| 834 | 3300047318 | Ga0495636_0015384 | Ga0495636_0015384_1620_2084 | 154 |
| 835 | 3300047318 | Ga0495636_0062273 | Ga0495636_0062273_1059_1523 | 154 |
| 836 | 3300047318 | Ga0495636_0071921 | Ga0495636_0071921_792_1256 | 154 |
| 837 | 3300047318 | Ga0495636_0312481 | Ga0495636_0312481_144_608 | 154 |
| 838 | 3300047319 | Ga0495674_0002008 | Ga0495674_0002008_12624_13091 | 154 |
| 839 | 3300047319 | Ga0495674_0054300 | Ga0495674_0054300_2303_2821 | 154 |
| 840 | 3300047319 | Ga0495674_0061291 | Ga0495674_0061291_155_622 | 154 |
| 841 | 3300047319 | Ga0495674_0163199 | Ga0495674_0163199_1213_1680 | 154 |
| 842 | 3300047319 | Ga0495674_0576860 | Ga0495674_0576860_303_767 | 154 |
| 843 | 3300047319 | Ga0495674_1464621 | Ga0495674_1464621_19_486 | 154 |
| 844 | 3300047321 | Ga0495676_0010821 | Ga0495676_0010821_5305_5769 | 154 |
| 845 | 3300047321 | Ga0495676_0237402 | Ga0495676_0237402_354_818 | 154 |
| 846 | 3300047322 | Ga0495680_0032767 | Ga0495680_0032767_2360_2827 | 154 |
| 847 | 3300047322 | Ga0495680_0399851 | Ga0495680_0399851_380_850 | 154 |
| 848 | 3300047322 | Ga0495680_0937945 | Ga0495680_0937945_78_542 | 154 |
| 849 | 3300047323 | Ga0495683_0081466 | Ga0495683_0081466_159_623 | 154 |
| 850 | 3300047444 | Ga0495675_0002749 | Ga0495675_0002749_8105_8572 | 154 |
| 851 | 3300047444 | Ga0495675_0738754 | Ga0495675_0738754_58_525 | 154 |
| 852 | 3300047445 | Ga0495677_0019265 | Ga0495677_0019265_1220_1684 | 154 |
| 853 | 3300047445 | Ga0495677_0025693 | Ga0495677_0025693_319_783 | 154 |
| 854 | 3300047445 | Ga0495677_0091357 | Ga0495677_0091357_485_949 | 154 |
| 855 | 3300047446 | Ga0495679_061254 | Ga0495679_061254_64_528 | 154 |
| 856 | 3300047447 | Ga0495685_076757 | Ga0495685_076757_344_808 | 154 |
| 857 | 3300047469 | Ga0495673_0110984 | Ga0495673_0110984_258_722 | 154 |
| 858 | 3300047471 | Ga0495684_0000431 | Ga0495684_0000431_16713_17186 | 154 |
| 859 | 3300047471 | Ga0495684_0049741 | Ga0495684_0049741_1457_1924 | 154 |
| 860 | 3300047471 | Ga0495684_0114954 | Ga0495684_0114954_1341_1805 | 154 |
| 861 | 3300047471 | Ga0495684_0165691 | Ga0495684_0165691_218_685 | 154 |
| 862 | 3300047471 | Ga0495684_0346958 | Ga0495684_0346958_378_851 | 154 |
| 863 | 3300047471 | Ga0495684_0454716 | Ga0495684_0454716_392_859 | 154 |
| 864 | 3300047472 | Ga0495686_0067826 | Ga0495686_0067826_1088_1552 | 154 |
| 865 | 3300047472 | Ga0495686_0084280 | Ga0495686_0084280_77_592 | 154 |
| 866 | 3300047673 | Ga0495593_0028114 | Ga0495593_0028114_2459_2923 | 154 |
| 867 | 3300047673 | Ga0495593_0266968 | Ga0495593_0266968_15_479 | 154 |
| 868 | 3300048088 | Ga0495602_0022172 | Ga0495602_0022172_4593_5060 | 154 |
| 869 | 3300048088 | Ga0495602_0142743 | Ga0495602_0142743_34_504 | 154 |
| 870 | 3300048089 | Ga0495614_0089055 | Ga0495614_0089055_242_706 | 154 |
| 871 | 3300048091 | Ga0495626_0233556 | Ga0495626_0233556_76_540 | 154 |
| 872 | 3300048903 | Ga0496100_0147115 | Ga0496100_0147115_543_1007 | 154 |
| 873 | 3300048904 | Ga0496101_0134728 | Ga0496101_0134728_710_1174 | 154 |
| 874 | 3300048904 | Ga0496101_0490320 | Ga0496101_0490320_295_759 | 154 |
| 875 | 3300048906 | Ga0496103_0022195 | Ga0496103_0022195_850_1314 | 154 |
| 876 | 3300048906 | Ga0496103_0128291 | Ga0496103_0128291_812_1276 | 154 |
| 877 | 3300048907 | Ga0496104_0045229 | Ga0496104_0045229_709_1173 | 154 |
| 878 | 3300048907 | Ga0496104_0113510 | Ga0496104_0113510_2100_2567 | 154 |
| 879 | 3300048908 | Ga0496105_0008859 | Ga0496105_0008859_670_1134 | 154 |
| 880 | 3300048908 | Ga0496105_0144110 | Ga0496105_0144110_493_960 | 154 |
| 881 | 3300048909 | Ga0496106_0028179 | Ga0496106_0028179_3010_3474 | 154 |
| 882 | 3300048909 | Ga0496106_0536135 | Ga0496106_0536135_372_836 | 154 |
| 883 | 3300048910 | Ga0496107_0191751 | Ga0496107_0191751_454_918 | 154 |
| 884 | 3300048911 | Ga0496108_0765552 | Ga0496108_0765552_68_532 | 154 |
| 885 | 3300048912 | Ga0496109_0004243 | Ga0496109_0004243_6058_6525 | 154 |
| 886 | 3300048912 | Ga0496109_0030998 | Ga0496109_0030998_614_1078 | 154 |
| 887 | 3300048913 | Ga0496110_0015614 | Ga0496110_0015614_5813_6280 | 154 |
| 888 | 3300048913 | Ga0496110_0030728 | Ga0496110_0030728_2680_3144 | 154 |
| 889 | 3300048913 | Ga0496110_0182665 | Ga0496110_0182665_260_727 | 154 |
| 890 | 3300048913 | Ga0496110_1095673 | Ga0496110_1095673_229_693 | 154 |
| 891 | 3300048914 | Ga0496111_0040436 | Ga0496111_0040436_2306_2770 | 154 |
| 892 | 3300048915 | Ga0496112_0056354 | Ga0496112_0056354_418_882 | 154 |
| 893 | 3300048915 | Ga0496112_0149860 | Ga0496112_0149860_527_994 | 154 |
| 894 | 3300048916 | Ga0496113_0203985 | Ga0496113_0203985_987_1454 | 154 |
| 895 | 3300048917 | Ga0496114_0034306 | Ga0496114_0034306_3145_3609 | 154 |
| 896 | 3300048917 | Ga0496114_0530816 | Ga0496114_0530816_475_939 | 154 |
| 897 | 3300048917 | Ga0496114_0561175 | Ga0496114_0561175_140_607 | 154 |
| 898 | 3300048918 | Ga0496115_0063455 | Ga0496115_0063455_1437_1904 | 154 |
| 899 | 3300048918 | Ga0496115_0127180 | Ga0496115_0127180_1066_1530 | 154 |
| 900 | 3300049459 | Ga0495678_180658 | Ga0495678_180658_89_553 | 154 |
| 901 | 3300049570 | Ga0501033_0344295 | Ga0501033_0344295_59_526 | 154 |
| 902 | 3300049581 | Ga0501047_0362572 | Ga0501047_0362572_560_1027 | 154 |
| 903 | 3300049585 | Ga0501069_0060766 | Ga0501069_0060766_29_493 | 154 |
| 904 | 3300049593 | Ga0501077_0337569 | Ga0501077_0337569_178_678 | 154 |
| 905 | 3300049741 | Ga0501079_0381439 | Ga0501079_0381439_291_791 | 154 |
| 906 | 3300049822 | Ga0501035_0913295 | Ga0501035_0913295_181_681 | 154 |
| 907 | 3300049823 | Ga0501044_0132431 | Ga0501044_0132431_1274_1741 | 154 |
| 908 | 3300050489 | nmdc:mga03683_67014_c1 | nmdc:mga03683_67014_c1_426_965 | 154 |
| 909 | 3300050489 | nmdc:mga03683_72119_c1 | nmdc:mga03683_72119_c1_825_1289 | 154 |
| 910 | 3300050491 | nmdc:mga00v17_278245_c1 | nmdc:mga00v17_278245_c1_443_907 | 154 |
| 911 | 3300050491 | nmdc:mga00v17_411970_c1 | nmdc:mga00v17_411970_c1_397_861 | 154 |
| 912 | 3300050492 | nmdc:mga0yw44_148899_c1 | nmdc:mga0yw44_148899_c1_741_1205 | 154 |
| 913 | 3300050492 | nmdc:mga0yw44_324843_c1 | nmdc:mga0yw44_324843_c1_147_611 | 154 |
| 914 | 3300050492 | nmdc:mga0yw44_54592_c1 | nmdc:mga0yw44_54592_c1_483_947 | 154 |
| 915 | 3300050495 | nmdc:mga04h51_105977_c1 | nmdc:mga04h51_105977_c1_449_913 | 154 |
| 916 | 3300050507 | nmdc:mga05p37_133007_c1 | nmdc:mga05p37_133007_c1_1251_1715 | 154 |
| 917 | 3300050507 | nmdc:mga05p37_1614817_c1 | nmdc:mga05p37_1614817_c1_36_503 | 154 |
| 918 | 3300050507 | nmdc:mga05p37_162177_c1 | nmdc:mga05p37_162177_c1_90_554 | 154 |
| 919 | 3300050507 | nmdc:mga05p37_166004_c1 | nmdc:mga05p37_166004_c1_1030_1575 | 154 |
| 920 | 3300050507 | nmdc:mga05p37_18097_c1 | nmdc:mga05p37_18097_c1_7051_7515 | 154 |
| 921 | 3300050507 | nmdc:mga05p37_266694_c1 | nmdc:mga05p37_266694_c1_1529_1993 | 154 |
| 922 | 3300050507 | nmdc:mga05p37_297280_c1 | nmdc:mga05p37_297280_c1_254_718 | 154 |
| 923 | 3300050507 | nmdc:mga05p37_690598_c1 | nmdc:mga05p37_690598_c1_192_659 | 154 |
| 924 | 3300050508 | nmdc:mga09592_21311_c1 | nmdc:mga09592_21311_c1_4354_4818 | 154 |
| 925 | 3300050508 | nmdc:mga09592_483879_c1 | nmdc:mga09592_483879_c1_377_844 | 154 |
| 926 | 3300050508 | nmdc:mga09592_90167_c1 | nmdc:mga09592_90167_c1_290_754 | 154 |
| 927 | 3300050509 | nmdc:mga0qj67_181347_c1 | nmdc:mga0qj67_181347_c1_17_481 | 154 |
| 928 | 3300050509 | nmdc:mga0qj67_551623_c1 | nmdc:mga0qj67_551623_c1_433_900 | 154 |
| 929 | 3300050510 | nmdc:mga06r32_427885_c1 | nmdc:mga06r32_427885_c1_28_495 | 154 |
| 930 | 3300050510 | nmdc:mga06r32_74553_c1 | nmdc:mga06r32_74553_c1_1508_1972 | 154 |
| 931 | 3300050511 | nmdc:mga08y16_1204_c1 | nmdc:mga08y16_1204_c1_24434_24898 | 154 |
| 932 | 3300050511 | nmdc:mga08y16_230785_c1 | nmdc:mga08y16_230785_c1_101_568 | 154 |
| 933 | 3300050511 | nmdc:mga08y16_293757_c1 | nmdc:mga08y16_293757_c1_243_707 | 154 |
| 934 | 3300050511 | nmdc:mga08y16_372888_c1 | nmdc:mga08y16_372888_c1_678_1142 | 154 |
| 935 | 3300050511 | nmdc:mga08y16_802366_c1 | nmdc:mga08y16_802366_c1_157_624 | 154 |
| 936 | 3300050511 | nmdc:mga08y16_917282_c1 | nmdc:mga08y16_917282_c1_173_664 | 154 |
| 937 | 3300050512 | nmdc:mga0n895_1009795_c1 | nmdc:mga0n895_1009795_c1_225_689 | 154 |
| 938 | 3300050512 | nmdc:mga0n895_140796_c1 | nmdc:mga0n895_140796_c1_1439_1906 | 154 |
| 939 | 3300050512 | nmdc:mga0n895_14463_c1 | nmdc:mga0n895_14463_c1_5974_6438 | 154 |
| 940 | 3300050512 | nmdc:mga0n895_236091_c1 | nmdc:mga0n895_236091_c1_153_617 | 154 |
| 941 | 3300050512 | nmdc:mga0n895_500844_c1 | nmdc:mga0n895_500844_c1_389_853 | 154 |
| 942 | 3300050512 | nmdc:mga0n895_75340_c1 | nmdc:mga0n895_75340_c1_2620_3084 | 154 |
| 943 | 3300050513 | nmdc:mga0rr50_39643_c1 | nmdc:mga0rr50_39643_c1_1718_2182 | 154 |
| 944 | 3300050513 | nmdc:mga0rr50_855086_c1 | nmdc:mga0rr50_855086_c1_231_695 | 154 |
| 945 | 3300050514 | nmdc:mga08x19_375248_c1 | nmdc:mga08x19_375248_c1_78_542 | 154 |
| 946 | 3300050514 | nmdc:mga08x19_958886_c1 | nmdc:mga08x19_958886_c1_51_518 | 154 |
| 947 | 3300050515 | nmdc:mga0a205_198749_c1 | nmdc:mga0a205_198749_c1_646_1110 | 154 |
| 948 | 3300050515 | nmdc:mga0a205_235148_c1 | nmdc:mga0a205_235148_c1_1156_1623 | 154 |
| 949 | 3300050515 | nmdc:mga0a205_359156_c1 | nmdc:mga0a205_359156_c1_745_1209 | 154 |
| 950 | 3300050515 | nmdc:mga0a205_463163_c1 | nmdc:mga0a205_463163_c1_442_909 | 154 |
| 951 | 3300050515 | nmdc:mga0a205_47295_c1 | nmdc:mga0a205_47295_c1_116_583 | 154 |
| 952 | 3300050515 | nmdc:mga0a205_78530_c1 | nmdc:mga0a205_78530_c1_1710_2174 | 154 |
| 953 | 3300050515 | nmdc:mga0a205_94729_c1 | nmdc:mga0a205_94729_c1_1093_1557 | 154 |
| 954 | 3300050515 | nmdc:mga0a205_959868_c1 | nmdc:mga0a205_959868_c1_145_609 | 154 |
| 955 | 3300053077 | Ga0495601_0010275 | Ga0495601_0010275_3208_3726 | 154 |
| 956 | 3300053077 | Ga0495601_0025087 | Ga0495601_0025087_525_998 | 154 |
| 957 | 3300053077 | Ga0495601_0461116 | Ga0495601_0461116_34_498 | 154 |
| 958 | 3300053078 | Ga0495612_0113192 | Ga0495612_0113192_433_900 | 154 |
| 959 | 3300053078 | Ga0495612_0544750 | Ga0495612_0544750_41_505 | 154 |
| 960 | 3300053083 | Ga0495655_0047399 | Ga0495655_0047399_154_618 | 154 |
| 961 | 3300053084 | Ga0495595_0479171 | Ga0495595_0479171_52_525 | 154 |
| 962 | 3300053085 | Ga0495619_0009832 | Ga0495619_0009832_2782_3255 | 154 |
| 963 | 3300053085 | Ga0495619_0080455 | Ga0495619_0080455_1529_1996 | 154 |
| 964 | 3300053085 | Ga0495619_0081089 | Ga0495619_0081089_624_1088 | 154 |
| 965 | 3300061734 | Ga0530510_0733527 | Ga0530510_0733527_96_563 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9292 | 2 | 153 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9277 | 1 | 153 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9195 | 2 | 153 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9189 | 1 | 153 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9163 | 1 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1alo002 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9342 | 74 | 153 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.923 | 78 | 154 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9207 | 78 | 154 | 1.10.150.120 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.91 | 79 | 152 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9096 | 78 | 154 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A386E6B5-F1-model_v4 | deleted | 0.9471 | 2 | 153 |
|
| AF-A0A7W8XAD6-F1-model_v4 | Nicotinate dehydrogenase subunit A (EC 1.17.2.1) | 0.9453 | 2 | 153 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A537UGU9-F1-model_v4 | (2Fe-2S)-binding protein | 0.9449 | 1 | 153 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A807CKA1-F1-model_v4 | deleted | 0.9447 | 6 | 153 |
|
| AF-A0A537JTT9-F1-model_v4 | (2Fe-2S)-binding protein | 0.9445 | 1 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar